1CULB

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
190
Chain Sequence
YHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE V ADENYLYL CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 64
structure length 190
sequence length 200
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1culB00
2QV6A 4NI2A 4P2FA 4WPAA 4P2MA 4OYWA 4CLLA 2GVZB 1WC1A 1Y10A 1CJTA 1YK9A 1TL7A 4OYIA 2BW7A 5IV4A 4CM0A 1WC3A 1YBUA 1YBTA 1WC4A 4WP8A 1CJKB 2GVDB 5D0EA 1U0HA 4CLFA 3MAAA 3C14A 4CLTA 4CLZA 1CULA 4NI2B 4P2XA 4OZ2A 3ET6B 4OYOA 1WC0A 1WC5A 4CLKA 3UVJA 3C15A 1CJUA 4USWA 4OYAA 4CLYA 4USUA 1AZSB 4USTA 3MAAB 3C14B 1AB8A 4CLWA 4OZ3A 1FX2A 4OYBA 3R5GA 4OYZA 5IV3A 3C15B 1CJTB 4CLSA 1TL7B 4CLUA 4WP9A 5D0RA 1WC6A 1CJVA 5D0HA 4CM2A 1CS4A 3C16A 3G82A 1U0HB 1FX4A 1CULB 2WZ1A 4CLPA 4OYXA 3ET6A 5D0GA 1Y11A 2W01A 4WP3A 2GVZA 3UVJB 5D15A 1CJUB 1AZSA 1CJVB 4USVA 1CS4B 3MR7A 4OYPA 3C16B 1CJKA 2GVDA 3G82B 4OYMA
chains in the Genus database with same CATH superfamily
3PJ9A 4I6WA 3SQGB 1YIJS 3HJFA 1TKDA 3TEGA 4I1TA 1K8AT 2F65A 4HHUA 4JI1F 4ER8A 3ZTRA 4G1PA 4LQ3A 4X84A 4TY8A 4DR2J 4LVNP 4O0NA 4ZMMA 4A8XA 5HQ8A 2KFNA 1Q7LB 3K59A 4KFBA 4G65A 2MQQA 4MT1A 2VUGA 1H2UX 3FKBA 4WZQA 3CJTA 2N4CA 4QU7A 4QR0A 4CYUB 1H38A 2CZVC 1E6VA 3DGPA 1F1BB 3K0JA 2IA0A 4IOBA 4OYZA 2MLYA 2FHKA 4O3PA 3A8EA 2OPQA 4DCPB 3M6VA 2WZ1A 1F9HA 4RBTA 1S4FA 1HQUB 2KT3A 4ED3A 1FFWB 4IH7A 4DV3J 2KTQA 2FC8A 4DUZF 3HHLB 3KDNA 4NZ6A 2RH3A 3EMTA 1CJKA 5CYMB 1M5PC 3H0PA 3KLEB 4UQTA 2KRBA 3JSMB 4QWAA 5JMNA 2YKPA 2FQQB 2DNGA 1IKWB 3D6HB 2DHSA 3JXOA 3CPWR 3QGIA 4ED6A 1HWJA 2VPXB 2JX2A 3MXHP 2BQUA 1WKLA 4MKAA 2XYPB 4G6VB 4FVMA 2B7CB 4DR6F 2JWNA 1KEKA 2BA9A 2A0FB 2JFKA 2DNQA 1SH3A 3CDWA 3HCXA 1RT6B 3LWLA 1VRQC 4OZNA 1BY9A 4UOCA 1UA1A 4PXEA 4USHA 5J2MA 4EEYA 4NLVA 1KDNA 1BQNB 1NK7A 3R5BA 5ETLA 4KFBB 1TFWA 1WI8A 5D0RA 1K9MT 1GTHA 3HSGA 3DRSB 3DU5A 3J7Z5 1Q4RA 4JYAF 1WACA 2R2UA 2RS8A 3DGPB 1HYSA 2YKNB 1FXLA 4ZP9A 3HJVA 2VQEJ 1HW8A 2ASLA 3DLLQ 1W25A 3K5PA 5IQ6A 2WK4A 2BE7D 2OPQB 2CQPA 4O4GA 1MU2A 5DG8A 3R6LB 4ECVA 2BMBA 3D2WA 2CPJA 1T03B 2QA2A 2V8DA 3D6TB 2NSBA 2K2PA 1R8PA 5BXIA 4WK1A 1YDLA 3R7NB 3MR2A 5DQGA 1AFJA 4B9LA 2CJKA 1OSCA 1CJKB 1LWXA 2BKPA 1U2RA 2KKHA 1TZ0A 1NU4A 2V68A 5HMZA 4DPTA 5A2QY 2MJNA 2RE1A 4I7FB 1YTYA 1RT1A 2NPFA 1HNWJ 1TAUA 3CUNA 4WCEQ 2EFGA 1G6BA 3B78A 3OR1A 3QAUA 3BQ2A 4Q8EA 2B5JA 3RTVA 4E2FB 5KG2A 3KJQB 5L1JA 1X4CA 3BZQA 3C8YA 4MK8A 3IR6B 4C11A 2EWHA 5IC6B 4WZMA 5KFXA 1JNZB 1P9YA 4WU2A 1VQ7S 3UDVA 5J2MB 4F25A 2Y9HA 2Z2MA 2MKHA 2C22A 1WSVA 2YWKA 2W24A 3S7RA 5KTQA 3DOKA 2HYIB 3GV5B 1EP4A 2ACMA 3M8WA 5KFNA 3Q8UA 4PG7A 2PN6A 3CCJS 3CJKA 4R5PA 1SQFA 1I94J 3RR8A 4X62J 1IKXB 1HYSB 3MD3A 1HARA 3CWJA 4O4GB 1UVNA 4P52A 5K8MA 3B82A 3J80U 1NJZA 1M1HA 2JC1A 1WDTA 2OTJS 5CCLA 2EI5A 3L9ZA 2CPZA 3CEDA 3WZ0A 3VR1A 2PA8D 2RB7A 4DSIA 3IS9A 2YXLA 5F8JA 1X9MA 1RWVB 4EGLA 2E5LF 1RT1B 3BN7A 3NAHA 3HT3A 1URRA 4TLRA 3CE8A 4OL8A 3OR1B 5KG1A 2YX1A 2B4PA 2PGCA 4DUYJ 2B5JB 1YG0A 3T1HJ 2GA7A 4IFYA 2IAJA 1V3RA 4YOEA 4DL0C 2QFIA 3CXCR 2QMXA 2Y0SD 2X51A 1AZSA 5KFUA 2OD4A 4BC9A 4RW9A 2E5HA 5IT9U 2HNDB 4J9RA 3MEGA 4NXMF 2E29A 5C5JA 4B3TF 2GMLA 2WVDA 2LEPA 1R8BA 3H2UB 2YNFA 5AXLA 3DOKB 4ED4A 2F4VJ 2OIHA 3CJKB 4R5PB 3NAIA 1P1TA 2HFNA 1XMBA 1RTDA 2ZBIA 4B9MA 4ED5A 3SMZA 1RTIB 2QTWA 4ID5B 3MHYA 2L41A 3IRWP 4C0BA 3Q8PB 2DVIA 1M5HA 3IR5B 3LUYA 2OUGA 5HJYA 1YZ6A 4F4XA 2FHJA 3TJAA 4DV4F 3TA0A 3W66A 2CXEA 3I55S 1XWLA 4P73A 1RT4A 1FDNA 1FE0A 2R8KA 4Y34A 5HROB 4C8LA 1YJ9S 3IS9B 5KG0A 1K0TA 2OPSA 2X1GA 4RKUC 1PAUB 1L3KA 3EM1A 2Z2ZA 3UD5A 3DLJA 3LGNA 2X1BA 3EPGA 4OJ1A 4RUAA 2CPEA 4AE5A 4IFYB 2IAJB 4WFBQ 1VMBA 3PYEA 1JQGA 4MYTA 2ZKUA 1NSKL 4YMEA 5IV4A 5KG7A 3M9NB 4PWWA 4U7UK 2NS1B 3KWMA 1U02A 3MEGB 2IHR1 1WG1A 2H1YA 1NBEB 3SZ2A 4NOHA 2RT3A 3KLFA 2VZ9A 4ATNA 4Y3CA 3TNVA 4OYAA 1FCAA 1NH7A 1S7IA 4DSEA 2MHEA 2FHOB 1B4SA 1YQHA 4V19J 1Y4ZB 2BW2A 1N5TA 1RTDB 1KRPA 5D77A 3V81B 1HI0P 4MAKA 3PW5A 3KUHA 5D0HA 1RB0A 2W8KA 2ZOGA 2X1FA 2ZDOA 2IMOA 4PAAA 1Q81T 1H72C 4JI1J 3M32A 1JNRB 3CC4S 2F40A 1FJGJ 2A6OA 4ED8A 1L3VA 1RT4B 3FBCA 2W9BB 3D6MB 2BRKA 2MPUA 4DQIA 4MKYA 5GAHI 5HP1A 4MJKA 1TUVA 2C3OA 1T02A 4UQGA 1UVKA 1DQAA 2DKOB 1L3TA 3SFGA 2M8DB 4BDPA 1YBUA 4O23A 5IM0B 3IMQJ 3K5LA 1F3FA 3GZ7A 3ET6B 2KT5A 3KG4A 1IKYB 3OTOJ 2O1PA 3GYNA 4FYWB 2HVHA 3Q2TC 4PPDA 3HX9A 3JTNA 1ZTWA 3A12A 3OQ2A 3PV8A 2OHDA 4JI8F 2O01C 2DNMA 2BDPA 1RKJA 1T94A 3PKMA 2MSTA 2HKEA 5D0GA 3PX6A 1G4CA 4EWTA 1D0EA 3IBCB 4CO3A 5E3CA 3O1LA 4DPUA 1RAJA 1ZPWX 2J5AA 1NPRA 2CZ9A 4PUOB 2ALYB 1A6LA 4P2MA 5I3PA 4OJ3A 1YBAA 2HFOA 4WXWA 2ZUAA 3EGWB 1D8ZA 1OO0B 2CPYA 1ZETA 2FJWA 4OQJA 2PFDA 5HP1B 3Q8VA 1HPZB 2C3MA 4ELTA 4ZLLA 1CEZA 1CBKA 2FUG9 2MSSA 2UVWA 3OJSA 4DV6F 3EZOA 3GIRA 3ICLA 4TU7A 8RUCA 2HSEB 1TU0B 2CFXA 1ZBTA 4ZN1A 3IP0A 5CABA 3AH6A 3R6GB 1QAYA 3N4WA 3SSRA 3FMBA 2DGVA 4LRBA 4K0KJ 2BJDA 1YX2A 3PYFA 4HTIA 5D8HB 4ZPWR 2ZZMA 2FZKB 1ZS6A 3T6BA 4ILLA 3CDBA 1FNXH 3M2VA 2QX0A 2W7AA 3R3TA 4DWIA 2NCKL 2B4OA 3PVXA 3VGTA 4CRJA 4ETXA 1S9EA 3TAMB 1S1TA 2KM8C 1NLKL 2A10A 2A1BA 1JK9B 3AAWB 2BW7A 2NUHA 3Q0AA 1QE1B 4Q2LA 4CLTA 2V4JB 4CO1A 1CULA 1LW0B 1B7FA 3M9OB 3K89A 1YSJA 2CQCA 5G0RB 4X4RA 2KHDA 3T5LA 1DQ9A 3FZBA 4KJIA 2IMWP 4ZK7M 2LFVA 1XERA 1KVIA 2RU9A 5GADI 4QW8A 5B09A 1RWOB 4X4VA 4I4BA 1P27B 2I1RA 4CLUA 3SDEA 4K4WA 2DXDA 1XMQJ 3OSNA 3W8PA 2YWEA 4YR3A 2MQPA 1CQMA 5F41A 4RUBA 5KFWA 3HVAA 4L6V3 3V6KA 5ETOA 1RCXB 3FBEA 2M4MA 3H5XA 1LV5A 5AXKA 4K7QA 2OAUA 2HHSA 4WPAA 3ZTPA 3M8PA 3DLKA 3BGOP 3BM7A 2IYIA 3K5MA 3ZO7A 1MW7A 4MIAA 2RMLA 3EJMA 2J9DE 1RAGB 1S9EB 3ELHA 2DNHA 5F9NA 3NLCA 4QR2A 1EQMA 1LWEA 1YRTA 2GNKA 3GQCA 5BR8F 1VK3A 1GMWD 2D7SA 4OHZA 4K59A 2K3KA 1KLMB 4IDKB 4M63A 1YRXA 2ZHBA 3R5GA 5H9EK 3HO1A 5KFAA 2XHCA 4X4UA 4L76A 1JWWA 5HO4A 2AEFA 4YQWA 3G6YA 2RHSB 4C8YA 3LA0A 5A76A 3UWTA 2CRLA 3RW7A 1W7WA 3PJXA 2K06A 2B6AA 2ZEJA 1XR7A 4NX9A 3MECA 2IJFA 3MM8A 5DQHA 1N8RT 1Q79A 2C28A 4JI5J 1YK9A 2G1DA 1RDRA 4NA1A 2Y1IA 1Z4UA 2E7VA 1PYTA 4OI4A 3M2RA 2ZH3A 1U26A 3BKTA 3DLKB 1RT2A 4CNZA 2VF3A 1EB0A 1ZYQA 3X3UA 2MTLA 2YX4A 2DGWA 1REVA 5FDLB 3OUYA 2HQGA 1XR6A 3QQCD 3B8HA 3CMQA 3WQPA 2I6WA 1JLCB 2ZM6J 3GSIA 1JLEA 1OQ6A 3OD2A 4AUKA 3PM9A 2CQBA 5B0EA 4IG0B 1CS4A 2LQ8A 3CJ3A 4J37A 4ES1A 4XO0A 4LSNB 5EDWA 3T1YJ 2QMWA 1TKTB 3R7SB 3T6JA 3LP1A 4R8UA 5C42B 2DR7A 4HI1A 4CH1A 3HHEA 2AGPA 4LRAA 5GMDA 4A8SA 1IR2A 2VBZA 2HRUA 3IRXA 4ZPCA 4ZA1A 1VQOS 3BSAA 1H73A 1YBTA 2VFSA 5G4DA 2DH9A 5EWFA 2LQJA 4I6YA 4LF4F 1JLAB 2NXEA 4DV7F 2BKOA 3I96A 3MECB 4K4TA 2OO4A 2BYCA 4NLOA 3IO1A 1QAJA 2F3JA 1RWWB 1YHQS 2JLFA 3C6UB 3V6DA 4USJC 2FJVA 1GXLA 4NLUA 2UXDF 1RT2B 3UN3A 1JLBA 1VBXA 5C24A 1Q0NA 1ICEB 1UFKA 4ZVTB 2VC0A 3IM8A 4FBUA 3OUYB 1VISA 4ALZA 2G2ZA 4DX5A 4O0IA 1PJ6A 4WYLA 2WVBA 3ONQA 1VQMS 4RJVA 5EWGA 4KV8B 1CS4B 4U7UD 1MNEA 4NLDA 2LEAA 2DR6A 2N7CA 2CZ4A 4KTQA 3GIKA 4IR9A 2GO8A 2XULA 4CTAB 1FKOB 2H54B 4WFAQ 1VQNS 1AROP 3OW2R 2ZH7A 1NK4A 2J76E 2WAQD 3JS9A 3LP1B 1RWMB 3OFEA 4N41A 4Z7YA 5BYRA 1S76D 1UW4A 2AZ3A 1AA1B 2ZOMA 2GHVC 3PX4A 2PMWA 1D09B 2I5JA 1T7PA 1QY7A 4EUVA 3UVJA 3IRXB 3PR5B 1Q86T 2HHXA 3QT7A 3KJVA 2EFOA 2QIFA 2FVRA 2ZBPA 2ZZTA 4DFJA 5KT6A 3RU0A 1T3NA 4OYBA 2CJQA 4JP8A 2HQCA 1N32J 2XY5A 2G4BA 5E3PA 2PD1A 2XEXA 1RTZA 1ZA1B 3GIMA 2RHQB 3V6DB 3OFGA 2FY1A 5T41A 2ZKTA 4XK8C 2VL1A 2K1RA 2DNLA 4ERDA 1WEZA 3T3FA 1JLBB 4DQQA 1C4CA 5F9LA 1DHMA 1FO1A 2AJ0A 2Y3YA 2UVRA 2FGOA 2Q1LA 2DXEA 4FNIA 1NUEA 4F2SA 4DR4J 3TUIC 4JI0F 1FRKA 2C2NA 3GG1A 1HNZF 3MPWA 3PFEA 4EK2A 3MMBB 4H4OB 4DJBA 2X3DA 1S59A 4M5DA 4FYVB 3EVMA 5I42B 3IWLA 2UUCJ 4DR3J 1SQGA 3IAM9 3LGHA 4HDGA 2WB4A 2J9CA 3UN2A 2DXFA 3QT8A 1VQ8S 2JLEA 3SIPB 1RWPB 2BE2B 3BV8A 2I5JB 3BQ0A 4K5SA 4FYYB 2UUBF 5KFFA 4KBIA 2V8GA 2L08A 4F4YA 2D74B 3PW2A 4ETZA 3W5ZA 1H98A 3BEGB 4J9VA 4OZ5A 1T11A 2Q79A 2RILA 5IS2A 4I2QA 3UR0A 1SI9A 4DV0F 2IRUA 4N8OA 3AFGA 4P10A 1HNXF 2Q6BA 3PXGa 1R31A 1OMSA 4RNMA 3L3CA 3RB4A 1LEOA 3JQKA 3M6UA 4LF6J 1RBLA 2DR9A 2AEMA 3IG1B 1TK8A 3OTEA 3RBEA 3O6QA 3Q8SB 1YWXA 2B0GA 4LSLB 1FDAA 1S12A 5KFCA 2VDHA 2O67A 4C48A 1KLNA 5IQQA 1FWPA 1HBMA 2UUAJ 2QYCA 4IYQA 1XNRJ 5AE1A 5CYQA 3W64A 2CWXA 1MSWD 4NPOA 4UOFA 1X5PA 4ECQA 4YB7A 3HKZD 3H5UA 5J2PA 3R9LA 1FKPB 1FX4A 1O0PA 2ROEA 4HLBA 2JJ4D 2CQ0A 2WVFA 3HT0A 3I9V9 4B3MF 1NSPA 5B08A 3SV3A 1VDHA 3R27A 1RP5A 3KLIA 1U6BA 1S0VA 4PXBA 5J2NB 4JV1A 1HLWA 1S7HA 5K9FA 4F4WA 3P96A 2C2EA 1RCOB 1RABB 1I51B 5HMWA 1KQGB 3OXFA 4PCQA 4CLZA 2RF2A 1IM6A 2BQ3A 1H0HB 1WOOA 4TXSA 4QPTA 4BLGA 3GFHA 3QT6A 3D9BA 3OTDA 2ZVSA 1NM2A 3CTRA 1IQTA 1C0UA 2QE5A 4DR5J 1NH8A 4JI7F 4X4NA 1HKAA 2R8IA 2AWZA 4UZCA 3MM6A 3RZAA 2P6TA 1AUDA 3HHNB 2C2OB 2KL8A 1KVKA 4M95A 3HVRA 1S0NA 4DG1B 4C8ZA 3PW0A 4O3RA 3V6HA 5HSPA 2R7UA 4Y2KA 5CYQB 4H54A 3OHBA 3MR5A 3R8YA 3MMCA 2W2PP 3RB3A 3L4BC 3KJNB 5M2RA 4KGXB 2CQ3A 3HZEA 3LAKA 2EXUA 4GKKJ 4OYWA 2ASJA 3MM9A 2DB1A 2KFZA 4F3MA 2K3IA 4WU3A 3D28A 3DMJA 1R0BG 4I6AA 1NKEA 2KB2A 3MPUB 1I3OB 3WHIA 4X2BA 1SJ1A 1G1XA 2RF2B 2KJVA 2BJ3A 1I6JA 1TKXB 1R6YA 4OZ1A 2Z8QA 3CULA 4ZPDA 3FQKA 3MEKA 4C3KA 4F0HA 4R25A 3JAMY 2EPIA 3MM6B 1DLOA 3M9MB 4P72A 7AT1B 5D3GB 2V63A 1LWCB 2B3TB 4TLQA 4EZ9A 1YJNS 2ZVIA 4X4TA 1B99A 4IH6A 3EE3A 4RW4B 1TFYA 2AYBA 3KJFB 2DR8A 1JIHA 2FHMA 2K7JA 1FD8A 3PHTA 1FNMA 1H7XA 4J9KA 4MMOA 3D0IE 2HBZB 2VG6A 3PDNA 3MMCB 1VQLS 4PEOA 1BWEA 3P6YC 1LQ9A 3R5AA 4DZDA 3RJMB 1WF0A 2HRTA 2HHHJ 1CJUA 4FBTA 4JI2F 3EUNA 3OSPA 2HWHA 1HNVA 2DHGA 4P71A 4PWUA 2YNGA 3LQVA 1SV5A 2R7QA 4G1IA 4DV5F 2M9KA 4FZVA 1FVSA 2HURA 5DLFA 1EIYB 5DDPC 3RBXA 5A8KA 3FCVA 3LW5C 2FJBB 2V2VA 1UMJA 2GVZA 1OIAA 2I9SA 4IG3A 1UFWA 3KUGA 2G1HA 3PX0A 3JQJA 1DLOB 2WRMA 4OX6A 1NEEA 5L39A 3R7BB 4WFZA 1TK5A 1QAIA 4KGMA 1S4EA 2XLKA 5I4MA 2X7IA 4OLPA 1B0TA 2VG5B 2YPZA 4YB6A 5GAHU 4RNFA 4P74A 3IWXA 4J91A 1S9GB 4NLTA 5KG4A 4LFAF 1C0TA 1VHIA 1AW0A 1M5KC 5F8LA 2K7KA 4C9DA 3Q22A 3PO5A 1G2EA 1FRJA 1VRUB 1RT7A 1AB8A 1S1VA 1LW2A 4F0MA 2IIHA 2N3OA 3GFZA 2FYXA 4RW8B 2BM0A 4U6PA 2VBXA 4WYWA 4X65J 4DI6A 1HNZJ 2N4DA 3CSKA 1FRLA 2CNOB 1TTHB 4NLYA 3DM2A 3WDOA 3M8RA 2H3EB 4Y6IA 1XNQF 3VCDA 2JEGA 4WKYA 2Y8YA 2I38A 5LXRA 3E51A 5J1NA 3UFCX 1HWKA 3H2LA 5K8NA 4KE5A 1VC5A 1E6YA 2HIYA 3G8QA 4YHHF 1WG5A 3AOCA 1R0CB 3BJYA 2GVZB 4C8KA 4IG3B 2DT9A 4IOCQ 3K17A 1B64A 1BMQB 3I9ZA 4EZ6A 2DD8S 4IFVB 4TYBA 2CVEA 5KFPA 3DDIA 2BJ1A 3CD0A 1Y7PA 5CAAA 4RW7B 3FEXB 1DTQA 3KYLA 2LA4A 4P75A 4EO6A 2HHTA 1X5OA 1D1UA 1M5SA 2NREA 4JI4J 1HNXJ 4ZJLA 1YJTA 4KY3A 3N79A 4WE1B 1FRIA 3Q83A 4NYOA 1WWHA 4BBYA 3Q89A 2NPIA 3CO9A 4UF4A 4OV6A 2BUNA 3BPDA 1RT7B 4PYDA 1LW2B 4DV1J 2RS2A 2KZMA 2DRDA 3J7ZT 1IBLJ 3G87A 5FJ4A 1MWQA 1RAHB 2BACA 4TU8A 2A18A 3US5A 3I82A 2EK1A 1X8DA 3FSYA 1TP7A 1HA1A 2OMLA 2DIUA 2BV3A 4PWDB 1GFWB 1NJIT 3I5BA 4QIFA 4J9QA 3RB6A 3O3LA 1E6YB 3D3CJ 2NUUG 4JI6F 3UCGA 2DNKA 2W2MP 3HM9A 4KH0B 1QUPA 4PRFA 1N36J 2O66A 2DPJA 3H7HB 1NK6A 4JI3F 2V5HG 2UP1A 3CIMA 4B3MJ 3DRXA 3DHXA 1EETA 1PSDA 1KKHA 5FLXY 4CO4A 3G8TA 1DTQB 3DLEB 4LF7J 3FRZA 5I3UA 4IRKA 4ZJOA 4OHXA 4S0MA 2VHGA 4CNYA 1HR0F 3DI6B 1RU2A 2AJ4A 1DAXA 2GQQA 2YQ1A 1GTEA 2UU9J 3UCZP 1YJVA 2ILZA 2HBYB 3M8YA 2WVEA 2ZC3A 3NOCA 4F50A 1KOHA 2GCFA 4E8UA 4JI7J 1VJWA 5KFSA 3GYXB 4LF5J 2DHAA 1Q8KA 3WC0A 3S01A 4OZLA 7FDRA 2V8HA 5M2UA 2HLTA 4CIOA 2G0IA 2YQ3A 2KXNB 2BJ7A 2Z2YB 2MY8A 1N34J 3UCUP 5MAOA 3TVYA 4DR2F 1CLFA 4WFYA 2C42A 1HQEA 4P7TA 4CO5A 5KFDA 1IXKA 3FCHA 4O44A 1K1QA 1N0VC 4LF9J 4JV5J 2WB1D 4YDXA 4ZVFA 2HWIA 2HW3A 1UWBA 4U67Q 3AB4B 2FLOA 1N33J 4NLPA 3I87A 3F0NA 4JV0A 2XCAA 4F3QA 2GJIA 1XK8A 3ADAC 1EETB 4LRDA 1NK9A 1MROA 2FLNA 1VR6A 1KVJA 5I3UB 3R97A 3DN9A 1PIEA 4DV3F 4URSA 1YITS 2VA2A 2OSQA 4NI2A 2GJ2A 1CVJA 1HMVB 3HHKA 5JVGQ 4B9VA 4NLRA 1UA0A 2ERRA 5L9XA 2J0SD 1F2HA 3QJPA 3BDEA 3HXMA 2YX7A 3EPIA 1SJ4P 3C6TB 3HHDA 5KFYA 2XNRA 3ZZTA 4QIGA 3H25A 2VODA 5HI7A 1JXVA 5ETKA 2YWWA 2F9DA 2LQBA 2M70A 1UWAA 4A8MP 2WSCC 3AA8A 1M1KT 2OH2A 4LF1A 2NQPA 1HFEL 3G6XA 4WF9Q 4ZP8A 3W9JA 1B0PA 1RK8A 3E8OA 5IV3A 3KNAA 4WTYA 2FJXA 1CJVA 3HFVA 2DO4A 1Y5LB 2DGUA 2H48B 4U95A 4Y2IA 4PG5A 1NB2A 1WNEA 3CCSS 1UWBB 4F4KA 2AEJA 5F8MA 1JLGA 5F8NA 1SKSA 3BGUA 2CNLB 5EWEA 3IWNC 2UVUA 2GAGC 4MTPA 3MR6A 2VQEF 1Q82T 1ZA2B 2WSFC 2GFFA 3CCZA 3R1HA 1DZ5A 3WIVA 2KHCA 3U27A 1S6QB 2CJXB 1LKZA 4KR0B 4N56A 1RT5A 1UJ6A 4DV5J 4NI2B 2FVCA 1VFJA 2DR5A 1CG2A 2BXJA 3H59A 3R2DJ 2LECA 1FRHA 1LK7A 2EKYA 1ZM3A 3A13A 4KQZA 4OV1A 1QTNB 1HNWF 4I64A 5KT5A 1TL1A 3PEHA 1PJ7A 4UZBA 1HBUA 4WKRA 2RJZA 2AW0A 1T9TA 2ZHAA 3KK3A 4E0DA 4CM2A 2OKQA 4ZVHA 3OL6A 2DGQA 2AX0A 1SH0A 2C2MB 1ZAWA 1SC4B 2DHHA 2ASYA 4K4SA 4L74A 3OFHA 1CJVB 3NGUA 5HLFA 1S6PB 3J81U 5KOXA 2CVIA 4M1KA 3ZXWA 2LXFA 1UKUA 3MTKA 4X66F 3EGZA 1LXNA 3PIOQ 2XSFA 3RRHA 3FUYA 3K5OA 1FJCA 1I94F 4BWMA 4X62F 2YKAA 1BC6A 4I68A 3LWMA 3PZPA 3QT5A 4U9RA 2CNKB 3IC1A 4ZJQA 4KH1B 2JNJA 4AT1B 4OI6A 1GMWA 3EZ5A 3W9IA 2YWGA 2KG1A 1UCNA 3CC7S 2YNIB 2I0XA 1SL2A 4GO7X 2RRBA 3QGHA 1RT5B 4AQYJ 1OSDA 1G3OA 1JKHB 3U1MA 3PACA 1UFLA 2Y0BB 4DL7A 3OHAA 5B0DA 4B3RJ 5K14A 2W25A 1UL3A 4MFBA 3OXGA 1RYRA 3FJ2A 3ZZZA 2J0XA 3DOLA 3PYGA 1MG7A 2Z57B 3SFUA 1M5VC 1IN0A 1I1GA 2R2SA 3HKWA 4YFUA 2XQCA 2DGTA 3CJ5A 1H74A 2KI2A 1RTJA 1SJ3P 1TL1B 4HYKA 3GPAA 4RW6B 3ETMA 4O3SA 4DUYF 1H6KX 3T1HF 2NXJA 2RNEA 1GT8A 3EVOA 3ITHA 2HIQA 4WTOB 3PR4A 4N7TA 1SL0A 2MMYA 3D6FB 1BQMB 2XY7A 5HN0A 1IWAA 4QBUA 4NEYA 5LJ5Y 4F36A 1U1MA 2HVDA 2QL5B 4MKVA 3PO4A 3HLUA 4G1QA 4V1Ak 2J7WA 3TRGA 2LQ9A 4X4PA 2RIJA 5DLGA 1U0HA 4LRCA 2NYIA 3PHEA 2CPIA 4QIVA 1R8CA 3ISND 2F4VF 2BVZA 3SCIE 4FS1A 2EFQA 3B6BA 2XB2D 2WOMA 3GB0A 3Q8RB 3CCTA 3FMWA 2AYMA 2FB0A 5L46A 1L3UA 1D9FA 5L1LA 4LF2A 1XQIA 2IM1A 3V6JA 1BGXT 4DQRA 2M2BA 2XC9A 1D9AA 2EC2A 5KAKA 2KXFA 1VQPS 3W61A 1ZZNA 4MFBB 3W2VA 1GXUA 1VC6A 4FF2A 2JZ5A 3M30B 3C2PA 2Z56B 8ATCB 3DDNA 3M1VB 4UUXA 3TZWA 3CJ0A 5LXYA 1GK8A 2OMOA 4CYUA 2QSWA 2IJNA 4TQSA 4WFNQ 1VGYA 1WI6A 5C25B 1SPBP 1V9OA 2DTJA 3QWPA 3M4XA 1R7IA 2LP4A 2WBMA 3ITHB 1PG5B 5LJ3Y 1HQUA 2OPRA 2DNZA 5LSLA 3NMAA 4NCGB 4C8MA 4QYRA 3V4IB 3VZHA 2V8VA 1U49A 4B3SJ 2ROGA 1F6TA 5CYMA 3IBWA 3KLEA 5ETNA 5IOLA 3LGMA 3RAQA 2GS8A 3J81j 4DEZA 3HK2A 1IKWA 1OYEA 4K2XA 3RB0A 2CJ9A 2CWKA 1IVZA 1KFSA 4WWSA 1X9SA 2V2QA 1TELA 3KG0A 3FBBA 2P9CA 5AXNA 1W26A 2ATCB 1XR5A 1EJ7L 4P7VA 3QRQA 4USVA 1RT6A 4ZOSA 1PGZA 3V4MA 1RA7A 4W98A 2YKOA 2FHJD 4ZP7A 1LFWA 2V0NA 1UETA 4KT0C 1FJGF 2IA6A 3W2VB 2YY3A 1BQNA 2J8AA 1TUWA 1Y10A 4M5MA 1SB6A 4HH0A 3KK2B 5HK4A 3GJRB 4EU0A 4F7VA 3DRSA 1NHVA 1GQEA 5D0EA 2V67A 4F4AA 3PYDA 1FXDA 4OZ2A 3VQSA 2YKNA 1MWYA 1K73T 2DRAA 1EHWA 1WC5A 1ZM9A 4FF1A 2UV8A 1WOSA 2PDAA 3GG0A 3NNCA 3GILA 3NWRA 3DLGA 1NK8A 3OTOF 4IOAQ 2BJ8A 1T03A 2BJEA 4LR7A 2XZTB 2CDQA 2OPRB 1B7YB 1SJRA 2QLWA 2C2KB 3TANA 1T3OA 4DLGA 2DEIA 1N5VA 5B0BA 3BYPA 2VD3A 4DSKA 1X0FA 2CKWA 3RRGA 1A7GE 3QJLA 3ENQA 5BYQA 4B02A 2FPHX 4I7FA 2JC0A 3GMGA 3OL7A 5A2QU 5E2QA 3L7UA 1RHKB 3VVUA 1TL4A 4KKOA 1T9WA 1YJ7A 3PKYA 2ABYA 3FBFA 4ID8A 2DEJA 4DV2J 3SSQA 4X64J 1ZAXA 2ZNYA 2UXBF 2JVRA 4UOHA 1RA6A 4ZHRB 5L1IA 3DRRB 2FIUA 1S10A 1FEHA 2BEFA 1WD6A 3ILLA 2ZH8A 1Y3JA 2CQ1A 3I4PA 1GEHA 4KGKA 5A8RA 1KTQA 5DDOC 2RQ4A 2H65B 2LA6A 5KG5A 4P6QA 1EQ0A 3J7YI 3BB5A 2VKZG 2MZQA 1IKXA 4DS5A 2MJUA 1AFIA 5LMNJ 4UTGA 4WXOA 2HK2A 4FS2A 3OTCA 1GX5A 3DLGB 4WK3A 5ETQA 3D3BJ 1VQ6S 3DCAA 2YH0A 1IBMJ 4ECZA 2VQFF 3VGSA 4F8RA 1KS2A 3DRPB 4O3NA 4OFZA 4K0KF 4EI2A 1C1CB 3MPYA 2CPDA 5CD4H 1DTTB 2DNOA 3H4DA 3DU6A 2HHQA 4B9NA 1R0AB 3W8GA 2W9CB 5LMUJ 5B0AA 2A6MA 5ETPA 4OZJA 1X9WA 4OX8A 8AT1B 2CQHA 3WX8A 3CJ8A 4WJBA 5HMYA 2APOA 1T0TV 2B9YA 3EXCX 5HATA 3FEYB 4CM0A 2V8PA 4KKOB 1PO6A 2BANA 3FSXA 1WG4A 3TAPA 1MLAA 2HQFA 4O3OA 2DIVA 1RISA 1UPMB 2RUGA 2J0WA 3SSSA 1HL6A 2CJBA 2HFVA 4NA3A 3C46A 2V2KA 3VVTA 1QLNA 4R0JA 1UJ5A 1X4GA 4C2MA 3K7RA 4I69A 2M0GB 2HNDA 2QLBB 2QLJB 4X66J 2HNYB 3FFIA 2CG8A 1WC6A 5A8RB 2MY7A 4EBEA 4RU2A 2OJ3A 3HFZB 4Q0BB 1PYSB 4TY9A 1XMQF 5FIIA 1RTIA 1C1BB 2XLJA 4ID5A 2CA9A 1P6TA 1KNZA 2LYVA 4LR9A 1KHVA 3MUTP 1NK5A 3MMAA 2RQMA 4HI2A 1WELA 3TZXA 1CC7A 3HD2A 5C7PA 1RACB 2V69A 2AGQA 2VOPA 2C1EB 1K47A 3F73A 4J5OA 1UW9A 3JYTB 5HROA 1QUVA 1WHVA 2UUTA 2KO1A 2I8EA 3BBFA 2BANB 3MCNA 5KG6A 2KT2A 1NK0A 5B7WA 2KYXA 1HI1A 2UXCJ 5HVFA 2JLGA 2HGLA 3FDSA 2P8IA 2EKNA 2V9WA 4K4VA 3AJDA 4ZCMA 2QA1A 4QYZJ 3Q8YA 4EBCA 2D3OR 4HR2A 3MZIA 5D6GA 3U1NA 1VQYA 4NLSA 1NKBA 2ZBQA 2CQ2A 1WKJA 3FFIB 4Q44A 4ZPVR 4F26A 4DXLA 1IR1A 3O8WA 2VG7A 1X4BA 4M5KA 5KFIA 2VDIA 2IDLA 4B08A 4GKJJ 3W2WB 3G71S 1RAIB 3HF5A 3V81A 3D54A 4TVAB 2JFDA 2ZFHA 2HAFA 4ECRA 3LPEA 1J5OA 4DR7J 3F41A 3MMAB 1TKZA 1PC5A 4JI5F 3J7AN 5JUMA 1O6XA 2CADA 4ZP6A 4C3MA 1TQLA 2V2ZA 1DJ0A 2DK2A 2W9BA 3L95X 3CD5A 3VAKA 5JVHQ 1Q53A 1T9XA 4ZIWA 1BWVA 4ZVPB 3D1QA 5RUBA 2E66A 4EO8A 1YI2S 3JSRA 1XN9A 5IM0A 2ZM6F 1N5QA 2OELA 3KFWX 3OVSA 1BHNA 5AJ3J 3ET6A 5C2GA 4PABA 1T05A 1IKYA 3BKUA 2W4DA 1UVMA 5DDQC 1JXEA 3CD7A 2CPHA 5AXMA 3T1YF 3A8IA 3OBIA 4UOGA 1S72S 3MM7B 2QJ3A 1P8GA 4FKYA 5ETVA 3QO9B 2ZH2A 2CQDA 1VI7A 3VQTA 2FD2A 1N6QB 3BSCA 7FD1A 2XMKA 5H9FJ 2JEJA 3MUMP 2VG7B 6AT1B 2AKWB 1Q7YT 2O5DA 1MN9A 3ILOA 3ZC4A 1J5OB 1XJWB 3WBZA 4NRTA 3H42A 1U7LA 2FTRA 1TKZB 4PUOA 3O44A 1SQEA 2E9TA 2N82B 2LEBA 1RYSA 1GAOA 3BYRA 2E1AA 3AOAA 5EX3A 1UVLA 1N54B 3ENVA 3L7OA 2RQCA 1HPZA 1Y5IB 1RJJA 2J7UA 3MFIA 1AT1B 2H5JB 4DCOB 3IAS9 3OXLA 3NG8A 2GV1A 1WF2A 1P1LA 1GX6A 3LAMA 2CDRB 3L09A 2IYGA 2Y1JA 3MPVA 2D3O1 3RGIA 1T05B 5K20B 4NXNJ 3FSIA 1D9DA 3AJ2A 2E44A 4XDCA 5HVHA 4IQXA 2XY6A 5F8GA 3K8WA 3NP5A 4RLEA 2HAIA 2HVZA 3PCOB 4PZVA 4ENOA 3AB2B 2M8HA 4EFAC 2E9ZA 4QZVB 2XZDB 4C3LA 4ELVA 3KNGA 2LLZA 3HFKA 1F60B 3TAMA 4J9UE 2CAJA 3BSNA 5KFHA 4BWJA 3N6NA 1TL7B 2J9EA 1DY3A 5ITHA 6FDRA 2UXBJ 4RZRA 3ZZRA 6FD1A 1QE1A 3KUEA 2OD6A 1U8WA 2V4JA 1N32F 1LW0A 4GVBB 1ELOA 3RG6A 4KGZB 2KJWA 5G0RA 1ROFA 4KRWA 1U2CA 2QN6B 1YKWA 1U2FA 4U8YA 4OYMA 2JSXA 1HI8A 3FVYA 3CCQS 5EN1A 2BJ9A 3IM9A 4LF8J 1NB7A 4CH7A 2HVEA 2RDIA 3V2UC 2W2QP 2XYHB 3G9CA 3CJRA 3MWBA 1OPIA 4DR4F 2MZRA 2EEYA 1VS3A 4K4UA 1K0VA 2FVPA 1HNIA 1NHUA 1S1XA 4AL6A 3IBFB 5F0WA 5KFRA 5JJBA 4ZCLA 2VQFJ 4MIBA 2X1AA 3HD1A 1X4EA 5T7LA 2E5GA 4Y2AA 2QLXA 3SCJE 2UUCF 4DR3F 4N77A 1KFDA 3X1LB 1KN6A 2QL7B 4KGVB 2W4PA 3HULA 4TYAA 1CJTB 3FZ2A 1SH2A 3KXDA 5HJXA 1VK8A 1U6FA 4ECYA 3TAQA 4Y65A 4PG6A 2ZITA 4LSZB 2VICA 3P8BB 2HMIB 4DOZA 2XBPA 1RE1B 3VAMA 1LNQA 1VRTA 3A3PB 1FRXA 3JQMA 3M8ZA 3NGDA 1U45A 2FLPA 3BO2A 1KLMA 5EHHA 4IDKA 4P2FA 3W62A 2MKCA 4A8OA 1VOMA 2B8QA 3PFOA 4I2PB 1OY8A 5KFOA 1N88A 2DISA 1WHWA 3RBDA 5K8OA 3HI9A 1R43A 3ZZUA 4B3OB 1RTHA 1HD0A 3H5SA 4LF6F 3SBMA 3I4HX 1X31C 2V50A 3HP6A 3NGRA 5KFVA 4ED7A 3B4DA 3HSDA 1MMNA 4FKXA 3RYLA 2MKSA 1HNIB 4DDFA 1S1XB 4ED2A 4ELUA 5I3QA 2IVMA 4YN3B 3J81Y 1UEUA 5T7LB 2UUAF 2HLUA 1FVQA 1HWIA 4ICLB 2HZVA 1W2BR 3UQSA 3GONA 4CQ1A 4PQAA 3G82A 3MFHA 1XNRF 3G96A 3K8VA 5F3ZA 1S57A 1RI7A 1BD6A 3M6XA 1DQ8A 1IM4A 4QR1A 2OP5A 2ADCA 1FFGB 3BKFA 1HBOB 1AXQA 3AD7C 5FDLA 3JTPA 4K2JA 2U1AA 1V5VA 3F56A 1JLCA 2KRRA 4F0KA 1FD2A 1S1WA 3A3OB 1VRTB 4IG0A 5J1EB 2H5EA 2WSEC 4YP3A 2QLFB 3ILIA 4L3NA 1YLXA 3OL8A 4LSNA 3UDEA 2XYGB 4J9NA 2KN4A 1IBCB 5HBMA 3BDPA 2DJWA 3GR1A 2F8EX 1TKTA 3CJ2A 2FJEB 2BZ2A 3CJ4A 2FLLA 2DYAA 5C42A 4EYIB 1PAEX 3H90A 1J5EJ 3MCSA 4AXJA 5HVGA 1RTHB 2DNRA 2R7WA 1SKRA 1A0OB 3G4SS 1EZZB 3GJTB 4DR5F 3EDQB 1S5ZA 4DX8H 3EWGA 2RRNA 3T9ZA 1FEEA 2DGXA 2ZBCA 2XMJA 4Q8FA 5E41A 3KLHB 1JLAA 4H4MB 4OX7A 2CJAA 3UNGC 2UV8G 4FPRA 3MDFA 4KIAA 3MOJB 3I0RA 4USKA 3G86A 1PC4A 5CQGA 3C6UA 2RUSA 2IBOA 4HDHA 3G82B 1LXJA 2KDOA 4KB7A 1RAAB 2R9LA 5J2QB 3UNYA 1WC1A 2MQMA 5DJBA 4TU9A 3DXSX 2XMTA 2J9DA 2L48A 3AJ1A 2YTCA 4GKKF 4Q7AA 2ZOFA 2JEFA 1TVRB 2FC9A 4RPFA 4IRDA 1S1WB 4W90B 3WX4A 4KV8A 4J7CA 3QMQA 3N6LA 1RHMB 2VBYA 1KQFB 3UW1A 3JB9k 2HZAA 2YQ0A 3CDEA 5L9NA 3OL9A 3K2YA 3QGPA 3GYGA 5CHCB 4XIUA 4CTAA 3OTBA 5HBMB 2CQ4A 1R27B 3BGFA 1FKOA 3VALA 1PBUA 1NDKA 1FF2A 1OPZA 1M1GA 2GX8A 1KSPA 2EW9A 1WF1A 2IBKA 1TL5A 3NBPB 2D3ZA 2GQ2A 3PW4A 4KPCA 5DM6Q 1RADB 4F4ZA 3MUVP 2CQGA 2GO9A 3ZZOA 1SIZA 3T41A 2F1FA 1K1SA 2B7BB 4DX7A 4UY8T 1VQKS 3NS6A 1VBKA 3S6EA 4AL5A 2CNNB 4LFCJ 5B0GA 2F8HA 3CW2C 1H3DA 2VC1A 2MKIA 3AT1B 1KR4A 4GVLA 3I0RB 2GJFA 1O51A 1NKCA 2QMUB 4OI3A 4ZPTR 4ZPAA 1RBAA 5EUHA 2Z30B 1ULRA 1Y0HA 3S8SA 3KHRA 3IGNA 4LVOP 1ZH5A 2G13A 1F2GA 3M05A 4RWXA 3KMQA 3GE9A 2RQKA 4QWEA 3G8SA 2XZWA 2HGNA 4LIRA 2DHXA 5HANA 1UAWA 4CCHA 1WEYA 1KTVA 2HHHF 2PE8A 4PYAA 5D4NA 1U1PA 3GTYX 2ZH5A 2D9PA 3MMBA 4H4OA 2MZTA 5A0YA 1S79A 3ZTOA 5I42A 2VFVA 1IWGA 2FY8A 2JVOA 4TY8B 4N5SA 1KBRA 2VFTA 2JL9A 3C66A 4CT9A 5U47A 4QW9A 3CCES 4DSJA 3H5YA 2X3GA 1LWFA 4HACA 3RAMA 3DNCA 3FGVA 4KC5A 1EX8A 3CD6S 4ECTA 3NGKA 4DFPA 3HMJG 1N5YA 2BE2A 4OIXA 4RNHA 2W1BA 1SJFA 2D1CA 2AU0A 2WONA 1E6VB 2J6SA 4DU7A 2L9DA 5FD1A 1X60A 2HFZA 4QJVA 4OYIA 3ISNC 1RUSA 5E3AA 2ILYA 3ZFVA 5KFLA 5D4OA 2R8GA 1S6UA 1SJQA 2P5VA 4RR5A 4ANDA 2L9WA 3BO3A 4OYOA 5GAGI 2ZWPA 1VC0A 4HHHA 4DU8A 2YNHA 4C8NA 1X5TA 2HFSA 3NCQA 1C2PA 4OZ3A 1J27A 4DPXA 3NEKA 5KFEA 1JMTA 3IG1A 3D1HA 2E5JA 2OEJA 5D4PA 2LCWA 1N52B 4LSLA 3W9HA 2BM1A 1TK0A 4IR1A 4OYXA 2HHWA 4LFBJ 4X65F 3CCLS 5GAEI 2W9AA 4BHQA 2XCPA 4WFXA 5A0YB 2AHOB 4KHPJ 1QJHA 4K4YA 2XO6A 5KFBA 3BN4A 3EX7B 1LWFB 4HACB 3T19A 3VZIA 3VAFA 1NSAA 1U24A 2Q43A 4YR2A 4EBDA 3BBCA 1N5YB 1FKPA 1SC1B 4YY3J 2W7PA 3R5DA 2IFXA 4ES2A 2WONB 4CO0A 3H20A 3H8YA 2LU1A 3GJQB 3PY8A 4IUFA 2L9NA 1G7CB 2R4FA 5THWA 1MU2B 2QEXS 3RRKA 3B54A 3TEHB 1RWKB 3QYYA 2AMCB 2GHWA 4FVCA 3FK4A 1U1OA 1NJWA 2C2ZB 2YNHB 4DSLA 4JI4F 3EICA 4RL1A 5J2NA 2ZBRA 1UVJA 3J7YU 2AJFE 1ACMB 2AJ2A 1B70B 2K8GA 3N6MA 2VPYB 1U1QA 2VPZB 1OS5A 1SC3B 1D8YA 3KHGA 2LDYA 5ETSA 4FN5A 2NYHA 3DLBA 4DV1F 5A8WA 1M90T 3SCLE 4DR1J 4GC6A 4CH0S 1IBLF 2QRRA 3D0HE 4M5HA 4Q45A 2ZH9A 1WC3A 4C11B 1PCAA 1VLYA 1T95A 2XMAA 4DG1A 2NR0A 5KT4A 4FP9A 3JSYA 4K4ZA 2W2NP 3EXYA 2YKMA 3FNNA 4B9UA 1V5IB 2D3UA 2ZH4A 2QA4S 1Q5VA 3OFFA 1FA0A 1EP4B 3QPIA 5BYSA 4PG4A 3G2XA 3POTA 3IGVA 2LQ5A 2P9EA 1N36F 1FKAF 1NSQA 5KFKA 2DNYA 3J80Y 3Q24A 3CVKA 4F2RA 1NPPA 2IRXA 3TI0A 4A8QA 2C3UA 2OI2A 3RR7A 2ASDA 5HQLA 2B8PA 1LK5A 4LF7F 2MQOA 3P5BP 5DQIA 2W2OP 1U48A 2B56A 4FXDA 1WHXA 3LF0A 5GMEA 2GGPA 3A8KA 1ZAVA 3T5KA 4Y2CA 3R5JB 5EGYA 3VAHA 3THVA 3GP9A 4A8KA 2UU9F 1TKXA 3KLVA 2QC3A 1VQ4S 1XEZA 5LSRA 2KU7A 2QGFB 3I56S 1NMEB 1H2TZ 2KYZA 1C4AA 3BR9A 1Q78A 3UD3P 1SUQA 5A8WB 3MD1A 4CP5A 2E5IA 1RU1A 4LF5F 3OVAA 3JAMU 5D78A 5D3GA 1LWCA 2FVSA 2HS0A 3Q8QB 5IT9Y 3TP2A 4RW4A 1AZSB 4RW9B 3PRVA 2D41A 1N34F 4CLWA 4QQBA 4N47A 2ACYA 1J2VA 2YKMB 4F67A 3FC9A 4HHJA 3W7BA 3H4BA 2Q66A 3MEEA 2YNFB 4DCJB 4LF9F 4JV5F 3POTB 2PA3A 4ZVSB 1N33F 3KDOA 3NRBA 9ATCB 1JJ2R 4PR6A 3CCMS 2IDEA 3ISZA 2PEHA 3T5JA 5AT1B 2W4CA 2Z4PA 4DBQA 4FPIA 4ECXA 5BJRA 2R7SA 2CPFA 1SXLA 2RAQA 1HHSA 2GGPB 1R89A 5KFZA 2CIMA 1HD1A 1FWKA 1T9VA 4EYHB 1UEKA 2OPSB 3DKDA 4DF8A 2HHPA 4MH8A 2D9OA 1F5CA 3CJSA 1SUQB 2NSCA 4TNOA 1VIXA 3NXZA 1FI4A 4RBUA 4I56A 3TJ9A 1VYAA 3HVTA 2HQDA 2I2YA 4DPYA 4UT4A 1U1KA 3SCKE 2VG5A 1S9GA 4DUZJ 1IJEB 2GMJA 2MZJA 2KFYA 1FWLA 3QJJA 3KLFB 2YKQA 2JDJA 1FDDA 3VAJA 1VLOA 3DYAA 3MEEB 5DETA 2CPXA 4DN9A 1S0OA 2LXIA 3BREA 1VRUA 1WTFA 3BQ1A 4KO0A 4DX6A 4AXIA 3D5MA 2EG1A 2IVFB 4NEZA 2XSJA 4J9SA 4RW8A 3KK1A 1NHKL 4DR6J 4BS2A 4NCAA 1B3TA 4ZVEA 1APSA 4M8LA 2R7XA 3OLAA 3M32B 3HVWA 1RWNB 2GQCA 1SBRA 4USWA 4OI2A 4ZVUB 2N3LA 2AIRB 4NA2A 3RBZA 2BOAA 1F5BA 2B4UA 1GMVA 4ZPBA 3ETOA 2ZD1A 2DCUB 3CDAA 4DPWA 3W63A 1K44A 1RHQB 4JYAJ 2QFJA 3M8SA 2G0CA 2MKJA 1N48A 2WTFA 4HT7A 4IFVA 2VOOA 5IC4B 2MQ8A 2DPIA 2JOQA 3QLHA 1X7VA 3AQPA 1RKIA 1JX4A 2XO7A 4RW7A 2MHNA 3HVTB 3IXQA 5LM7E 5D15A 3MI7X 3VF0B 4C4WA 4C7QA 1DRZA 4MK9A 4IRCA 2GVDA 1HWUA 4QWCA 2R7TA 4ES3A 3LOUA 1BUXA 4U7CA 4WE1A 2VJUA 3DYAB 1M5OC 4C0HA 1QSLA 1S48A 3W60A 2P2CB 2WCXA 3DXBA 4DL6A 2DGSA 3OJUA 4KO0B 3QATA 1JJCB 4TKTA 1U6ZA 4C8OA 2EC0A 2RRAA 4R0EA 4HH1A 2XSJB 3MR3A 1Q1KA 3ENWA 2UUWA 2XWYA 2XMMA 3CIZA 4ZVQB 4RWWA 5F8HA 3KK1B 3WC2A 3ENAA 3JTOA 1HIYA 4ZLPA 2XMVA 4ZVGA 3J7A1 4PWDA 3R5CA 3H98A 4AQYF 4LUBA 4I67A 1V3SA 1Q95G 4C0OC 3SI8A 3C16A 4B3RF 4LR8A 2FDNA 3QAEA 2ZD1B 4M94A 1S99A 5KFTA 4FDFA 3MF5A 4WP3A 1UPPA 1M0SA 4GC7A 1RAEB 2XS2A 5F8IA 3QLHB 3ZZYA 1PKUA 2MZ1A 3DLEA 2HHVA 4DMZA 2HS4A 5FLXU 2GVDB 1Q8BA 2GMHA 2VBWA 3DI6A 2PT0A 4J9PA 3C19A 3PW7A 2MKKA 2H5IB 4LBHA 2A3JA 3C15A 4V19X 1CSJA 2AD9A 3M2VB 2E5LJ 2PMHA 2AYEA 1WKKA 2PO4A 1S1TB 1NDLA 1SCJB 4NRUA 2XHWA 3MGJA 4A4JA 1FE4A 2XGPA 1QTMA 1CULB 1Z2ZA 1NXIA 4ZLNA 4NXMJ 3GFXA 4B3TJ 3LANA 3OT9A 3SQOP 4OYPA 2VONA 3C16B 4X4SA 2YPYA 1TAQA 2UZAA 3AD8C 2J0QD 4JBCA 4DS4A 3TVKA 1FHTA 4PQUA 3THPA 3QFWA 3SDEB 2NXNA 1GMUA 4CDIA 2R7VA 3RUBL 1JB0C 3A8JA 3Q23A 5JXSA 2XS5A 3BSOA 2CYYA 3CT9A 5F3TA 1OY6A 3ZZPA 4U96A 4J9OA 1EKRA 1Y5NB 1WOPA 4DV4J 1CC8A 1U8SA 4NASA 4LBIA 1NDPA 1HMVA 3P45B 4HTJA 3M8PB 1XC9A 5B0CA 4JUZA 1V6HA 4B3SF 4J90A 3C15B 2KM8B 2XS7A 2IRYA 1S0MA 5CXTA 3C6TA 4NMLA 3O5TB 4F3OA 2WBRA 4WIQA 2Y1RI 5DGBA 2IVYA 1W2IA 2P6SA 4M5GA 4Z7CA 1LWEB 1QM9A 2O3DA 2BKNA 4Z37A 3D68A 3I0SA 1IUJA 2MYFA 3VGUA 2LDIA 1WORA 4ZIVA 1OQ3A 1A9NB 2E1MC 1QSYA 1WSRA 5L38A 3M7VA 3BBBA 4L72B 1F9FA 2ZWOA 1VHFA 3D66A 2DRBA 1RQ0A 4ED0A 4NZ0A 2Y8WA 2YVSA 3R2CJ 3FEZA 3VV2B 1MN7A 2XMWA 5M2PA 3KKFA 4P2SA 1RWUA 2F9JA 2R42A 3QIDA 2WVCA 1EKSA 4XPEA 4PQUB 3EGVA 4DFKA 4LJMA 1S77D 3V5RA 3U02A 4M5LA 2B6AB 2HBQB 2KH9A 2BBEA 2NLWA 3TQ1A 1PILA 3MM8B 4ANCA 5CZVA 4NLQA 3NWGA 4ZVOB 4YUDA 1S6QA 3TWZA 1PBAA 2E1CA 4KAIA 4LQ9A 1ZM4A 4U8VA 2JH3A 1VJQA 3M2RB 3QGGA 3HHLD 3CC2S 3VHQA 2GC8A 1YJRA 3DGVA 4ZDNA 2LXUA 5SZTA 1X5SA 1REVB 2EK6A 4B17A 1F9EB 4YB5A 3EDRB 5KT3A 2FGCA 1JLEB 1KOOA 2B4VA 4QYZK 1RLCL 3I0SB 1RAOA 4DV2F 2XWXA 1AUSL 2HNZA 4X64F 1WDDA 2VPWB 4PXDA 4KSEB 4NLWA 4BC7A 1UVIA 2VFRA 4YEAA 4R8UB 1S6PA 4JI8J 3GJSB 4OZ0A 4OX9F 3BH6B 2J7KA 2IM3A 2NZCA 2RDDA 2CQIA 3PRBA 2NXCA 1QVGR 3AQOA 4DZ6A 2M3DA 2KZZA 3D4JA 5LMNF 2OSRA 3DDKA 3CNQP 2G2OA 4Q5VA 3EZUA 3GIIA 4EMDA 2Q3PA 5K8PA 2DY1A 1NJYA 2MQLA 1XBWA 2WHOA 3GV7B 1IBMF 2E7XA 2PI5A 2YNIA 3CGIA 1NO8A 2DITA 2WW8A 1Y9OA 3R1LA 1JKHA 1HHQA 2M5YA 2QV6A 5E0OA 2HK3A 4FNHA 3EGNA 3JSBA 5LMUF 4ITSA 5C24B 2DGOA 3ZZ0A 4DL2A 3LO3A 4HEA9 3TJ8A 2ZDPA 2GIRA 4DV6J 4HKQA 2R8HA 4RW6A 4L3KA 1HWLA 4NCBA 2HNZB 3L7PA 2G0JA 4C6AA 1BQMA 1PJ5A 2RVJA 3IN5A 4DSFA 4RUHA 2J6TA 5H9FK 5ETRA 3GSDA 2HRYA 5K5MA 4B9TA 1R8HA 2H4YB 3CF5Q 2VU5A 3N5BA 4RO0A 3A1YG 4OI0A 2XGQA 3PRDA 4WIIA 3AD9C 3UVJB 1QAXA 2B9EA 3K58A 4CT8A 2HZCA 2PIIA 4OJGA 3KJVB 5DZ6A 3SXLA 4YR0A 4OHWA 4Z2XA 2EBEA 5L1KA 3ZNJ1 2Z2LA 1T9UA 2K1RB 1TR0A 3UR3C 2PFFB 4KHMA 1BXNA 3M30A 3OLBA 2ZUGA 3NGSA 4USUA 2GW8A 3M1VA 2DH7A 2F4FA 2Q6CA 4AFFA 2L3MA 5HL7Q 5GAGU 1S6OA 2ADBA 2DNNA 1S9FA 5C25A 3K5NA 2EVZA 5KOWA 4UW2A 4DL4A 2C2DA 4M5DB 2UXCF 1KQKA 3EYZA 4RNNA 2AQ4A 1TMMA 1HQ2A 1GH8A 4A8YA 4ZVRB 1EARA 1RXOB 1VIOA 4NCGA 3M8QA 3V4IA 3BPSP 1T9YA 3FCWA 1TMJA 2G9OA 3N01A 2DBBA 2OLWA 5GAEU 4LIWA 4AL7A 4FF4A 4L75A 3BH7B 5C2CA 1IQZA 2VIHA 3UD4P 4GKJF 5F0UA 1GXTA 4LBPA 5BR8J 4YB1P 4I2QB 2ZJRQ 5EX0A 1KC8T 1VCTA 1HHTP 3VWSA 2OPPA 2A2CA 4CLKA 4DR7F 3Q86A 3TX0A 1Z2LA 4D3HA 3QWUA 3KG1A 2QG9B 2FZGB 1KP6A 4A46A 1S1UA 1F5AA 3KHLA 3CJQA 3VAGA 2SXLA 3I6PA 1DBDA 5DRKA 3KK2A 2HQ3A 4L73A 1MWZA 3UDLA 2OFHX 3E2EA 1RZMA 3DHWC 3VTIA 5CA5A 2GIQA 3PJWA 1RHJB 3S1TA 4M5JA 1Y11A 1F0XA 4PPZA 1IBKF 4PXCA 3CCRS 5CYJA 4NYPA 4Y28C 5AJ3F 1HBNA 1HBMB 3GLJA 4RBVA 1X4HA 3LPYA 1BLUA 1NZAA 5D4LA 1NZ8A 3M8QB 3AODA 2AP6A 2W7OA 4C97A 4WP8A 2DO0A 5A6PA 2OEMA 5J2PB 4JV2A 3MAAA 4IQMA 2YBVA 1Z1ZA 2FVQA 4ZITA 4DPOA 2COLA 1FERA 1WUUA 1SC6A 1CQNA 1U09A 2LU2A 4M5IA 2XM3A 5IXUA 2HWTA 3NGTA 2HBRB 2MEWA 1XMOF 2G2YA 1LFPA 3D1OA 1UTAA 2F7VA 3KLIB 1QDUB 2OPPB 2YH1A 2GZOA 5E7OB 4ZHRA 3GU0A 3DRRA 5IFMA 1RGVA 1S1UB 3UO0A 5CD4A 3NS5A 1OJ4A 3T1AA 4QPXA 4YS2A 3TR5A 2ZJPQ 2XG8A 2NXUA 2EFNA 2AX1A 3RAXA 1C0UB 4N76A 3QRRA 4DL3A 1FT8A 4Y0FA 2F63A 2KVIA 4LF4J 4DV7J 4PG8A 1RHUB 1HBNB 2QL9B 4QIEA 2LVWA 3AY0A 4NXNF 4CLFA 2ZE2A 5LL6d 3T5HA 2KG0A 2RU3A 3DRPA 4XPCA 1C1CA 1N5SA 4RX6A 2UXDJ 1DTTA 3UI3A 1R0AA 1S49A 1KD1T 2W9CA 2C2RA 4MKBA 3UE2A 3MAAB 2HHUA 5E3RA 3MAHA 4K4XA 2KVQE 4USIA 4HL9A 1D3WA 3MM9B 2POKA 1RHRB 3ILJA 3M2UA 2YWHA 4QU6A 1VQSA 5HAOA 3G6VA 3DMJB 4D3GA 3BR8A 3KHHA 1V3ZA 1QSSA 4OHYA 1JLQA 4QOTA 3CCUS 3QZ7A 3Q2SC 1F3VA 2QSFA 1YGYA 3THTA 4NWBA 3NKYA 1U1LA 2QYGA 1RT3A 4B9SA 3TUJC 2V4QA 3CDUA 5LSOA 1IJFB 1Q8IA 4QWBA 3LTOA 4OX9J 5DS7A 3MURP 1FXRA 2HNYA 3H2VE 2HFUA 2MXYA 1NCLA 2UVVA 3I31A 5H9EJ 4X4QA 2MDAA 4LF8F 2J6UA 3U7JA 3PEJA 3N0VA 4IO9Q 3MTJA 4Q0BA 3AHPA 1JJHA 3QBCA 5GMKa 4O3QA 2R7RA 1C1BA 3TARA 2XTJP 3HPOA 1Y00A 1O5JA 2ROPA 2ZE2B 1GNKA 2AZ1A 5DZ7A 4A8FA 2DCLA 3U1LA 2ZC4A 1URNA 2Z0GA 2XI2A 1R3NA 3ZTSA 3FQLA 4W4MA 2VG6B 2IPOB 3JYTA 3DFEA 4LRFA 3K57A 2C3PA 3T9NA 4K50A 4BCAA 3M2UB 1CJUB 3MCMA 3W5XA 4FYXB 1HNVB 4JI0J 2DNPA 2HGMA 2OFGX 2V9KA 3B4MA 3TX8A 5H1SV 3RW6A 2YNGB 1JLQB 1SV5B 1JLFA 1RLDA 1RT3B 1MMLA 2FJDB 2AJQA 1CPZA 3C14A 3MCOA 5KFQA 5KT7A 4DFMA 1R8AA 3MOZA 5A8KB 3IA0A 1WC0A 4K8RA 4LREA 4F02A 5KT2A 1UEVA 4JB8B 1QVFR 4ZCKA 2UUBJ 3TYTA 2HEKA 2PSZA 3W1YC 2M88A 2U2FA 1T8EA 5E33A 3W2WA 2QO3A 1XTZA 5DGAA 2AV5A 3W3SA 3PNIA 4DV0J 5L8RC 4GMKA 3OV7A 1FTRA 5ETMA 3BGRA 1C0TB 4J9MA 3QSIA 4FF3A 3KMSA 2CUYA 1YRUA 5E3QA 5CZXA 4KPYA 4Y2MA 3HSJA 4WBFA 3NCPA 3P3DA 2DH8A 1FDBA 2B9WA 3E01A 4C98A 5AE2A 1HW9A 2GIFA 3HDSA 1S1VB 2MB0B 4UY85 1KHWA 3I5CA 4OHVA 1ZPVA 2Z58B 5LT5A 1ZZFA 3WIUA 5E5NA 3DM2B 2D69A 2ATLA 2ZH1A 3CB4A 1TL3A 3PG9A 3QZ8A 1SL1A 4RU9A 4M5NA 2VASA 1ZTTA 1JLFB 2ALZA 1KONA 4DQSA 4USTA 3MM7A 2IM2A 2BX6A 1YZ7A 3C14B 3D0GE 3LP2A 3QO9A 2VB6A 4UUWA 3C3LA 3F44A 1NPKA 4MK7A 2GHPA 2H4WB 1N6QA 2LMIA 1J5EF 3LH2S 2NZ4A 1OYDA 4Q2MA 5SUHA 2W01A 2XLIA 1DFDA 4CI0B 3IR7B 4KYZA 4A48A 4HVZA 3I32A 4CZCA 1RSCA 3MEDA 5IWAF 5GADU 4AYBD 1U0SA 3W5YA 3BGRB 1YVFA 2H51B 2AT1B 2CG4A 1SVDA 4MYUA 2V4RA 1VQ5S 1AYEA 3CMAS 3AOBA 3N28A 1SKUB 3E01B 5B0FA 2ZH6A 4P2XA 1Q16B 3N5FA 4G3IA 3PIPQ 1RWXB 3TZZA 4NL5A 2M7SA 3P5TL 1TUGB 4CLYA 3BS9A 3MMJA 1FFSB 4ECWA 3GV8B 2E9RX 3UPFA 1IBKJ 3NS7B 3NNAA 2AJ1A 2XNQA 3N9UC 2HPUA 3BF4A 1TL3B 5IT0A 4CLSA 2PC6A 3NCRA 3TA2A 1I5OB 3TZYA 3M6WA 2FZCB 2R3VA 3LP2B 1L5UA 2BR0A 1Q8LA 4P9SA 3SYZA 3FRYA 4I0WA 3AA9A 2OTLS 4DQPA 3TA1A 1LOUA 1X4DA 3AXKA 5J1PA 5LOQA 4RUCA 3MR7A 2FJAB 4CO2A 2IM0A 4A47A 3TW0A 5ADZA 2MGZA 1X4AA 3GFYA 1NRKA 2EFPA 1FJ7A 1XMOJ 3NL0A 1TL7A 4LFCF 3MEDB 4NYZA 2VFUA 4F04B 3MM5A 4ILRA 4FXVA 2MLXA 1U4BA 3A4TA 4GVBA 2MQNA 2ZHOA 2MLZA 3TO8A 1FNOA 5DO2A 1RAFB 3DC2A 4DHVA 3OR2A 2GAHC 1FTCA 4DUTA 2EG2A 3ZNUA 4QWDA 4Q43A 4ZS6A 3CCWA 1FESA 1TV6A 4Y00A 1RBOB 2MKYA 1H2VZ 4WP9A 1NJXA 1UP1A 1BE4A 1VQ9S 2B9XA 4ED1A 1VBYA 2HVIA 2JHEA 4YDDB 2RDJA 4ANEA 5A6WA 4MIWA 1N0UA 1ITPA 3I5AA 4ILMA 3TUZC 1X4FA 3GWCA 4OJHA 2LKZA 1HQEB 1U47A 2PI4A 1Q5YA 2JEIA 2IJRA 2ZNZA 2XMUA 2RD5C 4O44B 3MPDA 1VBZA 4O4RA 4FXWA 4TN2A 5CH7B 1CJTA 4ZN3A 4XDDA 1JXLA 3TOQA 3NNHA 2V94A 4PKDB 3KLGA 4XAKA 1ZOTA 4JI2J 4NLGA 1QD1A 4KHRA 5IZHA 2MGZB 2HMIA 3NMRA 1ZM2A 2HG4A 2OEKA 1MROB 4IKAA 1EAYC 2H9ZA 2VA3A 4K5RA 3QSYB 2E1PA 3MM5B 5ETTA 1MMDA 4CWBA 4URGA 4A8WA 3BO4A 1YJUA 3VGVA 1WTBA 2B51A 3HZGA 2J8SA 5DDRC 1FK9A 4I2PA 4DF4A 3OR2B 2E1RA 1UZDA 4DL5A 4B3OA 1REGX 4TQRA 3TQEA 1TV6B 2M52A 4JOUA 2VJVA 4E98A 3O2IA 2R2TA 3CMES 1WJ9A 4LFBF 3HSZA 4OMFG 9RUBA 3PTWA 1U1RA 5DG9A 4ECSA 1UJ4A 4ZCIA 4CLLA 2BABA 5KG3A 4KHPF 1IKVA 4N8NA 4X4OA 4LFAJ 4ICLA 1FRMA 2PEBA 2P9GA 2JRSA 2KXHA 3GR0A 1L3SA 4DLEA 3P4UB 2R8JA 1B0VA 2PMZD 4YY3F 2BRLA 1HBOA 1XIQA 3LP0A 1JLGB 3KLGB 1OWXA 2HQIA 2WW4A 4XTTA 1FX2A 2AGOA 2DY9A 3H40A 2N7YA 4RNOA 2CJYB 3DRYA 2YWFA 1XNQJ 5J1EA 3BGLA 3SV4A 3ZTQA 2BOPA 2IC3A 1FK9B 1DURA 4YHHJ 3GIJA 2AF6A 2V34A 2RSQA 3QNWB 3G6ES 3GCXP 2EBGA 1NNDA 1U25A 3QIPA 2Y1LB 4GRSA 1PYOB 4ECUA 4DN0A 1HBUB 4HT5A 4OLOA 4QCLA 3CO0P 4DR1F 4FYDA 1S97A 1WC4A 3KK3B 5AE3A 3NY0A 1WEXA 2F5GA 3KLHA 4H4MA 4USMA 4LMZA 1R6VA 2HS3A 2QZ8A 3D7SB 3TVZA 5KFMA 1IKVB 1N4LA 2RKIA 5HLFB 3DLHA 1JJ4A 3NOGA 5MLCV 5DG7A 1IR0A 1SKWA 1WHYA 2W8LA 2IY5B 3E3XA 2VH7A 5J2QA 2MZSA 3HHLC 1P9QC 1BQXA 3LP0B 2BQRA 5IT4A 3GCWP 1NDCA 4H4KC 1X0PA 3DOMA 4NE9C 2VV5A 1H7WA 4NZ7A 4CLPA 2QT7A 1TVRA 3SQGA 4NMXA 5T14A 4IH5A 3EVWA 2B43A 4GO5X 4URQU 3ULHA 2AYGA 2A2DA 3P49B 5HQMA 4W92B 5KFGA 2F8MA 4ZKAA 2ZJQQ 2IC3B 3D67A 2QA4G 5K14B 2V6AA 4JI6J 4OI1A 1KQSR 3NBPA 5CCMA 1N56A 3DOLB 1O8BA 2OGUA 4IO1A 1NAQA 4NLXA 1OY9A 4JI3J 3UN5A 1RTJB 2XI3A 3QIPB 3W65A 3MAQA 2R2RA 3OVBA 3KTQA 3AXMA 5HMXA 3OPKA 5GVQA 4QIWD 1FJEB 3LALA 2VKRA 2BE9B 3VAIA 2C3YA 5IWAJ 3QRPA 1Y3KA 1KWMA 2E7WA 3KOAA 1HR0J 3HHLA 4J9LA 4ZLJA 4G1QB 2RKIB 4AD6A 3IFEA 2ZZNA 1U1NA 1U0HB 2R7OA 3JSMA 4H4KA 5DM7Q 3CCVS 2EFVA 3SEOA 3A3NB 3TUPA 5KFJA 3QFHA 1DARA 3UDCA 1UZHA 1SIWB 1YJWS 2WOMB 3DOMB 4LT6A
chains in the Genus database with same CATH topology
2QV6A 4NI2A 4P2FA 4WPAA 4P2MA 4OYWA 4CLLA 2GVZB 1WC1A 1Y10A 1CJTA 1YK9A 1TL7A 4OYIA 2BW7A 5IV4A 4CM0A 1WC3A 1YBUA 1YBTA 1WC4A 4WP8A 1CJKB 2GVDB 5D0EA 1U0HA 4CLFA 3MAAA 3C14A 4CLTA 4CLZA 1CULA 4NI2B 4P2XA 4OZ2A 3ET6B 4OYOA 1WC0A 1WC5A 4CLKA 3UVJA 3C15A 1CJUA 4USWA 4OYAA 4CLYA 4USUA 1AZSB 4USTA 3MAAB 3C14B 1AB8A 4CLWA 4OZ3A 1FX2A 4OYBA 3R5GA 4OYZA 5IV3A 3C15B 1CJTB 4CLSA 1TL7B 4CLUA 4WP9A 5D0RA 1WC6A 1CJVA 5D0HA 4CM2A 1CS4A 3C16A 3G82A 1U0HB 1FX4A 1CULB 2WZ1A 4CLPA 4OYXA 3ET6A 5D0GA 1Y11A 2W01A 4WP3A 2GVZA 3UVJB 5D15A 1CJUB 1AZSA 1CJVB 4USVA 1CS4B 3MR7A 4OYPA 3C16B 1CJKA 2GVDA 3G82B 4OYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QV6 A;  4NI2 A;  4P2F A;  4WPA A;  4P2M A;  4OYW A;  4CLL A;  2GVZ B;  1WC1 A;  1Y10 A;  1CJT A;  1YK9 A;  1TL7 A;  4OYI A;  2BW7 A;  5IV4 A;  4CM0 A;  1WC3 A;  1YBU A;  1YBT A;  1WC4 A;  4WP8 A;  1CJK B;  2GVD B;  5D0E A;  1U0H A;  4CLF A;  3MAA A;  3C14 A;  4CLT A;  4CLZ A;  1CUL A;  4NI2 B;  4P2X A;  4OZ2 A;  3ET6 B;  4OYO A;  1WC0 A;  1WC5 A;  4CLK A;  3UVJ A;  3C15 A;  1CJU A;  4USW A;  4OYA A;  4CLY A;  4USU A;  1AZS B;  4UST A;  3MAA B;  3C14 B;  1AB8 A;  4CLW A;  4OZ3 A;  1FX2 A;  4OYB A;  3R5G A;  4OYZ A;  5IV3 A;  3C15 B;  1CJT B;  4CLS A;  1TL7 B;  4CLU A;  4WP9 A;  5D0R A;  1WC6 A;  1CJV A;  5D0H A;  4CM2 A;  1CS4 A;  3C16 A;  3G82 A;  1U0H B;  1FX4 A;  1CUL B;  2WZ1 A;  4CLP A;  4OYX A;  3ET6 A;  5D0G A;  1Y11 A;  2W01 A;  4WP3 A;  2GVZ A;  3UVJ B;  5D15 A;  1CJU B;  1AZS A;  1CJV B;  4USV A;  1CS4 B;  3MR7 A;  4OYP A;  3C16 B;  1CJK A;  2GVD A;  3G82 B;  4OYM A; 
#chains in the Genus database with same CATH topology
 3PJ9 A;  4I6W A;  3SQG B;  1YIJ S;  3HJF A;  1TKD A;  3TEG A;  4I1T A;  1K8A T;  2F65 A;  4HHU A;  4JI1 F;  4ER8 A;  3ZTR A;  4G1P A;  4LQ3 A;  4X84 A;  4TY8 A;  4DR2 J;  4LVN P;  4O0N A;  4ZMM A;  4A8X A;  5HQ8 A;  2KFN A;  1Q7L B;  3K59 A;  4KFB A;  4G65 A;  2MQQ A;  4MT1 A;  2VUG A;  1H2U X;  3FKB A;  4WZQ A;  3CJT A;  2N4C A;  4QU7 A;  4QR0 A;  4CYU B;  1H38 A;  2CZV C;  1E6V A;  3DGP A;  1F1B B;  3K0J A;  2IA0 A;  4IOB A;  4OYZ A;  2MLY A;  2FHK A;  4O3P A;  3A8E A;  2OPQ A;  4DCP B;  3M6V A;  2WZ1 A;  1F9H A;  4RBT A;  1S4F A;  1HQU B;  2KT3 A;  4ED3 A;  1FFW B;  4IH7 A;  4DV3 J;  2KTQ A;  2FC8 A;  4DUZ F;  3HHL B;  3KDN A;  4NZ6 A;  2RH3 A;  3EMT A;  1CJK A;  5CYM B;  1M5P C;  3H0P A;  3KLE B;  4UQT A;  2KRB A;  3JSM B;  4QWA A;  5JMN A;  2YKP A;  2FQQ B;  2DNG A;  1IKW B;  3D6H B;  2DHS A;  3JXO A;  3CPW R;  3QGI A;  4ED6 A;  1HWJ A;  2VPX B;  2JX2 A;  3MXH P;  2BQU A;  1WKL A;  4MKA A;  2XYP B;  4G6V B;  4FVM A;  2B7C B;  4DR6 F;  2JWN A;  1KEK A;  2BA9 A;  2A0F B;  2JFK A;  2DNQ A;  1SH3 A;  3CDW A;  3HCX A;  1RT6 B;  3LWL A;  1VRQ C;  4OZN A;  1BY9 A;  4UOC A;  1UA1 A;  4PXE A;  4USH A;  5J2M A;  4EEY A;  4NLV A;  1KDN A;  1BQN B;  1NK7 A;  3R5B A;  5ETL A;  4KFB B;  1TFW A;  1WI8 A;  5D0R A;  1K9M T;  1GTH A;  3HSG A;  3DRS B;  3DU5 A;  3J7Z 5;  1Q4R A;  4JYA F;  1WAC A;  2R2U A;  2RS8 A;  3DGP B;  1HYS A;  2YKN B;  1FXL A;  4ZP9 A;  3HJV A;  2VQE J;  1HW8 A;  2ASL A;  3DLL Q;  1W25 A;  3K5P A;  5IQ6 A;  2WK4 A;  2BE7 D;  2OPQ B;  2CQP A;  4O4G A;  1MU2 A;  5DG8 A;  3R6L B;  4ECV A;  2BMB A;  3D2W A;  2CPJ A;  1T03 B;  2QA2 A;  2V8D A;  3D6T B;  2NSB A;  2K2P A;  1R8P A;  5BXI A;  4WK1 A;  1YDL A;  3R7N B;  3MR2 A;  5DQG A;  1AFJ A;  4B9L A;  2CJK A;  1OSC A;  1CJK B;  1LWX A;  2BKP A;  1U2R A;  2KKH A;  1TZ0 A;  1NU4 A;  2V68 A;  5HMZ A;  4DPT A;  5A2Q Y;  2MJN A;  2RE1 A;  4I7F B;  1YTY A;  1RT1 A;  2NPF A;  1HNW J;  1TAU A;  3CUN A;  4WCE Q;  2EFG A;  1G6B A;  3B78 A;  3OR1 A;  3QAU A;  3BQ2 A;  4Q8E A;  2B5J A;  3RTV A;  4E2F B;  5KG2 A;  3KJQ B;  5L1J A;  1X4C A;  3BZQ A;  3C8Y A;  4MK8 A;  3IR6 B;  4C11 A;  2EWH A;  5IC6 B;  4WZM A;  5KFX A;  1JNZ B;  1P9Y A;  4WU2 A;  1VQ7 S;  3UDV A;  5J2M B;  4F25 A;  2Y9H A;  2Z2M A;  2MKH A;  2C22 A;  1WSV A;  2YWK A;  2W24 A;  3S7R A;  5KTQ A;  3DOK A;  2HYI B;  3GV5 B;  1EP4 A;  2ACM A;  3M8W A;  5KFN A;  3Q8U A;  4PG7 A;  2PN6 A;  3CCJ S;  3CJK A;  4R5P A;  1SQF A;  1I94 J;  3RR8 A;  4X62 J;  1IKX B;  1HYS B;  3MD3 A;  1HAR A;  3CWJ A;  4O4G B;  1UVN A;  4P52 A;  5K8M A;  3B82 A;  3J80 U;  1NJZ A;  1M1H A;  2JC1 A;  1WDT A;  2OTJ S;  5CCL A;  2EI5 A;  3L9Z A;  2CPZ A;  3CED A;  3WZ0 A;  3VR1 A;  2PA8 D;  2RB7 A;  4DSI A;  3IS9 A;  2YXL A;  5F8J A;  1X9M A;  1RWV B;  4EGL A;  2E5L F;  1RT1 B;  3BN7 A;  3NAH A;  3HT3 A;  1URR A;  4TLR A;  3CE8 A;  4OL8 A;  3OR1 B;  5KG1 A;  2YX1 A;  2B4P A;  2PGC A;  4DUY J;  2B5J B;  1YG0 A;  3T1H J;  2GA7 A;  4IFY A;  2IAJ A;  1V3R A;  4YOE A;  4DL0 C;  2QFI A;  3CXC R;  2QMX A;  2Y0S D;  2X51 A;  1AZS A;  5KFU A;  2OD4 A;  4BC9 A;  4RW9 A;  2E5H A;  5IT9 U;  2HND B;  4J9R A;  3MEG A;  4NXM F;  2E29 A;  5C5J A;  4B3T F;  2GML A;  2WVD A;  2LEP A;  1R8B A;  3H2U B;  2YNF A;  5AXL A;  3DOK B;  4ED4 A;  2F4V J;  2OIH A;  3CJK B;  4R5P B;  3NAI A;  1P1T A;  2HFN A;  1XMB A;  1RTD A;  2ZBI A;  4B9M A;  4ED5 A;  3SMZ A;  1RTI B;  2QTW A;  4ID5 B;  3MHY A;  2L41 A;  3IRW P;  4C0B A;  3Q8P B;  2DVI A;  1M5H A;  3IR5 B;  3LUY A;  2OUG A;  5HJY A;  1YZ6 A;  4F4X A;  2FHJ A;  3TJA A;  4DV4 F;  3TA0 A;  3W66 A;  2CXE A;  3I55 S;  1XWL A;  4P73 A;  1RT4 A;  1FDN A;  1FE0 A;  2R8K A;  4Y34 A;  5HRO B;  4C8L A;  1YJ9 S;  3IS9 B;  5KG0 A;  1K0T A;  2OPS A;  2X1G A;  4RKU C;  1PAU B;  1L3K A;  3EM1 A;  2Z2Z A;  3UD5 A;  3DLJ A;  3LGN A;  2X1B A;  3EPG A;  4OJ1 A;  4RUA A;  2CPE A;  4AE5 A;  4IFY B;  2IAJ B;  4WFB Q;  1VMB A;  3PYE A;  1JQG A;  4MYT A;  2ZKU A;  1NSK L;  4YME A;  5IV4 A;  5KG7 A;  3M9N B;  4PWW A;  4U7U K;  2NS1 B;  3KWM A;  1U02 A;  3MEG B;  2IHR 1;  1WG1 A;  2H1Y A;  1NBE B;  3SZ2 A;  4NOH A;  2RT3 A;  3KLF A;  2VZ9 A;  4ATN A;  4Y3C A;  3TNV A;  4OYA A;  1FCA A;  1NH7 A;  1S7I A;  4DSE A;  2MHE A;  2FHO B;  1B4S A;  1YQH A;  4V19 J;  1Y4Z B;  2BW2 A;  1N5T A;  1RTD B;  1KRP A;  5D77 A;  3V81 B;  1HI0 P;  4MAK A;  3PW5 A;  3KUH A;  5D0H A;  1RB0 A;  2W8K A;  2ZOG A;  2X1F A;  2ZDO A;  2IMO A;  4PAA A;  1Q81 T;  1H72 C;  4JI1 J;  3M32 A;  1JNR B;  3CC4 S;  2F40 A;  1FJG J;  2A6O A;  4ED8 A;  1L3V A;  1RT4 B;  3FBC A;  2W9B B;  3D6M B;  2BRK A;  2MPU A;  4DQI A;  4MKY A;  5GAH I;  5HP1 A;  4MJK A;  1TUV A;  2C3O A;  1T02 A;  4UQG A;  1UVK A;  1DQA A;  2DKO B;  1L3T A;  3SFG A;  2M8D B;  4BDP A;  1YBU A;  4O23 A;  5IM0 B;  3IMQ J;  3K5L A;  1F3F A;  3GZ7 A;  3ET6 B;  2KT5 A;  3KG4 A;  1IKY B;  3OTO J;  2O1P A;  3GYN A;  4FYW B;  2HVH A;  3Q2T C;  4PPD A;  3HX9 A;  3JTN A;  1ZTW A;  3A12 A;  3OQ2 A;  3PV8 A;  2OHD A;  4JI8 F;  2O01 C;  2DNM A;  2BDP A;  1RKJ A;  1T94 A;  3PKM A;  2MST A;  2HKE A;  5D0G A;  3PX6 A;  1G4C A;  4EWT A;  1D0E A;  3IBC B;  4CO3 A;  5E3C A;  3O1L A;  4DPU A;  1RAJ A;  1ZPW X;  2J5A A;  1NPR A;  2CZ9 A;  4PUO B;  2ALY B;  1A6L A;  4P2M A;  5I3P A;  4OJ3 A;  1YBA A;  2HFO A;  4WXW A;  2ZUA A;  3EGW B;  1D8Z A;  1OO0 B;  2CPY A;  1ZET A;  2FJW A;  4OQJ A;  2PFD A;  5HP1 B;  3Q8V A;  1HPZ B;  2C3M A;  4ELT A;  4ZLL A;  1CEZ A;  1CBK A;  2FUG 9;  2MSS A;  2UVW A;  3OJS A;  4DV6 F;  3EZO A;  3GIR A;  3ICL A;  4TU7 A;  8RUC A;  2HSE B;  1TU0 B;  2CFX A;  1ZBT A;  4ZN1 A;  3IP0 A;  5CAB A;  3AH6 A;  3R6G B;  1QAY A;  3N4W A;  3SSR A;  3FMB A;  2DGV A;  4LRB A;  4K0K J;  2BJD A;  1YX2 A;  3PYF A;  4HTI A;  5D8H B;  4ZPW R;  2ZZM A;  2FZK B;  1ZS6 A;  3T6B A;  4ILL A;  3CDB A;  1FNX H;  3M2V A;  2QX0 A;  2W7A A;  3R3T A;  4DWI A;  2NCK L;  2B4O A;  3PVX A;  3VGT A;  4CRJ A;  4ETX A;  1S9E A;  3TAM B;  1S1T A;  2KM8 C;  1NLK L;  2A10 A;  2A1B A;  1JK9 B;  3AAW B;  2BW7 A;  2NUH A;  3Q0A A;  1QE1 B;  4Q2L A;  4CLT A;  2V4J B;  4CO1 A;  1CUL A;  1LW0 B;  1B7F A;  3M9O B;  3K89 A;  1YSJ A;  2CQC A;  5G0R B;  4X4R A;  2KHD A;  3T5L A;  1DQ9 A;  3FZB A;  4KJI A;  2IMW P;  4ZK7 M;  2LFV A;  1XER A;  1KVI A;  2RU9 A;  5GAD I;  4QW8 A;  5B09 A;  1RWO B;  4X4V A;  4I4B A;  1P27 B;  2I1R A;  4CLU A;  3SDE A;  4K4W A;  2DXD A;  1XMQ J;  3OSN A;  3W8P A;  2YWE A;  4YR3 A;  2MQP A;  1CQM A;  5F41 A;  4RUB A;  5KFW A;  3HVA A;  4L6V 3;  3V6K A;  5ETO A;  1RCX B;  3FBE A;  2M4M A;  3H5X A;  1LV5 A;  5AXK A;  4K7Q A;  2OAU A;  2HHS A;  4WPA A;  3ZTP A;  3M8P A;  3DLK A;  3BGO P;  3BM7 A;  2IYI A;  3K5M A;  3ZO7 A;  1MW7 A;  4MIA A;  2RML A;  3EJM A;  2J9D E;  1RAG B;  1S9E B;  3ELH A;  2DNH A;  5F9N A;  3NLC A;  4QR2 A;  1EQM A;  1LWE A;  1YRT A;  2GNK A;  3GQC A;  5BR8 F;  1VK3 A;  1GMW D;  2D7S A;  4OHZ A;  4K59 A;  2K3K A;  1KLM B;  4IDK B;  4M63 A;  1YRX A;  2ZHB A;  3R5G A;  5H9E K;  3HO1 A;  5KFA A;  2XHC A;  4X4U A;  4L76 A;  1JWW A;  5HO4 A;  2AEF A;  4YQW A;  3G6Y A;  2RHS B;  4C8Y A;  3LA0 A;  5A76 A;  3UWT A;  2CRL A;  3RW7 A;  1W7W A;  3PJX A;  2K06 A;  2B6A A;  2ZEJ A;  1XR7 A;  4NX9 A;  3MEC A;  2IJF A;  3MM8 A;  5DQH A;  1N8R T;  1Q79 A;  2C28 A;  4JI5 J;  1YK9 A;  2G1D A;  1RDR A;  4NA1 A;  2Y1I A;  1Z4U A;  2E7V A;  1PYT A;  4OI4 A;  3M2R A;  2ZH3 A;  1U26 A;  3BKT A;  3DLK B;  1RT2 A;  4CNZ A;  2VF3 A;  1EB0 A;  1ZYQ A;  3X3U A;  2MTL A;  2YX4 A;  2DGW A;  1REV A;  5FDL B;  3OUY A;  2HQG A;  1XR6 A;  3QQC D;  3B8H A;  3CMQ A;  3WQP A;  2I6W A;  1JLC B;  2ZM6 J;  3GSI A;  1JLE A;  1OQ6 A;  3OD2 A;  4AUK A;  3PM9 A;  2CQB A;  5B0E A;  4IG0 B;  1CS4 A;  2LQ8 A;  3CJ3 A;  4J37 A;  4ES1 A;  4XO0 A;  4LSN B;  5EDW A;  3T1Y J;  2QMW A;  1TKT B;  3R7S B;  3T6J A;  3LP1 A;  4R8U A;  5C42 B;  2DR7 A;  4HI1 A;  4CH1 A;  3HHE A;  2AGP A;  4LRA A;  5GMD A;  4A8S A;  1IR2 A;  2VBZ A;  2HRU A;  3IRX A;  4ZPC A;  4ZA1 A;  1VQO S;  3BSA A;  1H73 A;  1YBT A;  2VFS A;  5G4D A;  2DH9 A;  5EWF A;  2LQJ A;  4I6Y A;  4LF4 F;  1JLA B;  2NXE A;  4DV7 F;  2BKO A;  3I96 A;  3MEC B;  4K4T A;  2OO4 A;  2BYC A;  4NLO A;  3IO1 A;  1QAJ A;  2F3J A;  1RWW B;  1YHQ S;  2JLF A;  3C6U B;  3V6D A;  4USJ C;  2FJV A;  1GXL A;  4NLU A;  2UXD F;  1RT2 B;  3UN3 A;  1JLB A;  1VBX A;  5C24 A;  1Q0N A;  1ICE B;  1UFK A;  4ZVT B;  2VC0 A;  3IM8 A;  4FBU A;  3OUY B;  1VIS A;  4ALZ A;  2G2Z A;  4DX5 A;  4O0I A;  1PJ6 A;  4WYL A;  2WVB A;  3ONQ A;  1VQM S;  4RJV A;  5EWG A;  4KV8 B;  1CS4 B;  4U7U D;  1MNE A;  4NLD A;  2LEA A;  2DR6 A;  2N7C A;  2CZ4 A;  4KTQ A;  3GIK A;  4IR9 A;  2GO8 A;  2XUL A;  4CTA B;  1FKO B;  2H54 B;  4WFA Q;  1VQN S;  1ARO P;  3OW2 R;  2ZH7 A;  1NK4 A;  2J76 E;  2WAQ D;  3JS9 A;  3LP1 B;  1RWM B;  3OFE A;  4N41 A;  4Z7Y A;  5BYR A;  1S76 D;  1UW4 A;  2AZ3 A;  1AA1 B;  2ZOM A;  2GHV C;  3PX4 A;  2PMW A;  1D09 B;  2I5J A;  1T7P A;  1QY7 A;  4EUV A;  3UVJ A;  3IRX B;  3PR5 B;  1Q86 T;  2HHX A;  3QT7 A;  3KJV A;  2EFO A;  2QIF A;  2FVR A;  2ZBP A;  2ZZT A;  4DFJ A;  5KT6 A;  3RU0 A;  1T3N A;  4OYB A;  2CJQ A;  4JP8 A;  2HQC A;  1N32 J;  2XY5 A;  2G4B A;  5E3P A;  2PD1 A;  2XEX A;  1RTZ A;  1ZA1 B;  3GIM A;  2RHQ B;  3V6D B;  3OFG A;  2FY1 A;  5T41 A;  2ZKT A;  4XK8 C;  2VL1 A;  2K1R A;  2DNL A;  4ERD A;  1WEZ A;  3T3F A;  1JLB B;  4DQQ A;  1C4C A;  5F9L A;  1DHM A;  1FO1 A;  2AJ0 A;  2Y3Y A;  2UVR A;  2FGO A;  2Q1L A;  2DXE A;  4FNI A;  1NUE A;  4F2S A;  4DR4 J;  3TUI C;  4JI0 F;  1FRK A;  2C2N A;  3GG1 A;  1HNZ F;  3MPW A;  3PFE A;  4EK2 A;  3MMB B;  4H4O B;  4DJB A;  2X3D A;  1S59 A;  4M5D A;  4FYV B;  3EVM A;  5I42 B;  3IWL A;  2UUC J;  4DR3 J;  1SQG A;  3IAM 9;  3LGH A;  4HDG A;  2WB4 A;  2J9C A;  3UN2 A;  2DXF A;  3QT8 A;  1VQ8 S;  2JLE A;  3SIP B;  1RWP B;  2BE2 B;  3BV8 A;  2I5J B;  3BQ0 A;  4K5S A;  4FYY B;  2UUB F;  5KFF A;  4KBI A;  2V8G A;  2L08 A;  4F4Y A;  2D74 B;  3PW2 A;  4ETZ A;  3W5Z A;  1H98 A;  3BEG B;  4J9V A;  4OZ5 A;  1T11 A;  2Q79 A;  2RIL A;  5IS2 A;  4I2Q A;  3UR0 A;  1SI9 A;  4DV0 F;  2IRU A;  4N8O A;  3AFG A;  4P10 A;  1HNX F;  2Q6B A;  3PXG a;  1R31 A;  1OMS A;  4RNM A;  3L3C A;  3RB4 A;  1LEO A;  3JQK A;  3M6U A;  4LF6 J;  1RBL A;  2DR9 A;  2AEM A;  3IG1 B;  1TK8 A;  3OTE A;  3RBE A;  3O6Q A;  3Q8S B;  1YWX A;  2B0G A;  4LSL B;  1FDA A;  1S12 A;  5KFC A;  2VDH A;  2O67 A;  4C48 A;  1KLN A;  5IQQ A;  1FWP A;  1HBM A;  2UUA J;  2QYC A;  4IYQ A;  1XNR J;  5AE1 A;  5CYQ A;  3W64 A;  2CWX A;  1MSW D;  4NPO A;  4UOF A;  1X5P A;  4ECQ A;  4YB7 A;  3HKZ D;  3H5U A;  5J2P A;  3R9L A;  1FKP B;  1FX4 A;  1O0P A;  2ROE A;  4HLB A;  2JJ4 D;  2CQ0 A;  2WVF A;  3HT0 A;  3I9V 9;  4B3M F;  1NSP A;  5B08 A;  3SV3 A;  1VDH A;  3R27 A;  1RP5 A;  3KLI A;  1U6B A;  1S0V A;  4PXB A;  5J2N B;  4JV1 A;  1HLW A;  1S7H A;  5K9F A;  4F4W A;  3P96 A;  2C2E A;  1RCO B;  1RAB B;  1I51 B;  5HMW A;  1KQG B;  3OXF A;  4PCQ A;  4CLZ A;  2RF2 A;  1IM6 A;  2BQ3 A;  1H0H B;  1WOO A;  4TXS A;  4QPT A;  4BLG A;  3GFH A;  3QT6 A;  3D9B A;  3OTD A;  2ZVS A;  1NM2 A;  3CTR A;  1IQT A;  1C0U A;  2QE5 A;  4DR5 J;  1NH8 A;  4JI7 F;  4X4N A;  1HKA A;  2R8I A;  2AWZ A;  4UZC A;  3MM6 A;  3RZA A;  2P6T A;  1AUD A;  3HHN B;  2C2O B;  2KL8 A;  1KVK A;  4M95 A;  3HVR A;  1S0N A;  4DG1 B;  4C8Z A;  3PW0 A;  4O3R A;  3V6H A;  5HSP A;  2R7U A;  4Y2K A;  5CYQ B;  4H54 A;  3OHB A;  3MR5 A;  3R8Y A;  3MMC A;  2W2P P;  3RB3 A;  3L4B C;  3KJN B;  5M2R A;  4KGX B;  2CQ3 A;  3HZE A;  3LAK A;  2EXU A;  4GKK J;  4OYW A;  2ASJ A;  3MM9 A;  2DB1 A;  2KFZ A;  4F3M A;  2K3I A;  4WU3 A;  3D28 A;  3DMJ A;  1R0B G;  4I6A A;  1NKE A;  2KB2 A;  3MPU B;  1I3O B;  3WHI A;  4X2B A;  1SJ1 A;  1G1X A;  2RF2 B;  2KJV A;  2BJ3 A;  1I6J A;  1TKX B;  1R6Y A;  4OZ1 A;  2Z8Q A;  3CUL A;  4ZPD A;  3FQK A;  3MEK A;  4C3K A;  4F0H A;  4R25 A;  3JAM Y;  2EPI A;  3MM6 B;  1DLO A;  3M9M B;  4P72 A;  7AT1 B;  5D3G B;  2V63 A;  1LWC B;  2B3T B;  4TLQ A;  4EZ9 A;  1YJN S;  2ZVI A;  4X4T A;  1B99 A;  4IH6 A;  3EE3 A;  4RW4 B;  1TFY A;  2AYB A;  3KJF B;  2DR8 A;  1JIH A;  2FHM A;  2K7J A;  1FD8 A;  3PHT A;  1FNM A;  1H7X A;  4J9K A;  4MMO A;  3D0I E;  2HBZ B;  2VG6 A;  3PDN A;  3MMC B;  1VQL S;  4PEO A;  1BWE A;  3P6Y C;  1LQ9 A;  3R5A A;  4DZD A;  3RJM B;  1WF0 A;  2HRT A;  2HHH J;  1CJU A;  4FBT A;  4JI2 F;  3EUN A;  3OSP A;  2HWH A;  1HNV A;  2DHG A;  4P71 A;  4PWU A;  2YNG A;  3LQV A;  1SV5 A;  2R7Q A;  4G1I A;  4DV5 F;  2M9K A;  4FZV A;  1FVS A;  2HUR A;  5DLF A;  1EIY B;  5DDP C;  3RBX A;  5A8K A;  3FCV A;  3LW5 C;  2FJB B;  2V2V A;  1UMJ A;  2GVZ A;  1OIA A;  2I9S A;  4IG3 A;  1UFW A;  3KUG A;  2G1H A;  3PX0 A;  3JQJ A;  1DLO B;  2WRM A;  4OX6 A;  1NEE A;  5L39 A;  3R7B B;  4WFZ A;  1TK5 A;  1QAI A;  4KGM A;  1S4E A;  2XLK A;  5I4M A;  2X7I A;  4OLP A;  1B0T A;  2VG5 B;  2YPZ A;  4YB6 A;  5GAH U;  4RNF A;  4P74 A;  3IWX A;  4J91 A;  1S9G B;  4NLT A;  5KG4 A;  4LFA F;  1C0T A;  1VHI A;  1AW0 A;  1M5K C;  5F8L A;  2K7K A;  4C9D A;  3Q22 A;  3PO5 A;  1G2E A;  1FRJ A;  1VRU B;  1RT7 A;  1AB8 A;  1S1V A;  1LW2 A;  4F0M A;  2IIH A;  2N3O A;  3GFZ A;  2FYX A;  4RW8 B;  2BM0 A;  4U6P A;  2VBX A;  4WYW A;  4X65 J;  4DI6 A;  1HNZ J;  2N4D A;  3CSK A;  1FRL A;  2CNO B;  1TTH B;  4NLY A;  3DM2 A;  3WDO A;  3M8R A;  2H3E B;  4Y6I A;  1XNQ F;  3VCD A;  2JEG A;  4WKY A;  2Y8Y A;  2I38 A;  5LXR A;  3E51 A;  5J1N A;  3UFC X;  1HWK A;  3H2L A;  5K8N A;  4KE5 A;  1VC5 A;  1E6Y A;  2HIY A;  3G8Q A;  4YHH F;  1WG5 A;  3AOC A;  1R0C B;  3BJY A;  2GVZ B;  4C8K A;  4IG3 B;  2DT9 A;  4IOC Q;  3K17 A;  1B64 A;  1BMQ B;  3I9Z A;  4EZ6 A;  2DD8 S;  4IFV B;  4TYB A;  2CVE A;  5KFP A;  3DDI A;  2BJ1 A;  3CD0 A;  1Y7P A;  5CAA A;  4RW7 B;  3FEX B;  1DTQ A;  3KYL A;  2LA4 A;  4P75 A;  4EO6 A;  2HHT A;  1X5O A;  1D1U A;  1M5S A;  2NRE A;  4JI4 J;  1HNX J;  4ZJL A;  1YJT A;  4KY3 A;  3N79 A;  4WE1 B;  1FRI A;  3Q83 A;  4NYO A;  1WWH A;  4BBY A;  3Q89 A;  2NPI A;  3CO9 A;  4UF4 A;  4OV6 A;  2BUN A;  3BPD A;  1RT7 B;  4PYD A;  1LW2 B;  4DV1 J;  2RS2 A;  2KZM A;  2DRD A;  3J7Z T;  1IBL J;  3G87 A;  5FJ4 A;  1MWQ A;  1RAH B;  2BAC A;  4TU8 A;  2A18 A;  3US5 A;  3I82 A;  2EK1 A;  1X8D A;  3FSY A;  1TP7 A;  1HA1 A;  2OML A;  2DIU A;  2BV3 A;  4PWD B;  1GFW B;  1NJI T;  3I5B A;  4QIF A;  4J9Q A;  3RB6 A;  3O3L A;  1E6Y B;  3D3C J;  2NUU G;  4JI6 F;  3UCG A;  2DNK A;  2W2M P;  3HM9 A;  4KH0 B;  1QUP A;  4PRF A;  1N36 J;  2O66 A;  2DPJ A;  3H7H B;  1NK6 A;  4JI3 F;  2V5H G;  2UP1 A;  3CIM A;  4B3M J;  3DRX A;  3DHX A;  1EET A;  1PSD A;  1KKH A;  5FLX Y;  4CO4 A;  3G8T A;  1DTQ B;  3DLE B;  4LF7 J;  3FRZ A;  5I3U A;  4IRK A;  4ZJO A;  4OHX A;  4S0M A;  2VHG A;  4CNY A;  1HR0 F;  3DI6 B;  1RU2 A;  2AJ4 A;  1DAX A;  2GQQ A;  2YQ1 A;  1GTE A;  2UU9 J;  3UCZ P;  1YJV A;  2ILZ A;  2HBY B;  3M8Y A;  2WVE A;  2ZC3 A;  3NOC A;  4F50 A;  1KOH A;  2GCF A;  4E8U A;  4JI7 J;  1VJW A;  5KFS A;  3GYX B;  4LF5 J;  2DHA A;  1Q8K A;  3WC0 A;  3S01 A;  4OZL A;  7FDR A;  2V8H A;  5M2U A;  2HLT A;  4CIO A;  2G0I A;  2YQ3 A;  2KXN B;  2BJ7 A;  2Z2Y B;  2MY8 A;  1N34 J;  3UCU P;  5MAO A;  3TVY A;  4DR2 F;  1CLF A;  4WFY A;  2C42 A;  1HQE A;  4P7T A;  4CO5 A;  5KFD A;  1IXK A;  3FCH A;  4O44 A;  1K1Q A;  1N0V C;  4LF9 J;  4JV5 J;  2WB1 D;  4YDX A;  4ZVF A;  2HWI A;  2HW3 A;  1UWB A;  4U67 Q;  3AB4 B;  2FLO A;  1N33 J;  4NLP A;  3I87 A;  3F0N A;  4JV0 A;  2XCA A;  4F3Q A;  2GJI A;  1XK8 A;  3ADA C;  1EET B;  4LRD A;  1NK9 A;  1MRO A;  2FLN A;  1VR6 A;  1KVJ A;  5I3U B;  3R97 A;  3DN9 A;  1PIE A;  4DV3 F;  4URS A;  1YIT S;  2VA2 A;  2OSQ A;  4NI2 A;  2GJ2 A;  1CVJ A;  1HMV B;  3HHK A;  5JVG Q;  4B9V A;  4NLR A;  1UA0 A;  2ERR A;  5L9X A;  2J0S D;  1F2H A;  3QJP A;  3BDE A;  3HXM A;  2YX7 A;  3EPI A;  1SJ4 P;  3C6T B;  3HHD A;  5KFY A;  2XNR A;  3ZZT A;  4QIG A;  3H25 A;  2VOD A;  5HI7 A;  1JXV A;  5ETK A;  2YWW A;  2F9D A;  2LQB A;  2M70 A;  1UWA A;  4A8M P;  2WSC C;  3AA8 A;  1M1K T;  2OH2 A;  4LF1 A;  2NQP A;  1HFE L;  3G6X A;  4WF9 Q;  4ZP8 A;  3W9J A;  1B0P A;  1RK8 A;  3E8O A;  5IV3 A;  3KNA A;  4WTY A;  2FJX A;  1CJV A;  3HFV A;  2DO4 A;  1Y5L B;  2DGU A;  2H48 B;  4U95 A;  4Y2I A;  4PG5 A;  1NB2 A;  1WNE A;  3CCS S;  1UWB B;  4F4K A;  2AEJ A;  5F8M A;  1JLG A;  5F8N A;  1SKS A;  3BGU A;  2CNL B;  5EWE A;  3IWN C;  2UVU A;  2GAG C;  4MTP A;  3MR6 A;  2VQE F;  1Q82 T;  1ZA2 B;  2WSF C;  2GFF A;  3CCZ A;  3R1H A;  1DZ5 A;  3WIV A;  2KHC A;  3U27 A;  1S6Q B;  2CJX B;  1LKZ A;  4KR0 B;  4N56 A;  1RT5 A;  1UJ6 A;  4DV5 J;  4NI2 B;  2FVC A;  1VFJ A;  2DR5 A;  1CG2 A;  2BXJ A;  3H59 A;  3R2D J;  2LEC A;  1FRH A;  1LK7 A;  2EKY A;  1ZM3 A;  3A13 A;  4KQZ A;  4OV1 A;  1QTN B;  1HNW F;  4I64 A;  5KT5 A;  1TL1 A;  3PEH A;  1PJ7 A;  4UZB A;  1HBU A;  4WKR A;  2RJZ A;  2AW0 A;  1T9T A;  2ZHA A;  3KK3 A;  4E0D A;  4CM2 A;  2OKQ A;  4ZVH A;  3OL6 A;  2DGQ A;  2AX0 A;  1SH0 A;  2C2M B;  1ZAW A;  1SC4 B;  2DHH A;  2ASY A;  4K4S A;  4L74 A;  3OFH A;  1CJV B;  3NGU A;  5HLF A;  1S6P B;  3J81 U;  5KOX A;  2CVI A;  4M1K A;  3ZXW A;  2LXF A;  1UKU A;  3MTK A;  4X66 F;  3EGZ A;  1LXN A;  3PIO Q;  2XSF A;  3RRH A;  3FUY A;  3K5O A;  1FJC A;  1I94 F;  4BWM A;  4X62 F;  2YKA A;  1BC6 A;  4I68 A;  3LWM A;  3PZP A;  3QT5 A;  4U9R A;  2CNK B;  3IC1 A;  4ZJQ A;  4KH1 B;  2JNJ A;  4AT1 B;  4OI6 A;  1GMW A;  3EZ5 A;  3W9I A;  2YWG A;  2KG1 A;  1UCN A;  3CC7 S;  2YNI B;  2I0X A;  1SL2 A;  4GO7 X;  2RRB A;  3QGH A;  1RT5 B;  4AQY J;  1OSD A;  1G3O A;  1JKH B;  3U1M A;  3PAC A;  1UFL A;  2Y0B B;  4DL7 A;  3OHA A;  5B0D A;  4B3R J;  5K14 A;  2W25 A;  1UL3 A;  4MFB A;  3OXG A;  1RYR A;  3FJ2 A;  3ZZZ A;  2J0X A;  3DOL A;  3PYG A;  1MG7 A;  2Z57 B;  3SFU A;  1M5V C;  1IN0 A;  1I1G A;  2R2S A;  3HKW A;  4YFU A;  2XQC A;  2DGT A;  3CJ5 A;  1H74 A;  2KI2 A;  1RTJ A;  1SJ3 P;  1TL1 B;  4HYK A;  3GPA A;  4RW6 B;  3ETM A;  4O3S A;  4DUY F;  1H6K X;  3T1H F;  2NXJ A;  2RNE A;  1GT8 A;  3EVO A;  3ITH A;  2HIQ A;  4WTO B;  3PR4 A;  4N7T A;  1SL0 A;  2MMY A;  3D6F B;  1BQM B;  2XY7 A;  5HN0 A;  1IWA A;  4QBU A;  4NEY A;  5LJ5 Y;  4F36 A;  1U1M A;  2HVD A;  2QL5 B;  4MKV A;  3PO4 A;  3HLU A;  4G1Q A;  4V1A k;  2J7W A;  3TRG A;  2LQ9 A;  4X4P A;  2RIJ A;  5DLG A;  1U0H A;  4LRC A;  2NYI A;  3PHE A;  2CPI A;  4QIV A;  1R8C A;  3ISN D;  2F4V F;  2BVZ A;  3SCI E;  4FS1 A;  2EFQ A;  3B6B A;  2XB2 D;  2WOM A;  3GB0 A;  3Q8R B;  3CCT A;  3FMW A;  2AYM A;  2FB0 A;  5L46 A;  1L3U A;  1D9F A;  5L1L A;  4LF2 A;  1XQI A;  2IM1 A;  3V6J A;  1BGX T;  4DQR A;  2M2B A;  2XC9 A;  1D9A A;  2EC2 A;  5KAK A;  2KXF A;  1VQP S;  3W61 A;  1ZZN A;  4MFB B;  3W2V A;  1GXU A;  1VC6 A;  4FF2 A;  2JZ5 A;  3M30 B;  3C2P A;  2Z56 B;  8ATC B;  3DDN A;  3M1V B;  4UUX A;  3TZW A;  3CJ0 A;  5LXY A;  1GK8 A;  2OMO A;  4CYU A;  2QSW A;  2IJN A;  4TQS A;  4WFN Q;  1VGY A;  1WI6 A;  5C25 B;  1SPB P;  1V9O A;  2DTJ A;  3QWP A;  3M4X A;  1R7I A;  2LP4 A;  2WBM A;  3ITH B;  1PG5 B;  5LJ3 Y;  1HQU A;  2OPR A;  2DNZ A;  5LSL A;  3NMA A;  4NCG B;  4C8M A;  4QYR A;  3V4I B;  3VZH A;  2V8V A;  1U49 A;  4B3S J;  2ROG A;  1F6T A;  5CYM A;  3IBW A;  3KLE A;  5ETN A;  5IOL A;  3LGM A;  3RAQ A;  2GS8 A;  3J81 j;  4DEZ A;  3HK2 A;  1IKW A;  1OYE A;  4K2X A;  3RB0 A;  2CJ9 A;  2CWK A;  1IVZ A;  1KFS A;  4WWS A;  1X9S A;  2V2Q A;  1TEL A;  3KG0 A;  3FBB A;  2P9C A;  5AXN A;  1W26 A;  2ATC B;  1XR5 A;  1EJ7 L;  4P7V A;  3QRQ A;  4USV A;  1RT6 A;  4ZOS A;  1PGZ A;  3V4M A;  1RA7 A;  4W98 A;  2YKO A;  2FHJ D;  4ZP7 A;  1LFW A;  2V0N A;  1UET A;  4KT0 C;  1FJG F;  2IA6 A;  3W2V B;  2YY3 A;  1BQN A;  2J8A A;  1TUW A;  1Y10 A;  4M5M A;  1SB6 A;  4HH0 A;  3KK2 B;  5HK4 A;  3GJR B;  4EU0 A;  4F7V A;  3DRS A;  1NHV A;  1GQE A;  5D0E A;  2V67 A;  4F4A A;  3PYD A;  1FXD A;  4OZ2 A;  3VQS A;  2YKN A;  1MWY A;  1K73 T;  2DRA A;  1EHW A;  1WC5 A;  1ZM9 A;  4FF1 A;  2UV8 A;  1WOS A;  2PDA A;  3GG0 A;  3NNC A;  3GIL A;  3NWR A;  3DLG A;  1NK8 A;  3OTO F;  4IOA Q;  2BJ8 A;  1T03 A;  2BJE A;  4LR7 A;  2XZT B;  2CDQ A;  2OPR B;  1B7Y B;  1SJR A;  2QLW A;  2C2K B;  3TAN A;  1T3O A;  4DLG A;  2DEI A;  1N5V A;  5B0B A;  3BYP A;  2VD3 A;  4DSK A;  1X0F A;  2CKW A;  3RRG A;  1A7G E;  3QJL A;  3ENQ A;  5BYQ A;  4B02 A;  2FPH X;  4I7F A;  2JC0 A;  3GMG A;  3OL7 A;  5A2Q U;  5E2Q A;  3L7U A;  1RHK B;  3VVU A;  1TL4 A;  4KKO A;  1T9W A;  1YJ7 A;  3PKY A;  2ABY A;  3FBF A;  4ID8 A;  2DEJ A;  4DV2 J;  3SSQ A;  4X64 J;  1ZAX A;  2ZNY A;  2UXB F;  2JVR A;  4UOH A;  1RA6 A;  4ZHR B;  5L1I A;  3DRR B;  2FIU A;  1S10 A;  1FEH A;  2BEF A;  1WD6 A;  3ILL A;  2ZH8 A;  1Y3J A;  2CQ1 A;  3I4P A;  1GEH A;  4KGK A;  5A8R A;  1KTQ A;  5DDO C;  2RQ4 A;  2H65 B;  2LA6 A;  5KG5 A;  4P6Q A;  1EQ0 A;  3J7Y I;  3BB5 A;  2VKZ G;  2MZQ A;  1IKX A;  4DS5 A;  2MJU A;  1AFI A;  5LMN J;  4UTG A;  4WXO A;  2HK2 A;  4FS2 A;  3OTC A;  1GX5 A;  3DLG B;  4WK3 A;  5ETQ A;  3D3B J;  1VQ6 S;  3DCA A;  2YH0 A;  1IBM J;  4ECZ A;  2VQF F;  3VGS A;  4F8R A;  1KS2 A;  3DRP B;  4O3N A;  4OFZ A;  4K0K F;  4EI2 A;  1C1C B;  3MPY A;  2CPD A;  5CD4 H;  1DTT B;  2DNO A;  3H4D A;  3DU6 A;  2HHQ A;  4B9N A;  1R0A B;  3W8G A;  2W9C B;  5LMU J;  5B0A A;  2A6M A;  5ETP A;  4OZJ A;  1X9W A;  4OX8 A;  8AT1 B;  2CQH A;  3WX8 A;  3CJ8 A;  4WJB A;  5HMY A;  2APO A;  1T0T V;  2B9Y A;  3EXC X;  5HAT A;  3FEY B;  4CM0 A;  2V8P A;  4KKO B;  1PO6 A;  2BAN A;  3FSX A;  1WG4 A;  3TAP A;  1MLA A;  2HQF A;  4O3O A;  2DIV A;  1RIS A;  1UPM B;  2RUG A;  2J0W A;  3SSS A;  1HL6 A;  2CJB A;  2HFV A;  4NA3 A;  3C46 A;  2V2K A;  3VVT A;  1QLN A;  4R0J A;  1UJ5 A;  1X4G A;  4C2M A;  3K7R A;  4I69 A;  2M0G B;  2HND A;  2QLB B;  2QLJ B;  4X66 J;  2HNY B;  3FFI A;  2CG8 A;  1WC6 A;  5A8R B;  2MY7 A;  4EBE A;  4RU2 A;  2OJ3 A;  3HFZ B;  4Q0B B;  1PYS B;  4TY9 A;  1XMQ F;  5FII A;  1RTI A;  1C1B B;  2XLJ A;  4ID5 A;  2CA9 A;  1P6T A;  1KNZ A;  2LYV A;  4LR9 A;  1KHV A;  3MUT P;  1NK5 A;  3MMA A;  2RQM A;  4HI2 A;  1WEL A;  3TZX A;  1CC7 A;  3HD2 A;  5C7P A;  1RAC B;  2V69 A;  2AGQ A;  2VOP A;  2C1E B;  1K47 A;  3F73 A;  4J5O A;  1UW9 A;  3JYT B;  5HRO A;  1QUV A;  1WHV A;  2UUT A;  2KO1 A;  2I8E A;  3BBF A;  2BAN B;  3MCN A;  5KG6 A;  2KT2 A;  1NK0 A;  5B7W A;  2KYX A;  1HI1 A;  2UXC J;  5HVF A;  2JLG A;  2HGL A;  3FDS A;  2P8I A;  2EKN A;  2V9W A;  4K4V A;  3AJD A;  4ZCM A;  2QA1 A;  4QYZ J;  3Q8Y A;  4EBC A;  2D3O R;  4HR2 A;  3MZI A;  5D6G A;  3U1N A;  1VQY A;  4NLS A;  1NKB A;  2ZBQ A;  2CQ2 A;  1WKJ A;  3FFI B;  4Q44 A;  4ZPV R;  4F26 A;  4DXL A;  1IR1 A;  3O8W A;  2VG7 A;  1X4B A;  4M5K A;  5KFI A;  2VDI A;  2IDL A;  4B08 A;  4GKJ J;  3W2W B;  3G71 S;  1RAI B;  3HF5 A;  3V81 A;  3D54 A;  4TVA B;  2JFD A;  2ZFH A;  2HAF A;  4ECR A;  3LPE A;  1J5O A;  4DR7 J;  3F41 A;  3MMA B;  1TKZ A;  1PC5 A;  4JI5 F;  3J7A N;  5JUM A;  1O6X A;  2CAD A;  4ZP6 A;  4C3M A;  1TQL A;  2V2Z A;  1DJ0 A;  2DK2 A;  2W9B A;  3L95 X;  3CD5 A;  3VAK A;  5JVH Q;  1Q53 A;  1T9X A;  4ZIW A;  1BWV A;  4ZVP B;  3D1Q A;  5RUB A;  2E66 A;  4EO8 A;  1YI2 S;  3JSR A;  1XN9 A;  5IM0 A;  2ZM6 F;  1N5Q A;  2OEL A;  3KFW X;  3OVS A;  1BHN A;  5AJ3 J;  3ET6 A;  5C2G A;  4PAB A;  1T05 A;  1IKY A;  3BKU A;  2W4D A;  1UVM A;  5DDQ C;  1JXE A;  3CD7 A;  2CPH A;  5AXM A;  3T1Y F;  3A8I A;  3OBI A;  4UOG A;  1S72 S;  3MM7 B;  2QJ3 A;  1P8G A;  4FKY A;  5ETV A;  3QO9 B;  2ZH2 A;  2CQD A;  1VI7 A;  3VQT A;  2FD2 A;  1N6Q B;  3BSC A;  7FD1 A;  2XMK A;  5H9F J;  2JEJ A;  3MUM P;  2VG7 B;  6AT1 B;  2AKW B;  1Q7Y T;  2O5D A;  1MN9 A;  3ILO A;  3ZC4 A;  1J5O B;  1XJW B;  3WBZ A;  4NRT A;  3H42 A;  1U7L A;  2FTR A;  1TKZ B;  4PUO A;  3O44 A;  1SQE A;  2E9T A;  2N82 B;  2LEB A;  1RYS A;  1GAO A;  3BYR A;  2E1A A;  3AOA A;  5EX3 A;  1UVL A;  1N54 B;  3ENV A;  3L7O A;  2RQC A;  1HPZ A;  1Y5I B;  1RJJ A;  2J7U A;  3MFI A;  1AT1 B;  2H5J B;  4DCO B;  3IAS 9;  3OXL A;  3NG8 A;  2GV1 A;  1WF2 A;  1P1L A;  1GX6 A;  3LAM A;  2CDR B;  3L09 A;  2IYG A;  2Y1J A;  3MPV A;  2D3O 1;  3RGI A;  1T05 B;  5K20 B;  4NXN J;  3FSI A;  1D9D A;  3AJ2 A;  2E44 A;  4XDC A;  5HVH A;  4IQX A;  2XY6 A;  5F8G A;  3K8W A;  3NP5 A;  4RLE A;  2HAI A;  2HVZ A;  3PCO B;  4PZV A;  4ENO A;  3AB2 B;  2M8H A;  4EFA C;  2E9Z A;  4QZV B;  2XZD B;  4C3L A;  4ELV A;  3KNG A;  2LLZ A;  3HFK A;  1F60 B;  3TAM A;  4J9U E;  2CAJ A;  3BSN A;  5KFH A;  4BWJ A;  3N6N A;  1TL7 B;  2J9E A;  1DY3 A;  5ITH A;  6FDR A;  2UXB J;  4RZR A;  3ZZR A;  6FD1 A;  1QE1 A;  3KUE A;  2OD6 A;  1U8W A;  2V4J A;  1N32 F;  1LW0 A;  4GVB B;  1ELO A;  3RG6 A;  4KGZ B;  2KJW A;  5G0R A;  1ROF A;  4KRW A;  1U2C A;  2QN6 B;  1YKW A;  1U2F A;  4U8Y A;  4OYM A;  2JSX A;  1HI8 A;  3FVY A;  3CCQ S;  5EN1 A;  2BJ9 A;  3IM9 A;  4LF8 J;  1NB7 A;  4CH7 A;  2HVE A;  2RDI A;  3V2U C;  2W2Q P;  2XYH B;  3G9C A;  3CJR A;  3MWB A;  1OPI A;  4DR4 F;  2MZR A;  2EEY A;  1VS3 A;  4K4U A;  1K0V A;  2FVP A;  1HNI A;  1NHU A;  1S1X A;  4AL6 A;  3IBF B;  5F0W A;  5KFR A;  5JJB A;  4ZCL A;  2VQF J;  4MIB A;  2X1A A;  3HD1 A;  1X4E A;  5T7L A;  2E5G A;  4Y2A A;  2QLX A;  3SCJ E;  2UUC F;  4DR3 F;  4N77 A;  1KFD A;  3X1L B;  1KN6 A;  2QL7 B;  4KGV B;  2W4P A;  3HUL A;  4TYA A;  1CJT B;  3FZ2 A;  1SH2 A;  3KXD A;  5HJX A;  1VK8 A;  1U6F A;  4ECY A;  3TAQ A;  4Y65 A;  4PG6 A;  2ZIT A;  4LSZ B;  2VIC A;  3P8B B;  2HMI B;  4DOZ A;  2XBP A;  1RE1 B;  3VAM A;  1LNQ A;  1VRT A;  3A3P B;  1FRX A;  3JQM A;  3M8Z A;  3NGD A;  1U45 A;  2FLP A;  3BO2 A;  1KLM A;  5EHH A;  4IDK A;  4P2F A;  3W62 A;  2MKC A;  4A8O A;  1VOM A;  2B8Q A;  3PFO A;  4I2P B;  1OY8 A;  5KFO A;  1N88 A;  2DIS A;  1WHW A;  3RBD A;  5K8O A;  3HI9 A;  1R43 A;  3ZZU A;  4B3O B;  1RTH A;  1HD0 A;  3H5S A;  4LF6 F;  3SBM A;  3I4H X;  1X31 C;  2V50 A;  3HP6 A;  3NGR A;  5KFV A;  4ED7 A;  3B4D A;  3HSD A;  1MMN A;  4FKX A;  3RYL A;  2MKS A;  1HNI B;  4DDF A;  1S1X B;  4ED2 A;  4ELU A;  5I3Q A;  2IVM A;  4YN3 B;  3J81 Y;  1UEU A;  5T7L B;  2UUA F;  2HLU A;  1FVQ A;  1HWI A;  4ICL B;  2HZV A;  1W2B R;  3UQS A;  3GON A;  4CQ1 A;  4PQA A;  3G82 A;  3MFH A;  1XNR F;  3G96 A;  3K8V A;  5F3Z A;  1S57 A;  1RI7 A;  1BD6 A;  3M6X A;  1DQ8 A;  1IM4 A;  4QR1 A;  2OP5 A;  2ADC A;  1FFG B;  3BKF A;  1HBO B;  1AXQ A;  3AD7 C;  5FDL A;  3JTP A;  4K2J A;  2U1A A;  1V5V A;  3F56 A;  1JLC A;  2KRR A;  4F0K A;  1FD2 A;  1S1W A;  3A3O B;  1VRT B;  4IG0 A;  5J1E B;  2H5E A;  2WSE C;  4YP3 A;  2QLF B;  3ILI A;  4L3N A;  1YLX A;  3OL8 A;  4LSN A;  3UDE A;  2XYG B;  4J9N A;  2KN4 A;  1IBC B;  5HBM A;  3BDP A;  2DJW A;  3GR1 A;  2F8E X;  1TKT A;  3CJ2 A;  2FJE B;  2BZ2 A;  3CJ4 A;  2FLL A;  2DYA A;  5C42 A;  4EYI B;  1PAE X;  3H90 A;  1J5E J;  3MCS A;  4AXJ A;  5HVG A;  1RTH B;  2DNR A;  2R7W A;  1SKR A;  1A0O B;  3G4S S;  1EZZ B;  3GJT B;  4DR5 F;  3EDQ B;  1S5Z A;  4DX8 H;  3EWG A;  2RRN A;  3T9Z A;  1FEE A;  2DGX A;  2ZBC A;  2XMJ A;  4Q8F A;  5E41 A;  3KLH B;  1JLA A;  4H4M B;  4OX7 A;  2CJA A;  3UNG C;  2UV8 G;  4FPR A;  3MDF A;  4KIA A;  3MOJ B;  3I0R A;  4USK A;  3G86 A;  1PC4 A;  5CQG A;  3C6U A;  2RUS A;  2IBO A;  4HDH A;  3G82 B;  1LXJ A;  2KDO A;  4KB7 A;  1RAA B;  2R9L A;  5J2Q B;  3UNY A;  1WC1 A;  2MQM A;  5DJB A;  4TU9 A;  3DXS X;  2XMT A;  2J9D A;  2L48 A;  3AJ1 A;  2YTC A;  4GKK F;  4Q7A A;  2ZOF A;  2JEF A;  1TVR B;  2FC9 A;  4RPF A;  4IRD A;  1S1W B;  4W90 B;  3WX4 A;  4KV8 A;  4J7C A;  3QMQ A;  3N6L A;  1RHM B;  2VBY A;  1KQF B;  3UW1 A;  3JB9 k;  2HZA A;  2YQ0 A;  3CDE A;  5L9N A;  3OL9 A;  3K2Y A;  3QGP A;  3GYG A;  5CHC B;  4XIU A;  4CTA A;  3OTB A;  5HBM B;  2CQ4 A;  1R27 B;  3BGF A;  1FKO A;  3VAL A;  1PBU A;  1NDK A;  1FF2 A;  1OPZ A;  1M1G A;  2GX8 A;  1KSP A;  2EW9 A;  1WF1 A;  2IBK A;  1TL5 A;  3NBP B;  2D3Z A;  2GQ2 A;  3PW4 A;  4KPC A;  5DM6 Q;  1RAD B;  4F4Z A;  3MUV P;  2CQG A;  2GO9 A;  3ZZO A;  1SIZ A;  3T41 A;  2F1F A;  1K1S A;  2B7B B;  4DX7 A;  4UY8 T;  1VQK S;  3NS6 A;  1VBK A;  3S6E A;  4AL5 A;  2CNN B;  4LFC J;  5B0G A;  2F8H A;  3CW2 C;  1H3D A;  2VC1 A;  2MKI A;  3AT1 B;  1KR4 A;  4GVL A;  3I0R B;  2GJF A;  1O51 A;  1NKC A;  2QMU B;  4OI3 A;  4ZPT R;  4ZPA A;  1RBA A;  5EUH A;  2Z30 B;  1ULR A;  1Y0H A;  3S8S A;  3KHR A;  3IGN A;  4LVO P;  1ZH5 A;  2G13 A;  1F2G A;  3M05 A;  4RWX A;  3KMQ A;  3GE9 A;  2RQK A;  4QWE A;  3G8S A;  2XZW A;  2HGN A;  4LIR A;  2DHX A;  5HAN A;  1UAW A;  4CCH A;  1WEY A;  1KTV A;  2HHH F;  2PE8 A;  4PYA A;  5D4N A;  1U1P A;  3GTY X;  2ZH5 A;  2D9P A;  3MMB A;  4H4O A;  2MZT A;  5A0Y A;  1S79 A;  3ZTO A;  5I42 A;  2VFV A;  1IWG A;  2FY8 A;  2JVO A;  4TY8 B;  4N5S A;  1KBR A;  2VFT A;  2JL9 A;  3C66 A;  4CT9 A;  5U47 A;  4QW9 A;  3CCE S;  4DSJ A;  3H5Y A;  2X3G A;  1LWF A;  4HAC A;  3RAM A;  3DNC A;  3FGV A;  4KC5 A;  1EX8 A;  3CD6 S;  4ECT A;  3NGK A;  4DFP A;  3HMJ G;  1N5Y A;  2BE2 A;  4OIX A;  4RNH A;  2W1B A;  1SJF A;  2D1C A;  2AU0 A;  2WON A;  1E6V B;  2J6S A;  4DU7 A;  2L9D A;  5FD1 A;  1X60 A;  2HFZ A;  4QJV A;  4OYI A;  3ISN C;  1RUS A;  5E3A A;  2ILY A;  3ZFV A;  5KFL A;  5D4O A;  2R8G A;  1S6U A;  1SJQ A;  2P5V A;  4RR5 A;  4AND A;  2L9W A;  3BO3 A;  4OYO A;  5GAG I;  2ZWP A;  1VC0 A;  4HHH A;  4DU8 A;  2YNH A;  4C8N A;  1X5T A;  2HFS A;  3NCQ A;  1C2P A;  4OZ3 A;  1J27 A;  4DPX A;  3NEK A;  5KFE A;  1JMT A;  3IG1 A;  3D1H A;  2E5J A;  2OEJ A;  5D4P A;  2LCW A;  1N52 B;  4LSL A;  3W9H A;  2BM1 A;  1TK0 A;  4IR1 A;  4OYX A;  2HHW A;  4LFB J;  4X65 F;  3CCL S;  5GAE I;  2W9A A;  4BHQ A;  2XCP A;  4WFX A;  5A0Y B;  2AHO B;  4KHP J;  1QJH A;  4K4Y A;  2XO6 A;  5KFB A;  3BN4 A;  3EX7 B;  1LWF B;  4HAC B;  3T19 A;  3VZI A;  3VAF A;  1NSA A;  1U24 A;  2Q43 A;  4YR2 A;  4EBD A;  3BBC A;  1N5Y B;  1FKP A;  1SC1 B;  4YY3 J;  2W7P A;  3R5D A;  2IFX A;  4ES2 A;  2WON B;  4CO0 A;  3H20 A;  3H8Y A;  2LU1 A;  3GJQ B;  3PY8 A;  4IUF A;  2L9N A;  1G7C B;  2R4F A;  5THW A;  1MU2 B;  2QEX S;  3RRK A;  3B54 A;  3TEH B;  1RWK B;  3QYY A;  2AMC B;  2GHW A;  4FVC A;  3FK4 A;  1U1O A;  1NJW A;  2C2Z B;  2YNH B;  4DSL A;  4JI4 F;  3EIC A;  4RL1 A;  5J2N A;  2ZBR A;  1UVJ A;  3J7Y U;  2AJF E;  1ACM B;  2AJ2 A;  1B70 B;  2K8G A;  3N6M A;  2VPY B;  1U1Q A;  2VPZ B;  1OS5 A;  1SC3 B;  1D8Y A;  3KHG A;  2LDY A;  5ETS A;  4FN5 A;  2NYH A;  3DLB A;  4DV1 F;  5A8W A;  1M90 T;  3SCL E;  4DR1 J;  4GC6 A;  4CH0 S;  1IBL F;  2QRR A;  3D0H E;  4M5H A;  4Q45 A;  2ZH9 A;  1WC3 A;  4C11 B;  1PCA A;  1VLY A;  1T95 A;  2XMA A;  4DG1 A;  2NR0 A;  5KT4 A;  4FP9 A;  3JSY A;  4K4Z A;  2W2N P;  3EXY A;  2YKM A;  3FNN A;  4B9U A;  1V5I B;  2D3U A;  2ZH4 A;  2QA4 S;  1Q5V A;  3OFF A;  1FA0 A;  1EP4 B;  3QPI A;  5BYS A;  4PG4 A;  3G2X A;  3POT A;  3IGV A;  2LQ5 A;  2P9E A;  1N36 F;  1FKA F;  1NSQ A;  5KFK A;  2DNY A;  3J80 Y;  3Q24 A;  3CVK A;  4F2R A;  1NPP A;  2IRX A;  3TI0 A;  4A8Q A;  2C3U A;  2OI2 A;  3RR7 A;  2ASD A;  5HQL A;  2B8P A;  1LK5 A;  4LF7 F;  2MQO A;  3P5B P;  5DQI A;  2W2O P;  1U48 A;  2B56 A;  4FXD A;  1WHX A;  3LF0 A;  5GME A;  2GGP A;  3A8K A;  1ZAV A;  3T5K A;  4Y2C A;  3R5J B;  5EGY A;  3VAH A;  3THV A;  3GP9 A;  4A8K A;  2UU9 F;  1TKX A;  3KLV A;  2QC3 A;  1VQ4 S;  1XEZ A;  5LSR A;  2KU7 A;  2QGF B;  3I56 S;  1NME B;  1H2T Z;  2KYZ A;  1C4A A;  3BR9 A;  1Q78 A;  3UD3 P;  1SUQ A;  5A8W B;  3MD1 A;  4CP5 A;  2E5I A;  1RU1 A;  4LF5 F;  3OVA A;  3JAM U;  5D78 A;  5D3G A;  1LWC A;  2FVS A;  2HS0 A;  3Q8Q B;  5IT9 Y;  3TP2 A;  4RW4 A;  1AZS B;  4RW9 B;  3PRV A;  2D41 A;  1N34 F;  4CLW A;  4QQB A;  4N47 A;  2ACY A;  1J2V A;  2YKM B;  4F67 A;  3FC9 A;  4HHJ A;  3W7B A;  3H4B A;  2Q66 A;  3MEE A;  2YNF B;  4DCJ B;  4LF9 F;  4JV5 F;  3POT B;  2PA3 A;  4ZVS B;  1N33 F;  3KDO A;  3NRB A;  9ATC B;  1JJ2 R;  4PR6 A;  3CCM S;  2IDE A;  3ISZ A;  2PEH A;  3T5J A;  5AT1 B;  2W4C A;  2Z4P A;  4DBQ A;  4FPI A;  4ECX A;  5BJR A;  2R7S A;  2CPF A;  1SXL A;  2RAQ A;  1HHS A;  2GGP B;  1R89 A;  5KFZ A;  2CIM A;  1HD1 A;  1FWK A;  1T9V A;  4EYH B;  1UEK A;  2OPS B;  3DKD A;  4DF8 A;  2HHP A;  4MH8 A;  2D9O A;  1F5C A;  3CJS A;  1SUQ B;  2NSC A;  4TNO A;  1VIX A;  3NXZ A;  1FI4 A;  4RBU A;  4I56 A;  3TJ9 A;  1VYA A;  3HVT A;  2HQD A;  2I2Y A;  4DPY A;  4UT4 A;  1U1K A;  3SCK E;  2VG5 A;  1S9G A;  4DUZ J;  1IJE B;  2GMJ A;  2MZJ A;  2KFY A;  1FWL A;  3QJJ A;  3KLF B;  2YKQ A;  2JDJ A;  1FDD A;  3VAJ A;  1VLO A;  3DYA A;  3MEE B;  5DET A;  2CPX A;  4DN9 A;  1S0O A;  2LXI A;  3BRE A;  1VRU A;  1WTF A;  3BQ1 A;  4KO0 A;  4DX6 A;  4AXI A;  3D5M A;  2EG1 A;  2IVF B;  4NEZ A;  2XSJ A;  4J9S A;  4RW8 A;  3KK1 A;  1NHK L;  4DR6 J;  4BS2 A;  4NCA A;  1B3T A;  4ZVE A;  1APS A;  4M8L A;  2R7X A;  3OLA A;  3M32 B;  3HVW A;  1RWN B;  2GQC A;  1SBR A;  4USW A;  4OI2 A;  4ZVU B;  2N3L A;  2AIR B;  4NA2 A;  3RBZ A;  2BOA A;  1F5B A;  2B4U A;  1GMV A;  4ZPB A;  3ETO A;  2ZD1 A;  2DCU B;  3CDA A;  4DPW A;  3W63 A;  1K44 A;  1RHQ B;  4JYA J;  2QFJ A;  3M8S A;  2G0C A;  2MKJ A;  1N48 A;  2WTF A;  4HT7 A;  4IFV A;  2VOO A;  5IC4 B;  2MQ8 A;  2DPI A;  2JOQ A;  3QLH A;  1X7V A;  3AQP A;  1RKI A;  1JX4 A;  2XO7 A;  4RW7 A;  2MHN A;  3HVT B;  3IXQ A;  5LM7 E;  5D15 A;  3MI7 X;  3VF0 B;  4C4W A;  4C7Q A;  1DRZ A;  4MK9 A;  4IRC A;  2GVD A;  1HWU A;  4QWC A;  2R7T A;  4ES3 A;  3LOU A;  1BUX A;  4U7C A;  4WE1 A;  2VJU A;  3DYA B;  1M5O C;  4C0H A;  1QSL A;  1S48 A;  3W60 A;  2P2C B;  2WCX A;  3DXB A;  4DL6 A;  2DGS A;  3OJU A;  4KO0 B;  3QAT A;  1JJC B;  4TKT A;  1U6Z A;  4C8O A;  2EC0 A;  2RRA A;  4R0E A;  4HH1 A;  2XSJ B;  3MR3 A;  1Q1K A;  3ENW A;  2UUW A;  2XWY A;  2XMM A;  3CIZ A;  4ZVQ B;  4RWW A;  5F8H A;  3KK1 B;  3WC2 A;  3ENA A;  3JTO A;  1HIY A;  4ZLP A;  2XMV A;  4ZVG A;  3J7A 1;  4PWD A;  3R5C A;  3H98 A;  4AQY F;  4LUB A;  4I67 A;  1V3S A;  1Q95 G;  4C0O C;  3SI8 A;  3C16 A;  4B3R F;  4LR8 A;  2FDN A;  3QAE A;  2ZD1 B;  4M94 A;  1S99 A;  5KFT A;  4FDF A;  3MF5 A;  4WP3 A;  1UPP A;  1M0S A;  4GC7 A;  1RAE B;  2XS2 A;  5F8I A;  3QLH B;  3ZZY A;  1PKU A;  2MZ1 A;  3DLE A;  2HHV A;  4DMZ A;  2HS4 A;  5FLX U;  2GVD B;  1Q8B A;  2GMH A;  2VBW A;  3DI6 A;  2PT0 A;  4J9P A;  3C19 A;  3PW7 A;  2MKK A;  2H5I B;  4LBH A;  2A3J A;  3C15 A;  4V19 X;  1CSJ A;  2AD9 A;  3M2V B;  2E5L J;  2PMH A;  2AYE A;  1WKK A;  2PO4 A;  1S1T B;  1NDL A;  1SCJ B;  4NRU A;  2XHW A;  3MGJ A;  4A4J A;  1FE4 A;  2XGP A;  1QTM A;  1CUL B;  1Z2Z A;  1NXI A;  4ZLN A;  4NXM J;  3GFX A;  4B3T J;  3LAN A;  3OT9 A;  3SQO P;  4OYP A;  2VON A;  3C16 B;  4X4S A;  2YPY A;  1TAQ A;  2UZA A;  3AD8 C;  2J0Q D;  4JBC A;  4DS4 A;  3TVK A;  1FHT A;  4PQU A;  3THP A;  3QFW A;  3SDE B;  2NXN A;  1GMU A;  4CDI A;  2R7V A;  3RUB L;  1JB0 C;  3A8J A;  3Q23 A;  5JXS A;  2XS5 A;  3BSO A;  2CYY A;  3CT9 A;  5F3T A;  1OY6 A;  3ZZP A;  4U96 A;  4J9O A;  1EKR A;  1Y5N B;  1WOP A;  4DV4 J;  1CC8 A;  1U8S A;  4NAS A;  4LBI A;  1NDP A;  1HMV A;  3P45 B;  4HTJ A;  3M8P B;  1XC9 A;  5B0C A;  4JUZ A;  1V6H A;  4B3S F;  4J90 A;  3C15 B;  2KM8 B;  2XS7 A;  2IRY A;  1S0M A;  5CXT A;  3C6T A;  4NML A;  3O5T B;  4F3O A;  2WBR A;  4WIQ A;  2Y1R I;  5DGB A;  2IVY A;  1W2I A;  2P6S A;  4M5G A;  4Z7C A;  1LWE B;  1QM9 A;  2O3D A;  2BKN A;  4Z37 A;  3D68 A;  3I0S A;  1IUJ A;  2MYF A;  3VGU A;  2LDI A;  1WOR A;  4ZIV A;  1OQ3 A;  1A9N B;  2E1M C;  1QSY A;  1WSR A;  5L38 A;  3M7V A;  3BBB A;  4L72 B;  1F9F A;  2ZWO A;  1VHF A;  3D66 A;  2DRB A;  1RQ0 A;  4ED0 A;  4NZ0 A;  2Y8W A;  2YVS A;  3R2C J;  3FEZ A;  3VV2 B;  1MN7 A;  2XMW A;  5M2P A;  3KKF A;  4P2S A;  1RWU A;  2F9J A;  2R42 A;  3QID A;  2WVC A;  1EKS A;  4XPE A;  4PQU B;  3EGV A;  4DFK A;  4LJM A;  1S77 D;  3V5R A;  3U02 A;  4M5L A;  2B6A B;  2HBQ B;  2KH9 A;  2BBE A;  2NLW A;  3TQ1 A;  1PIL A;  3MM8 B;  4ANC A;  5CZV A;  4NLQ A;  3NWG A;  4ZVO B;  4YUD A;  1S6Q A;  3TWZ A;  1PBA A;  2E1C A;  4KAI A;  4LQ9 A;  1ZM4 A;  4U8V A;  2JH3 A;  1VJQ A;  3M2R B;  3QGG A;  3HHL D;  3CC2 S;  3VHQ A;  2GC8 A;  1YJR A;  3DGV A;  4ZDN A;  2LXU A;  5SZT A;  1X5S A;  1REV B;  2EK6 A;  4B17 A;  1F9E B;  4YB5 A;  3EDR B;  5KT3 A;  2FGC A;  1JLE B;  1KOO A;  2B4V A;  4QYZ K;  1RLC L;  3I0S B;  1RAO A;  4DV2 F;  2XWX A;  1AUS L;  2HNZ A;  4X64 F;  1WDD A;  2VPW B;  4PXD A;  4KSE B;  4NLW A;  4BC7 A;  1UVI A;  2VFR A;  4YEA A;  4R8U B;  1S6P A;  4JI8 J;  3GJS B;  4OZ0 A;  4OX9 F;  3BH6 B;  2J7K A;  2IM3 A;  2NZC A;  2RDD A;  2CQI A;  3PRB A;  2NXC A;  1QVG R;  3AQO A;  4DZ6 A;  2M3D A;  2KZZ A;  3D4J A;  5LMN F;  2OSR A;  3DDK A;  3CNQ P;  2G2O A;  4Q5V A;  3EZU A;  3GII A;  4EMD A;  2Q3P A;  5K8P A;  2DY1 A;  1NJY A;  2MQL A;  1XBW A;  2WHO A;  3GV7 B;  1IBM F;  2E7X A;  2PI5 A;  2YNI A;  3CGI A;  1NO8 A;  2DIT A;  2WW8 A;  1Y9O A;  3R1L A;  1JKH A;  1HHQ A;  2M5Y A;  2QV6 A;  5E0O A;  2HK3 A;  4FNH A;  3EGN A;  3JSB A;  5LMU F;  4ITS A;  5C24 B;  2DGO A;  3ZZ0 A;  4DL2 A;  3LO3 A;  4HEA 9;  3TJ8 A;  2ZDP A;  2GIR A;  4DV6 J;  4HKQ A;  2R8H A;  4RW6 A;  4L3K A;  1HWL A;  4NCB A;  2HNZ B;  3L7P A;  2G0J A;  4C6A A;  1BQM A;  1PJ5 A;  2RVJ A;  3IN5 A;  4DSF A;  4RUH A;  2J6T A;  5H9F K;  5ETR A;  3GSD A;  2HRY A;  5K5M A;  4B9T A;  1R8H A;  2H4Y B;  3CF5 Q;  2VU5 A;  3N5B A;  4RO0 A;  3A1Y G;  4OI0 A;  2XGQ A;  3PRD A;  4WII A;  3AD9 C;  3UVJ B;  1QAX A;  2B9E A;  3K58 A;  4CT8 A;  2HZC A;  2PII A;  4OJG A;  3KJV B;  5DZ6 A;  3SXL A;  4YR0 A;  4OHW A;  4Z2X A;  2EBE A;  5L1K A;  3ZNJ 1;  2Z2L A;  1T9U A;  2K1R B;  1TR0 A;  3UR3 C;  2PFF B;  4KHM A;  1BXN A;  3M30 A;  3OLB A;  2ZUG A;  3NGS A;  4USU A;  2GW8 A;  3M1V A;  2DH7 A;  2F4F A;  2Q6C A;  4AFF A;  2L3M A;  5HL7 Q;  5GAG U;  1S6O A;  2ADB A;  2DNN A;  1S9F A;  5C25 A;  3K5N A;  2EVZ A;  5KOW A;  4UW2 A;  4DL4 A;  2C2D A;  4M5D B;  2UXC F;  1KQK A;  3EYZ A;  4RNN A;  2AQ4 A;  1TMM A;  1HQ2 A;  1GH8 A;  4A8Y A;  4ZVR B;  1EAR A;  1RXO B;  1VIO A;  4NCG A;  3M8Q A;  3V4I A;  3BPS P;  1T9Y A;  3FCW A;  1TMJ A;  2G9O A;  3N01 A;  2DBB A;  2OLW A;  5GAE U;  4LIW A;  4AL7 A;  4FF4 A;  4L75 A;  3BH7 B;  5C2C A;  1IQZ A;  2VIH A;  3UD4 P;  4GKJ F;  5F0U A;  1GXT A;  4LBP A;  5BR8 J;  4YB1 P;  4I2Q B;  2ZJR Q;  5EX0 A;  1KC8 T;  1VCT A;  1HHT P;  3VWS A;  2OPP A;  2A2C A;  4CLK A;  4DR7 F;  3Q86 A;  3TX0 A;  1Z2L A;  4D3H A;  3QWU A;  3KG1 A;  2QG9 B;  2FZG B;  1KP6 A;  4A46 A;  1S1U A;  1F5A A;  3KHL A;  3CJQ A;  3VAG A;  2SXL A;  3I6P A;  1DBD A;  5DRK A;  3KK2 A;  2HQ3 A;  4L73 A;  1MWZ A;  3UDL A;  2OFH X;  3E2E A;  1RZM A;  3DHW C;  3VTI A;  5CA5 A;  2GIQ A;  3PJW A;  1RHJ B;  3S1T A;  4M5J A;  1Y11 A;  1F0X A;  4PPZ A;  1IBK F;  4PXC A;  3CCR S;  5CYJ A;  4NYP A;  4Y28 C;  5AJ3 F;  1HBN A;  1HBM B;  3GLJ A;  4RBV A;  1X4H A;  3LPY A;  1BLU A;  1NZA A;  5D4L A;  1NZ8 A;  3M8Q B;  3AOD A;  2AP6 A;  2W7O A;  4C97 A;  4WP8 A;  2DO0 A;  5A6P A;  2OEM A;  5J2P B;  4JV2 A;  3MAA A;  4IQM A;  2YBV A;  1Z1Z A;  2FVQ A;  4ZIT A;  4DPO A;  2COL A;  1FER A;  1WUU A;  1SC6 A;  1CQN A;  1U09 A;  2LU2 A;  4M5I A;  2XM3 A;  5IXU A;  2HWT A;  3NGT A;  2HBR B;  2MEW A;  1XMO F;  2G2Y A;  1LFP A;  3D1O A;  1UTA A;  2F7V A;  3KLI B;  1QDU B;  2OPP B;  2YH1 A;  2GZO A;  5E7O B;  4ZHR A;  3GU0 A;  3DRR A;  5IFM A;  1RGV A;  1S1U B;  3UO0 A;  5CD4 A;  3NS5 A;  1OJ4 A;  3T1A A;  4QPX A;  4YS2 A;  3TR5 A;  2ZJP Q;  2XG8 A;  2NXU A;  2EFN A;  2AX1 A;  3RAX A;  1C0U B;  4N76 A;  3QRR A;  4DL3 A;  1FT8 A;  4Y0F A;  2F63 A;  2KVI A;  4LF4 J;  4DV7 J;  4PG8 A;  1RHU B;  1HBN B;  2QL9 B;  4QIE A;  2LVW A;  3AY0 A;  4NXN F;  4CLF A;  2ZE2 A;  5LL6 d;  3T5H A;  2KG0 A;  2RU3 A;  3DRP A;  4XPC A;  1C1C A;  1N5S A;  4RX6 A;  2UXD J;  1DTT A;  3UI3 A;  1R0A A;  1S49 A;  1KD1 T;  2W9C A;  2C2R A;  4MKB A;  3UE2 A;  3MAA B;  2HHU A;  5E3R A;  3MAH A;  4K4X A;  2KVQ E;  4USI A;  4HL9 A;  1D3W A;  3MM9 B;  2POK A;  1RHR B;  3ILJ A;  3M2U A;  2YWH A;  4QU6 A;  1VQS A;  5HAO A;  3G6V A;  3DMJ B;  4D3G A;  3BR8 A;  3KHH A;  1V3Z A;  1QSS A;  4OHY A;  1JLQ A;  4QOT A;  3CCU S;  3QZ7 A;  3Q2S C;  1F3V A;  2QSF A;  1YGY A;  3THT A;  4NWB A;  3NKY A;  1U1L A;  2QYG A;  1RT3 A;  4B9S A;  3TUJ C;  2V4Q A;  3CDU A;  5LSO A;  1IJF B;  1Q8I A;  4QWB A;  3LTO A;  4OX9 J;  5DS7 A;  3MUR P;  1FXR A;  2HNY A;  3H2V E;  2HFU A;  2MXY A;  1NCL A;  2UVV A;  3I31 A;  5H9E J;  4X4Q A;  2MDA A;  4LF8 F;  2J6U A;  3U7J A;  3PEJ A;  3N0V A;  4IO9 Q;  3MTJ A;  4Q0B A;  3AHP A;  1JJH A;  3QBC A;  5GMK a;  4O3Q A;  2R7R A;  1C1B A;  3TAR A;  2XTJ P;  3HPO A;  1Y00 A;  1O5J A;  2ROP A;  2ZE2 B;  1GNK A;  2AZ1 A;  5DZ7 A;  4A8F A;  2DCL A;  3U1L A;  2ZC4 A;  1URN A;  2Z0G A;  2XI2 A;  1R3N A;  3ZTS A;  3FQL A;  4W4M A;  2VG6 B;  2IPO B;  3JYT A;  3DFE A;  4LRF A;  3K57 A;  2C3P A;  3T9N A;  4K50 A;  4BCA A;  3M2U B;  1CJU B;  3MCM A;  3W5X A;  4FYX B;  1HNV B;  4JI0 J;  2DNP A;  2HGM A;  2OFG X;  2V9K A;  3B4M A;  3TX8 A;  5H1S V;  3RW6 A;  2YNG B;  1JLQ B;  1SV5 B;  1JLF A;  1RLD A;  1RT3 B;  1MML A;  2FJD B;  2AJQ A;  1CPZ A;  3C14 A;  3MCO A;  5KFQ A;  5KT7 A;  4DFM A;  1R8A A;  3MOZ A;  5A8K B;  3IA0 A;  1WC0 A;  4K8R A;  4LRE A;  4F02 A;  5KT2 A;  1UEV A;  4JB8 B;  1QVF R;  4ZCK A;  2UUB J;  3TYT A;  2HEK A;  2PSZ A;  3W1Y C;  2M88 A;  2U2F A;  1T8E A;  5E33 A;  3W2W A;  2QO3 A;  1XTZ A;  5DGA A;  2AV5 A;  3W3S A;  3PNI A;  4DV0 J;  5L8R C;  4GMK A;  3OV7 A;  1FTR A;  5ETM A;  3BGR A;  1C0T B;  4J9M A;  3QSI A;  4FF3 A;  3KMS A;  2CUY A;  1YRU A;  5E3Q A;  5CZX A;  4KPY A;  4Y2M A;  3HSJ A;  4WBF A;  3NCP A;  3P3D A;  2DH8 A;  1FDB A;  2B9W A;  3E01 A;  4C98 A;  5AE2 A;  1HW9 A;  2GIF A;  3HDS A;  1S1V B;  2MB0 B;  4UY8 5;  1KHW A;  3I5C A;  4OHV A;  1ZPV A;  2Z58 B;  5LT5 A;  1ZZF A;  3WIU A;  5E5N A;  3DM2 B;  2D69 A;  2ATL A;  2ZH1 A;  3CB4 A;  1TL3 A;  3PG9 A;  3QZ8 A;  1SL1 A;  4RU9 A;  4M5N A;  2VAS A;  1ZTT A;  1JLF B;  2ALZ A;  1KON A;  4DQS A;  4UST A;  3MM7 A;  2IM2 A;  2BX6 A;  1YZ7 A;  3C14 B;  3D0G E;  3LP2 A;  3QO9 A;  2VB6 A;  4UUW A;  3C3L A;  3F44 A;  1NPK A;  4MK7 A;  2GHP A;  2H4W B;  1N6Q A;  2LMI A;  1J5E F;  3LH2 S;  2NZ4 A;  1OYD A;  4Q2M A;  5SUH A;  2W01 A;  2XLI A;  1DFD A;  4CI0 B;  3IR7 B;  4KYZ A;  4A48 A;  4HVZ A;  3I32 A;  4CZC A;  1RSC A;  3MED A;  5IWA F;  5GAD U;  4AYB D;  1U0S A;  3W5Y A;  3BGR B;  1YVF A;  2H51 B;  2AT1 B;  2CG4 A;  1SVD A;  4MYU A;  2V4R A;  1VQ5 S;  1AYE A;  3CMA S;  3AOB A;  3N28 A;  1SKU B;  3E01 B;  5B0F A;  2ZH6 A;  4P2X A;  1Q16 B;  3N5F A;  4G3I A;  3PIP Q;  1RWX B;  3TZZ A;  4NL5 A;  2M7S A;  3P5T L;  1TUG B;  4CLY A;  3BS9 A;  3MMJ A;  1FFS B;  4ECW A;  3GV8 B;  2E9R X;  3UPF A;  1IBK J;  3NS7 B;  3NNA A;  2AJ1 A;  2XNQ A;  3N9U C;  2HPU A;  3BF4 A;  1TL3 B;  5IT0 A;  4CLS A;  2PC6 A;  3NCR A;  3TA2 A;  1I5O B;  3TZY A;  3M6W A;  2FZC B;  2R3V A;  3LP2 B;  1L5U A;  2BR0 A;  1Q8L A;  4P9S A;  3SYZ A;  3FRY A;  4I0W A;  3AA9 A;  2OTL S;  4DQP A;  3TA1 A;  1LOU A;  1X4D A;  3AXK A;  5J1P A;  5LOQ A;  4RUC A;  3MR7 A;  2FJA B;  4CO2 A;  2IM0 A;  4A47 A;  3TW0 A;  5ADZ A;  2MGZ A;  1X4A A;  3GFY A;  1NRK A;  2EFP A;  1FJ7 A;  1XMO J;  3NL0 A;  1TL7 A;  4LFC F;  3MED B;  4NYZ A;  2VFU A;  4F04 B;  3MM5 A;  4ILR A;  4FXV A;  2MLX A;  1U4B A;  3A4T A;  4GVB A;  2MQN A;  2ZHO A;  2MLZ A;  3TO8 A;  1FNO A;  5DO2 A;  1RAF B;  3DC2 A;  4DHV A;  3OR2 A;  2GAH C;  1FTC A;  4DUT A;  2EG2 A;  3ZNU A;  4QWD A;  4Q43 A;  4ZS6 A;  3CCW A;  1FES A;  1TV6 A;  4Y00 A;  1RBO B;  2MKY A;  1H2V Z;  4WP9 A;  1NJX A;  1UP1 A;  1BE4 A;  1VQ9 S;  2B9X A;  4ED1 A;  1VBY A;  2HVI A;  2JHE A;  4YDD B;  2RDJ A;  4ANE A;  5A6W A;  4MIW A;  1N0U A;  1ITP A;  3I5A A;  4ILM A;  3TUZ C;  1X4F A;  3GWC A;  4OJH A;  2LKZ A;  1HQE B;  1U47 A;  2PI4 A;  1Q5Y A;  2JEI A;  2IJR A;  2ZNZ A;  2XMU A;  2RD5 C;  4O44 B;  3MPD A;  1VBZ A;  4O4R A;  4FXW A;  4TN2 A;  5CH7 B;  1CJT A;  4ZN3 A;  4XDD A;  1JXL A;  3TOQ A;  3NNH A;  2V94 A;  4PKD B;  3KLG A;  4XAK A;  1ZOT A;  4JI2 J;  4NLG A;  1QD1 A;  4KHR A;  5IZH A;  2MGZ B;  2HMI A;  3NMR A;  1ZM2 A;  2HG4 A;  2OEK A;  1MRO B;  4IKA A;  1EAY C;  2H9Z A;  2VA3 A;  4K5R A;  3QSY B;  2E1P A;  3MM5 B;  5ETT A;  1MMD A;  4CWB A;  4URG A;  4A8W A;  3BO4 A;  1YJU A;  3VGV A;  1WTB A;  2B51 A;  3HZG A;  2J8S A;  5DDR C;  1FK9 A;  4I2P A;  4DF4 A;  3OR2 B;  2E1R A;  1UZD A;  4DL5 A;  4B3O A;  1REG X;  4TQR A;  3TQE A;  1TV6 B;  2M52 A;  4JOU A;  2VJV A;  4E98 A;  3O2I A;  2R2T A;  3CME S;  1WJ9 A;  4LFB F;  3HSZ A;  4OMF G;  9RUB A;  3PTW A;  1U1R A;  5DG9 A;  4ECS A;  1UJ4 A;  4ZCI A;  4CLL A;  2BAB A;  5KG3 A;  4KHP F;  1IKV A;  4N8N A;  4X4O A;  4LFA J;  4ICL A;  1FRM A;  2PEB A;  2P9G A;  2JRS A;  2KXH A;  3GR0 A;  1L3S A;  4DLE A;  3P4U B;  2R8J A;  1B0V A;  2PMZ D;  4YY3 F;  2BRL A;  1HBO A;  1XIQ A;  3LP0 A;  1JLG B;  3KLG B;  1OWX A;  2HQI A;  2WW4 A;  4XTT A;  1FX2 A;  2AGO A;  2DY9 A;  3H40 A;  2N7Y A;  4RNO A;  2CJY B;  3DRY A;  2YWF A;  1XNQ J;  5J1E A;  3BGL A;  3SV4 A;  3ZTQ A;  2BOP A;  2IC3 A;  1FK9 B;  1DUR A;  4YHH J;  3GIJ A;  2AF6 A;  2V34 A;  2RSQ A;  3QNW B;  3G6E S;  3GCX P;  2EBG A;  1NND A;  1U25 A;  3QIP A;  2Y1L B;  4GRS A;  1PYO B;  4ECU A;  4DN0 A;  1HBU B;  4HT5 A;  4OLO A;  4QCL A;  3CO0 P;  4DR1 F;  4FYD A;  1S97 A;  1WC4 A;  3KK3 B;  5AE3 A;  3NY0 A;  1WEX A;  2F5G A;  3KLH A;  4H4M A;  4USM A;  4LMZ A;  1R6V A;  2HS3 A;  2QZ8 A;  3D7S B;  3TVZ A;  5KFM A;  1IKV B;  1N4L A;  2RKI A;  5HLF B;  3DLH A;  1JJ4 A;  3NOG A;  5MLC V;  5DG7 A;  1IR0 A;  1SKW A;  1WHY A;  2W8L A;  2IY5 B;  3E3X A;  2VH7 A;  5J2Q A;  2MZS A;  3HHL C;  1P9Q C;  1BQX A;  3LP0 B;  2BQR A;  5IT4 A;  3GCW P;  1NDC A;  4H4K C;  1X0P A;  3DOM A;  4NE9 C;  2VV5 A;  1H7W A;  4NZ7 A;  4CLP A;  2QT7 A;  1TVR A;  3SQG A;  4NMX A;  5T14 A;  4IH5 A;  3EVW A;  2B43 A;  4GO5 X;  4URQ U;  3ULH A;  2AYG A;  2A2D A;  3P49 B;  5HQM A;  4W92 B;  5KFG A;  2F8M A;  4ZKA A;  2ZJQ Q;  2IC3 B;  3D67 A;  2QA4 G;  5K14 B;  2V6A A;  4JI6 J;  4OI1 A;  1KQS R;  3NBP A;  5CCM A;  1N56 A;  3DOL B;  1O8B A;  2OGU A;  4IO1 A;  1NAQ A;  4NLX A;  1OY9 A;  4JI3 J;  3UN5 A;  1RTJ B;  2XI3 A;  3QIP B;  3W65 A;  3MAQ A;  2R2R A;  3OVB A;  3KTQ A;  3AXM A;  5HMX A;  3OPK A;  5GVQ A;  4QIW D;  1FJE B;  3LAL A;  2VKR A;  2BE9 B;  3VAI A;  2C3Y A;  5IWA J;  3QRP A;  1Y3K A;  1KWM A;  2E7W A;  3KOA A;  1HR0 J;  3HHL A;  4J9L A;  4ZLJ A;  4G1Q B;  2RKI B;  4AD6 A;  3IFE A;  2ZZN A;  1U1N A;  1U0H B;  2R7O A;  3JSM A;  4H4K A;  5DM7 Q;  3CCV S;  2EFV A;  3SEO A;  3A3N B;  3TUP A;  5KFJ A;  3QFH A;  1DAR A;  3UDC A;  1UZH A;  1SIW B;  1YJW S;  2WOM B;  3DOM B;  4LT6 A; 
#chains in the Genus database with same CATH homology
 2QV6 A;  4NI2 A;  4P2F A;  4WPA A;  4P2M A;  4OYW A;  4CLL A;  2GVZ B;  1WC1 A;  1Y10 A;  1CJT A;  1YK9 A;  1TL7 A;  4OYI A;  2BW7 A;  5IV4 A;  4CM0 A;  1WC3 A;  1YBU A;  1YBT A;  1WC4 A;  4WP8 A;  1CJK B;  2GVD B;  5D0E A;  1U0H A;  4CLF A;  3MAA A;  3C14 A;  4CLT A;  4CLZ A;  1CUL A;  4NI2 B;  4P2X A;  4OZ2 A;  3ET6 B;  4OYO A;  1WC0 A;  1WC5 A;  4CLK A;  3UVJ A;  3C15 A;  1CJU A;  4USW A;  4OYA A;  4CLY A;  4USU A;  1AZS B;  4UST A;  3MAA B;  3C14 B;  1AB8 A;  4CLW A;  4OZ3 A;  1FX2 A;  4OYB A;  3R5G A;  4OYZ A;  5IV3 A;  3C15 B;  1CJT B;  4CLS A;  1TL7 B;  4CLU A;  4WP9 A;  5D0R A;  1WC6 A;  1CJV A;  5D0H A;  4CM2 A;  1CS4 A;  3C16 A;  3G82 A;  1U0H B;  1FX4 A;  1CUL B;  2WZ1 A;  4CLP A;  4OYX A;  3ET6 A;  5D0G A;  1Y11 A;  2W01 A;  4WP3 A;  2GVZ A;  3UVJ B;  5D15 A;  1CJU B;  1AZS A;  1CJV B;  4USV A;  1CS4 B;  3MR7 A;  4OYP A;  3C16 B;  1CJK A;  2GVD A;  3G82 B;  4OYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...