1CVOA

The solution structure of cardiotoxin v from naja naja atra
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of cardiotoxin V from Naja naja atra.
pubmed doi rcsb
source organism Naja atra
molecule tags Cytotoxin
molecule keywords CARDIOTOXIN V
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1993-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cvoA00
1IK8A 1F8UB 2CRTA 2H8UA 1ES7B 1HAAA 1JBDA 2LCRA 5EBXA 4DO8A 2MFAA 1NXBA 1M9ZA 2PJYC 1QKEA 1TXAA 2X8BB 1IQ9A 1YWHA 4P7UA 5IMYC 1ONJA 2UWRA 3EVSC 2H64B 2QJ9C 2OFSA 2H5FA 1RL5A 3KFDI 1KTZB 5DO6A 2L03A 1BTEA 2H7ZA 2CCXA 2CDXA 2ERAA 1MAHF 2NBTA 2CTXA 1CVOA 1JGKA 2LA1A 1DRSA 1NORA 1COEA 2H62D 2HLRA 1IDGA 2GOOB 4XJJA 1KBTA 4HQPF 2H62C 1CODA 3EBXA 1FSSB 1LJZA 1MR6A 5IMTD 1ERGA 2QJAC 2CRSA 1LXHA 1KFHA 3PLCA 1S4YA 3QB4B 1KU6B 2I9BE 3BT1U 1HC9B 1LXGA 1FF4A 1NYUA 1CDSA 1REWC 1KL8A 2MUPA 1CCQA 1XT3A 3ERAA 1UG4A 1B41B 1NEAA 3NEQA 1QKDA 3VTSA 1G6MA 2FD6U 1ERAA 3LAQU 1IJCA 1HOYA 5DU1A 2ABXA 2JQPA 4LFTA 1CDRA 1CXOA 4OM5A 4FAOC 4UY2C 1LSIA 6EBXA 1FASA 1FRAA 1KC4A 1FSCA 1LX5B 1CTXA 1HAJA 4OM4A 1TGXA 2JVEA 1IDHA 2H64C 1CB9A 2QJBC 2MHYA 2BHIA 1NYSA 2MJ0A 2VLWA 1NTNA 4FAOE 3KFDE 2PJYB 1V6PA 2L5SA 3NDSA 4BDTB 2UX2A 4ZQYA 3U73U 1BXPA 1CREA 2QC1A 4BIKB 1KBAA 2MJ4A 2BTXA 1F94A 1RGJA 1KBSA 2H7ZB 1W6BA 1IDLA 1PLOA 3U74U 1CDQA 1KXIA 3FEVA 1I02A 2K3GA 2HLQA 4AEAA 1CRFA 1KS6A 3HH7A 4IYEA 2GOOC 3BT2U 1NTXA 1H0JA 1IDIA 1ZADA 2MJYA 4QTIU 1CHVS 1VB0A 4RUDA 5DZ5A 3NH7A 1CXNA 2MUOA 2J8BA 2N99A 1HC9A 1ABTA 1QM7A 1JE9A 1FFJA 1CDTA 4EY8B 1TXBA 1L4WA 1TFSA 1IKCA
chains in the Genus database with same CATH superfamily
1IK8A 1F8UB 2CRTA 2H8UA 1ES7B 1HAAA 1JBDA 2LCRA 5EBXA 4DO8A 2MFAA 1NXBA 1M9ZA 2PJYC 1QKEA 1TXAA 2X8BB 1IQ9A 1YWHA 4P7UA 5IMYC 1ONJA 2UWRA 3EVSC 2H64B 2QJ9C 2OFSA 2H5FA 1RL5A 3KFDI 1KTZB 5DO6A 2L03A 1BTEA 2H7ZA 2CCXA 2CDXA 2ERAA 1MAHF 2NBTA 2CTXA 1CVOA 1JGKA 2LA1A 1DRSA 1NORA 1COEA 2H62D 2HLRA 1IDGA 2GOOB 4XJJA 1KBTA 4HQPF 2H62C 1CODA 3EBXA 1FSSB 1LJZA 1MR6A 5IMTD 1ERGA 2QJAC 2CRSA 1LXHA 1KFHA 3PLCA 1S4YA 3QB4B 1KU6B 2I9BE 3BT1U 1HC9B 1LXGA 1FF4A 1NYUA 1CDSA 1REWC 1KL8A 2MUPA 1CCQA 1XT3A 3ERAA 1UG4A 1B41B 1NEAA 3NEQA 1QKDA 3VTSA 1G6MA 2FD6U 1ERAA 3LAQU 1IJCA 1HOYA 5DU1A 2ABXA 2JQPA 4LFTA 1CDRA 1CXOA 4OM5A 4FAOC 4UY2C 1LSIA 6EBXA 1FASA 1FRAA 1KC4A 1FSCA 1LX5B 1CTXA 1HAJA 4OM4A 1TGXA 2JVEA 1IDHA 2H64C 1CB9A 2QJBC 2MHYA 2BHIA 1NYSA 2MJ0A 2VLWA 1NTNA 4FAOE 3KFDE 2PJYB 1V6PA 2L5SA 3NDSA 4BDTB 2UX2A 4ZQYA 3U73U 1BXPA 1CREA 2QC1A 4BIKB 1KBAA 2MJ4A 2BTXA 1F94A 1RGJA 1KBSA 2H7ZB 1W6BA 1IDLA 1PLOA 3U74U 1CDQA 1KXIA 3FEVA 1I02A 4KSNA 2K3GA 2HLQA 4AEAA 1CRFA 1KS6A 3HH7A 4IYEA 2GOOC 3BT2U 1NTXA 1H0JA 1IDIA 1ZADA 2MJYA 4QTIU 1CHVS 1VB0A 4RUDA 5DZ5A 3NH7A 1CXNA 2MUOA 2J8BA 2N99A 1HC9A 1ABTA 1QM7A 1JE9A 1FFJA 1CDTA 4EY8B 1TXBA 1L4WA 1TFSA 1IKCA
chains in the Genus database with same CATH topology
1IK8A 1F8UB 2CRTA 2H8UA 1ES7B 1HAAA 1JBDA 2LCRA 5EBXA 4DO8A 2MFAA 1NXBA 1M9ZA 2PJYC 1QKEA 1TXAA 2X8BB 1IQ9A 1YWHA 4P7UA 5IMYC 1ONJA 2UWRA 3EVSC 2H64B 2QJ9C 2OFSA 2H5FA 1RL5A 3KFDI 1KTZB 5DO6A 2L03A 1BTEA 2H7ZA 2CCXA 2CDXA 2ERAA 1MAHF 2NBTA 2CTXA 1CVOA 1JGKA 2LA1A 1DRSA 1NORA 1COEA 2H62D 2HLRA 1IDGA 2GOOB 4XJJA 1KBTA 4HQPF 2H62C 1CODA 3EBXA 1FSSB 1LJZA 1MR6A 5IMTD 1ERGA 2QJAC 2CRSA 1LXHA 1KFHA 3PLCA 1S4YA 3QB4B 1KU6B 2I9BE 3BT1U 1HC9B 1LXGA 1FF4A 1NYUA 1CDSA 1REWC 1KL8A 2MUPA 1CCQA 1XT3A 3ERAA 1UG4A 1B41B 1NEAA 3NEQA 1QKDA 3VTSA 1G6MA 2FD6U 1ERAA 3LAQU 1IJCA 1HOYA 5DU1A 2ABXA 2JQPA 4LFTA 1CDRA 1CXOA 4OM5A 4FAOC 4UY2C 1LSIA 6EBXA 1FASA 1FRAA 1KC4A 1FSCA 1LX5B 1CTXA 1HAJA 4OM4A 1TGXA 2JVEA 1IDHA 2H64C 1CB9A 2QJBC 2MHYA 2BHIA 1NYSA 2MJ0A 2VLWA 1NTNA 4FAOE 3KFDE 2PJYB 1V6PA 2L5SA 3NDSA 4BDTB 2UX2A 4ZQYA 3U73U 1BXPA 1CREA 2QC1A 4BIKB 1KBAA 2MJ4A 2BTXA 1F94A 1RGJA 1KBSA 2H7ZB 1W6BA 1IDLA 1PLOA 3U74U 1CDQA 1KXIA 3FEVA 1I02A 4KSNA 2K3GA 2HLQA 4AEAA 1CRFA 1KS6A 3HH7A 4IYEA 2GOOC 3BT2U 1NTXA 1H0JA 1IDIA 1ZADA 2MJYA 4QTIU 1CHVS 1VB0A 4RUDA 5DZ5A 3NH7A 1CXNA 2MUOA 2J8BA 2N99A 1HC9A 1ABTA 1QM7A 1JE9A 1FFJA 1CDTA 4EY8B 1TXBA 1L4WA 1TFSA 1IKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IK8 A;  1F8U B;  2CRT A;  2H8U A;  1ES7 B;  1HAA A;  1JBD A;  2LCR A;  5EBX A;  4DO8 A;  2MFA A;  1NXB A;  1M9Z A;  2PJY C;  1QKE A;  1TXA A;  2X8B B;  1IQ9 A;  1YWH A;  4P7U A;  5IMY C;  1ONJ A;  2UWR A;  3EVS C;  2H64 B;  2QJ9 C;  2OFS A;  2H5F A;  1RL5 A;  3KFD I;  1KTZ B;  5DO6 A;  2L03 A;  1BTE A;  2H7Z A;  2CCX A;  2CDX A;  2ERA A;  1MAH F;  2NBT A;  2CTX A;  1CVO A;  1JGK A;  2LA1 A;  1DRS A;  1NOR A;  1COE A;  2H62 D;  2HLR A;  1IDG A;  2GOO B;  4XJJ A;  1KBT A;  4HQP F;  2H62 C;  1COD A;  3EBX A;  1FSS B;  1LJZ A;  1MR6 A;  5IMT D;  1ERG A;  2QJA C;  2CRS A;  1LXH A;  1KFH A;  3PLC A;  1S4Y A;  3QB4 B;  1KU6 B;  2I9B E;  3BT1 U;  1HC9 B;  1LXG A;  1FF4 A;  1NYU A;  1CDS A;  1REW C;  1KL8 A;  2MUP A;  1CCQ A;  1XT3 A;  3ERA A;  1UG4 A;  1B41 B;  1NEA A;  3NEQ A;  1QKD A;  3VTS A;  1G6M A;  2FD6 U;  1ERA A;  3LAQ U;  1IJC A;  1HOY A;  5DU1 A;  2ABX A;  2JQP A;  4LFT A;  1CDR A;  1CXO A;  4OM5 A;  4FAO C;  4UY2 C;  1LSI A;  6EBX A;  1FAS A;  1FRA A;  1KC4 A;  1FSC A;  1LX5 B;  1CTX A;  1HAJ A;  4OM4 A;  1TGX A;  2JVE A;  1IDH A;  2H64 C;  1CB9 A;  2QJB C;  2MHY A;  2BHI A;  1NYS A;  2MJ0 A;  2VLW A;  1NTN A;  4FAO E;  3KFD E;  2PJY B;  1V6P A;  2L5S A;  3NDS A;  4BDT B;  2UX2 A;  4ZQY A;  3U73 U;  1BXP A;  1CRE A;  2QC1 A;  4BIK B;  1KBA A;  2MJ4 A;  2BTX A;  1F94 A;  1RGJ A;  1KBS A;  2H7Z B;  1W6B A;  1IDL A;  1PLO A;  3U74 U;  1CDQ A;  1KXI A;  3FEV A;  1I02 A;  2K3G A;  2HLQ A;  4AEA A;  1CRF A;  1KS6 A;  3HH7 A;  4IYE A;  2GOO C;  3BT2 U;  1NTX A;  1H0J A;  1IDI A;  1ZAD A;  2MJY A;  4QTI U;  1CHV S;  1VB0 A;  4RUD A;  5DZ5 A;  3NH7 A;  1CXN A;  2MUO A;  2J8B A;  2N99 A;  1HC9 A;  1ABT A;  1QM7 A;  1JE9 A;  1FFJ A;  1CDT A;  4EY8 B;  1TXB A;  1L4W A;  1TFS A;  1IKC A; 
#chains in the Genus database with same CATH topology
 1IK8 A;  1F8U B;  2CRT A;  2H8U A;  1ES7 B;  1HAA A;  1JBD A;  2LCR A;  5EBX A;  4DO8 A;  2MFA A;  1NXB A;  1M9Z A;  2PJY C;  1QKE A;  1TXA A;  2X8B B;  1IQ9 A;  1YWH A;  4P7U A;  5IMY C;  1ONJ A;  2UWR A;  3EVS C;  2H64 B;  2QJ9 C;  2OFS A;  2H5F A;  1RL5 A;  3KFD I;  1KTZ B;  5DO6 A;  2L03 A;  1BTE A;  2H7Z A;  2CCX A;  2CDX A;  2ERA A;  1MAH F;  2NBT A;  2CTX A;  1CVO A;  1JGK A;  2LA1 A;  1DRS A;  1NOR A;  1COE A;  2H62 D;  2HLR A;  1IDG A;  2GOO B;  4XJJ A;  1KBT A;  4HQP F;  2H62 C;  1COD A;  3EBX A;  1FSS B;  1LJZ A;  1MR6 A;  5IMT D;  1ERG A;  2QJA C;  2CRS A;  1LXH A;  1KFH A;  3PLC A;  1S4Y A;  3QB4 B;  1KU6 B;  2I9B E;  3BT1 U;  1HC9 B;  1LXG A;  1FF4 A;  1NYU A;  1CDS A;  1REW C;  1KL8 A;  2MUP A;  1CCQ A;  1XT3 A;  3ERA A;  1UG4 A;  1B41 B;  1NEA A;  3NEQ A;  1QKD A;  3VTS A;  1G6M A;  2FD6 U;  1ERA A;  3LAQ U;  1IJC A;  1HOY A;  5DU1 A;  2ABX A;  2JQP A;  4LFT A;  1CDR A;  1CXO A;  4OM5 A;  4FAO C;  4UY2 C;  1LSI A;  6EBX A;  1FAS A;  1FRA A;  1KC4 A;  1FSC A;  1LX5 B;  1CTX A;  1HAJ A;  4OM4 A;  1TGX A;  2JVE A;  1IDH A;  2H64 C;  1CB9 A;  2QJB C;  2MHY A;  2BHI A;  1NYS A;  2MJ0 A;  2VLW A;  1NTN A;  4FAO E;  3KFD E;  2PJY B;  1V6P A;  2L5S A;  3NDS A;  4BDT B;  2UX2 A;  4ZQY A;  3U73 U;  1BXP A;  1CRE A;  2QC1 A;  4BIK B;  1KBA A;  2MJ4 A;  2BTX A;  1F94 A;  1RGJ A;  1KBS A;  2H7Z B;  1W6B A;  1IDL A;  1PLO A;  3U74 U;  1CDQ A;  1KXI A;  3FEV A;  1I02 A;  4KSN A;  2K3G A;  2HLQ A;  4AEA A;  1CRF A;  1KS6 A;  3HH7 A;  4IYE A;  2GOO C;  3BT2 U;  1NTX A;  1H0J A;  1IDI A;  1ZAD A;  2MJY A;  4QTI U;  1CHV S;  1VB0 A;  4RUD A;  5DZ5 A;  3NH7 A;  1CXN A;  2MUO A;  2J8B A;  2N99 A;  1HC9 A;  1ABT A;  1QM7 A;  1JE9 A;  1FFJ A;  1CDT A;  4EY8 B;  1TXB A;  1L4W A;  1TFS A;  1IKC A; 
#chains in the Genus database with same CATH homology
 1IK8 A;  1F8U B;  2CRT A;  2H8U A;  1ES7 B;  1HAA A;  1JBD A;  2LCR A;  5EBX A;  4DO8 A;  2MFA A;  1NXB A;  1M9Z A;  2PJY C;  1QKE A;  1TXA A;  2X8B B;  1IQ9 A;  1YWH A;  4P7U A;  5IMY C;  1ONJ A;  2UWR A;  3EVS C;  2H64 B;  2QJ9 C;  2OFS A;  2H5F A;  1RL5 A;  3KFD I;  1KTZ B;  5DO6 A;  2L03 A;  1BTE A;  2H7Z A;  2CCX A;  2CDX A;  2ERA A;  1MAH F;  2NBT A;  2CTX A;  1CVO A;  1JGK A;  2LA1 A;  1DRS A;  1NOR A;  1COE A;  2H62 D;  2HLR A;  1IDG A;  2GOO B;  4XJJ A;  1KBT A;  4HQP F;  2H62 C;  1COD A;  3EBX A;  1FSS B;  1LJZ A;  1MR6 A;  5IMT D;  1ERG A;  2QJA C;  2CRS A;  1LXH A;  1KFH A;  3PLC A;  1S4Y A;  3QB4 B;  1KU6 B;  2I9B E;  3BT1 U;  1HC9 B;  1LXG A;  1FF4 A;  1NYU A;  1CDS A;  1REW C;  1KL8 A;  2MUP A;  1CCQ A;  1XT3 A;  3ERA A;  1UG4 A;  1B41 B;  1NEA A;  3NEQ A;  1QKD A;  3VTS A;  1G6M A;  2FD6 U;  1ERA A;  3LAQ U;  1IJC A;  1HOY A;  5DU1 A;  2ABX A;  2JQP A;  4LFT A;  1CDR A;  1CXO A;  4OM5 A;  4FAO C;  4UY2 C;  1LSI A;  6EBX A;  1FAS A;  1FRA A;  1KC4 A;  1FSC A;  1LX5 B;  1CTX A;  1HAJ A;  4OM4 A;  1TGX A;  2JVE A;  1IDH A;  2H64 C;  1CB9 A;  2QJB C;  2MHY A;  2BHI A;  1NYS A;  2MJ0 A;  2VLW A;  1NTN A;  4FAO E;  3KFD E;  2PJY B;  1V6P A;  2L5S A;  3NDS A;  4BDT B;  2UX2 A;  4ZQY A;  3U73 U;  1BXP A;  1CRE A;  2QC1 A;  4BIK B;  1KBA A;  2MJ4 A;  2BTX A;  1F94 A;  1RGJ A;  1KBS A;  2H7Z B;  1W6B A;  1IDL A;  1PLO A;  3U74 U;  1CDQ A;  1KXI A;  3FEV A;  1I02 A;  4KSN A;  2K3G A;  2HLQ A;  4AEA A;  1CRF A;  1KS6 A;  3HH7 A;  4IYE A;  2GOO C;  3BT2 U;  1NTX A;  1H0J A;  1IDI A;  1ZAD A;  2MJY A;  4QTI U;  1CHV S;  1VB0 A;  4RUD A;  5DZ5 A;  3NH7 A;  1CXN A;  2MUO A;  2J8B A;  2N99 A;  1HC9 A;  1ABT A;  1QM7 A;  1JE9 A;  1FFJ A;  1CDT A;  4EY8 B;  1TXB A;  1L4W A;  1TFS A;  1IKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...