1CTXA

Three-dimensional structure of the-long-neurotoxin from cobra venom
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
71
structure length
71
Chain Sequence
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-COBRATOXIN
publication title Three-dimensional structure of the "long" neurotoxin from cobra venom.
pubmed doi rcsb
source organism Naja siamensis
molecule tags Toxin
total genus 9
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1982-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ctxA00
4RUDA 3VTSA 2GOOB 2BHIA 2MJ4A 1TGXA 1HAJA 2ABXA 1FSSB 1KBSA 3ERAA 1DRSA 2VLWA 1ONJA 2H62C 2MFAA 2H62D 3LAQU 1NTXA 2HLQA 1TXAA 2CDXA 3FEVA 4XJJA 1CB9A 1KL8A 1H0JA 3NH7A 3PLCA 2OFSA 4BDTB 2NBTA 2LA1A 2GOOC 1KU6B 2MJ0A 2CRTA 1KC4A 1CXNA 1PLOA 1NXBA 5DZ5A 3EBXA 1CDSA 1KFHA 1W6BA 4AEAA 2ERAA 1ES7B 2MUOA 3KFDE 4LFTA 2JQPA 2CTXA 2MJYA 1MAHF 1KS6A 2UX2A 2CRSA 1V6PA 1B41B 4QTIU 3U73U 1CCQA 1HOYA 3BT2U 1JBDA 2I9BE 2MHYA 1JGKA 1REWC 3NDSA 1IQ9A 1F8UB 4ZQYA 5IMYC 2HLRA 2JVEA 1IKCA 4FAOE 2CCXA 2LCRA 1CHVS 2PJYB 2K3GA 4HQPF 4IYEA 1CDQA 1JE9A 1CDTA 1NORA 1ABTA 1QKEA 3HH7A 1FSCA 1FASA 2H5FA 2MUPA 1RGJA 4FAOC 2QJ9C 3BT1U 5IMTD 1HAAA 3NEQA 3EVSC 1FFJA 6EBXA 1FRAA 1KXIA 4EY8B 1CXOA 1QKDA 1FF4A 4OM5A 1IDIA 1YWHA 1LX5B 4P7UA 2PJYC 2H64B 5EBXA 4OM4A 1S4YA 1NTNA 1MR6A 2J8BA 3QB4B 1COEA 1CRFA 2X8BB 3U74U 1I02A 2H8UA 2H7ZA 1XT3A 1ERAA 1RL5A 2QC1A 1HC9A 2H7ZB 1CREA 1TXBA 2QJAC 1CDRA 2UWRA 1IDHA 2N99A 1CTXA 1NYSA 1HC9B 4BIKB 2QJBC 1IDLA 1IK8A 1LSIA 4UY2C 1KBAA 1IJCA 2H64C 1BXPA 1G6MA 5DO6A 1VB0A 2L03A 1BTEA 1L4WA 1IDGA 2BTXA 1ZADA 5DU1A 1QM7A 1LJZA 1KBTA 1LXGA 1UG4A 1KTZB 1LXHA 4DO8A 1TFSA 1F94A 1NEAA 3KFDI 1CODA 1ERGA 1NYUA 2FD6U 1CVOA 1M9ZA 2L5SA
chains in the Genus database with same CATH superfamily
4RUDA 3VTSA 2GOOB 2BHIA 2MJ4A 1TGXA 1HAJA 2ABXA 1FSSB 1KBSA 3ERAA 1DRSA 2VLWA 1ONJA 2H62C 2MFAA 2H62D 3LAQU 1NTXA 2HLQA 1TXAA 2CDXA 4KSNA 3FEVA 4XJJA 1CB9A 1KL8A 1H0JA 3NH7A 3PLCA 2OFSA 4BDTB 2NBTA 2LA1A 2GOOC 1KU6B 2MJ0A 2CRTA 1KC4A 1CXNA 1PLOA 1NXBA 5DZ5A 3EBXA 1CDSA 1KFHA 1W6BA 4AEAA 2ERAA 1ES7B 2MUOA 3KFDE 4LFTA 2JQPA 2CTXA 2MJYA 1MAHF 1KS6A 2UX2A 2CRSA 1V6PA 1B41B 4QTIU 3U73U 1CCQA 1HOYA 3BT2U 1JBDA 2I9BE 2MHYA 1JGKA 1REWC 3NDSA 1IQ9A 1F8UB 4ZQYA 5IMYC 2HLRA 2JVEA 1IKCA 4FAOE 2CCXA 2LCRA 1CHVS 2PJYB 2K3GA 4HQPF 4IYEA 1CDQA 1JE9A 1CDTA 1NORA 1ABTA 1QKEA 3HH7A 1FSCA 1FASA 2H5FA 2MUPA 1RGJA 4FAOC 2QJ9C 3BT1U 5IMTD 1HAAA 3NEQA 3EVSC 1FFJA 6EBXA 1FRAA 1KXIA 4EY8B 1CXOA 1QKDA 1FF4A 4OM5A 1IDIA 1YWHA 1LX5B 4P7UA 2PJYC 2H64B 5EBXA 4OM4A 1S4YA 1NTNA 1MR6A 2J8BA 3QB4B 1COEA 1CRFA 2X8BB 3U74U 1I02A 2H8UA 2H7ZA 1XT3A 1ERAA 1RL5A 2QC1A 1HC9A 2H7ZB 1CREA 1TXBA 2QJAC 1CDRA 2UWRA 1IDHA 2N99A 1CTXA 1NYSA 1HC9B 4BIKB 2QJBC 1IDLA 1IK8A 1LSIA 4UY2C 1KBAA 1IJCA 2H64C 1BXPA 1G6MA 5DO6A 1VB0A 2L03A 1BTEA 1L4WA 1IDGA 2BTXA 1ZADA 5DU1A 1QM7A 1LJZA 1KBTA 1LXGA 1UG4A 1KTZB 1LXHA 4DO8A 1TFSA 1F94A 1NEAA 3KFDI 1CODA 1ERGA 1NYUA 2FD6U 1CVOA 1M9ZA 2L5SA
chains in the Genus database with same CATH topology
4RUDA 3VTSA 2GOOB 2BHIA 2MJ4A 1TGXA 1HAJA 2ABXA 1FSSB 1KBSA 3ERAA 1DRSA 2VLWA 1ONJA 2H62C 2MFAA 2H62D 3LAQU 1NTXA 2HLQA 1TXAA 2CDXA 4KSNA 3FEVA 4XJJA 1CB9A 1KL8A 1H0JA 3NH7A 3PLCA 2OFSA 4BDTB 2NBTA 2LA1A 2GOOC 1KU6B 2MJ0A 2CRTA 1KC4A 1CXNA 1PLOA 1NXBA 5DZ5A 3EBXA 1CDSA 1KFHA 1W6BA 4AEAA 2ERAA 1ES7B 2MUOA 3KFDE 4LFTA 2JQPA 2CTXA 2MJYA 1MAHF 1KS6A 2UX2A 2CRSA 1V6PA 1B41B 4QTIU 3U73U 1CCQA 1HOYA 3BT2U 1JBDA 2I9BE 2MHYA 1JGKA 1REWC 3NDSA 1IQ9A 1F8UB 4ZQYA 5IMYC 2HLRA 2JVEA 1IKCA 4FAOE 2CCXA 2LCRA 1CHVS 2PJYB 2K3GA 4HQPF 4IYEA 1CDQA 1JE9A 1CDTA 1NORA 1ABTA 1QKEA 3HH7A 1FSCA 1FASA 2H5FA 2MUPA 1RGJA 4FAOC 2QJ9C 3BT1U 5IMTD 1HAAA 3NEQA 3EVSC 1FFJA 6EBXA 1FRAA 1KXIA 4EY8B 1CXOA 1QKDA 1FF4A 4OM5A 1IDIA 1YWHA 1LX5B 4P7UA 2PJYC 2H64B 5EBXA 4OM4A 1S4YA 1NTNA 1MR6A 2J8BA 3QB4B 1COEA 1CRFA 2X8BB 3U74U 1I02A 2H8UA 2H7ZA 1XT3A 1ERAA 1RL5A 2QC1A 1HC9A 2H7ZB 1CREA 1TXBA 2QJAC 1CDRA 2UWRA 1IDHA 2N99A 1CTXA 1NYSA 1HC9B 4BIKB 2QJBC 1IDLA 1IK8A 1LSIA 4UY2C 1KBAA 1IJCA 2H64C 1BXPA 1G6MA 5DO6A 1VB0A 2L03A 1BTEA 1L4WA 1IDGA 2BTXA 1ZADA 5DU1A 1QM7A 1LJZA 1KBTA 1LXGA 1UG4A 1KTZB 1LXHA 4DO8A 1TFSA 1F94A 1NEAA 3KFDI 1CODA 1ERGA 1NYUA 2FD6U 1CVOA 1M9ZA 2L5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUD A;  3VTS A;  2GOO B;  2BHI A;  2MJ4 A;  1TGX A;  1HAJ A;  2ABX A;  1FSS B;  1KBS A;  3ERA A;  1DRS A;  2VLW A;  1ONJ A;  2H62 C;  2MFA A;  2H62 D;  3LAQ U;  1NTX A;  2HLQ A;  1TXA A;  2CDX A;  3FEV A;  4XJJ A;  1CB9 A;  1KL8 A;  1H0J A;  3NH7 A;  3PLC A;  2OFS A;  4BDT B;  2NBT A;  2LA1 A;  2GOO C;  1KU6 B;  2MJ0 A;  2CRT A;  1KC4 A;  1CXN A;  1PLO A;  1NXB A;  5DZ5 A;  3EBX A;  1CDS A;  1KFH A;  1W6B A;  4AEA A;  2ERA A;  1ES7 B;  2MUO A;  3KFD E;  4LFT A;  2JQP A;  2CTX A;  2MJY A;  1MAH F;  1KS6 A;  2UX2 A;  2CRS A;  1V6P A;  1B41 B;  4QTI U;  3U73 U;  1CCQ A;  1HOY A;  3BT2 U;  1JBD A;  2I9B E;  2MHY A;  1JGK A;  1REW C;  3NDS A;  1IQ9 A;  1F8U B;  4ZQY A;  5IMY C;  2HLR A;  2JVE A;  1IKC A;  4FAO E;  2CCX A;  2LCR A;  1CHV S;  2PJY B;  2K3G A;  4HQP F;  4IYE A;  1CDQ A;  1JE9 A;  1CDT A;  1NOR A;  1ABT A;  1QKE A;  3HH7 A;  1FSC A;  1FAS A;  2H5F A;  2MUP A;  1RGJ A;  4FAO C;  2QJ9 C;  3BT1 U;  5IMT D;  1HAA A;  3NEQ A;  3EVS C;  1FFJ A;  6EBX A;  1FRA A;  1KXI A;  4EY8 B;  1CXO A;  1QKD A;  1FF4 A;  4OM5 A;  1IDI A;  1YWH A;  1LX5 B;  4P7U A;  2PJY C;  2H64 B;  5EBX A;  4OM4 A;  1S4Y A;  1NTN A;  1MR6 A;  2J8B A;  3QB4 B;  1COE A;  1CRF A;  2X8B B;  3U74 U;  1I02 A;  2H8U A;  2H7Z A;  1XT3 A;  1ERA A;  1RL5 A;  2QC1 A;  1HC9 A;  2H7Z B;  1CRE A;  1TXB A;  2QJA C;  1CDR A;  2UWR A;  1IDH A;  2N99 A;  1CTX A;  1NYS A;  1HC9 B;  4BIK B;  2QJB C;  1IDL A;  1IK8 A;  1LSI A;  4UY2 C;  1KBA A;  1IJC A;  2H64 C;  1BXP A;  1G6M A;  5DO6 A;  1VB0 A;  2L03 A;  1BTE A;  1L4W A;  1IDG A;  2BTX A;  1ZAD A;  5DU1 A;  1QM7 A;  1LJZ A;  1KBT A;  1LXG A;  1UG4 A;  1KTZ B;  1LXH A;  4DO8 A;  1TFS A;  1F94 A;  1NEA A;  3KFD I;  1COD A;  1ERG A;  1NYU A;  2FD6 U;  1CVO A;  1M9Z A;  2L5S A; 
#chains in the Genus database with same CATH topology
 4RUD A;  3VTS A;  2GOO B;  2BHI A;  2MJ4 A;  1TGX A;  1HAJ A;  2ABX A;  1FSS B;  1KBS A;  3ERA A;  1DRS A;  2VLW A;  1ONJ A;  2H62 C;  2MFA A;  2H62 D;  3LAQ U;  1NTX A;  2HLQ A;  1TXA A;  2CDX A;  4KSN A;  3FEV A;  4XJJ A;  1CB9 A;  1KL8 A;  1H0J A;  3NH7 A;  3PLC A;  2OFS A;  4BDT B;  2NBT A;  2LA1 A;  2GOO C;  1KU6 B;  2MJ0 A;  2CRT A;  1KC4 A;  1CXN A;  1PLO A;  1NXB A;  5DZ5 A;  3EBX A;  1CDS A;  1KFH A;  1W6B A;  4AEA A;  2ERA A;  1ES7 B;  2MUO A;  3KFD E;  4LFT A;  2JQP A;  2CTX A;  2MJY A;  1MAH F;  1KS6 A;  2UX2 A;  2CRS A;  1V6P A;  1B41 B;  4QTI U;  3U73 U;  1CCQ A;  1HOY A;  3BT2 U;  1JBD A;  2I9B E;  2MHY A;  1JGK A;  1REW C;  3NDS A;  1IQ9 A;  1F8U B;  4ZQY A;  5IMY C;  2HLR A;  2JVE A;  1IKC A;  4FAO E;  2CCX A;  2LCR A;  1CHV S;  2PJY B;  2K3G A;  4HQP F;  4IYE A;  1CDQ A;  1JE9 A;  1CDT A;  1NOR A;  1ABT A;  1QKE A;  3HH7 A;  1FSC A;  1FAS A;  2H5F A;  2MUP A;  1RGJ A;  4FAO C;  2QJ9 C;  3BT1 U;  5IMT D;  1HAA A;  3NEQ A;  3EVS C;  1FFJ A;  6EBX A;  1FRA A;  1KXI A;  4EY8 B;  1CXO A;  1QKD A;  1FF4 A;  4OM5 A;  1IDI A;  1YWH A;  1LX5 B;  4P7U A;  2PJY C;  2H64 B;  5EBX A;  4OM4 A;  1S4Y A;  1NTN A;  1MR6 A;  2J8B A;  3QB4 B;  1COE A;  1CRF A;  2X8B B;  3U74 U;  1I02 A;  2H8U A;  2H7Z A;  1XT3 A;  1ERA A;  1RL5 A;  2QC1 A;  1HC9 A;  2H7Z B;  1CRE A;  1TXB A;  2QJA C;  1CDR A;  2UWR A;  1IDH A;  2N99 A;  1CTX A;  1NYS A;  1HC9 B;  4BIK B;  2QJB C;  1IDL A;  1IK8 A;  1LSI A;  4UY2 C;  1KBA A;  1IJC A;  2H64 C;  1BXP A;  1G6M A;  5DO6 A;  1VB0 A;  2L03 A;  1BTE A;  1L4W A;  1IDG A;  2BTX A;  1ZAD A;  5DU1 A;  1QM7 A;  1LJZ A;  1KBT A;  1LXG A;  1UG4 A;  1KTZ B;  1LXH A;  4DO8 A;  1TFS A;  1F94 A;  1NEA A;  3KFD I;  1COD A;  1ERG A;  1NYU A;  2FD6 U;  1CVO A;  1M9Z A;  2L5S A; 
#chains in the Genus database with same CATH homology
 4RUD A;  3VTS A;  2GOO B;  2BHI A;  2MJ4 A;  1TGX A;  1HAJ A;  2ABX A;  1FSS B;  1KBS A;  3ERA A;  1DRS A;  2VLW A;  1ONJ A;  2H62 C;  2MFA A;  2H62 D;  3LAQ U;  1NTX A;  2HLQ A;  1TXA A;  2CDX A;  4KSN A;  3FEV A;  4XJJ A;  1CB9 A;  1KL8 A;  1H0J A;  3NH7 A;  3PLC A;  2OFS A;  4BDT B;  2NBT A;  2LA1 A;  2GOO C;  1KU6 B;  2MJ0 A;  2CRT A;  1KC4 A;  1CXN A;  1PLO A;  1NXB A;  5DZ5 A;  3EBX A;  1CDS A;  1KFH A;  1W6B A;  4AEA A;  2ERA A;  1ES7 B;  2MUO A;  3KFD E;  4LFT A;  2JQP A;  2CTX A;  2MJY A;  1MAH F;  1KS6 A;  2UX2 A;  2CRS A;  1V6P A;  1B41 B;  4QTI U;  3U73 U;  1CCQ A;  1HOY A;  3BT2 U;  1JBD A;  2I9B E;  2MHY A;  1JGK A;  1REW C;  3NDS A;  1IQ9 A;  1F8U B;  4ZQY A;  5IMY C;  2HLR A;  2JVE A;  1IKC A;  4FAO E;  2CCX A;  2LCR A;  1CHV S;  2PJY B;  2K3G A;  4HQP F;  4IYE A;  1CDQ A;  1JE9 A;  1CDT A;  1NOR A;  1ABT A;  1QKE A;  3HH7 A;  1FSC A;  1FAS A;  2H5F A;  2MUP A;  1RGJ A;  4FAO C;  2QJ9 C;  3BT1 U;  5IMT D;  1HAA A;  3NEQ A;  3EVS C;  1FFJ A;  6EBX A;  1FRA A;  1KXI A;  4EY8 B;  1CXO A;  1QKD A;  1FF4 A;  4OM5 A;  1IDI A;  1YWH A;  1LX5 B;  4P7U A;  2PJY C;  2H64 B;  5EBX A;  4OM4 A;  1S4Y A;  1NTN A;  1MR6 A;  2J8B A;  3QB4 B;  1COE A;  1CRF A;  2X8B B;  3U74 U;  1I02 A;  2H8U A;  2H7Z A;  1XT3 A;  1ERA A;  1RL5 A;  2QC1 A;  1HC9 A;  2H7Z B;  1CRE A;  1TXB A;  2QJA C;  1CDR A;  2UWR A;  1IDH A;  2N99 A;  1CTX A;  1NYS A;  1HC9 B;  4BIK B;  2QJB C;  1IDL A;  1IK8 A;  1LSI A;  4UY2 C;  1KBA A;  1IJC A;  2H64 C;  1BXP A;  1G6M A;  5DO6 A;  1VB0 A;  2L03 A;  1BTE A;  1L4W A;  1IDG A;  2BTX A;  1ZAD A;  5DU1 A;  1QM7 A;  1LJZ A;  1KBT A;  1LXG A;  1UG4 A;  1KTZ B;  1LXH A;  4DO8 A;  1TFS A;  1F94 A;  1NEA A;  3KFD I;  1COD A;  1ERG A;  1NYU A;  2FD6 U;  1CVO A;  1M9Z A;  2L5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...