1CUNA

Crystal structure of repeats 16 and 17 of chicken brain alpha spectrin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
213
structure length
213
Chain Sequence
b'MVHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQSVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALPHA SPECTRIN)
publication title Structures of two repeats of spectrin suggest models of flexibility.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 99
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1cunA02
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1cunA01
2ODUA 3UUNA 1AJ3A 1CUNA 2ODVA 1U5PA 1WLXA 1OWAA 3EDVA 1HCIA 3FB2A 1QUUA 3LBXB 3UULA 1S35A 2SPCA 1U4QA 3PE0A 3UUMA 3F31A 3LBXA
chains in the Genus database with same CATH superfamily
5JDHA 2J1DG 3IEEA 5GONE 4AKGA 2IMLA 4AKIA 3VR8A 2HN1A 2YDRA 4IL4A 1D1CA 4QX8B 4UV9B 1LVFA 3BQLA 2QYWA 3ZJ2A 4A56A 1ZP0A 3RLFF 3UU3A 4NPPA 4ANJA 3RC8A 3A7MA 4KHZF 3OPCA 4WBOA 4EIWA 5JDFA 2CBIA 3C4ZA 5CJ5A 3N9MA 3PU8A 1OEDA 5LG3A 2YDSA 1KF6A 3CPZA 5CB4E 4X1YE 1KEYA 3RRWA 3K3NA 4U7IA 2DLRA 2HPJA 3ESLA 2XQ7A 3ZMUB 2XSBA 2LKGA 4O4IE 2M67A 3L3PA 5L4EA 2UXBT 5DQWA 2JQHA 2LRLA 4LMJA 2V26A 3BQIA 4EGWA 3KBUA 3CMLA 3ZEFB 5FL0A 4PFPA 2CWYA 2CXDA 5IWAT 1IBMT 1SHZC 4U74A 1UX4A 2BG9C 1UURA 4LF9T 3VR9A 3NKZA 2JMKA 2VASA 4I4TE 4HWHA 1HX8A 1M7KA 2BS2A 2WU5A 2LSYA 2KNDA 2V7JA 4IGUA 5HXSA 5CA0E 3AXJA 2XQ4A 5CA1E 3ZT7A 2W61A 4ZI2C 5IYZE 4DV0T 4E7SA 2XQYA 3MA9A 4NIQA 2EHOB 4LF5T 5HXEA 2SPCA 2UUBT 3C50A 3FZMB 2W4XA 3B13A 2LM9A 4JEUB 4ZI3D 3PV0F 1O3XA 3UTKA 5C2TA 2BG9A 4AKRB 3AE6A 4FJOA 2PFVA 3I0QA 3TLVA 3PUQA 4GIWA 4WZXA 3WAKA 5FP3A 3C4WA 4HTEA 2CHOA 5HCJA 4O8SA 2CHNA 1G73A 2ZM8A 5AQFB 4HFDA 4AQYT 5AQUB 4PK4A 1IBLT 1FIOA 2FUPA 3ZT5A 3LSVA 4JI8T 3ZMVB 4O4LE 4AQFA 2V6YA 3PJAJ 3LFMA 2WS3A 2BDEA 3AE1A 3ZMTB 4LF6T 2XZEA 1T7SA 2W00A 4EV6A 2CE7A 3DP7A 1FEWA 2DWKA 3AE8A 4IREA 2V7KA 3KBTA 1N32T 2Z6EA 3HI2A 1B7TA 2AE9A 2BBJA 3CQGB 2RP4A 2OA5A 4XBFB 2VK9A 4ADZA 4AISA 3JAEA 5FY0A 3SRZA 2K5BB 2KZ7B 1CHUA 4Q25A 4DV2T 2LT3A 2W66A 1H7CA 1XNRT 2Q9QC 3KFWX 2K9AA 4G2AA 4C91A 2ODUA 2VVNA 3CWZB 4F6RC 3P4SA 4L9IA 2DNXA 4X1KE 5LBQB 2XY8B 5LNKA 4L0RA 3JC6D 3N9LA 4EZ4A 2XQ6A 2NTYA 2VKOA 3P4QA 2L3LA 3VRAA 5HEJA 4YFSA 1WCRA 4LMKA 5HWXA 2NW9A 3ZN1B 4U2YA 4IE7A 2MYSA 5FY1A 2E5VA 2J4GA 4IL9A 3P50A 4U7YA 5JDMA 4J2CA 2V7MA 4UV8B 3P4PA 2N9DA 1MNEA 3ANWB 3Q9DA 4KX6A 4QXCB 4DR1T 4E7ZA 5DJQC 3T1YT 4CQIA 4H63H 3BQKA 4IE4A 3CX8B 3VKHA 4UELA 5HCMA 5FY7A 4Z91A 2E9XB 3ZYKA 4B3RT 3UUMA 3LDQB 3MZKB 5L3EB 1N36T 4QXBB 4GK0E 1T8BA 4ZS2A 2V5CA 3C51A 4DV3T 3UT5E 2CWOA 3I9WA 1R8IA 2V1DB 3OYXA 4NXNT 2M6IA 2VKDA 5F5WA 3UUXB 4WW0A 4TUYE 4OHFA 2WSSV 2X51A 2WP9A 3UU6A 2IHR1 2P9BA 2YDQA 2ODVA 2W67A 1FJGT 5L3GB 3I0OA 2K48A 2X9HA 2XAQB 4A97A 2LSJA 2WWVA 3RYHE 3LK42 3V5UA 5C3JA 5EK3A 4DMWA 3WAJA 2XQ3A 3TLWA 3TLSA 5HEUA 1E1HB 5ABEA 3H3MA 3ZT6A 2VL8A 3EI0A 4ZI7E 5DQVA 3AAEB 4H9RC 1VCSA 2NR4A 4DVDA 2CEAA 4YHJA 3RIUA 3RGLA 2XQ9A 3L09A 5FXXA 2FJBA 3VU7H 3RQWA 4CI3B 4LMLA 3N9NA 1UGOA 2E2AA 2CPTA 4YHHT 1I94T 4IDZA 3HKCE 3F31A 2EHOA 2LHNA 4HFEA 2V5DA 4PJMA 2X66A 4PW8A 3ONLC 2CMRA 2XPKA 3RRCA 3TLTA 3EAMA 2WDRA 1WR0A 2FJAA 5AQMB 3FZLB 2YEVC 4YTMA 2WY2A 4HFHA 1XZYA 1T72A 2VKJA 3N9QA 3N2KE 2QRXA 1QLBA 3CK6A 2KWIB 2BS4A 3K3QC 5DABA 4UIGA 2DHRA 2BKNA 2ES0A 3PJAA 3BK9A 3N9OA 3HR0A 1HNXT 5FYMA 2WWUA 3Q2MA 4YTNA 2PG8A 4YXDA 1W0BA 3QUJA 2UXDT 4UEMA 5AQIB 2V6XA 1ZOYA 3MKDA 4GOUA 3FBLA 4EOZB 1IAPA 1E2AA 3AEBA 2J62A 4JLEA 2NW8A 4QXHB 1MMNA 4BA9A 2RPAA 3ZN0B 4DV1T 5LOVE 3HKDE 2E9XC 2X0YA 4I0UA 3P7IA 1YW0A 3PURA 4O4HE 5L47A 1NWMX 5EZYE 1MMAA 1LVKA 3O9XA 3W15B 5HEGA 5AQJB 4DR6T 2Q9QB 2X9YA 1QSDA 4P09A 3AE7A 5HEOA 5KX5E 2NW7A 4UF0B 5AQTB 4TNWA 4CN6A 1KNRA 2A9UA 2XAFB 4KP3C 4DO0A 3ANWA 2LEHA 4WNKA 4JBWF 3DJBA 3FB2A 2VB6A 4UVCB 3AEEA 1XMOT 2I6HA 3LK3B 3KV5A 4P0BA 4QX7B 2LSKA 2E9XA 3H37A 2ACXA 3JAFA 4LFAT 3NBXX 1IJ5A 1T98A 1OEDE 3AE3A 4CN1A 1S35A 4FI5A 2CA5A 5J1GA 2C5JA 3FXDB 4HFVA 1LKXA 5LG4A 1W0AA 3PUVF 2H7OA 2XAHB 4IDPA 1MIWA 5HYAA 5JDNA 1WYCA 5JDLA 3R6NA 1HF8A 1I6ZA 1S94A 3PU3A 3RYCE 3AA7B 5M4YA 2LHRA 1E7PA 3AEAA 3AA0B 4U2ZA 2K3WA 2XUEA 4UXNB 3B5MA 4IE6A 3R84B 4X20E 2WB5A 2KXPB 3G06A 4ILBA 3T8OA 4QHOA 5FXWA 2HH7A 2D9DA 3GN5B 5ABHA 4YY3T 3ZLIA 2XQ8A 2I0MA 3OVUA 2KINB 2UUAT 1D1BA 5IHYA 2B76A 2XJ7A 3ONJA 3I9YA 1X9BA 3AE4A 5HXHA 3A5XA 3LBXA 1W09A 3AEDA 2EHOD 2JJ9A 3KV9A 1DU2A 1FMWA 2GK9A 2LE8A 3ZYMA 4CXWA 4AQGA 3Q5DA 3AAIA 3O1HA 5LMUT 5AQLB 5J0ZA 3UFEA 3RKOA 3OBVE 5LA6E 4GKJT 3JADA 2NOXA 1JNRA 2ZM2A 2KLQA 1ZEEA 2LJLA 3SFEA 3N2OA 4PJJA 1HNZT 2PBIA 5LGUB 4OFZA 3CX7B 4CI1B 4BAYB 2OV9A 5L4HA 5CGMA 4ISSA 2BS3A 5HWYA 1V9DA 1OXZA 2OLTA 3VRBA 2BG9E 3IA3A 5KMGP 4X66T 2BBHA 3RYIE 2Y6XA 1LRZA 3J7Yq 4YSYA 2QA7A 2XAGB 5LHHB 3RI5A 5L3FB 1NEKA 4AKHA 3CVRA 1HX1B 4YJ2E 2CRBA 3WI3A 2IW5B 4JUYA 3B57A 1N34T 5BR8T 4KHPT 4QH1A 2MTQA 3UU5A 4G63A 4I55E 1KK7A 4HFIA 2M6BA 3TKLB 3AB3B 3C98B 2G0UA 2J47A 2IC6A 2VL0A 1VCTA 1KNPA 4UVAB 1FMVA 4ASKA 1D0XA 5LHIB 3QNUA 2BVLA 2LSIA 2MBGA 3GMIA 3PTRB 5FMNA 4JV5T 3CQXC 2YU1A 4X65T 2WBLA 2UXCT 2QVAA 2H7VC 4HKAA 3ABVA 5ABGA 4H63V 1D1AA 3PUGA 4IT4A 5JVDE 3I1AA 1WFDA 5LCYA 4O2AE 2CXLA 3OTOT 4DBQA 3ONXA 4DV7T 3HA4A 2JPFA 3ZC1A 2Y8DA 2FBWA 4HWCA 3LG7A 3O1IA 1G8XA 4JYAT 2XASB 3EDVA 2DI4A 4BJMA 1HTJF 2X68A 5AQKB 4QH5A 2Q9QA 3EHZA 4N78D 2HPLA 5AQHB 2C0SA 2KT9A 4UF0A 1N33T 1VRBA 3ETUA 4PFOA 2X67A 5JH7E 2PJQA 2ZM0A 2H3RA 2WQYA 4HN9A 2K24A 4B3TT 4L5GA 4IIJE 2DWGA 5AQOB 5LXTE 5HXCA 5H6QB 4OYJA 2C5KT 4ZI3C 1HR0T 5FL1A 4COFA 4JI6T 2VWAA 3PDYA 4K0KT 2LM2A 5LB7B 2W62A 1IZNB 2E5LT 5HEHA 4TX5A 3VHLA 2V7IA 3QK6A 5TAOA 4H9SE 4AI6A 3RKGA 4IE0A 3ZCIA 4ZOLE 4GYRA 3H3AA 2JMHA 2XSAA 4IHJE 3NZPA 4X62T 3GN5A 5E0OA 3PUZF 4DNDA 3RYFE 2L9QA 2IUBA 2WCAA 2YINA 3ZYLA 5ETWA 3C4XA 3OYZA 3O4XE 4HWFA 4LFCT 4H9PC 3PUYF 4AIUA 2VKHA 5L3CB 3RHWA 2LOPA 4TWFA 2X0HA 4AXPA 3AE9A 4YSXA 2CXFA 5EK2A 4ILAA 3CIRA 4ZI2D 4KMCA 2JRKA 5LGTB 4TZ4C 4U33A 2H89A 4EYYR 1MIYA 3M3ZB 2YU2A 1XMQT 3KV6A 4HEAA 4HWDA 3L8RA 4EEBA 4GKKT 4CZZB 3O1JA 1CUNA 1XNQT 3RPUA 4DUYT 3JC6C 5JR9B 5JTGA 5F8PA 4XZCA 2R6GF 1YXRA 5AQVB 2XM2A 2N1GA 3MJXA 2B1EA 2W2UA 2X0LB 3UFGA 3M65A 3FXEB 3RIFA 5ABFB 3AE2A 1NENA 2LLYA 2VQET 5J2TE 1SA0E 4AKLA 2N2NA 2WU2A 2X9XA 2W63A 3CKDA 5L3DB 4OX9T 5LYJE 5ADXL 5JRCB 4EAHA 1WLXA 3OJAA 2Y48B 4ISTA 2IC9A 5AFUL 2UUCT 4WBNE 4IDOA 3OKQA 2E8IA 1IBKT 1IJ6A 1L0VA 3GWHA 2KMFA 5LP6E 1US7B 5LJMA 4B3ST 3NRYA 1SUMB 1UCUA 2BZBA 4ZHQE 2DL1A 1UK5A 4PK5A 5CFBA 4CI2B 2UXXB 3HKBE 2XM1A 1X79A 3AECA 2XHEB 4X1IE 3F57A 3MACA 2WZIA 2QGSA 3PE0A 1XDOA 3CX6B 2NP9A 4GK5E 2Q9QD 2C5IT 4ILCA 3A8YC 5L3BB 5AQRB 4QH4A 2ZLYA 1BR1A 5KDMC 3EVYA 5BMVE 4HGAA 3C64A 1ZKEA 3PUWF 5LJNA 2VVSA 4EEDA 5AQSB 3X1DA 2JQ9A 3AA1B 5HAXA 4K0UA 4X5TA 3ZJ1A 2ZM6T 4DIDB 5EK4A 3J9X1 3RQUA 2LKHA 1U4QA 3EDUA 4EB6E 3JCFA 1BR2A 2LSGA 3AEFA 4MALA 2KSRA 1BR0A 3K1SA 5FXVA 3KINB 4DR5T 2HN2A 4H9OC 2A2FX 1WRDA 3IF8B 4MFRA 3EABA 2IAKA 3IHRA 2LRKA 3UQ7A 4JI7T 5IUXA 5L2LA 3N9PA 3ZSTA 3AA6B 2D2SA 3K3OA 4JI3T 4DMVA 4TV9E 5JREA 2MPKA 4YT0A 2BKPA 2NTXA 4JI1T 2WAUA 2MAWA 3LK2B 4IDNA 2NWBA 1EZ3A 4AQFC 5FVKA 3QB5A 2PTFA 4MHCA 4CN4A 3HKEE 4LF8T 4IE5A 3NRXA 4WYVA 4TV8E 2IDOB 4CXXA 5JR9C 4DBRA 4HWIB 3P4RA 1AJ3A 5AQNB 4DR4T 1U5PA 4NUUA 1HCIA 2CLYC 2I59A 5AQPB 4PNIA 5LMNT 3S4UA 3NWIA 1MMGA 3AAAB 2W0GA 4LF4T 4Z8XA 2X9WA 5KXJA 4NUVA 1D0ZA 1GQEA 4OK0A 4LF7T 4ZXLA 2LOSA 3NZQA 5C8YE 3ZPOA 3SFDA 4KI0F 4MLKA 3SS1A 1YKHB 3KDSE 4DV5T 3FZFB 4PJNA 4DUZT 4JI0T 4ZS3A 3U3IA 3LJCA 3F2EA 5JR9A 4JI5T 1W9RA 2YOEA 5FVLA 4HE8A 3K8PC 1NAFA 3ZKRA 1WYBA 2A72A 3ETVA 3HL6A 4CXYA 4C90A 5ABFA 1HG5A 3MXZA 4A5XA 1HNWT 1BR4A 4QWNB 4TNVA 4B6XA 4O4JE 1MMDA 5FXZA 4UR9A 3N5LA 4BJNA 4PK6A 3Q5XA 3ZC0A 3QC9A 4M1PA 2JQKA 4B3MT 3NVOA 5JRCA 2ZMAA 4IDQA 3MK7C 3P4WA 2CCQA 3VKGA 2L8KA 1YKEB 1J1JA 3ZSSA 3CQCB 4ZZCA 2WZHA 2JIWA 3RF1A 1OEDB 3V5SA 3FBZA 4DV4T 4U3CA 2BKOA 3TLUA 3U78A 2D0UA 3ZCJA 4A98A 4HFBA 2FJEA 1YQ3A 1Y64B 4NXMT 2V7LA 2D5UA 2E9XD 2WM9A 1SE7A 5LGNB 1KNZA 1MIVA 4JI4T 2KWHA 1WR6A 1XWMA 4JEHB 3L39A 4GYSA 1Y01A 4OYKA 2XQ5A 3FZHB 4UVBB 3UQ4A 4H9QC 3RIUC 2UXNB 3QB5K 1HFAA 2FJDA 3AEGA 4U72A 3GA8A 3AVRA 2JQQA 5AQGB 4I50E 4ZZBA 2YK0A 2EHOC 2ACZA 1J5WA 4YSZA 1VOMA 1Z8UA 2YN6A 4DR3T 4KBMB 3Q5WA 1ZHCA 4YTPA 2H88A 2VURA 2IIUA 3AXJB 3E22E 4U31A 4HFCA 3AE5A 5JDQA 5FNVE 4ERRA 4MBQA 3Q5EA 1D0YA 1ZV4X 3UUNA 5LBMA 5J2UE 2AXDS 1HS7A 3RIAA 2V8SV 3P8CD 4TN7B 4V1Av 4EZHA 3LBXB 4PAGA 3SWHA 5A1LA 2DCFA 1JNZA 2WDQA 4LFBT 4P1NA 2WMOA 2BG9B 3FHNA 4ZEYA 1Z0PA 2WMNA 3KVAA 1YD8G 2YKSA 2MOZA 4PJLA 4TWDA 1XDPA 2XAJB 4TWHA 2VQFT 3RH3A 4O2BE 3N2GE 3FZKB 5HXRA 3DTOA 3KV4A 5F3JA 4DR7T 3D0TA 2CBJA 3ZMSB 2HHHT 1OWAA 2RA1A 3UU8A 4Z90A 2XQAA 1UX5A 4XAXB 1KFYA 2A3DA 5FKYA 4X64T 2V6YB 4I43B 1MNDA 3UULA 4ILUA 4EXTA 3ZMZB 5LHGB 3KVBA 3E08A 1YQ4A 3IBPA 3UUBA 3T1HT 1QUUA 3SOLA 4H9NC 2UU9T 5H6RB 2WDVA 5JDGA 2BVMA 4YJ3E 2CLYB 3PUXF 1M62A 4QKNA 1J5ET 4JI2T 3RX6A 4DR2T 4EYUA 1HG2A 3RC3A 3E0ZA 2F4VT 3AVSA 2CM0A 1OEDC 4F8HA 4YLHA 3PUSA 5AQQB 4DV6T 3EUHA 5JQGE 2XTLA 3PUAA 4KUMB 3UU4A 2D0TA 1UUSA 3QOFA 4P0AA
chains in the Genus database with same CATH topology
3LK2B 2NWBA 5JDHA 4H63V 1D1AA 1EZ3A 2J1DG 3IEEA 5GONE 4AQFC 3L09A 4AKGA 3PUGA 5FXXA 4MHCA 3VU7H 4CI3B 4AKIA 3HKEE 5JVDE 3I1AA 1D1CA 3N9NA 4QX8B 4UV9B 1LVFA 3BQLA 5LCYA 4IE5A 4O2AE 3ZJ2A 3NRXA 2CXLA 4A56A 4DBQA 3ONXA 3HA4A 2JPFA 4TV8E 3ZC1A 4CXXA 4IDZA 2Y8DA 4ANJA 3HKCE 3F31A 2EHOA 3RC8A 5JR9C 2LHNA 4DBRA 4PJMA 1AJ3A 2X66A 4WBOA 3LG7A 4EIWA 4PW8A 5JDFA 1U5PA 1G8XA 2CMRA 3O1IA 4NUUA 2XASB 3RRCA 1HCIA 3EDVA 2CLYC 2I59A 3C4ZA 4PNIA 2DI4A 3N9MA 3PU8A 3S4UA 4BJMA 1HTJF 1MMGA 2X68A 3AAAB 2W0GA 3CPZA 5CB4E 2Q9QA 4X1YE 2X9WA 4Z8XA 4N78D 2HPLA 2YEVC 3RRWA 3K3NA 2DLRA 2HPJA 2C0SA 3ESLA 2KT9A 4NUVA 1D0ZA 3ZMUB 4UF0A 4OK0A 2VKJA 1VRBA 3ETUA 3N9QA 4PFOA 2X67A 3N2KE 5JH7E 4O4IE 2LOSA 3NZQA 2PJQA 5C8YE 3ZPOA 2M67A 2ZM0A 4MLKA 2KWIB 2H3RA 3L3PA 3K3QC 5DQWA 4HN9A 3SS1A 1YKHB 2V26A 2K24A 3BQIA 5DABA 3KBUA 3KDSE 3CMLA 4PJNA 4UIGA 3ZEFB 4L5GA 2DHRA 4PFPA 2ES0A 2CWYA 2CXDA 3BK9A 3N9OA 4IIJE 2DWGA 1SHZC 4U74A 3HR0A 1UX4A 5FYMA 4ZS3A 5LXTE 5HXCA 3U3IA 5H6QB 2WWUA 3LJCA 2JMKA 3F2EA 3Q2MA 5JR9A 2VASA 4I4TE 4OYJA 2C5KT 2PG8A 1HX8A 4ZI3C 3QUJA 2LSYA 4UEMA 4HE8A 3K8PC 1NAFA 3MKDA 2KNDA 2V7JA 2VWAA 4GOUA 3FBLA 1WYBA 2A72A 3PDYA 3ETVA 4IGUA 3HL6A 4CXYA 4EOZB 1IAPA 5HXSA 2W62A 1IZNB 4C90A 4TX5A 3VHLA 1HG5A 2V7IA 2NW8A 3MXZA 3QK6A 4JLEA 5TAOA 5CA0E 1BR4A 4H9SE 4QWNB 4QXHB 4AI6A 1MMNA 4B6XA 4BA9A 5CA1E 4O4JE 1MMDA 5FXZA 3N5LA 4BJNA 4PK6A 2W61A 3Q5XA 3ZN0B 3ZC0A 5LOVE 4IE0A 3QC9A 3ZCIA 3HKDE 4ZI2C 5IYZE 4M1PA 4ZOLE 2E9XC 4GYRA 3H3AA 2JMHA 4IHJE 3NZPA 5JRCA 2ZMAA 3P7IA 3MK7C 1YW0A 4E7SA 2CCQA 2XQYA 3MA9A 3GN5A 2EHOB 5HXEA 5E0OA 3VKGA 3PURA 2SPCA 2L8KA 4DNDA 3C50A 1YKEB 4O4HE 3RYFE 2L9QA 3CQCB 3B13A 2LM9A 1NWMX 2YINA 4JEUB 5EZYE 5ETWA 3ZYLA 4ZI3D 1MMAA 3C4XA 1O3XA 3OYZA 3O4XE 3UTKA 4H9PC 1LVKA 3V5SA 2VKHA 3O9XA 3FBZA 4AKRB 3W15B 5L3CB 4FJOA 3U78A 2Q9QB 2X9YA 2D0UA 3ZCJA 2LOPA 2PFVA 3I0QA 1QSDA 4P09A 3PUQA 4AXPA 4GIWA 3WAKA 1Y64B 5FP3A 5KX5E 2V7LA 2CXFA 3C4WA 5EK2A 2NW7A 4UF0B 4HTEA 4O8SA 1G73A 2D5UA 4ZI2D 2XAFB 4KP3C 4DO0A 2E9XD 4KMCA 3ANWA 2ZM8A 2LEHA 2WM9A 4WNKA 2JRKA 5LGTB 4TZ4C 5LGNB 1KNZA 1MIVA 3DJBA 3FB2A 2VB6A 4PK4A 4UVCB 2KWHA 1WR6A 4EYYR 4JEHB 1FIOA 1MIYA 4GYSA 2YU2A 4OYKA 3LK3B 3KV5A 3KV6A 4HEAA 4P0BA 4QX7B 4UVBB 3ZMVB 2LSKA 4H9QC 4O4LE 4AQFA 2E9XA 4CZZB 2UXNB 3H37A 3O1JA 1CUNA 1HFAA 2ACXA 3NBXX 1IJ5A 3LFMA 1T98A 2BDEA 4U72A 3RPUA 3ZMTB 2W00A 3GA8A 2CE7A 3JC6C 5JR9B 5F8PA 3AVRA 4XZCA 2JQQA 3DP7A 1FEWA 2DWKA 1S35A 4FI5A 2CA5A 4I50E 2N1GA 5J1GA 2C5JA 2V7KA 3KBTA 3MJXA 2B1EA 3FXDB 2Z6EA 3HI2A 4HFVA 1LKXA 1B7TA 2X0LB 5LG4A 2H7OA 2YK0A 2XAHB 2EHOC 3CQGB 3M65A 2RP4A 1MIWA 2OA5A 5HYAA 5JDNA 4XBFB 1VOMA 1WYCA 2VK9A 4ADZA 3FXEB 5JDLA 4KBMB 3Q5WA 3R6NA 1HF8A 1ZHCA 5FY0A 1S94A 3E22E 3SRZA 3PU3A 2K5BB 2KZ7B 3RYCE 5J2TE 1SA0E 4AKLA 3AA7B 5M4YA 2LHRA 2N2NA 3AA0B 2X9XA 2W63A 3CKDA 2XUEA 4UXNB 5L3DB 2LT3A 1H7CA 5LYJE 5ADXL 5FNVE 5JDQA 4ERRA 2Q9QC 3KFWX 4IE6A 2K9AA 4MBQA 4G2AA 3R84B 4C91A 1D0YA 2ODUA 1ZV4X 4X20E 2KXPB 5JRCB 3T8OA 5LBMA 3CWZB 3UUNA 4QHOA 4EAHA 5FXWA 4F6RC 5J2UE 2HH7A 3GN5B 1HS7A 4L9IA 1WLXA 2DNXA 4X1KE 3OJAA 5LBQB 2Y48B 4ISTA 2IC9A 3ZLIA 5AFUL 3P8CD 5LNKA 4WBNE 2KINB 4L0RA 4TN7B 4V1Av 1D1BA 3JC6D 5IHYA 3OKQA 3N9LA 4EZHA 3LBXB 2E8IA 4EZ4A 1IJ6A 2NTYA 3GWHA 4PAGA 2KMFA 2VKOA 3SWHA 5A1LA 3I9YA 5LP6E 2DCFA 2L3LA 1US7B 5LJMA 4YFSA 3NRYA 5HXHA 3A5XA 1UCUA 2BZBA 3LBXA 2WMOA 2EHOD 2JJ9A 3KV9A 4ZHQE 3FHNA 5HWXA 1Z0PA 2WMNA 3KVAA 4PK5A 2NW9A 1FMWA 4CI2B 2GK9A 1YD8G 2UXXB 3HKBE 3ZN1B 4IE7A 1X79A 2MOZA 2LE8A 4PJLA 3ZYMA 2MYSA 4AQGA 4CXWA 5FY1A 2XAJB 2XHEB 4X1IE 3AAIA 3F57A 3O1HA 3MACA 3RH3A 4J2CA 5JDMA 2QGSA 2V7MA 4O2BE 4UV8B 3N2GE 3UFEA 3RKOA 2N9DA 1MNEA 3OBVE 3PE0A 3CX6B 3ANWB 2NP9A 3Q9DA 4GK5E 4QXCB 5HXRA 2Q9QD 5LA6E 2NOXA 2C5IT 3DTOA 4E7ZA 3KV4A 5DJQC 4CQIA 4H63H 2ZM2A 5L3BB 2KLQA 5F3JA 1ZEEA 2LJLA 3BQKA 2ZLYA 3D0TA 3N2OA 3ZMSB 1BR1A 4PJJA 5KDMC 3EVYA 1OWAA 2RA1A 2PBIA 4IE4A 5BMVE 3CX8B 4HGAA 3C64A 5LGUB 1UX5A 1ZKEA 3CX7B 4OFZA 4XAXB 3VKHA 4CI1B 4UELA 4BAYB 5LJNA 5FY7A 2A3DA 2E9XB 4ISSA 3ZYKA 5HWYA 1V9DA 4I43B 1OXZA 3UUMA 3MZKB 1MNDA 3UULA 5L3EB 4ILUA 4QXBB 5KMGP 4GK0E 4EXTA 3ZMZB 5LHGB 3KVBA 3AA1B 5HAXA 4ZS2A 4K0UA 3E08A 3ZJ1A 3C51A 3RYIE 5EK4A 3UT5E 2CWOA 3J9X1 2Y6XA 3IBPA 3I9WA 1QUUA 2V1DB 3OYXA 1LRZA 3SOLA 4H9NC 3J7Yq 2QA7A 2XAGB 5LHHB 1U4QA 5L3FB 4AKHA 5H6RB 2VKDA 3EDUA 4EB6E 5JDGA 3UUXB 3CVRA 4WW0A 4TUYE 4OHFA 2WSSV 2BVMA 1BR2A 4YJ2E 2X51A 2LSGA 4MALA 4YJ3E 3WI3A 2CLYB 2IW5B 1BR0A 5FXVA 3KINB 2P9BA 4JUYA 3B57A 4H9OC 2ODVA 4QKNA 2A2FX 1WRDA 3IF8B 2MTQA 3RX6A 5L3GB 4G63A 3I0OA 2K48A 1KK7A 2X9HA 4I55E 2XAQB 1HG2A 4EYUA 2LSJA 4MFRA 3RC3A 3TKLB 2IAKA 3C98B 3AB3B 3IHRA 3LK42 3RYHE 3V5UA 3E0ZA 2G0UA 3AVSA 2CM0A 2IC6A 5EK3A 4UVAB 4DMWA 1FMVA 3WAJA 4ASKA 1D0XA 4YLHA 5LHIB 5L2LA 3PUSA 3N9PA 1E1HB 2BVLA 2LSIA 2VL8A 2MBGA 4ZI7E 3AA6B 2D2SA 3EUHA 5DQVA 5JQGE 3K3OA 2XTLA 4DMVA 3AAEB 4TV9E 3GMIA 4H9RC 5JREA 3PUAA 3PTRB 5FMNA 3CQXC 4KUMB 2YU1A 2WBLA 2NTXA 4DVDA 2D0TA 2CEAA 4P0AA 2H7VC 2WAUA 4HKAA 4YHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODU A;  3UUN A;  1AJ3 A;  1CUN A;  2ODV A;  1U5P A;  1WLX A;  1OWA A;  3EDV A;  1HCI A;  3FB2 A;  1QUU A;  3LBX B;  3UUL A;  1S35 A;  2SPC A;  1U4Q A;  3PE0 A;  3UUM A;  3F31 A;  3LBX A; 
#chains in the Genus database with same CATH topology
 5JDH A;  2J1D G;  3IEE A;  5GON E;  4AKG A;  2IML A;  4AKI A;  3VR8 A;  2HN1 A;  2YDR A;  4IL4 A;  1D1C A;  4QX8 B;  4UV9 B;  1LVF A;  3BQL A;  2QYW A;  3ZJ2 A;  4A56 A;  1ZP0 A;  3RLF F;  3UU3 A;  4NPP A;  4ANJ A;  3RC8 A;  3A7M A;  4KHZ F;  3OPC A;  4WBO A;  4EIW A;  5JDF A;  2CBI A;  3C4Z A;  5CJ5 A;  3N9M A;  3PU8 A;  1OED A;  5LG3 A;  2YDS A;  1KF6 A;  3CPZ A;  5CB4 E;  4X1Y E;  1KEY A;  3RRW A;  3K3N A;  4U7I A;  2DLR A;  2HPJ A;  3ESL A;  2XQ7 A;  3ZMU B;  2XSB A;  2LKG A;  4O4I E;  2M67 A;  3L3P A;  5L4E A;  2UXB T;  5DQW A;  2JQH A;  2LRL A;  4LMJ A;  2V26 A;  3BQI A;  4EGW A;  3KBU A;  3CML A;  3ZEF B;  5FL0 A;  4PFP A;  2CWY A;  2CXD A;  5IWA T;  1IBM T;  1SHZ C;  4U74 A;  1UX4 A;  2BG9 C;  1UUR A;  4LF9 T;  3VR9 A;  3NKZ A;  2JMK A;  2VAS A;  4I4T E;  4HWH A;  1HX8 A;  1M7K A;  2BS2 A;  2WU5 A;  2LSY A;  2KND A;  2V7J A;  4IGU A;  5HXS A;  5CA0 E;  3AXJ A;  2XQ4 A;  5CA1 E;  3ZT7 A;  2W61 A;  4ZI2 C;  5IYZ E;  4DV0 T;  4E7S A;  2XQY A;  3MA9 A;  4NIQ A;  2EHO B;  4LF5 T;  5HXE A;  2SPC A;  2UUB T;  3C50 A;  3FZM B;  2W4X A;  3B13 A;  2LM9 A;  4JEU B;  4ZI3 D;  3PV0 F;  1O3X A;  3UTK A;  5C2T A;  2BG9 A;  4AKR B;  3AE6 A;  4FJO A;  2PFV A;  3I0Q A;  3TLV A;  3PUQ A;  4GIW A;  4WZX A;  3WAK A;  5FP3 A;  3C4W A;  4HTE A;  2CHO A;  5HCJ A;  4O8S A;  2CHN A;  1G73 A;  2ZM8 A;  5AQF B;  4HFD A;  4AQY T;  5AQU B;  4PK4 A;  1IBL T;  1FIO A;  2FUP A;  3ZT5 A;  3LSV A;  4JI8 T;  3ZMV B;  4O4L E;  4AQF A;  2V6Y A;  3PJA J;  3LFM A;  2WS3 A;  2BDE A;  3AE1 A;  3ZMT B;  4LF6 T;  2XZE A;  1T7S A;  2W00 A;  4EV6 A;  2CE7 A;  3DP7 A;  1FEW A;  2DWK A;  3AE8 A;  4IRE A;  2V7K A;  3KBT A;  1N32 T;  2Z6E A;  3HI2 A;  1B7T A;  2AE9 A;  2BBJ A;  3CQG B;  2RP4 A;  2OA5 A;  4XBF B;  2VK9 A;  4ADZ A;  4AIS A;  3JAE A;  5FY0 A;  3SRZ A;  2K5B B;  2KZ7 B;  1CHU A;  4Q25 A;  4DV2 T;  2LT3 A;  2W66 A;  1H7C A;  1XNR T;  2Q9Q C;  3KFW X;  2K9A A;  4G2A A;  4C91 A;  2ODU A;  2VVN A;  3CWZ B;  4F6R C;  3P4S A;  4L9I A;  2DNX A;  4X1K E;  5LBQ B;  2XY8 B;  5LNK A;  4L0R A;  3JC6 D;  3N9L A;  4EZ4 A;  2XQ6 A;  2NTY A;  2VKO A;  3P4Q A;  2L3L A;  3VRA A;  5HEJ A;  4YFS A;  1WCR A;  4LMK A;  5HWX A;  2NW9 A;  3ZN1 B;  4U2Y A;  4IE7 A;  2MYS A;  5FY1 A;  2E5V A;  2J4G A;  4IL9 A;  3P50 A;  4U7Y A;  5JDM A;  4J2C A;  2V7M A;  4UV8 B;  3P4P A;  2N9D A;  1MNE A;  3ANW B;  3Q9D A;  4KX6 A;  4QXC B;  4DR1 T;  4E7Z A;  5DJQ C;  3T1Y T;  4CQI A;  4H63 H;  3BQK A;  4IE4 A;  3CX8 B;  3VKH A;  4UEL A;  5HCM A;  5FY7 A;  4Z91 A;  2E9X B;  3ZYK A;  4B3R T;  3UUM A;  3LDQ B;  3MZK B;  5L3E B;  1N36 T;  4QXB B;  4GK0 E;  1T8B A;  4ZS2 A;  2V5C A;  3C51 A;  4DV3 T;  3UT5 E;  2CWO A;  3I9W A;  1R8I A;  2V1D B;  3OYX A;  4NXN T;  2M6I A;  2VKD A;  5F5W A;  3UUX B;  4WW0 A;  4TUY E;  4OHF A;  2WSS V;  2X51 A;  2WP9 A;  3UU6 A;  2IHR 1;  2P9B A;  2YDQ A;  2ODV A;  2W67 A;  1FJG T;  5L3G B;  3I0O A;  2K48 A;  2X9H A;  2XAQ B;  4A97 A;  2LSJ A;  2WWV A;  3RYH E;  3LK4 2;  3V5U A;  5C3J A;  5EK3 A;  4DMW A;  3WAJ A;  2XQ3 A;  3TLW A;  3TLS A;  5HEU A;  1E1H B;  5ABE A;  3H3M A;  3ZT6 A;  2VL8 A;  3EI0 A;  4ZI7 E;  5DQV A;  3AAE B;  4H9R C;  1VCS A;  2NR4 A;  4DVD A;  2CEA A;  4YHJ A;  3RIU A;  3RGL A;  2XQ9 A;  3L09 A;  5FXX A;  2FJB A;  3VU7 H;  3RQW A;  4CI3 B;  4LML A;  3N9N A;  1UGO A;  2E2A A;  2CPT A;  4YHH T;  1I94 T;  4IDZ A;  3HKC E;  3F31 A;  2EHO A;  2LHN A;  4HFE A;  2V5D A;  4PJM A;  2X66 A;  4PW8 A;  3ONL C;  2CMR A;  2XPK A;  3RRC A;  3TLT A;  3EAM A;  2WDR A;  1WR0 A;  2FJA A;  5AQM B;  3FZL B;  2YEV C;  4YTM A;  2WY2 A;  4HFH A;  1XZY A;  1T72 A;  2VKJ A;  3N9Q A;  3N2K E;  2QRX A;  1QLB A;  3CK6 A;  2KWI B;  2BS4 A;  3K3Q C;  5DAB A;  4UIG A;  2DHR A;  2BKN A;  2ES0 A;  3PJA A;  3BK9 A;  3N9O A;  3HR0 A;  1HNX T;  5FYM A;  2WWU A;  3Q2M A;  4YTN A;  2PG8 A;  4YXD A;  1W0B A;  3QUJ A;  2UXD T;  4UEM A;  5AQI B;  2V6X A;  1ZOY A;  3MKD A;  4GOU A;  3FBL A;  4EOZ B;  1IAP A;  1E2A A;  3AEB A;  2J62 A;  4JLE A;  2NW8 A;  4QXH B;  1MMN A;  4BA9 A;  2RPA A;  3ZN0 B;  4DV1 T;  5LOV E;  3HKD E;  2E9X C;  2X0Y A;  4I0U A;  3P7I A;  1YW0 A;  3PUR A;  4O4H E;  5L47 A;  1NWM X;  5EZY E;  1MMA A;  1LVK A;  3O9X A;  3W15 B;  5HEG A;  5AQJ B;  4DR6 T;  2Q9Q B;  2X9Y A;  1QSD A;  4P09 A;  3AE7 A;  5HEO A;  5KX5 E;  2NW7 A;  4UF0 B;  5AQT B;  4TNW A;  4CN6 A;  1KNR A;  2A9U A;  2XAF B;  4KP3 C;  4DO0 A;  3ANW A;  2LEH A;  4WNK A;  4JBW F;  3DJB A;  3FB2 A;  2VB6 A;  4UVC B;  3AEE A;  1XMO T;  2I6H A;  3LK3 B;  3KV5 A;  4P0B A;  4QX7 B;  2LSK A;  2E9X A;  3H37 A;  2ACX A;  3JAF A;  4LFA T;  3NBX X;  1IJ5 A;  1T98 A;  1OED E;  3AE3 A;  4CN1 A;  1S35 A;  4FI5 A;  2CA5 A;  5J1G A;  2C5J A;  3FXD B;  4HFV A;  1LKX A;  5LG4 A;  1W0A A;  3PUV F;  2H7O A;  2XAH B;  4IDP A;  1MIW A;  5HYA A;  5JDN A;  1WYC A;  5JDL A;  3R6N A;  1HF8 A;  1I6Z A;  1S94 A;  3PU3 A;  3RYC E;  3AA7 B;  5M4Y A;  2LHR A;  1E7P A;  3AEA A;  3AA0 B;  4U2Z A;  2K3W A;  2XUE A;  4UXN B;  3B5M A;  4IE6 A;  3R84 B;  4X20 E;  2WB5 A;  2KXP B;  3G06 A;  4ILB A;  3T8O A;  4QHO A;  5FXW A;  2HH7 A;  2D9D A;  3GN5 B;  5ABH A;  4YY3 T;  3ZLI A;  2XQ8 A;  2I0M A;  3OVU A;  2KIN B;  2UUA T;  1D1B A;  5IHY A;  2B76 A;  2XJ7 A;  3ONJ A;  3I9Y A;  1X9B A;  3AE4 A;  5HXH A;  3A5X A;  3LBX A;  1W09 A;  3AED A;  2EHO D;  2JJ9 A;  3KV9 A;  1DU2 A;  1FMW A;  2GK9 A;  2LE8 A;  3ZYM A;  4CXW A;  4AQG A;  3Q5D A;  3AAI A;  3O1H A;  5LMU T;  5AQL B;  5J0Z A;  3UFE A;  3RKO A;  3OBV E;  5LA6 E;  4GKJ T;  3JAD A;  2NOX A;  1JNR A;  2ZM2 A;  2KLQ A;  1ZEE A;  2LJL A;  3SFE A;  3N2O A;  4PJJ A;  1HNZ T;  2PBI A;  5LGU B;  4OFZ A;  3CX7 B;  4CI1 B;  4BAY B;  2OV9 A;  5L4H A;  5CGM A;  4ISS A;  2BS3 A;  5HWY A;  1V9D A;  1OXZ A;  2OLT A;  3VRB A;  2BG9 E;  3IA3 A;  5KMG P;  4X66 T;  2BBH A;  3RYI E;  2Y6X A;  1LRZ A;  3J7Y q;  4YSY A;  2QA7 A;  2XAG B;  5LHH B;  3RI5 A;  5L3F B;  1NEK A;  4AKH A;  3CVR A;  1HX1 B;  4YJ2 E;  2CRB A;  3WI3 A;  2IW5 B;  4JUY A;  3B57 A;  1N34 T;  5BR8 T;  4KHP T;  4QH1 A;  2MTQ A;  3UU5 A;  4G63 A;  4I55 E;  1KK7 A;  4HFI A;  2M6B A;  3TKL B;  3AB3 B;  3C98 B;  2G0U A;  2J47 A;  2IC6 A;  2VL0 A;  1VCT A;  1KNP A;  4UVA B;  1FMV A;  4ASK A;  1D0X A;  5LHI B;  3QNU A;  2BVL A;  2LSI A;  2MBG A;  3GMI A;  3PTR B;  5FMN A;  4JV5 T;  3CQX C;  2YU1 A;  4X65 T;  2WBL A;  2UXC T;  2QVA A;  2H7V C;  4HKA A;  3ABV A;  5ABG A;  4H63 V;  1D1A A;  3PUG A;  4IT4 A;  5JVD E;  3I1A A;  1WFD A;  5LCY A;  4O2A E;  2CXL A;  3OTO T;  4DBQ A;  3ONX A;  4DV7 T;  3HA4 A;  2JPF A;  3ZC1 A;  2Y8D A;  2FBW A;  4HWC A;  3LG7 A;  3O1I A;  1G8X A;  4JYA T;  2XAS B;  3EDV A;  2DI4 A;  4BJM A;  1HTJ F;  2X68 A;  5AQK B;  4QH5 A;  2Q9Q A;  3EHZ A;  4N78 D;  2HPL A;  5AQH B;  2C0S A;  2KT9 A;  4UF0 A;  1N33 T;  1VRB A;  3ETU A;  4PFO A;  2X67 A;  5JH7 E;  2PJQ A;  2ZM0 A;  2H3R A;  2WQY A;  4HN9 A;  2K24 A;  4B3T T;  4L5G A;  4IIJ E;  2DWG A;  5AQO B;  5LXT E;  5HXC A;  5H6Q B;  4OYJ A;  2C5K T;  4ZI3 C;  1HR0 T;  5FL1 A;  4COF A;  4JI6 T;  2VWA A;  3PDY A;  4K0K T;  2LM2 A;  5LB7 B;  2W62 A;  1IZN B;  2E5L T;  5HEH A;  4TX5 A;  3VHL A;  2V7I A;  3QK6 A;  5TAO A;  4H9S E;  4AI6 A;  3RKG A;  4IE0 A;  3ZCI A;  4ZOL E;  4GYR A;  3H3A A;  2JMH A;  2XSA A;  4IHJ E;  3NZP A;  4X62 T;  3GN5 A;  5E0O A;  3PUZ F;  4DND A;  3RYF E;  2L9Q A;  2IUB A;  2WCA A;  2YIN A;  3ZYL A;  5ETW A;  3C4X A;  3OYZ A;  3O4X E;  4HWF A;  4LFC T;  4H9P C;  3PUY F;  4AIU A;  2VKH A;  5L3C B;  3RHW A;  2LOP A;  4TWF A;  2X0H A;  4AXP A;  3AE9 A;  4YSX A;  2CXF A;  5EK2 A;  4ILA A;  3CIR A;  4ZI2 D;  4KMC A;  2JRK A;  5LGT B;  4TZ4 C;  4U33 A;  2H89 A;  4EYY R;  1MIY A;  3M3Z B;  2YU2 A;  1XMQ T;  3KV6 A;  4HEA A;  4HWD A;  3L8R A;  4EEB A;  4GKK T;  4CZZ B;  3O1J A;  1CUN A;  1XNQ T;  3RPU A;  4DUY T;  3JC6 C;  5JR9 B;  5JTG A;  5F8P A;  4XZC A;  2R6G F;  1YXR A;  5AQV B;  2XM2 A;  2N1G A;  3MJX A;  2B1E A;  2W2U A;  2X0L B;  3UFG A;  3M65 A;  3FXE B;  3RIF A;  5ABF B;  3AE2 A;  1NEN A;  2LLY A;  2VQE T;  5J2T E;  1SA0 E;  4AKL A;  2N2N A;  2WU2 A;  2X9X A;  2W63 A;  3CKD A;  5L3D B;  4OX9 T;  5LYJ E;  5ADX L;  5JRC B;  4EAH A;  1WLX A;  3OJA A;  2Y48 B;  4IST A;  2IC9 A;  5AFU L;  2UUC T;  4WBN E;  4IDO A;  3OKQ A;  2E8I A;  1IBK T;  1IJ6 A;  1L0V A;  3GWH A;  2KMF A;  5LP6 E;  1US7 B;  5LJM A;  4B3S T;  3NRY A;  1SUM B;  1UCU A;  2BZB A;  4ZHQ E;  2DL1 A;  1UK5 A;  4PK5 A;  5CFB A;  4CI2 B;  2UXX B;  3HKB E;  2XM1 A;  1X79 A;  3AEC A;  2XHE B;  4X1I E;  3F57 A;  3MAC A;  2WZI A;  2QGS A;  3PE0 A;  1XDO A;  3CX6 B;  2NP9 A;  4GK5 E;  2Q9Q D;  2C5I T;  4ILC A;  3A8Y C;  5L3B B;  5AQR B;  4QH4 A;  2ZLY A;  1BR1 A;  5KDM C;  3EVY A;  5BMV E;  4HGA A;  3C64 A;  1ZKE A;  3PUW F;  5LJN A;  2VVS A;  4EED A;  5AQS B;  3X1D A;  2JQ9 A;  3AA1 B;  5HAX A;  4K0U A;  4X5T A;  3ZJ1 A;  2ZM6 T;  4DID B;  5EK4 A;  3J9X 1;  3RQU A;  2LKH A;  1U4Q A;  3EDU A;  4EB6 E;  3JCF A;  1BR2 A;  2LSG A;  3AEF A;  4MAL A;  2KSR A;  1BR0 A;  3K1S A;  5FXV A;  3KIN B;  4DR5 T;  2HN2 A;  4H9O C;  2A2F X;  1WRD A;  3IF8 B;  4MFR A;  3EAB A;  2IAK A;  3IHR A;  2LRK A;  3UQ7 A;  4JI7 T;  5IUX A;  5L2L A;  3N9P A;  3ZST A;  3AA6 B;  2D2S A;  3K3O A;  4JI3 T;  4DMV A;  4TV9 E;  5JRE A;  2MPK A;  4YT0 A;  2BKP A;  2NTX A;  4JI1 T;  2WAU A;  2MAW A;  3LK2 B;  4IDN A;  2NWB A;  1EZ3 A;  4AQF C;  5FVK A;  3QB5 A;  2PTF A;  4MHC A;  4CN4 A;  3HKE E;  4LF8 T;  4IE5 A;  3NRX A;  4WYV A;  4TV8 E;  2IDO B;  4CXX A;  5JR9 C;  4DBR A;  4HWI B;  3P4R A;  1AJ3 A;  5AQN B;  4DR4 T;  1U5P A;  4NUU A;  1HCI A;  2CLY C;  2I59 A;  5AQP B;  4PNI A;  5LMN T;  3S4U A;  3NWI A;  1MMG A;  3AAA B;  2W0G A;  4LF4 T;  4Z8X A;  2X9W A;  5KXJ A;  4NUV A;  1D0Z A;  1GQE A;  4OK0 A;  4LF7 T;  4ZXL A;  2LOS A;  3NZQ A;  5C8Y E;  3ZPO A;  3SFD A;  4KI0 F;  4MLK A;  3SS1 A;  1YKH B;  3KDS E;  4DV5 T;  3FZF B;  4PJN A;  4DUZ T;  4JI0 T;  4ZS3 A;  3U3I A;  3LJC A;  3F2E A;  5JR9 A;  4JI5 T;  1W9R A;  2YOE A;  5FVL A;  4HE8 A;  3K8P C;  1NAF A;  3ZKR A;  1WYB A;  2A72 A;  3ETV A;  3HL6 A;  4CXY A;  4C90 A;  5ABF A;  1HG5 A;  3MXZ A;  4A5X A;  1HNW T;  1BR4 A;  4QWN B;  4TNV A;  4B6X A;  4O4J E;  1MMD A;  5FXZ A;  4UR9 A;  3N5L A;  4BJN A;  4PK6 A;  3Q5X A;  3ZC0 A;  3QC9 A;  4M1P A;  2JQK A;  4B3M T;  3NVO A;  5JRC A;  2ZMA A;  4IDQ A;  3MK7 C;  3P4W A;  2CCQ A;  3VKG A;  2L8K A;  1YKE B;  1J1J A;  3ZSS A;  3CQC B;  4ZZC A;  2WZH A;  2JIW A;  3RF1 A;  1OED B;  3V5S A;  3FBZ A;  4DV4 T;  4U3C A;  2BKO A;  3TLU A;  3U78 A;  2D0U A;  3ZCJ A;  4A98 A;  4HFB A;  2FJE A;  1YQ3 A;  1Y64 B;  4NXM T;  2V7L A;  2D5U A;  2E9X D;  2WM9 A;  1SE7 A;  5LGN B;  1KNZ A;  1MIV A;  4JI4 T;  2KWH A;  1WR6 A;  1XWM A;  4JEH B;  3L39 A;  4GYS A;  1Y01 A;  4OYK A;  2XQ5 A;  3FZH B;  4UVB B;  3UQ4 A;  4H9Q C;  3RIU C;  2UXN B;  3QB5 K;  1HFA A;  2FJD A;  3AEG A;  4U72 A;  3GA8 A;  3AVR A;  2JQQ A;  5AQG B;  4I50 E;  4ZZB A;  2YK0 A;  2EHO C;  2ACZ A;  1J5W A;  4YSZ A;  1VOM A;  1Z8U A;  2YN6 A;  4DR3 T;  4KBM B;  3Q5W A;  1ZHC A;  4YTP A;  2H88 A;  2VUR A;  2IIU A;  3AXJ B;  3E22 E;  4U31 A;  4HFC A;  3AE5 A;  5JDQ A;  5FNV E;  4ERR A;  4MBQ A;  3Q5E A;  1D0Y A;  1ZV4 X;  3UUN A;  5LBM A;  5J2U E;  2AXD S;  1HS7 A;  3RIA A;  2V8S V;  3P8C D;  4TN7 B;  4V1A v;  4EZH A;  3LBX B;  4PAG A;  3SWH A;  5A1L A;  2DCF A;  1JNZ A;  2WDQ A;  4LFB T;  4P1N A;  2WMO A;  2BG9 B;  3FHN A;  4ZEY A;  1Z0P A;  2WMN A;  3KVA A;  1YD8 G;  2YKS A;  2MOZ A;  4PJL A;  4TWD A;  1XDP A;  2XAJ B;  4TWH A;  2VQF T;  3RH3 A;  4O2B E;  3N2G E;  3FZK B;  5HXR A;  3DTO A;  3KV4 A;  5F3J A;  4DR7 T;  3D0T A;  2CBJ A;  3ZMS B;  2HHH T;  1OWA A;  2RA1 A;  3UU8 A;  4Z90 A;  2XQA A;  1UX5 A;  4XAX B;  1KFY A;  2A3D A;  5FKY A;  4X64 T;  2V6Y B;  4I43 B;  1MND A;  3UUL A;  4ILU A;  4EXT A;  3ZMZ B;  5LHG B;  3KVB A;  3E08 A;  1YQ4 A;  3IBP A;  3UUB A;  3T1H T;  1QUU A;  3SOL A;  4H9N C;  2UU9 T;  5H6R B;  2WDV A;  5JDG A;  2BVM A;  4YJ3 E;  2CLY B;  3PUX F;  1M62 A;  4QKN A;  1J5E T;  4JI2 T;  3RX6 A;  4DR2 T;  4EYU A;  1HG2 A;  3RC3 A;  3E0Z A;  2F4V T;  3AVS A;  2CM0 A;  1OED C;  4F8H A;  4YLH A;  3PUS A;  5AQQ B;  4DV6 T;  3EUH A;  5JQG E;  2XTL A;  3PUA A;  4KUM B;  3UU4 A;  2D0T A;  1UUS A;  3QOF A;  4P0A A; 
#chains in the Genus database with same CATH homology
 3LK2 B;  2NWB A;  5JDH A;  4H63 V;  1D1A A;  1EZ3 A;  2J1D G;  3IEE A;  5GON E;  4AQF C;  3L09 A;  4AKG A;  3PUG A;  5FXX A;  4MHC A;  3VU7 H;  4CI3 B;  4AKI A;  3HKE E;  5JVD E;  3I1A A;  1D1C A;  3N9N A;  4QX8 B;  4UV9 B;  1LVF A;  3BQL A;  5LCY A;  4IE5 A;  4O2A E;  3ZJ2 A;  3NRX A;  2CXL A;  4A56 A;  4DBQ A;  3ONX A;  3HA4 A;  2JPF A;  4TV8 E;  3ZC1 A;  4CXX A;  4IDZ A;  2Y8D A;  4ANJ A;  3HKC E;  3F31 A;  2EHO A;  3RC8 A;  5JR9 C;  2LHN A;  4DBR A;  4PJM A;  1AJ3 A;  2X66 A;  4WBO A;  3LG7 A;  4EIW A;  4PW8 A;  5JDF A;  1U5P A;  1G8X A;  2CMR A;  3O1I A;  4NUU A;  2XAS B;  3RRC A;  1HCI A;  3EDV A;  2CLY C;  2I59 A;  3C4Z A;  4PNI A;  2DI4 A;  3N9M A;  3PU8 A;  3S4U A;  4BJM A;  1HTJ F;  1MMG A;  2X68 A;  3AAA B;  2W0G A;  3CPZ A;  5CB4 E;  2Q9Q A;  4X1Y E;  2X9W A;  4Z8X A;  4N78 D;  2HPL A;  2YEV C;  3RRW A;  3K3N A;  2DLR A;  2HPJ A;  2C0S A;  3ESL A;  2KT9 A;  4NUV A;  1D0Z A;  3ZMU B;  4UF0 A;  4OK0 A;  2VKJ A;  1VRB A;  3ETU A;  3N9Q A;  4PFO A;  2X67 A;  3N2K E;  5JH7 E;  4O4I E;  2LOS A;  3NZQ A;  2PJQ A;  5C8Y E;  3ZPO A;  2M67 A;  2ZM0 A;  4MLK A;  2KWI B;  2H3R A;  3L3P A;  3K3Q C;  5DQW A;  4HN9 A;  3SS1 A;  1YKH B;  2V26 A;  2K24 A;  3BQI A;  5DAB A;  3KBU A;  3KDS E;  3CML A;  4PJN A;  4UIG A;  3ZEF B;  4L5G A;  2DHR A;  4PFP A;  2ES0 A;  2CWY A;  2CXD A;  3BK9 A;  3N9O A;  4IIJ E;  2DWG A;  1SHZ C;  4U74 A;  3HR0 A;  1UX4 A;  5FYM A;  4ZS3 A;  5LXT E;  5HXC A;  3U3I A;  5H6Q B;  2WWU A;  3LJC A;  2JMK A;  3F2E A;  3Q2M A;  5JR9 A;  2VAS A;  4I4T E;  4OYJ A;  2C5K T;  2PG8 A;  1HX8 A;  4ZI3 C;  3QUJ A;  2LSY A;  4UEM A;  4HE8 A;  3K8P C;  1NAF A;  3MKD A;  2KND A;  2V7J A;  2VWA A;  4GOU A;  3FBL A;  1WYB A;  2A72 A;  3PDY A;  3ETV A;  4IGU A;  3HL6 A;  4CXY A;  4EOZ B;  1IAP A;  5HXS A;  2W62 A;  1IZN B;  4C90 A;  4TX5 A;  3VHL A;  1HG5 A;  2V7I A;  2NW8 A;  3MXZ A;  3QK6 A;  4JLE A;  5TAO A;  5CA0 E;  1BR4 A;  4H9S E;  4QWN B;  4QXH B;  4AI6 A;  1MMN A;  4B6X A;  4BA9 A;  5CA1 E;  4O4J E;  1MMD A;  5FXZ A;  3N5L A;  4BJN A;  4PK6 A;  2W61 A;  3Q5X A;  3ZN0 B;  3ZC0 A;  5LOV E;  4IE0 A;  3QC9 A;  3ZCI A;  3HKD E;  4ZI2 C;  5IYZ E;  4M1P A;  4ZOL E;  2E9X C;  4GYR A;  3H3A A;  2JMH A;  4IHJ E;  3NZP A;  5JRC A;  2ZMA A;  3P7I A;  3MK7 C;  1YW0 A;  4E7S A;  2CCQ A;  2XQY A;  3MA9 A;  3GN5 A;  2EHO B;  5HXE A;  5E0O A;  3VKG A;  3PUR A;  2SPC A;  2L8K A;  4DND A;  3C50 A;  1YKE B;  4O4H E;  3RYF E;  2L9Q A;  3CQC B;  3B13 A;  2LM9 A;  1NWM X;  2YIN A;  4JEU B;  5EZY E;  5ETW A;  3ZYL A;  4ZI3 D;  1MMA A;  3C4X A;  1O3X A;  3OYZ A;  3O4X E;  3UTK A;  4H9P C;  1LVK A;  3V5S A;  2VKH A;  3O9X A;  3FBZ A;  4AKR B;  3W15 B;  5L3C B;  4FJO A;  3U78 A;  2Q9Q B;  2X9Y A;  2D0U A;  3ZCJ A;  2LOP A;  2PFV A;  3I0Q A;  1QSD A;  4P09 A;  3PUQ A;  4AXP A;  4GIW A;  3WAK A;  1Y64 B;  5FP3 A;  5KX5 E;  2V7L A;  2CXF A;  3C4W A;  5EK2 A;  2NW7 A;  4UF0 B;  4HTE A;  4O8S A;  1G73 A;  2D5U A;  4ZI2 D;  2XAF B;  4KP3 C;  4DO0 A;  2E9X D;  4KMC A;  3ANW A;  2ZM8 A;  2LEH A;  2WM9 A;  4WNK A;  2JRK A;  5LGT B;  4TZ4 C;  5LGN B;  1KNZ A;  1MIV A;  3DJB A;  3FB2 A;  2VB6 A;  4PK4 A;  4UVC B;  2KWH A;  1WR6 A;  4EYY R;  4JEH B;  1FIO A;  1MIY A;  4GYS A;  2YU2 A;  4OYK A;  3LK3 B;  3KV5 A;  3KV6 A;  4HEA A;  4P0B A;  4QX7 B;  4UVB B;  3ZMV B;  2LSK A;  4H9Q C;  4O4L E;  4AQF A;  2E9X A;  4CZZ B;  2UXN B;  3H37 A;  3O1J A;  1CUN A;  1HFA A;  2ACX A;  3NBX X;  1IJ5 A;  3LFM A;  1T98 A;  2BDE A;  4U72 A;  3RPU A;  3ZMT B;  2W00 A;  3GA8 A;  2CE7 A;  3JC6 C;  5JR9 B;  5F8P A;  3AVR A;  4XZC A;  2JQQ A;  3DP7 A;  1FEW A;  2DWK A;  1S35 A;  4FI5 A;  2CA5 A;  4I50 E;  2N1G A;  5J1G A;  2C5J A;  2V7K A;  3KBT A;  3MJX A;  2B1E A;  3FXD B;  2Z6E A;  3HI2 A;  4HFV A;  1LKX A;  1B7T A;  2X0L B;  5LG4 A;  2H7O A;  2YK0 A;  2XAH B;  2EHO C;  3CQG B;  3M65 A;  2RP4 A;  1MIW A;  2OA5 A;  5HYA A;  5JDN A;  4XBF B;  1VOM A;  1WYC A;  2VK9 A;  4ADZ A;  3FXE B;  5JDL A;  4KBM B;  3Q5W A;  3R6N A;  1HF8 A;  1ZHC A;  5FY0 A;  1S94 A;  3E22 E;  3SRZ A;  3PU3 A;  2K5B B;  2KZ7 B;  3RYC E;  5J2T E;  1SA0 E;  4AKL A;  3AA7 B;  5M4Y A;  2LHR A;  2N2N A;  3AA0 B;  2X9X A;  2W63 A;  3CKD A;  2XUE A;  4UXN B;  5L3D B;  2LT3 A;  1H7C A;  5LYJ E;  5ADX L;  5FNV E;  5JDQ A;  4ERR A;  2Q9Q C;  3KFW X;  4IE6 A;  2K9A A;  4MBQ A;  4G2A A;  3R84 B;  4C91 A;  1D0Y A;  2ODU A;  1ZV4 X;  4X20 E;  2KXP B;  5JRC B;  3T8O A;  5LBM A;  3CWZ B;  3UUN A;  4QHO A;  4EAH A;  5FXW A;  4F6R C;  5J2U E;  2HH7 A;  3GN5 B;  1HS7 A;  4L9I A;  1WLX A;  2DNX A;  4X1K E;  3OJA A;  5LBQ B;  2Y48 B;  4IST A;  2IC9 A;  3ZLI A;  5AFU L;  3P8C D;  5LNK A;  4WBN E;  2KIN B;  4L0R A;  4TN7 B;  4V1A v;  1D1B A;  3JC6 D;  5IHY A;  3OKQ A;  3N9L A;  4EZH A;  3LBX B;  2E8I A;  4EZ4 A;  1IJ6 A;  2NTY A;  3GWH A;  4PAG A;  2KMF A;  2VKO A;  3SWH A;  5A1L A;  3I9Y A;  5LP6 E;  2DCF A;  2L3L A;  1US7 B;  5LJM A;  4YFS A;  3NRY A;  5HXH A;  3A5X A;  1UCU A;  2BZB A;  3LBX A;  2WMO A;  2EHO D;  2JJ9 A;  3KV9 A;  4ZHQ E;  3FHN A;  5HWX A;  1Z0P A;  2WMN A;  3KVA A;  4PK5 A;  2NW9 A;  1FMW A;  4CI2 B;  2GK9 A;  1YD8 G;  2UXX B;  3HKB E;  3ZN1 B;  4IE7 A;  1X79 A;  2MOZ A;  2LE8 A;  4PJL A;  3ZYM A;  2MYS A;  4AQG A;  4CXW A;  5FY1 A;  2XAJ B;  2XHE B;  4X1I E;  3AAI A;  3F57 A;  3O1H A;  3MAC A;  3RH3 A;  4J2C A;  5JDM A;  2QGS A;  2V7M A;  4O2B E;  4UV8 B;  3N2G E;  3UFE A;  3RKO A;  2N9D A;  1MNE A;  3OBV E;  3PE0 A;  3CX6 B;  3ANW B;  2NP9 A;  3Q9D A;  4GK5 E;  4QXC B;  5HXR A;  2Q9Q D;  5LA6 E;  2NOX A;  2C5I T;  3DTO A;  4E7Z A;  3KV4 A;  5DJQ C;  4CQI A;  4H63 H;  2ZM2 A;  5L3B B;  2KLQ A;  5F3J A;  1ZEE A;  2LJL A;  3BQK A;  2ZLY A;  3D0T A;  3N2O A;  3ZMS B;  1BR1 A;  4PJJ A;  5KDM C;  3EVY A;  1OWA A;  2RA1 A;  2PBI A;  4IE4 A;  5BMV E;  3CX8 B;  4HGA A;  3C64 A;  5LGU B;  1UX5 A;  1ZKE A;  3CX7 B;  4OFZ A;  4XAX B;  3VKH A;  4CI1 B;  4UEL A;  4BAY B;  5LJN A;  5FY7 A;  2A3D A;  2E9X B;  4ISS A;  3ZYK A;  5HWY A;  1V9D A;  4I43 B;  1OXZ A;  3UUM A;  3MZK B;  1MND A;  3UUL A;  5L3E B;  4ILU A;  4QXB B;  5KMG P;  4GK0 E;  4EXT A;  3ZMZ B;  5LHG B;  3KVB A;  3AA1 B;  5HAX A;  4ZS2 A;  4K0U A;  3E08 A;  3ZJ1 A;  3C51 A;  3RYI E;  5EK4 A;  3UT5 E;  2CWO A;  3J9X 1;  2Y6X A;  3IBP A;  3I9W A;  1QUU A;  2V1D B;  3OYX A;  1LRZ A;  3SOL A;  4H9N C;  3J7Y q;  2QA7 A;  2XAG B;  5LHH B;  1U4Q A;  5L3F B;  4AKH A;  5H6R B;  2VKD A;  3EDU A;  4EB6 E;  5JDG A;  3UUX B;  3CVR A;  4WW0 A;  4TUY E;  4OHF A;  2WSS V;  2BVM A;  1BR2 A;  4YJ2 E;  2X51 A;  2LSG A;  4MAL A;  4YJ3 E;  3WI3 A;  2CLY B;  2IW5 B;  1BR0 A;  5FXV A;  3KIN B;  2P9B A;  4JUY A;  3B57 A;  4H9O C;  2ODV A;  4QKN A;  2A2F X;  1WRD A;  3IF8 B;  2MTQ A;  3RX6 A;  5L3G B;  4G63 A;  3I0O A;  2K48 A;  1KK7 A;  2X9H A;  4I55 E;  2XAQ B;  1HG2 A;  4EYU A;  2LSJ A;  4MFR A;  3RC3 A;  3TKL B;  2IAK A;  3C98 B;  3AB3 B;  3IHR A;  3LK4 2;  3RYH E;  3V5U A;  3E0Z A;  2G0U A;  3AVS A;  2CM0 A;  2IC6 A;  5EK3 A;  4UVA B;  4DMW A;  1FMV A;  3WAJ A;  4ASK A;  1D0X A;  4YLH A;  5LHI B;  5L2L A;  3PUS A;  3N9P A;  1E1H B;  2BVL A;  2LSI A;  2VL8 A;  2MBG A;  4ZI7 E;  3AA6 B;  2D2S A;  3EUH A;  5DQV A;  5JQG E;  3K3O A;  2XTL A;  4DMV A;  3AAE B;  4TV9 E;  3GMI A;  4H9R C;  5JRE A;  3PUA A;  3PTR B;  5FMN A;  3CQX C;  4KUM B;  2YU1 A;  2WBL A;  2NTX A;  4DVD A;  2D0T A;  2CEA A;  4P0A A;  2H7V C;  2WAU A;  4HKA A;  4YHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...