1CUNA

Crystal structure of repeats 16 and 17 of chicken brain alpha spectrin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
213
structure length
213
Chain Sequence
MVHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQSVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two repeats of spectrin suggest models of flexibility.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords PROTEIN (ALPHA SPECTRIN)
total genus 99
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1cunA02
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1cunA01
1CUNA 1U5PA 1WLXA 1OWAA 3FB2A 2ODUA 3LBXA 1AJ3A 3UUNA 2SPCA 3F31A 3EDVA 1HCIA 3PE0A 2ODVA 1U4QA 3UULA 3LBXB 1S35A 1QUUA 3UUMA
chains in the Genus database with same CATH superfamily
2MBGA 2DNXA 4CQIA 3JAFA 1L0VA 4QHOA 3RQWA 2P9BA 1OEDC 4OX9T 1NWMX 2VVSA 2WY2A 3CWZB 2CXDA 1JNZA 3C50A 3GN5B 1VOMA 3CIRA 4U7YA 4PJMA 4X20E 3HKCE 5DJQC 3KBUA 4CN1A 4E7ZA 1E2AA 3OYZA 4KHZF 3UU6A 4F8HA 3D0TA 2XPKA 1M62A 1V9DA 4QXBB 1OEDA 4M1PA 3RPUA 3C98B 3UU5A 1HS7A 3IBPA 3N2GE 4DR3T 4GKKT 5FXVA 2MYSA 2ZM6T 2CXLA 4HE8A 2W67A 2V7KA 2X0LB 4OK0A 4IL9A 2E9XB 3SFDA 3P7IA 3QNUA 1FIOA 3N9NA 2X51A 3CX8B 1XDOA 1VCTA 2CMRA 4O2BE 4JUYA 2X0YA 3BK9A 5DQVA 3ZMUB 5KXJA 2G0UA 3CQXC 4ZEYA 5LJMA 2CWOA 2YKSA 3MA9A 3PU8A 3ETVA 3IHRA 4LMLA 1QUUA 1SE7A 4U7IA 5H6QB 1I94T 4NXMT 3N5LA 5F3JA 2EHOD 4O2AE 2CLYC 2YDSA 4H9RC 2CEAA 1HNXT 4HGAA 4JI3T 2E8IA 3O1IA 5FNVE 4CXWA 3AA6B 3ABVA 4YSZA 4TV8E 3MJXA 5HEOA 2XTLA 4AKRB 3HR0A 3PURA 5HEUA 3V5SA 2RA1A 5L4HA 4UV8B 1IBMT 4EZHA 3WAJA 2IIUA 2K5BB 4LMJA 2WWVA 1IJ6A 2LM2A 3C4WA 3ZPOA 5JVDE 2XJ7A 3FBZA 1UUSA 1YQ3A 2X9YA 2XQ3A 3N9OA 2A72A 4AXPA 5AQFB 4UF0B 3AA1B 5LHIB 3RQUA 2XAHB 4TWHA 3SRZA 5ABEA 2LRLA 3ESLA 4LMKA 5EK3A 2KNDA 3RIFA 2KWIB 2H89A 1MMGA 2WDVA 2WDQA 1Z8UA 2XAJB 2V5DA 2LJLA 1LKXA 5J1GA 3AE2A 4P0BA 3T1YT 4DVDA 4UV9B 4HWFA 4ISTA 3TLVA 4ANJA 4WBNE 2X0HA 3PJAJ 5JRCB 4TZ4C 2BVLA 2PBIA 3KDSE 1FMVA 4ZXLA 5ABGA 3RRCA 4Z8XA 3CK6A 5LG3A 4AI6A 4U33A 2ZM0A 2DL1A 4GIWA 5LG4A 3E08A 3OTOT 1HCIA 3GWHA 3ZMSB 2K24A 2OLTA 3UUBA 4A98A 2CBIA 2UUCT 5ETWA 4B3TT 2LOSA 3ZSSA 5KDMC 3LK3B 3ZMVB 1ZP0A 3LSVA 4JI7T 2X9WA 2F4VT 3FZLB 5JR9C 5L3GB 2HN2A 1KNRA 3RLFF 2BKPA 5IUXA 3O9XA 2NW9A 3B5MA 4GYSA 5FY7A 4AQFC 4AKIA 4TN7B 1UK5A 3QUJA 3PDYA 2V6YA 4HFBA 3V5UA 4YFSA 2V26A 3R84B 3O1JA 1HNWT 2LE8A 3AE1A 1IJ5A 2VASA 2C5JA 2LKGA 2WB5A 3AVSA 1N32T 5FL0A 2ACZA 2B76A 2XAFB 3K3QC 4HFIA 1HG2A 4EV6A 4YHHT 3P4WA 4LF9T 4DR7T 4JI4T 2WMOA 1HX8A 3FZMB 2A9UA 3UT5E 5FVKA 4DV5T 1NAFA 3AEBA 2FJDA 2K3WA 4MHCA 4QH5A 4PFOA 3RYHE 1Z0PA 3FXEB 1IZNB 4ILBA 3ZMZB 3P50A 3UUMA 2BG9C 4DR4T 4DV3T 3UU4A 1XMQT 2BG9E 5LGTB 1X9BA 1HFAA 2NR4A 5JDMA 5AQNB 2IUBA 2XQAA 2WS3A 2GK9A 4L0RA 4YHJA 2HH7A 1UURA 2FUPA 2ODUA 2WAUA 4PW8A 4LFBT 2LSYA 1E1HB 2XQ7A 4JBWF 2LSIA 4U31A 5LNKA 2W00A 4JEUB 2Q9QD 5J0ZA 4IDPA 4C91A 5LMUT 3Q5EA 4UEMA 2M6IA 1EZ3A 2VKDA 2UUBT 2KXPB 2DLRA 2V6XA 1S94A 2NWBA 2V7IA 4H63V 1OXZA 3AEDA 2IC6A 3CPZA 3VKHA 1T7SA 2C0SA 3C51A 4ERRA 1HX1B 1Y01A 5BR8T 1YD8G 1MNEA 2W63A 3BQLA 4I4TE 3KVBA 4JLEA 2V7MA 3RKGA 2IHR1 4KBMB 1XNRT 2H7VC 4AQFA 4IDQA 3PUVF 3VR9A 4GOUA 3AE7A 4X1YE 2ZMAA 1GQEA 2LM9A 2JIWA 3AE9A 3NZQA 4CXYA 5HEHA 1UX5A 2KWHA 3FXDB 4E7SA 3A7MA 1D1CA 4OHFA 1AJ3A 3HKDE 4IL4A 4CI1B 1LVKA 3SFEA 4DMVA 2XSAA 1FEWA 2VB6A 1T98A 4UF0A 5IYZE 2WBLA 4PNIA 2QRXA 4C90A 1IAPA 1KNPA 1D0YA 3UTKA 1QSDA 1WYCA 1KEYA 2WCAA 4N78D 3CQCB 1MMAA 4PAGA 4LF8T 3HKBE 2WP9A 4UXNB 4OYKA 5AFUL 3WI3A 5ADXL 2EHOA 1MIWA 2CHOA 2R6GF 3Q5WA 2BG9A 2KLQA 2J47A 2ES0A 3DJBA 3ZJ2A 4DV2T 2XUEA 2LLYA 4HTEA 2UU9T 2UXCT 3N9PA 1ZV4X 3ZN1B 3O4XE 4ISSA 4DUZT 4ZI3C 5LA6E 2D0UA 3RX6A 3HKEE 4KX6A 1ZEEA 5FY1A 1HNZT 5FMNA 1N34T 2CHNA 2W2UA 2WU2A 2BS4A 2XM1A 3ZSTA 3SWHA 2ZM8A 4DMWA 3S4UA 2XZEA 4TWDA 5AQIB 2CCQA 2YDRA 4P0AA 3P4QA 3RGLA 5JH7E 2HPLA 2EHOB 1LVFA 3OJAA 2UXXB 4QXHB 2FBWA 2JPFA 4LF7T 3H3MA 3I0QA 5AQOB 2VQET 2BBJA 3F2EA 3IA3A 3RYFE 4AQYT 3B13A 4YTNA 4CI3B 4BJNA 4O4IE 1YXRA 4DNDA 4GK5E 4AQGA 4JI2T 5JQGE 4HN9A 3CX6B 3G06A 2D0TA 3N9LA 2JQKA 4L9IA 3VU7H 4JI0T 4AISA 2RPAA 4H9OC 4Q25A 3AE5A 1J1JA 5M4YA 1YW0A 5IHYA 3ZN0B 4ASKA 5ABFB 3T1HT 2V7LA 3IF8B 3P4SA 3M65A 2XY8B 4EXTA 2IAKA 4DIDB 2FJAA 4WYVA 5C8YE 5JDLA 2L3LA 5HXEA 4YJ2E 5L3EB 4DV7T 4QKNA 4GKJT 2LHNA 2Q9QB 4EEBA 3TKLB 2NP9A 3RKOA 3OPCA 5EK4A 2CRBA 5FP3A 4XAXB 4KI0F 2LEHA 2QGSA 3PUSA 4X65T 3O1HA 2YU2A 3ZT7A 3CVRA 5ABFA 3PUGA 2PTFA 2E9XD 2AE9A 5L2LA 2HN1A 3PUAA 4X5TA 2ZM2A 3KV5A 5AQGB 4YSXA 5AQKB 2HHHT 3UU8A 4DV1T 1KF6A 2BBHA 2QYWA 3C4ZA 3LK42 4KP3C 5AQUB 5F5WA 5IWAT 3AB3B 3FBLA 3NVOA 5L3DB 3ZLIA 2KT9A 1G73A 1O3XA 3KVAA 4B6XA 3PE0A 5GONE 5H6RB 5FL1A 3ZC0A 2WZIA 3CKDA 2OA5A 4B3ST 4NUVA 1KFYA 4EYUA 3ZYKA 4EB6E 3AAEB 5FXWA 2Y8DA 3LG7A 2XQ9A 3TLTA 1MMDA 2PJQA 3OVUA 2J62A 1WFDA 4PFPA 4U74A 5F8PA 5LP6E 2W4XA 4JV5T 3UUXB 1W09A 5HXHA 2X9HA 3LFMA 5FXXA 5JDGA 3I9WA 4IHJE 4DO0A 1UCUA 2J1DG 2N9DA 4OFZA 4QH1A 4CI2B 2N1GA 3QC9A 3UUNA 4IE4A 1WYBA 2BZBA 4DV4T 4KHPT 2JQHA 1WR6A 5HAXA 4PK6A 1D1BA 2UUAT 2E2AA 1VRBA 3H3AA 3PUQA 4WZXA 4ZZBA 1XNQT 3P4RA 4HFDA 3FZFB 2WSSV 3RIUA 3RC8A 2XSBA 2KZ7B 1VCSA 4GYRA 4KUMB 2X67A 3PU3A 2BG9B 2YDQA 3J9X1 2E9XA 4DBQA 1MMNA 4P09A 2UXBT 2M6BA 2AXDS 1E7PA 2V1DB 2QVAA 1XZYA 3AAIA 3FHNA 3K1SA 3LBXB 3TLUA 3UULA 3ZCIA 3CQGB 4FI5A 4A56A 4EAHA 2JJ9A 2VK9A 5KMGP 5LHGB 4X62T 2BKNA 3ZMTB 3A5XA 2E9XC 3P8CD 5L3FB 3AXJB 4LF5T 2DWGA 4K0UA 3AEAA 3AE8A 1YKEB 5AQMB 4EIWA 5DQWA 4J2CA 2CPTA 2KMFA 2JMHA 4UIGA 3VHLA 2WZHA 1H7CA 2HPJA 5TAOA 4AKHA 5KX5E 4ILUA 2B1EA 3GMIA 1KK7A 4YTPA 2LRKA 4H63H 4KMCA 5EK2A 1WRDA 2D9DA 3L3PA 4GK0E 2SPCA 2CA5A 1CHUA 5AQQB 3VKGA 3JC6D 4G63A 3F31A 2LSGA 3KV4A 4HFHA 4PJNA 4Z91A 5AQRB 3PUZF 4H9NC 4ZI2C 5FKYA 1XDPA 1KNZA 4K0KT 4UVBB 4PK4A 4ZOLE 1T72A 2H3RA 3NZPA 4YTMA 5HCMA 3HI2A 3X1DA 2NW8A 4EGWA 4OYJA 1R8IA 2JQQA 2LOPA 4U3CA 4TWFA 1UGOA 2JQ9A 4UVAB 3UQ4A 5LB7B 4TV9E 3W15B 1SHZC 5CA0E 5HEJA 2JMKA 3HA4A 3PUWF 4X1IE 3TLWA 3EVYA 4IREA 3WAKA 3ZT5A 3ZT6A 4TX5A 5A1LA 1B7TA 3HL6A 3RYCE 3U3IA 1WR0A 3AEEA 1ZHCA 3KINB 3LBXA 3K3NA 2XAQB 1T8BA 3IEEA 3DP7A 3JADA 2VKJA 4HWCA 1D1AA 4U2YA 2H7OA 3RHWA 3ZYLA 4Z90A 1MIYA 5AQJB 2VKHA 3C64A 3P4PA 5AQHB 4BA9A 4ZI3D 1M7KA 3FZKB 1HF8A 3EI0A 5LJNA 3NRYA 3ZYMA 4LF6T 4DBRA 2VWAA 3OKQA 3N9QA 5E0OA 4I0UA 3EAMA 1OEDE 2X9XA 3E0ZA 3SOLA 1U4QA 5JR9B 4X66T 4XBFB 2LT3A 2ZLYA 5JR9A 2IC9A 1MNDA 4HFEA 2MPKA 3PTRB 3C4XA 3J7Yq 2IMLA 3H37A 3N2OA 5HWYA 5C2TA 5LGNB 4EOZB 2NOXA 5AQTB 2I0MA 5LBMA 1IBKT 2H88A 1OWAA 4IDZA 5HYAA 3QOFA 4IT4A 5CJ5A 1N33T 4DV0T 2FJEA 5LBQB 5LOVE 3ZCJA 3TLSA 1OEDB 4LFAT 1HTJF 1D0ZA 5HEGA 3MKDA 3MK7C 4ZI7E 4NXNT 1Y64B 2J4GA 3RIAA 3ZJ1A 1G8XA 2D2SA 4IIJE 3BQIA 4ZI2D 3I0OA 2V7JA 5L3CB 1NEKA 2IDOB 2YN6A 2Z6EA 2XAGB 3AAAB 5AQLB 5HXSA 5J2UE 2I6HA 2W66A 3ONXA 4I55E 1QLBA 4O4JE 3T8OA 2Q9QC 4HEAA 3NBXX 4ZZCA 3CX7B 3ZKRA 1YKHB 3KFWX 1WCRA 3Q5XA 4MBQA 3VRAA 3PUXF 2WU5A 1US7B 3AEFA 3VRBA 2VL8A 4LFCT 3LJCA 2Q9QA 2X66A 1WLXA 2YU1A 2C5KT 2BS3A 4JEHB 2YOEA 3UFEA 5AQSB 5LYJE 1SUMB 3QK6A 4COFA 3JAEA 5LCYA 4BJMA 4CZZB 3QB5A 5CFBA 4H9SE 4EZ4A 4DUYT 2LSJA 3ANWA 4IE6A 2DHRA 2CLYB 2V8SV 4TNWA 3VR8A 1J5WA 4H9QC 5C3JA 4JYAT 2YK0A 2UXDT 2XQ5A 3EUHA 3L8RA 2XQ4A 1JNRA 2Y6XA 4QX8B 3EDUA 3JCFA 1FMWA 3Q9DA 5EZYE 5JDQA 3AA0B 4HKAA 4FJOA 4MALA 2OV9A 4HWHA 3NRXA 1XMOT 3MXZA 3N2KE 2RP4A 4ZHQE 2DI4A 1W9RA 2YINA 5CA1E 1N36T 2MTQA 2FJBA 2NTXA 2ODVA 4P1NA 4A97A 4AKLA 4YSYA 2VQFT 2VKOA 4QH4A 5JDHA 5J2TE 3AE4A 5FYMA 2XHEB 4H9PC 5HCJA 4DR5T 1NENA 4QWNB 4CN6A 4B3MT 4AIUA 2A2FX 2LHRA 2CE7A 5CB4E 3AE3A 3NWIA 3LK2B 4PJJA 5AQVB 3AVRA 3Q5DA 1W0AA 4JI8T 4IGUA 2W0GA 4DR6T 2BS2A 3FB2A 4I43B 4ILCA 2M67A 2I59A 3BQKA 4O4HE 3MZKB 1HR0T 2BKOA 2VURA 2Y48B 5JRCA 1W0BA 3LDQB 4UR9A 2QA7A 3I1AA 3MACA 2XQ8A 4HWDA 2MOZA 2X68A 2NW7A 2XASB 3AECA 3RF1A 3RI5A 3RRWA 5HWXA 4X64T 4U72A 5L47A 2WMNA 4X1KE 3OBVE 3FZHB 3ZC1A 3OYXA 5DABA 1I6ZA 3UQ7A 4IDOA 4O4LE 5JREA 2CBJA 2KSRA 4F6RC 4NPPA 3M3ZB 4O8SA 1IBLT 4ZS2A 3AA7B 2LKHA 4PK5A 3DTOA 2YEVC 4EEDA 3E22E 1S35A 3AXJA 4QXCB 3PUYF 2EHOC 4A5XA 5JDFA 1CUNA 3SS1A 1U5PA 2V5CA 3F57A 1SA0E 2VVNA 3GN5A 3RH3A 3JC6C 4WBOA 2IW5B 4YY3T 4DR2T 4IE5A 1X79A 3U78A 4ZS3A 4HWIB 1BR2A 4U2ZA 1BR4A 2D5UA 2NTYA 2E5VA 4QX7B 4HFVA 4CXXA 5L3BB 4YXDA 5FY0A 1HG5A 4YJ3E 2E5LT 2UXNB 3ETUA 2PFVA 2WQYA 3EDVA 1DU2A 2PG8A 2BDEA 4JI1T 1D0XA 2K9AA 4I50E 5AQPB 3RYIE 3L09A 4L5GA 2MAWA 2JRKA 4V1Av 4LF4T 4AKGA 2DWKA 1FJGT 4NUUA 2VL0A 4MLKA 3KV6A 3ONJA 4PJLA 3RIUC 4JI6T 4NIQA 5HXRA 4CN4A 5FXZA 1BR1A 3GA8A 2V6YB 3UU3A 5LXTE 4UELA 2CWYA 4MFRA 4TUYE 4WW0A 5CGMA 3QB5K 4XZCA 3UFGA 3AEGA 4G2AA 2L9QA 4ADZA 4JI5T 2A3DA 2XQ6A 3L39A 2BVMA 4BAYB 3EABA 3R6NA 1YQ4A 4YT0A 2XQYA 3KBTA 4ILAA 5L4EA 3I9YA 4IE0A 4YLHA 1MIVA 2CXFA 2CM0A 3K3OA 3ONLC 4TNVA 1XWMA 2KINB 2LSKA 3ZEFB 3EHZA 3ANWB 2L8KA 5LGUB 2W61A 5LMNT 3N9MA 3KV9A 3PV0F 2WWUA 4UVCB 1LRZA 2N2NA 4IE7A 1BR0A 5LHHB 2WDRA 4B3RT 2K48A 4HFCA 3A8YC 5FVLA 2W62A 5HXCA 5JDNA 2XM2A 5JTGA 3CMLA 3B57A 2WM9A 2DCFA 3PJAA 2C5IT 3K8PC 4IDNA 3NKZA 1UX4A 3RC3A 1ZKEA 4WNKA 5BMVE 4DR1T 2ACXA 1J5ET 4DV6T 3Q2MA 4EYYR 5ABHA 3AE6A 1ZOYA
chains in the Genus database with same CATH topology
2MBGA 2DNXA 4CQIA 4QHOA 2P9BA 1NWMX 4EOZB 3CWZB 2CXDA 3GN5B 3C50A 1VOMA 4PJMA 4X20E 3HKCE 5DJQC 3KBUA 4E7ZA 3OYZA 3D0TA 1V9DA 4QXBB 4M1PA 3RPUA 3C98B 1HS7A 3IBPA 3N2GE 5FXVA 2MYSA 2CXLA 4HE8A 2V7KA 2X0LB 4OK0A 2E9XB 3P7IA 1FIOA 3N9NA 2X51A 3CX8B 5DQVA 2CMRA 4JUYA 3ZMUB 3BK9A 2G0UA 3CQXC 5LJMA 2CWOA 3MA9A 5H6QB 3PU8A 3ETVA 3IHRA 1QUUA 3N5LA 5F3JA 2EHOD 4O2AE 2CLYC 4H9RC 2CEAA 4HGAA 2E8IA 3O1IA 5FNVE 4CXWA 3AA6B 4TV8E 3MJXA 2XTLA 4AKRB 3HR0A 3PURA 3V5SA 2RA1A 4UV8B 4EZHA 3WAJA 2K5BB 1IJ6A 3C4WA 3ZPOA 5JVDE 3FBZA 3N9OA 2X9YA 2A72A 4AXPA 4UF0B 3AA1B 5LHIB 2XAHB 3SRZA 3ESLA 5EK3A 2KNDA 2KWIB 1MMGA 2XAJB 2LJLA 1LKXA 5J1GA 4P0BA 4DVDA 4UV9B 4ISTA 4WBNE 4ANJA 5JRCB 4TZ4C 2BVLA 2PBIA 3KDSE 1FMVA 3RRCA 4Z8XA 4AI6A 2ZM0A 4GIWA 5LG4A 3E08A 1HCIA 3GWHA 3ZMSB 2K24A 5ETWA 2LOSA 5KDMC 3LK3B 3ZMVB 2X9WA 5JR9C 5L3GB 3O9XA 2NW9A 4GYSA 5FY7A 4AKIA 4AQFC 4TN7B 3QUJA 3PDYA 3V5UA 4YFSA 2V26A 3R84B 3O1JA 2LE8A 1IJ5A 2VASA 2C5JA 3AVSA 2XAFB 3K3QC 1HG2A 2WMOA 1HX8A 3UT5E 1NAFA 4PFOA 4MHCA 3RYHE 1Z0PA 3FXEB 1IZNB 3ZMZB 3UUMA 5LGTB 1HFAA 5JDMA 2GK9A 4L0RA 4YHJA 2HH7A 2WAUA 4PW8A 2ODUA 2LSYA 1E1HB 5LNKA 2LSIA 2W00A 4JEUB 2Q9QD 4C91A 4UEMA 1EZ3A 2VKDA 2KXPB 2DLRA 1S94A 2NWBA 2V7IA 4H63V 1OXZA 2IC6A 3CPZA 3VKHA 2C0SA 3C51A 4ERRA 1YD8G 1MNEA 2W63A 3BQLA 4I4TE 3KVBA 4JLEA 2V7MA 5C8YE 4KBMB 2H7VC 4AQFA 4GOUA 4X1YE 2ZMAA 2LM9A 3NZQA 4CXYA 1UX5A 2KWHA 3FXDB 4E7SA 1D1CA 4OHFA 1AJ3A 3HKDE 4CI1B 1LVKA 4DMVA 1FEWA 2VB6A 1T98A 4UF0A 5IYZE 2WBLA 4PNIA 4C90A 1IAPA 1D0YA 3UTKA 1QSDA 1WYCA 4N78D 3CQCB 1MMAA 4PAGA 3HKBE 4UXNB 5AFUL 4OYKA 3WI3A 5ADXL 2EHOA 1MIWA 4O2BE 3Q5WA 3ZJ2A 2KLQA 2ES0A 3DJBA 2XUEA 4HTEA 3N9PA 1ZV4X 3ZN1B 3O4XE 4ISSA 4ZI3C 5LA6E 2D0UA 3RX6A 3HKEE 5FY1A 1ZEEA 5FMNA 3SWHA 2ZM8A 4DMWA 3S4UA 2CCQA 4P0AA 5JH7E 2HPLA 2EHOB 1LVFA 3OJAA 2UXXB 4QXHB 2JPFA 3I0QA 3F2EA 3RYFE 3B13A 4CI3B 4BJNA 4O4IE 4DNDA 4GK5E 4AQGA 5JQGE 4HN9A 3CX6B 2D0TA 3N9LA 4L9IA 3VU7H 4H9OC 5M4YA 1YW0A 5IHYA 3ZN0B 4ASKA 2V7LA 3IF8B 3M65A 4EXTA 2IAKA 5L3EB 5JDLA 2L3LA 5HXEA 4YJ2E 4QKNA 2LHNA 2Q9QB 3TKLB 2NP9A 3RKOA 5EK4A 5FP3A 4XAXB 2LEHA 2QGSA 3PUSA 3O1HA 2YU2A 3CVRA 3PUGA 2E9XD 5L2LA 3PUAA 2ZM2A 3KV5A 4KP3C 3C4ZA 3LK42 3AB3B 3FBLA 5L3DB 3ZLIA 2KT9A 1G73A 1O3XA 3KVAA 4B6XA 3PE0A 5GONE 5H6RB 3ZC0A 3CKDA 2OA5A 4NUVA 4EYUA 3ZYKA 4EB6E 3AAEB 5FXWA 2Y8DA 3LG7A 1MMDA 2PJQA 4PFPA 4U74A 5F8PA 5LP6E 3UUXB 5HXHA 2X9HA 3LFMA 5FXXA 5JDGA 3I9WA 4IHJE 4DO0A 1UCUA 2J1DG 2N9DA 4OFZA 4CI2B 2N1GA 3QC9A 3UUNA 4IE4A 1WYBA 2BZBA 1WR6A 5HAXA 4PK6A 1D1BA 1VRBA 3H3AA 3PUQA 2WSSV 3RC8A 2KZ7B 4GYRA 4KUMB 2X67A 3PU3A 3J9X1 2E9XA 4DBQA 1MMNA 4P09A 2V1DB 3FHNA 3AAIA 3UULA 3ZCIA 4EAHA 3LBXB 4EZ4A 5LHGB 4A56A 3CQGB 4FI5A 5KMGP 2JJ9A 2VK9A 5L3FB 3ZMTB 3A5XA 2E9XC 3P8CD 2DWGA 4K0UA 1YKEB 4EIWA 5DQWA 4J2CA 2KMFA 4UIGA 2JMHA 3VHLA 1H7CA 2HPJA 5TAOA 4AKHA 5KX5E 4ILUA 2B1EA 3GMIA 1KK7A 5EK2A 4H63H 4KMCA 1WRDA 4GK0E 3L3PA 2SPCA 2CA5A 3VKGA 3JC6D 4G63A 3F31A 2LSGA 3KV4A 4PJNA 4ZI2C 4H9NC 1KNZA 4UVBB 4PK4A 4ZOLE 2H3RA 3NZPA 3HI2A 2NW8A 4OYJA 2JQQA 2LOPA 4UVAB 4TV9E 3W15B 1SHZC 5CA0E 2JMKA 3HA4A 4X1IE 3EVYA 3WAKA 5A1LA 4TX5A 1B7TA 3HL6A 3RYCE 3U3IA 3KINB 1ZHCA 3LBXA 3K3NA 2XAQB 3IEEA 3DP7A 2VKJA 1D1AA 2H7OA 3ZYLA 1MIYA 4BA9A 2VKHA 3C64A 4ZI3D 1HF8A 5LJNA 3NRYA 3ZYMA 4DBRA 2VWAA 3OKQA 3N9QA 5E0OA 2X9XA 3E0ZA 3SOLA 1U4QA 5JR9B 4XBFB 2LT3A 2ZLYA 5JR9A 2IC9A 1MNDA 3PTRB 3C4XA 3J7Yq 3H37A 3N2OA 5HWYA 2NOXA 5LBMA 1OWAA 4IDZA 5HYAA 5LOVE 5LBQB 3ZCJA 1HTJF 1D0ZA 3MKDA 3MK7C 4ZI7E 1Y64B 3ZJ1A 1G8XA 2D2SA 4IIJE 3BQIA 4ZI2D 3I0OA 2V7JA 5L3CB 2Z6EA 2XAGB 3AAAB 5HXSA 5J2UE 3ONXA 4I55E 4O4JE 3T8OA 2Q9QC 4HEAA 3NBXX 3CX7B 1YKHB 3KFWX 3Q5XA 4MBQA 1US7B 2VL8A 3LJCA 2Q9QA 2X66A 1WLXA 2YU1A 2C5KT 4JEHB 3UFEA 5LYJE 3QK6A 5LCYA 4BJMA 4CZZB 4H9SE 2LSJA 3ANWA 4IE6A 2DHRA 2CLYB 5LGNB 4H9QC 2YK0A 3EUHA 2Y6XA 4QX8B 3EDUA 3Q9DA 1FMWA 5EZYE 5JDQA 3AA0B 4HKAA 4FJOA 4MALA 3NRXA 3MXZA 3N2KE 2RP4A 4ZHQE 2DI4A 2YINA 5CA1E 2MTQA 2NTXA 2ODVA 4AKLA 2VKOA 5JDHA 5J2TE 5FYMA 2XHEB 4H9PC 4QWNB 2A2FX 2LHRA 2CE7A 5CB4E 4PJJA 3LK2B 3AVRA 4IGUA 2W0GA 3FB2A 4I43B 2M67A 2I59A 3BQKA 4O4HE 3MZKB 5JRCA 2Y48B 2QA7A 3I1AA 3MACA 2MOZA 2X68A 2NW7A 2XASB 3RRWA 5HWXA 4U72A 2WMNA 4X1KE 3OBVE 3ZC1A 3OYXA 5DABA 4O4LE 5JREA 4F6RC 4O8SA 4ZS2A 3AA7B 4PK5A 3DTOA 2YEVC 3E22E 1S35A 4QXCB 2EHOC 5JDFA 1CUNA 3SS1A 1U5PA 3F57A 1SA0E 3GN5A 3RH3A 3JC6C 4WBOA 2IW5B 4IE5A 1X79A 3U78A 4ZS3A 1BR2A 1BR4A 2D5UA 2NTYA 4QX7B 4HFVA 4CXXA 5L3BB 5FY0A 1HG5A 4YJ3E 2UXNB 3ETUA 2PFVA 3EDVA 2PG8A 2BDEA 1D0XA 2K9AA 4I50E 3RYIE 3L09A 4L5GA 4V1Av 2JRKA 4AKGA 2DWKA 4NUUA 4MLKA 3KV6A 4PJLA 5HXRA 5FXZA 1BR1A 3GA8A 5LXTE 4UELA 2CWYA 4MFRA 4TUYE 4WW0A 4XZCA 4G2AA 2L9QA 4ADZA 2A3DA 2BVMA 4BAYB 3R6NA 2XQYA 3KBTA 3I9YA 4IE0A 4YLHA 1MIVA 2CXFA 2CM0A 3K3OA 2KINB 2LSKA 3ZEFB 3ANWB 2L8KA 5LGUB 2W61A 3N9MA 3KV9A 2WWUA 4UVCB 1LRZA 2N2NA 4IE7A 1BR0A 5LHHB 2K48A 5HXCA 5JDNA 2W62A 3CMLA 3B57A 2WM9A 2DCFA 2C5IT 3K8PC 1UX4A 3RC3A 1ZKEA 4WNKA 5BMVE 2ACXA 3Q2MA 4EYYR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUN A;  1U5P A;  1WLX A;  1OWA A;  3FB2 A;  2ODU A;  3LBX A;  1AJ3 A;  3UUN A;  2SPC A;  3F31 A;  3EDV A;  1HCI A;  3PE0 A;  2ODV A;  1U4Q A;  3UUL A;  3LBX B;  1S35 A;  1QUU A;  3UUM A; 
#chains in the Genus database with same CATH topology
 2MBG A;  2DNX A;  4CQI A;  3JAF A;  1L0V A;  4QHO A;  3RQW A;  2P9B A;  1OED C;  4OX9 T;  1NWM X;  2VVS A;  2WY2 A;  3CWZ B;  2CXD A;  1JNZ A;  3C50 A;  3GN5 B;  1VOM A;  3CIR A;  4U7Y A;  4PJM A;  4X20 E;  3HKC E;  5DJQ C;  3KBU A;  4CN1 A;  4E7Z A;  1E2A A;  3OYZ A;  4KHZ F;  3UU6 A;  4F8H A;  3D0T A;  2XPK A;  1M62 A;  1V9D A;  4QXB B;  1OED A;  4M1P A;  3RPU A;  3C98 B;  3UU5 A;  1HS7 A;  3IBP A;  3N2G E;  4DR3 T;  4GKK T;  5FXV A;  2MYS A;  2ZM6 T;  2CXL A;  4HE8 A;  2W67 A;  2V7K A;  2X0L B;  4OK0 A;  4IL9 A;  2E9X B;  3SFD A;  3P7I A;  3QNU A;  1FIO A;  3N9N A;  2X51 A;  3CX8 B;  1XDO A;  1VCT A;  2CMR A;  4O2B E;  4JUY A;  2X0Y A;  3BK9 A;  5DQV A;  3ZMU B;  5KXJ A;  2G0U A;  3CQX C;  4ZEY A;  5LJM A;  2CWO A;  2YKS A;  3MA9 A;  3PU8 A;  3ETV A;  3IHR A;  4LML A;  1QUU A;  1SE7 A;  4U7I A;  5H6Q B;  1I94 T;  4NXM T;  3N5L A;  5F3J A;  2EHO D;  4O2A E;  2CLY C;  2YDS A;  4H9R C;  2CEA A;  1HNX T;  4HGA A;  4JI3 T;  2E8I A;  3O1I A;  5FNV E;  4CXW A;  3AA6 B;  3ABV A;  4YSZ A;  4TV8 E;  3MJX A;  5HEO A;  2XTL A;  4AKR B;  3HR0 A;  3PUR A;  5HEU A;  3V5S A;  2RA1 A;  5L4H A;  4UV8 B;  1IBM T;  4EZH A;  3WAJ A;  2IIU A;  2K5B B;  4LMJ A;  2WWV A;  1IJ6 A;  2LM2 A;  3C4W A;  3ZPO A;  5JVD E;  2XJ7 A;  3FBZ A;  1UUS A;  1YQ3 A;  2X9Y A;  2XQ3 A;  3N9O A;  2A72 A;  4AXP A;  5AQF B;  4UF0 B;  3AA1 B;  5LHI B;  3RQU A;  2XAH B;  4TWH A;  3SRZ A;  5ABE A;  2LRL A;  3ESL A;  4LMK A;  5EK3 A;  2KND A;  3RIF A;  2KWI B;  2H89 A;  1MMG A;  2WDV A;  2WDQ A;  1Z8U A;  2XAJ B;  2V5D A;  2LJL A;  1LKX A;  5J1G A;  3AE2 A;  4P0B A;  3T1Y T;  4DVD A;  4UV9 B;  4HWF A;  4IST A;  3TLV A;  4ANJ A;  4WBN E;  2X0H A;  3PJA J;  5JRC B;  4TZ4 C;  2BVL A;  2PBI A;  3KDS E;  1FMV A;  4ZXL A;  5ABG A;  3RRC A;  4Z8X A;  3CK6 A;  5LG3 A;  4AI6 A;  4U33 A;  2ZM0 A;  2DL1 A;  4GIW A;  5LG4 A;  3E08 A;  3OTO T;  1HCI A;  3GWH A;  3ZMS B;  2K24 A;  2OLT A;  3UUB A;  4A98 A;  2CBI A;  2UUC T;  5ETW A;  4B3T T;  2LOS A;  3ZSS A;  5KDM C;  3LK3 B;  3ZMV B;  1ZP0 A;  3LSV A;  4JI7 T;  2X9W A;  2F4V T;  3FZL B;  5JR9 C;  5L3G B;  2HN2 A;  1KNR A;  3RLF F;  2BKP A;  5IUX A;  3O9X A;  2NW9 A;  3B5M A;  4GYS A;  5FY7 A;  4AQF C;  4AKI A;  4TN7 B;  1UK5 A;  3QUJ A;  3PDY A;  2V6Y A;  4HFB A;  3V5U A;  4YFS A;  2V26 A;  3R84 B;  3O1J A;  1HNW T;  2LE8 A;  3AE1 A;  1IJ5 A;  2VAS A;  2C5J A;  2LKG A;  2WB5 A;  3AVS A;  1N32 T;  5FL0 A;  2ACZ A;  2B76 A;  2XAF B;  3K3Q C;  4HFI A;  1HG2 A;  4EV6 A;  4YHH T;  3P4W A;  4LF9 T;  4DR7 T;  4JI4 T;  2WMO A;  1HX8 A;  3FZM B;  2A9U A;  3UT5 E;  5FVK A;  4DV5 T;  1NAF A;  3AEB A;  2FJD A;  2K3W A;  4MHC A;  4QH5 A;  4PFO A;  3RYH E;  1Z0P A;  3FXE B;  1IZN B;  4ILB A;  3ZMZ B;  3P50 A;  3UUM A;  2BG9 C;  4DR4 T;  4DV3 T;  3UU4 A;  1XMQ T;  2BG9 E;  5LGT B;  1X9B A;  1HFA A;  2NR4 A;  5JDM A;  5AQN B;  2IUB A;  2XQA A;  2WS3 A;  2GK9 A;  4L0R A;  4YHJ A;  2HH7 A;  1UUR A;  2FUP A;  2ODU A;  2WAU A;  4PW8 A;  4LFB T;  2LSY A;  1E1H B;  2XQ7 A;  4JBW F;  2LSI A;  4U31 A;  5LNK A;  2W00 A;  4JEU B;  2Q9Q D;  5J0Z A;  4IDP A;  4C91 A;  5LMU T;  3Q5E A;  4UEM A;  2M6I A;  1EZ3 A;  2VKD A;  2UUB T;  2KXP B;  2DLR A;  2V6X A;  1S94 A;  2NWB A;  2V7I A;  4H63 V;  1OXZ A;  3AED A;  2IC6 A;  3CPZ A;  3VKH A;  1T7S A;  2C0S A;  3C51 A;  4ERR A;  1HX1 B;  1Y01 A;  5BR8 T;  1YD8 G;  1MNE A;  2W63 A;  3BQL A;  4I4T E;  3KVB A;  4JLE A;  2V7M A;  3RKG A;  2IHR 1;  4KBM B;  1XNR T;  2H7V C;  4AQF A;  4IDQ A;  3PUV F;  3VR9 A;  4GOU A;  3AE7 A;  4X1Y E;  2ZMA A;  1GQE A;  2LM9 A;  2JIW A;  3AE9 A;  3NZQ A;  4CXY A;  5HEH A;  1UX5 A;  2KWH A;  3FXD B;  4E7S A;  3A7M A;  1D1C A;  4OHF A;  1AJ3 A;  3HKD E;  4IL4 A;  4CI1 B;  1LVK A;  3SFE A;  4DMV A;  2XSA A;  1FEW A;  2VB6 A;  1T98 A;  4UF0 A;  5IYZ E;  2WBL A;  4PNI A;  2QRX A;  4C90 A;  1IAP A;  1KNP A;  1D0Y A;  3UTK A;  1QSD A;  1WYC A;  1KEY A;  2WCA A;  4N78 D;  3CQC B;  1MMA A;  4PAG A;  4LF8 T;  3HKB E;  2WP9 A;  4UXN B;  4OYK A;  5AFU L;  3WI3 A;  5ADX L;  2EHO A;  1MIW A;  2CHO A;  2R6G F;  3Q5W A;  2BG9 A;  2KLQ A;  2J47 A;  2ES0 A;  3DJB A;  3ZJ2 A;  4DV2 T;  2XUE A;  2LLY A;  4HTE A;  2UU9 T;  2UXC T;  3N9P A;  1ZV4 X;  3ZN1 B;  3O4X E;  4ISS A;  4DUZ T;  4ZI3 C;  5LA6 E;  2D0U A;  3RX6 A;  3HKE E;  4KX6 A;  1ZEE A;  5FY1 A;  1HNZ T;  5FMN A;  1N34 T;  2CHN A;  2W2U A;  2WU2 A;  2BS4 A;  2XM1 A;  3ZST A;  3SWH A;  2ZM8 A;  4DMW A;  3S4U A;  2XZE A;  4TWD A;  5AQI B;  2CCQ A;  2YDR A;  4P0A A;  3P4Q A;  3RGL A;  5JH7 E;  2HPL A;  2EHO B;  1LVF A;  3OJA A;  2UXX B;  4QXH B;  2FBW A;  2JPF A;  4LF7 T;  3H3M A;  3I0Q A;  5AQO B;  2VQE T;  2BBJ A;  3F2E A;  3IA3 A;  3RYF E;  4AQY T;  3B13 A;  4YTN A;  4CI3 B;  4BJN A;  4O4I E;  1YXR A;  4DND A;  4GK5 E;  4AQG A;  4JI2 T;  5JQG E;  4HN9 A;  3CX6 B;  3G06 A;  2D0T A;  3N9L A;  2JQK A;  4L9I A;  3VU7 H;  4JI0 T;  4AIS A;  2RPA A;  4H9O C;  4Q25 A;  3AE5 A;  1J1J A;  5M4Y A;  1YW0 A;  5IHY A;  3ZN0 B;  4ASK A;  5ABF B;  3T1H T;  2V7L A;  3IF8 B;  3P4S A;  3M65 A;  2XY8 B;  4EXT A;  2IAK A;  4DID B;  2FJA A;  4WYV A;  5C8Y E;  5JDL A;  2L3L A;  5HXE A;  4YJ2 E;  5L3E B;  4DV7 T;  4QKN A;  4GKJ T;  2LHN A;  2Q9Q B;  4EEB A;  3TKL B;  2NP9 A;  3RKO A;  3OPC A;  5EK4 A;  2CRB A;  5FP3 A;  4XAX B;  4KI0 F;  2LEH A;  2QGS A;  3PUS A;  4X65 T;  3O1H A;  2YU2 A;  3ZT7 A;  3CVR A;  5ABF A;  3PUG A;  2PTF A;  2E9X D;  2AE9 A;  5L2L A;  2HN1 A;  3PUA A;  4X5T A;  2ZM2 A;  3KV5 A;  5AQG B;  4YSX A;  5AQK B;  2HHH T;  3UU8 A;  4DV1 T;  1KF6 A;  2BBH A;  2QYW A;  3C4Z A;  3LK4 2;  4KP3 C;  5AQU B;  5F5W A;  5IWA T;  3AB3 B;  3FBL A;  3NVO A;  5L3D B;  3ZLI A;  2KT9 A;  1G73 A;  1O3X A;  3KVA A;  4B6X A;  3PE0 A;  5GON E;  5H6R B;  5FL1 A;  3ZC0 A;  2WZI A;  3CKD A;  2OA5 A;  4B3S T;  4NUV A;  1KFY A;  4EYU A;  3ZYK A;  4EB6 E;  3AAE B;  5FXW A;  2Y8D A;  3LG7 A;  2XQ9 A;  3TLT A;  1MMD A;  2PJQ A;  3OVU A;  2J62 A;  1WFD A;  4PFP A;  4U74 A;  5F8P A;  5LP6 E;  2W4X A;  4JV5 T;  3UUX B;  1W09 A;  5HXH A;  2X9H A;  3LFM A;  5FXX A;  5JDG A;  3I9W A;  4IHJ E;  4DO0 A;  1UCU A;  2J1D G;  2N9D A;  4OFZ A;  4QH1 A;  4CI2 B;  2N1G A;  3QC9 A;  3UUN A;  4IE4 A;  1WYB A;  2BZB A;  4DV4 T;  4KHP T;  2JQH A;  1WR6 A;  5HAX A;  4PK6 A;  1D1B A;  2UUA T;  2E2A A;  1VRB A;  3H3A A;  3PUQ A;  4WZX A;  4ZZB A;  1XNQ T;  3P4R A;  4HFD A;  3FZF B;  2WSS V;  3RIU A;  3RC8 A;  2XSB A;  2KZ7 B;  1VCS A;  4GYR A;  4KUM B;  2X67 A;  3PU3 A;  2BG9 B;  2YDQ A;  3J9X 1;  2E9X A;  4DBQ A;  1MMN A;  4P09 A;  2UXB T;  2M6B A;  2AXD S;  1E7P A;  2V1D B;  2QVA A;  1XZY A;  3AAI A;  3FHN A;  3K1S A;  3LBX B;  3TLU A;  3UUL A;  3ZCI A;  3CQG B;  4FI5 A;  4A56 A;  4EAH A;  2JJ9 A;  2VK9 A;  5KMG P;  5LHG B;  4X62 T;  2BKN A;  3ZMT B;  3A5X A;  2E9X C;  3P8C D;  5L3F B;  3AXJ B;  4LF5 T;  2DWG A;  4K0U A;  3AEA A;  3AE8 A;  1YKE B;  5AQM B;  4EIW A;  5DQW A;  4J2C A;  2CPT A;  2KMF A;  2JMH A;  4UIG A;  3VHL A;  2WZH A;  1H7C A;  2HPJ A;  5TAO A;  4AKH A;  5KX5 E;  4ILU A;  2B1E A;  3GMI A;  1KK7 A;  4YTP A;  2LRK A;  4H63 H;  4KMC A;  5EK2 A;  1WRD A;  2D9D A;  3L3P A;  4GK0 E;  2SPC A;  2CA5 A;  1CHU A;  5AQQ B;  3VKG A;  3JC6 D;  4G63 A;  3F31 A;  2LSG A;  3KV4 A;  4HFH A;  4PJN A;  4Z91 A;  5AQR B;  3PUZ F;  4H9N C;  4ZI2 C;  5FKY A;  1XDP A;  1KNZ A;  4K0K T;  4UVB B;  4PK4 A;  4ZOL E;  1T72 A;  2H3R A;  3NZP A;  4YTM A;  5HCM A;  3HI2 A;  3X1D A;  2NW8 A;  4EGW A;  4OYJ A;  1R8I A;  2JQQ A;  2LOP A;  4U3C A;  4TWF A;  1UGO A;  2JQ9 A;  4UVA B;  3UQ4 A;  5LB7 B;  4TV9 E;  3W15 B;  1SHZ C;  5CA0 E;  5HEJ A;  2JMK A;  3HA4 A;  3PUW F;  4X1I E;  3TLW A;  3EVY A;  4IRE A;  3WAK A;  3ZT5 A;  3ZT6 A;  4TX5 A;  5A1L A;  1B7T A;  3HL6 A;  3RYC E;  3U3I A;  1WR0 A;  3AEE A;  1ZHC A;  3KIN B;  3LBX A;  3K3N A;  2XAQ B;  1T8B A;  3IEE A;  3DP7 A;  3JAD A;  2VKJ A;  4HWC A;  1D1A A;  4U2Y A;  2H7O A;  3RHW A;  3ZYL A;  4Z90 A;  1MIY A;  5AQJ B;  2VKH A;  3C64 A;  3P4P A;  5AQH B;  4BA9 A;  4ZI3 D;  1M7K A;  3FZK B;  1HF8 A;  3EI0 A;  5LJN A;  3NRY A;  3ZYM A;  4LF6 T;  4DBR A;  2VWA A;  3OKQ A;  3N9Q A;  5E0O A;  4I0U A;  3EAM A;  1OED E;  2X9X A;  3E0Z A;  3SOL A;  1U4Q A;  5JR9 B;  4X66 T;  4XBF B;  2LT3 A;  2ZLY A;  5JR9 A;  2IC9 A;  1MND A;  4HFE A;  2MPK A;  3PTR B;  3C4X A;  3J7Y q;  2IML A;  3H37 A;  3N2O A;  5HWY A;  5C2T A;  5LGN B;  4EOZ B;  2NOX A;  5AQT B;  2I0M A;  5LBM A;  1IBK T;  2H88 A;  1OWA A;  4IDZ A;  5HYA A;  3QOF A;  4IT4 A;  5CJ5 A;  1N33 T;  4DV0 T;  2FJE A;  5LBQ B;  5LOV E;  3ZCJ A;  3TLS A;  1OED B;  4LFA T;  1HTJ F;  1D0Z A;  5HEG A;  3MKD A;  3MK7 C;  4ZI7 E;  4NXN T;  1Y64 B;  2J4G A;  3RIA A;  3ZJ1 A;  1G8X A;  2D2S A;  4IIJ E;  3BQI A;  4ZI2 D;  3I0O A;  2V7J A;  5L3C B;  1NEK A;  2IDO B;  2YN6 A;  2Z6E A;  2XAG B;  3AAA B;  5AQL B;  5HXS A;  5J2U E;  2I6H A;  2W66 A;  3ONX A;  4I55 E;  1QLB A;  4O4J E;  3T8O A;  2Q9Q C;  4HEA A;  3NBX X;  4ZZC A;  3CX7 B;  3ZKR A;  1YKH B;  3KFW X;  1WCR A;  3Q5X A;  4MBQ A;  3VRA A;  3PUX F;  2WU5 A;  1US7 B;  3AEF A;  3VRB A;  2VL8 A;  4LFC T;  3LJC A;  2Q9Q A;  2X66 A;  1WLX A;  2YU1 A;  2C5K T;  2BS3 A;  4JEH B;  2YOE A;  3UFE A;  5AQS B;  5LYJ E;  1SUM B;  3QK6 A;  4COF A;  3JAE A;  5LCY A;  4BJM A;  4CZZ B;  3QB5 A;  5CFB A;  4H9S E;  4EZ4 A;  4DUY T;  2LSJ A;  3ANW A;  4IE6 A;  2DHR A;  2CLY B;  2V8S V;  4TNW A;  3VR8 A;  1J5W A;  4H9Q C;  5C3J A;  4JYA T;  2YK0 A;  2UXD T;  2XQ5 A;  3EUH A;  3L8R A;  2XQ4 A;  1JNR A;  2Y6X A;  4QX8 B;  3EDU A;  3JCF A;  1FMW A;  3Q9D A;  5EZY E;  5JDQ A;  3AA0 B;  4HKA A;  4FJO A;  4MAL A;  2OV9 A;  4HWH A;  3NRX A;  1XMO T;  3MXZ A;  3N2K E;  2RP4 A;  4ZHQ E;  2DI4 A;  1W9R A;  2YIN A;  5CA1 E;  1N36 T;  2MTQ A;  2FJB A;  2NTX A;  2ODV A;  4P1N A;  4A97 A;  4AKL A;  4YSY A;  2VQF T;  2VKO A;  4QH4 A;  5JDH A;  5J2T E;  3AE4 A;  5FYM A;  2XHE B;  4H9P C;  5HCJ A;  4DR5 T;  1NEN A;  4QWN B;  4CN6 A;  4B3M T;  4AIU A;  2A2F X;  2LHR A;  2CE7 A;  5CB4 E;  3AE3 A;  3NWI A;  3LK2 B;  4PJJ A;  5AQV B;  3AVR A;  3Q5D A;  1W0A A;  4JI8 T;  4IGU A;  2W0G A;  4DR6 T;  2BS2 A;  3FB2 A;  4I43 B;  4ILC A;  2M67 A;  2I59 A;  3BQK A;  4O4H E;  3MZK B;  1HR0 T;  2BKO A;  2VUR A;  2Y48 B;  5JRC A;  1W0B A;  3LDQ B;  4UR9 A;  2QA7 A;  3I1A A;  3MAC A;  2XQ8 A;  4HWD A;  2MOZ A;  2X68 A;  2NW7 A;  2XAS B;  3AEC A;  3RF1 A;  3RI5 A;  3RRW A;  5HWX A;  4X64 T;  4U72 A;  5L47 A;  2WMN A;  4X1K E;  3OBV E;  3FZH B;  3ZC1 A;  3OYX A;  5DAB A;  1I6Z A;  3UQ7 A;  4IDO A;  4O4L E;  5JRE A;  2CBJ A;  2KSR A;  4F6R C;  4NPP A;  3M3Z B;  4O8S A;  1IBL T;  4ZS2 A;  3AA7 B;  2LKH A;  4PK5 A;  3DTO A;  2YEV C;  4EED A;  3E22 E;  1S35 A;  3AXJ A;  4QXC B;  3PUY F;  2EHO C;  4A5X A;  5JDF A;  1CUN A;  3SS1 A;  1U5P A;  2V5C A;  3F57 A;  1SA0 E;  2VVN A;  3GN5 A;  3RH3 A;  3JC6 C;  4WBO A;  2IW5 B;  4YY3 T;  4DR2 T;  4IE5 A;  1X79 A;  3U78 A;  4ZS3 A;  4HWI B;  1BR2 A;  4U2Z A;  1BR4 A;  2D5U A;  2NTY A;  2E5V A;  4QX7 B;  4HFV A;  4CXX A;  5L3B B;  4YXD A;  5FY0 A;  1HG5 A;  4YJ3 E;  2E5L T;  2UXN B;  3ETU A;  2PFV A;  2WQY A;  3EDV A;  1DU2 A;  2PG8 A;  2BDE A;  4JI1 T;  1D0X A;  2K9A A;  4I50 E;  5AQP B;  3RYI E;  3L09 A;  4L5G A;  2MAW A;  2JRK A;  4V1A v;  4LF4 T;  4AKG A;  2DWK A;  1FJG T;  4NUU A;  2VL0 A;  4MLK A;  3KV6 A;  3ONJ A;  4PJL A;  3RIU C;  4JI6 T;  4NIQ A;  5HXR A;  4CN4 A;  5FXZ A;  1BR1 A;  3GA8 A;  2V6Y B;  3UU3 A;  5LXT E;  4UEL A;  2CWY A;  4MFR A;  4TUY E;  4WW0 A;  5CGM A;  3QB5 K;  4XZC A;  3UFG A;  3AEG A;  4G2A A;  2L9Q A;  4ADZ A;  4JI5 T;  2A3D A;  2XQ6 A;  3L39 A;  2BVM A;  4BAY B;  3EAB A;  3R6N A;  1YQ4 A;  4YT0 A;  2XQY A;  3KBT A;  4ILA A;  5L4E A;  3I9Y A;  4IE0 A;  4YLH A;  1MIV A;  2CXF A;  2CM0 A;  3K3O A;  3ONL C;  4TNV A;  1XWM A;  2KIN B;  2LSK A;  3ZEF B;  3EHZ A;  3ANW B;  2L8K A;  5LGU B;  2W61 A;  5LMN T;  3N9M A;  3KV9 A;  3PV0 F;  2WWU A;  4UVC B;  1LRZ A;  2N2N A;  4IE7 A;  1BR0 A;  5LHH B;  2WDR A;  4B3R T;  2K48 A;  4HFC A;  3A8Y C;  5FVL A;  2W62 A;  5HXC A;  5JDN A;  2XM2 A;  5JTG A;  3CML A;  3B57 A;  2WM9 A;  2DCF A;  3PJA A;  2C5I T;  3K8P C;  4IDN A;  3NKZ A;  1UX4 A;  3RC3 A;  1ZKE A;  4WNK A;  5BMV E;  4DR1 T;  2ACX A;  1J5E T;  4DV6 T;  3Q2M A;  4EYY R;  5ABH A;  3AE6 A;  1ZOY A; 
#chains in the Genus database with same CATH homology
 2MBG A;  2DNX A;  4CQI A;  4QHO A;  2P9B A;  1NWM X;  4EOZ B;  3CWZ B;  2CXD A;  3GN5 B;  3C50 A;  1VOM A;  4PJM A;  4X20 E;  3HKC E;  5DJQ C;  3KBU A;  4E7Z A;  3OYZ A;  3D0T A;  1V9D A;  4QXB B;  4M1P A;  3RPU A;  3C98 B;  1HS7 A;  3IBP A;  3N2G E;  5FXV A;  2MYS A;  2CXL A;  4HE8 A;  2V7K A;  2X0L B;  4OK0 A;  2E9X B;  3P7I A;  1FIO A;  3N9N A;  2X51 A;  3CX8 B;  5DQV A;  2CMR A;  4JUY A;  3ZMU B;  3BK9 A;  2G0U A;  3CQX C;  5LJM A;  2CWO A;  3MA9 A;  5H6Q B;  3PU8 A;  3ETV A;  3IHR A;  1QUU A;  3N5L A;  5F3J A;  2EHO D;  4O2A E;  2CLY C;  4H9R C;  2CEA A;  4HGA A;  2E8I A;  3O1I A;  5FNV E;  4CXW A;  3AA6 B;  4TV8 E;  3MJX A;  2XTL A;  4AKR B;  3HR0 A;  3PUR A;  3V5S A;  2RA1 A;  4UV8 B;  4EZH A;  3WAJ A;  2K5B B;  1IJ6 A;  3C4W A;  3ZPO A;  5JVD E;  3FBZ A;  3N9O A;  2X9Y A;  2A72 A;  4AXP A;  4UF0 B;  3AA1 B;  5LHI B;  2XAH B;  3SRZ A;  3ESL A;  5EK3 A;  2KND A;  2KWI B;  1MMG A;  2XAJ B;  2LJL A;  1LKX A;  5J1G A;  4P0B A;  4DVD A;  4UV9 B;  4IST A;  4WBN E;  4ANJ A;  5JRC B;  4TZ4 C;  2BVL A;  2PBI A;  3KDS E;  1FMV A;  3RRC A;  4Z8X A;  4AI6 A;  2ZM0 A;  4GIW A;  5LG4 A;  3E08 A;  1HCI A;  3GWH A;  3ZMS B;  2K24 A;  5ETW A;  2LOS A;  5KDM C;  3LK3 B;  3ZMV B;  2X9W A;  5JR9 C;  5L3G B;  3O9X A;  2NW9 A;  4GYS A;  5FY7 A;  4AKI A;  4AQF C;  4TN7 B;  3QUJ A;  3PDY A;  3V5U A;  4YFS A;  2V26 A;  3R84 B;  3O1J A;  2LE8 A;  1IJ5 A;  2VAS A;  2C5J A;  3AVS A;  2XAF B;  3K3Q C;  1HG2 A;  2WMO A;  1HX8 A;  3UT5 E;  1NAF A;  4PFO A;  4MHC A;  3RYH E;  1Z0P A;  3FXE B;  1IZN B;  3ZMZ B;  3UUM A;  5LGT B;  1HFA A;  5JDM A;  2GK9 A;  4L0R A;  4YHJ A;  2HH7 A;  2WAU A;  4PW8 A;  2ODU A;  2LSY A;  1E1H B;  5LNK A;  2LSI A;  2W00 A;  4JEU B;  2Q9Q D;  4C91 A;  4UEM A;  1EZ3 A;  2VKD A;  2KXP B;  2DLR A;  1S94 A;  2NWB A;  2V7I A;  4H63 V;  1OXZ A;  2IC6 A;  3CPZ A;  3VKH A;  2C0S A;  3C51 A;  4ERR A;  1YD8 G;  1MNE A;  2W63 A;  3BQL A;  4I4T E;  3KVB A;  4JLE A;  2V7M A;  5C8Y E;  4KBM B;  2H7V C;  4AQF A;  4GOU A;  4X1Y E;  2ZMA A;  2LM9 A;  3NZQ A;  4CXY A;  1UX5 A;  2KWH A;  3FXD B;  4E7S A;  1D1C A;  4OHF A;  1AJ3 A;  3HKD E;  4CI1 B;  1LVK A;  4DMV A;  1FEW A;  2VB6 A;  1T98 A;  4UF0 A;  5IYZ E;  2WBL A;  4PNI A;  4C90 A;  1IAP A;  1D0Y A;  3UTK A;  1QSD A;  1WYC A;  4N78 D;  3CQC B;  1MMA A;  4PAG A;  3HKB E;  4UXN B;  5AFU L;  4OYK A;  3WI3 A;  5ADX L;  2EHO A;  1MIW A;  4O2B E;  3Q5W A;  3ZJ2 A;  2KLQ A;  2ES0 A;  3DJB A;  2XUE A;  4HTE A;  3N9P A;  1ZV4 X;  3ZN1 B;  3O4X E;  4ISS A;  4ZI3 C;  5LA6 E;  2D0U A;  3RX6 A;  3HKE E;  5FY1 A;  1ZEE A;  5FMN A;  3SWH A;  2ZM8 A;  4DMW A;  3S4U A;  2CCQ A;  4P0A A;  5JH7 E;  2HPL A;  2EHO B;  1LVF A;  3OJA A;  2UXX B;  4QXH B;  2JPF A;  3I0Q A;  3F2E A;  3RYF E;  3B13 A;  4CI3 B;  4BJN A;  4O4I E;  4DND A;  4GK5 E;  4AQG A;  5JQG E;  4HN9 A;  3CX6 B;  2D0T A;  3N9L A;  4L9I A;  3VU7 H;  4H9O C;  5M4Y A;  1YW0 A;  5IHY A;  3ZN0 B;  4ASK A;  2V7L A;  3IF8 B;  3M65 A;  4EXT A;  2IAK A;  5L3E B;  5JDL A;  2L3L A;  5HXE A;  4YJ2 E;  4QKN A;  2LHN A;  2Q9Q B;  3TKL B;  2NP9 A;  3RKO A;  5EK4 A;  5FP3 A;  4XAX B;  2LEH A;  2QGS A;  3PUS A;  3O1H A;  2YU2 A;  3CVR A;  3PUG A;  2E9X D;  5L2L A;  3PUA A;  2ZM2 A;  3KV5 A;  4KP3 C;  3C4Z A;  3LK4 2;  3AB3 B;  3FBL A;  5L3D B;  3ZLI A;  2KT9 A;  1G73 A;  1O3X A;  3KVA A;  4B6X A;  3PE0 A;  5GON E;  5H6R B;  3ZC0 A;  3CKD A;  2OA5 A;  4NUV A;  4EYU A;  3ZYK A;  4EB6 E;  3AAE B;  5FXW A;  2Y8D A;  3LG7 A;  1MMD A;  2PJQ A;  4PFP A;  4U74 A;  5F8P A;  5LP6 E;  3UUX B;  5HXH A;  2X9H A;  3LFM A;  5FXX A;  5JDG A;  3I9W A;  4IHJ E;  4DO0 A;  1UCU A;  2J1D G;  2N9D A;  4OFZ A;  4CI2 B;  2N1G A;  3QC9 A;  3UUN A;  4IE4 A;  1WYB A;  2BZB A;  1WR6 A;  5HAX A;  4PK6 A;  1D1B A;  1VRB A;  3H3A A;  3PUQ A;  2WSS V;  3RC8 A;  2KZ7 B;  4GYR A;  4KUM B;  2X67 A;  3PU3 A;  3J9X 1;  2E9X A;  4DBQ A;  1MMN A;  4P09 A;  2V1D B;  3FHN A;  3AAI A;  3UUL A;  3ZCI A;  4EAH A;  3LBX B;  4EZ4 A;  5LHG B;  4A56 A;  3CQG B;  4FI5 A;  5KMG P;  2JJ9 A;  2VK9 A;  5L3F B;  3ZMT B;  3A5X A;  2E9X C;  3P8C D;  2DWG A;  4K0U A;  1YKE B;  4EIW A;  5DQW A;  4J2C A;  2KMF A;  4UIG A;  2JMH A;  3VHL A;  1H7C A;  2HPJ A;  5TAO A;  4AKH A;  5KX5 E;  4ILU A;  2B1E A;  3GMI A;  1KK7 A;  5EK2 A;  4H63 H;  4KMC A;  1WRD A;  4GK0 E;  3L3P A;  2SPC A;  2CA5 A;  3VKG A;  3JC6 D;  4G63 A;  3F31 A;  2LSG A;  3KV4 A;  4PJN A;  4ZI2 C;  4H9N C;  1KNZ A;  4UVB B;  4PK4 A;  4ZOL E;  2H3R A;  3NZP A;  3HI2 A;  2NW8 A;  4OYJ A;  2JQQ A;  2LOP A;  4UVA B;  4TV9 E;  3W15 B;  1SHZ C;  5CA0 E;  2JMK A;  3HA4 A;  4X1I E;  3EVY A;  3WAK A;  5A1L A;  4TX5 A;  1B7T A;  3HL6 A;  3RYC E;  3U3I A;  3KIN B;  1ZHC A;  3LBX A;  3K3N A;  2XAQ B;  3IEE A;  3DP7 A;  2VKJ A;  1D1A A;  2H7O A;  3ZYL A;  1MIY A;  4BA9 A;  2VKH A;  3C64 A;  4ZI3 D;  1HF8 A;  5LJN A;  3NRY A;  3ZYM A;  4DBR A;  2VWA A;  3OKQ A;  3N9Q A;  5E0O A;  2X9X A;  3E0Z A;  3SOL A;  1U4Q A;  5JR9 B;  4XBF B;  2LT3 A;  2ZLY A;  5JR9 A;  2IC9 A;  1MND A;  3PTR B;  3C4X A;  3J7Y q;  3H37 A;  3N2O A;  5HWY A;  2NOX A;  5LBM A;  1OWA A;  4IDZ A;  5HYA A;  5LOV E;  5LBQ B;  3ZCJ A;  1HTJ F;  1D0Z A;  3MKD A;  3MK7 C;  4ZI7 E;  1Y64 B;  3ZJ1 A;  1G8X A;  2D2S A;  4IIJ E;  3BQI A;  4ZI2 D;  3I0O A;  2V7J A;  5L3C B;  2Z6E A;  2XAG B;  3AAA B;  5HXS A;  5J2U E;  3ONX A;  4I55 E;  4O4J E;  3T8O A;  2Q9Q C;  4HEA A;  3NBX X;  3CX7 B;  1YKH B;  3KFW X;  3Q5X A;  4MBQ A;  1US7 B;  2VL8 A;  3LJC A;  2Q9Q A;  2X66 A;  1WLX A;  2YU1 A;  2C5K T;  4JEH B;  3UFE A;  5LYJ E;  3QK6 A;  5LCY A;  4BJM A;  4CZZ B;  4H9S E;  2LSJ A;  3ANW A;  4IE6 A;  2DHR A;  2CLY B;  5LGN B;  4H9Q C;  2YK0 A;  3EUH A;  2Y6X A;  4QX8 B;  3EDU A;  3Q9D A;  1FMW A;  5EZY E;  5JDQ A;  3AA0 B;  4HKA A;  4FJO A;  4MAL A;  3NRX A;  3MXZ A;  3N2K E;  2RP4 A;  4ZHQ E;  2DI4 A;  2YIN A;  5CA1 E;  2MTQ A;  2NTX A;  2ODV A;  4AKL A;  2VKO A;  5JDH A;  5J2T E;  5FYM A;  2XHE B;  4H9P C;  4QWN B;  2A2F X;  2LHR A;  2CE7 A;  5CB4 E;  4PJJ A;  3LK2 B;  3AVR A;  4IGU A;  2W0G A;  3FB2 A;  4I43 B;  2M67 A;  2I59 A;  3BQK A;  4O4H E;  3MZK B;  5JRC A;  2Y48 B;  2QA7 A;  3I1A A;  3MAC A;  2MOZ A;  2X68 A;  2NW7 A;  2XAS B;  3RRW A;  5HWX A;  4U72 A;  2WMN A;  4X1K E;  3OBV E;  3ZC1 A;  3OYX A;  5DAB A;  4O4L E;  5JRE A;  4F6R C;  4O8S A;  4ZS2 A;  3AA7 B;  4PK5 A;  3DTO A;  2YEV C;  3E22 E;  1S35 A;  4QXC B;  2EHO C;  5JDF A;  1CUN A;  3SS1 A;  1U5P A;  3F57 A;  1SA0 E;  3GN5 A;  3RH3 A;  3JC6 C;  4WBO A;  2IW5 B;  4IE5 A;  1X79 A;  3U78 A;  4ZS3 A;  1BR2 A;  1BR4 A;  2D5U A;  2NTY A;  4QX7 B;  4HFV A;  4CXX A;  5L3B B;  5FY0 A;  1HG5 A;  4YJ3 E;  2UXN B;  3ETU A;  2PFV A;  3EDV A;  2PG8 A;  2BDE A;  1D0X A;  2K9A A;  4I50 E;  3RYI E;  3L09 A;  4L5G A;  4V1A v;  2JRK A;  4AKG A;  2DWK A;  4NUU A;  4MLK A;  3KV6 A;  4PJL A;  5HXR A;  5FXZ A;  1BR1 A;  3GA8 A;  5LXT E;  4UEL A;  2CWY A;  4MFR A;  4TUY E;  4WW0 A;  4XZC A;  4G2A A;  2L9Q A;  4ADZ A;  2A3D A;  2BVM A;  4BAY B;  3R6N A;  2XQY A;  3KBT A;  3I9Y A;  4IE0 A;  4YLH A;  1MIV A;  2CXF A;  2CM0 A;  3K3O A;  2KIN B;  2LSK A;  3ZEF B;  3ANW B;  2L8K A;  5LGU B;  2W61 A;  3N9M A;  3KV9 A;  2WWU A;  4UVC B;  1LRZ A;  2N2N A;  4IE7 A;  1BR0 A;  5LHH B;  2K48 A;  5HXC A;  5JDN A;  2W62 A;  3CML A;  3B57 A;  2WM9 A;  2DCF A;  2C5I T;  3K8P C;  1UX4 A;  3RC3 A;  1ZKE A;  4WNK A;  5BMV E;  2ACX A;  3Q2M A;  4EYY R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...