1CWPA

Structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
KAIKAWTGYSVSKWTASCAAAEAKVTSAITISLPNELSSERNKQLKVGRVLLWLGLLPSVSGTVKSCVTETQTTAAASFQVALAVADNSKDVVAAMYPEAFKGITLEQLAADLTIYLYSSAALTEGDVIVHLEVEHVRPTFDDSFTPVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the native and swollen forms of cowpea chlorotic mottle virus determined by X-ray crystallography and cryo-electron microscopy.
pubmed doi rcsb
molecule tags Virus/rna
molecule keywords RNA (5'-R(*AP*UP*AP*U)-3')
total genus 27
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1995-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1cwpA00
3J7MA 1YC61 3J7NA 4OQ9A 1CWPA 1STMA 1JS9A 4NIAA 3J7LA 1ZA7A 1A34A 4OQ8A
chains in the Genus database with same CATH superfamily
2NQYA 1W6NB 1DP0A 4YM3A 4IV1B 5JZGA 1O3TA 2PFWA 2BNOA 3THPA 3VBHA 3DV8A 5A6XA 5IATA 4QQOA 5FZ6A 4AEDB 3HPNA 3PJYA 3ZYPA 1CWPA 3VDCA 4IEUA 1AR62 1FX5A 1RUC1 4GKYA 3W20A 4AHWA 3NAPC 2VXRA 4FPOB 4OYUA 4B4QA 1QJU1 2KXLA 2QQWA 1YQ8A 1VRBA 1DFQA 1GP5A 1RUJ2 1KFXL 2CHHA 4NPMA 5EJ3A 4LBQB 2CL2A 5CNAA 1UX7A 1ZNPA 2DVBA 1MEC2 4BYYA 1LB2A 4RR3C 1ND2A 3VZNA 2X5IA 2DCTA 1TMF2 4XBNA 4C0HA 1JYVA 4S2FA 3D0SA 3R6SA 2E33A 2RM21 2R7EB 1XYOA 4WM8C 4B3NA 1HRV1 4MXVA 2VECA 2E9QA 2HWF3 2VOVA 3QACA 4XVHA 1WLTA 3O1SA 1RVF1 4FXKB 2YFZA 2ZEZA 1QXJA 1O5UA 1QJY2 3U10A 3OEBA 2OX0A 1AXYA 1B09A 3N4MA 5FZFA 1Q8PA 4ZPIA 1QOOA 1XXNA 4R9BA 2RMU1 4P9GA 1NXD1 2D6PA 3RQ0A 1TME2 3S30A 3ZFGA 3I3QA 3JCIA 5A33B 5I0SA 5FKBA 3U4SA 3L9JT 3NJYA 4I09A 3VDDB 1JZ6A 4JZRA 4MGKE 4N9IA 4IE0A 1TMF3 1V6JA 4XFBA 2HWD2 5FYYA 1DG6A 2D5FA 4GD4A 4DFSA 4E2GA 1C8M2 1DQ0A 2P3IA 4FPHA 2BDRA 1SMVA 2RDSA 2WWUA 4COVA 1PVC1 3RWKX 4OQ9A 4AFMA 2CAUA 4LBQD 1LOBA 4XIKA 3THTA 3VDBA 2E26A 1LECA 2BP6A 1HRI1 3HT2A 2ZGMA 4FPYA 1J84A 4Y22A 4AFCA 5KXBA 1DGRA 1QJZA 3FHAA 1X50A 3AB0A 1JYCA 4XFFA 1PO13 1HKDA 2WAOA 4P14A 4AQSA 2CWSA 4KBBA 2E7AA 4NIIA 4YZ4A 3VBRB 1W9YA 3HAGA 4UW4A 2W1WA 5FZBA 2C0ZA 4WVWA 4CEWB 1Y3TA 1KGYA 2JG8B 2JE9A 3NW4A 3DXTA 4H14A 2AH2A 1UIJA 2R32A 3EHKA 1MACA 3UJQA 3LOBA 1DGWA 3IM0A 2D98A 2LTNA 3VBFA 1RXFA 3AYEA 5EYXA 4D3WA 3J8F3 5F9TA 5A3WA 5FP4A 2VL4A 1POV0 1EV12 2VBBA 3JQXA 5KHGA 2D40A 3S6PA 1VBA2 1DGWX 5D2AA 3LQCA 1O5LA 4V1PA 1EV11 5FTTC 2DU1A 1JU3A 4A7YA 4PLOA 4AVVA 1JHNA 4WM8B 3POWA 3WG2A 3T4HB 1UY1A 2ZGQA 4E2QA 1NE4A 1JZ3A 1X82A 1LJ7A 3VBHC 3LDKA 4XIOA 2W2IA 1WCKA 2FHRA 4E4ZA 4BHPA 4LITA 5FYMA 3N9LA 1YQCA 1J59A 1RUNA 5E6HA 3AMPA 1P8JA 4ATFA 4GWIA 5LK7B 1ULPA 3M4FA 3U37A 2GP3A 2PELA 3LIHA 4ZZ8A 2A1XA 3J7MA 2HJIA 3FHIB 4BJ0A 1HN1A 5DAWA 4Y20B 4LHSA 4AXOA 5ACA3 3K2OA 1NZCA 1A6CA 4KH9A 5IVEA 1O8PA 2QVSB 1UPSA 1W9FA 3ZX7A 5C8CA 3CZJA 2WT2A 1VAVA 2JIGA 2YXSA 2XONA 2D93A 5E89A 3WX5A 4UW6A 2JE7A 3MPBA 2EAKA 3A0KA 3C3VA 4KWJA 1RITA 1C8M1 1VR3A 1TE1B 3LWCA 1RJ7A 4RD7A 4QKFA 1YO8A 5FXXA 2HEYF 1GWMA 3PLQA 3AYCA 2OT7A 1WW6A 4M0NA 4AI9A 3V0AA 2QQOA 3MLKA 3IWZA 4OULA 1AZDA 5HV4A 3OSDA 1UZVA 4OI0A 3W5NA 3VKMA 3IT8A 3NRUA 1QJX3 4YVSB 4PCRA 5FOJB 4Y4YA 3D5OA 2ZGUA 1V6LA 4B29A 2D6MA 5LK5A 2AZ5A 2MHFA 5D21A 1XNDA 3KHBA 4HG6B 1W8NA 4XBQA 1KRIA 1D2SA 4JV4A 2CSGA 5D8AB 1VBC2 1W28A 3LPFA 3N35A 3RVHA 4HPKA 1EUTA 4GQ7A 2P3KA 1NQJA 1FNYA 2RM22 1PM7A 3OBTA 1YWKA 4IGOA 2IFRA 2HWE1 3TBDA 3ZKUA 1TMF1 3T2TA 5EP9A 1AL0G 4Y22B 4K8RB 3J26N 3ZYIB 2YU2A 3OBAA 1QNYA 4RHV1 5LW9A 1V6NA 5L9VA 4KGQA 4X6RB 4AQTA 5FZ4A 1OQEA 1CONA 1YQ6A 2AR6A 3SKJE 4CP9B 1UYYA 3OYWA 5A33A 5BNNC 3IBMA 4KNCA 2WNUB 1JYWA 1MZFA 1QU0A 1DQ2A 1N3OA 5C4WA 1OUXA 4BA6A 3RGBA 5KBFA 1FV3A 1NUKA 1OKQA 2B9VA 1WCQA 3PIGA 5FPAA 2P6HA 5H9RA 3ZLIA 5KC6A 3WINE 4C91A 4ZXKA 4GKXA 3QD6A 2C9KA 4LBLA 4Y4RA 3USUB 4RQPA 5H9SA 1HDKA 1MS5A 5KXEA 5KWRA 4WZFA 4Q4V3 3BALA 3JD73 2LALA 3FJSA 3RWNA 3KT7A 1JW6A 4Q0VA 2YHJA 4CDUC 4Q8KA 2XWJB 2X53S 3DYPA 5FZ8A 3P1IA 1TQ5A 1CX4A 1OQ1A 1N47A 4M00A 2BQPA 4META 3SITA 3WSOA 4WVZA 5LWBA 1AR63 4QXBA 4AW7A 3H50A 3SHRA 3ALQA 5A1LA 1QDCA 3KV5A 5CKNA 4DIQA 4P9JA 3SH4A 2B39A 3FUOA 1HB1A 1HV1A 2ARXA 1MS3A 2VNVA 4Q4X1 4QHOA 1ZRRA 2QUOA 3AFGA 4FFIA 4N90A 3KS7A 3RS6A 2OA2A 4J1WA 3ZR5A 5HCBA 1OA3A 1OURA 2D43A 1OF3A 2Y0OA 4Z92B 2QQJA 3N7KA 1JODA 1BZWA 1LOCA 2IWGB 4FTSA 2ZAAA 1DGLA 1ZBA1 2WINB 4DNYA 3EJKA 4Z2AA 1PK6B 4FPFA 2BERA 5CFCA 3TEXA 2JG9B 1AR82 2RS12 4CCLA 4UF0A 3Q8FA 1V6IA 1S0FA 2WUHA 4JHTA 2ENRA 5FP7A 4FFFA 3WW4A 4D94A 2PAKA 1DQ6A 3PIJA 4BQ3A 4FAGA 1JU4A 5B4NA 4O65A 2Z4FA 1IS5A 2R071 1OVPA 2Q1MA 4LNVA 4EV0A 5DG2A 3A0NA 1W8ZA 2PLV1 4XETA 4JGYC 4QPIC 2R042 1VBC1 4JDOA 4XDOA 3WF1A 3HN1A 2VD7A 4P02B 4LHNA 2UY9A 3N9OA 1O4YA 1RUG2 4P5HA 2YV8A 5EYYA 5CISA 1IPKA 2BJSA 5D8AA 1XE0A 2H0VA 5FPBA 1Y9GA 3ACIA 3WP5A 5T3NA 1R1A2 4LHLA 5FZAA 2VTFA 2TEPA 2RJKA 1LOFA 2DUPA 5F3GA 3OPWA 3M3QA 1NT0A 3B00A 4KGGA 3ZN6A 1BYHA 2C26A 1VPHA 3ZXLA 2HH9A 1QF3A 4K1ZA 4N7UA 5F3CA 3I2OA 1JYIA 2ZX1A 4Q4Y3 3ELNA 4NHXA 4CP9A 1KDMA 2EIGA 2ZS6B 4MGIE 3GZUC 4MXWB 2WR9A 4NRPA 3C7EA 4L97A 3PHMA 4JDMA 2P4EA 5FY8A 4ASLA 3OBRA 4COYA 5CBLA 5JPMB 2W94A 5F1RA 4BM8A 2PHFA 3ACHA 3CJIC 3DYOA 3KV4A 1YIFA 2QDNA 5IJRA 1LRHA 1YFYA 2PN5A 4QQHA 1BMV1 2XB6C 1H30A 2SLIA 3GJBA 4NIAA 3WW3A 3GHMA 1UMIA 2XKOA 1Y43B 4XURA 1EPZA 2ARAA 3ES4A 3A4UA 3LA2A 1G9CA 2BBVA 1W3XA 1H2LA 4EZ4A 1I3HA 1TME3 4CRQA 4QPGB 4Q4X3 4IEWA 3ACLA 5ISLA 3T09A 1XU2A 3OY8B 4X6QB 5DPNA 4GB32 4GMP3 1NG0A 4IL7A 4KU8A 5F3IA 2DVFA 5ABJB 3DUIA 4IXLA 2CGOA 4XFAA 5A7SA 4P08A 1COV3 3LF7A 4LA3A 5F32A 3I4IA 1H0BA 1MR5A 1K42A 5JZGC 4LLFA 4WM7A 3I3MA 1GMMA 5IAXA 3T0AA 4QKNA 3BODA 1HXS3 2K0GA 5C9AB 1D0GA 1PGW2 2RS13 2ORZA 1I5ZA 5A7WA 5CADA 4CEYB 3EXUA 3WQBA 4ISRA 4JX0A 3S5QA 3WNPA 2VY0A 1W8HA 2DYCA 4DUVA 1GOGA 4R9AA 2V09A 2ADDA 2WZ8A 5JXJA 2W68A 1EY2A 1KEXA 4LO6B 2LS6A 2BOJA 3P5BA 2WAAA 3QH7A 3VKFC 3KF5A 3IB3A 1LCLA 2CYFA 3O12A 3O1TA 2QQPA 2X10A 2ZGRA 5LA2A 1V6KA 2QQUA 3WXPA 3PVBB 3OYWB 5JI7A 3FWEA 1G9FA 2YGMA 4ZZ5A 2EA7A 4I2OA 3SH5A 1CAWB 4Y5SA 5BNOC 2GMPA 1L7QA 2ZHMA 2GN3A 3KF3A 1DLCA 1NE6A 1VBD1 1RUE3 2OPWA 3JXSA 5CFCB 3UGGA 3LSDA 1K5MC 3MDPA 3MF6A 2OUJA 4LK7A 5CKMA 4CCCA 5A7WB 5K0UC 1LHNA 1Z78A 3FMGA 2WFF2 4YW7A 3H7YA 1DQ5A 4Z82A 1OFSA 4XFHA 5IVJA 3RG0A 1W2OA 3OGSA 3NSTA 2J1EA 1HRV2 1IKQA 1D4M3 3MICA 4RQPC 1UWWA 4Q5OA 1I9RA 3WF2A 5FRAA 4MGTA 4IE4A 2AACA 2XUEA 5FYBA 1C8M3 1B35A 2JG8C 4LBKA 4PLMA 2YBKA 3B9IA 2GU9A 2D3RA 3I3DA 5GLZA 2HLEA 3BIWE 1LOAA 1RUE2 3HBZA 2D6LX 1WBFA 3I2FA 5FXWA 1RUOA 3RYRA 2PYTA 4JKLA 1QJU2 5JXHA 4CDUB 1LGNA 3ORJA 4GH4B 4HMZA 2WZEA 4XABA 4I30A 2E31A 1RMU3 2VO5A 3TRSB 3NNMA 2IXLA 1AR61 5FMOL 2GH8A 1UOJA 2ZZJA 4JGZA 5FPZA 4QDQA 1CAUB 3VBFC 4A6OA 1MVQA 4B4RA 3MV11 2AYHA 2HWB3 3AKSA 5CFDA 2ZGTA 2BZDA 2WNUC 3VUOA 3G6JB 3BUCA 4AVCA 1RJ8A 5BUVA 4M3CF 4CDWB 2BGPA 4F3JA 1LODA 3E5XA 3H1YA 4QWNA 3RPQA 3OTFA 4QX3A 4FOYA 1FATA 2J1UA 4MXWA 4U36A 1QIQA 1LOGA 3RMXA 2HWF1 2JD9A 2YPDA 3UESA 1UYPA 5HCAA 3T2OA 2VCMA 1PGL2 3ZIWA 4AEMA 5FP9A 4XQWA 1RUI2 1UU5A 1HQNA 4IV3A 2P34A 3TYJA 4WVVA 3AMMA 1DQ1A 2OUHA 2PXJA 3IDAA 5K7PA 3POEA 1GOFA 1Y9QA 2XVGA 3D82A 4PIZA 5FLHA 3DEMA 1BKZA 3J8F1 3WDXA 5FUPA 2XQXA 1FOD1 3DPRB 4H55A 4R9DA 4FTBA 2GNDA 3KLSA 5DAXA 3H0OA 5I8TA 5IK5A 4Z8BA 4RHV3 2EVXA 1UYXA 5BNPB 3VBFB 2CAVA 4LHKA 4PHZA 3WHUA 3WP6A 5JSRA 1HXS1 1J3PA 2ZGNA 3N9PA 3UKTA 4OFGA 1F9KA 4OUMA 1W9WA 4N8MA 3UGFA 2IFWA 4HVRA 3USUA 1K5MA 1BK0A 1PO11 1AX2A 3ZMNA 4B1LA 4GH4C 3SKVA 1OLMA 4IEXA 4LT5A 1R64A 1H4GA 2EF6A 3LZZA 2EXIA 3R0RA 2D6NA 2OVUA 3KWVA 4CDQC 2WZR3 1UMZA 2CV6A 2P17A 2QQVA 3NL1A 4LUKA 2VMEA 5AFBA 2RG4A 1FV2A 1SG3A 2B5HA 5DZEA 3V56A 3AC0A 5L7OB 5C5TA 1JYNA 3OJBA 4RQPB 3FL7A 4L11A 2ES3A 3QH6A 4YFWA 4AEDC 1JZ2A 4N53A 1S0DA 2XJRA 4G4FA 1I1EA 1O3SA 4YM0A 2PQQA 2BGOA 3B5LB 4P9XA 3WCRA 5LB6A 3DKWA 5HXVA 2ZGKA 1EPWA 2GZWA 3D0JA 4M01A 2NM1A 3IIIA 1GQHA 2CTVA 1D7PM 3BN6A 3OPZA 4MHRA 5K0UB 3GNEA 1F4HA 3ME2A 1KDKA 4YW4A 5CFCC 4MX3A 4TN7A 3PVEA 3ZYFA 3ZFGB 1UZYA 2A3XA 4AK3A 4B1MA 3WDYA 3VBHB 2XDVA 3O14A 4AGRA 3LSEA 2XJPA 1PMJX 3ZFFB 4HKLA 5FYHA 3DN7A 4P9LA 4QQPA 2PHTA 2QE3A 4M0HA 3VB9A 1IS3A 4UFHA 5G04L 5FZ3A 4D7SA 4WV8A 2ORXA 4H7LA 4C1XA 4FI9A 5DDJ1 1C3HA 2JX9A 5F5AA 4BWOA 2VZTA 3V64A 1XNCA 3MIEA 5GZDA 5G05L 3TEYA 2WSUA 4OQ8A 3SH3A 2PMWB 1POV3 3NNJA 4XCBA 1JTZX 2YPJA 3VV1A 4QU1A 3B3QE 2QFEA 4WM7B 4CCDA 1MPXA 3NQHA 5C8CC 5JZGB 1RMU1 2EAAA 1NCRA 4X8PA 3VDAA 2RS52 2WNVB 4JRAA 4A45A 5A7NA 3SCFA 3U0ZA 2WA3A 3RMYA 2Y26A 4H3WA 3WNNA 3M2MA 2QTWB 1LR5A 4IV1A 1GNHA 2JWPA 2XHNA 1TEIA 4IW3A 4QM8A 4W6XA 4AQ6A 3O1MA 4BOWA 4P5YA 4COWA 1YLLA 4LKSA 3T2QA 2DFBA 1X8EA 4FCAA 3VLBB 1HXS2 5DUWA 2DDUA 3AP9A 1YCIA 4RGKA 1QJX1 3W21A 1KITA 1L7LA 2IC1A 1OXCA 4LORA 5FK7A 5BYNA 3LDRA 2G9FA 1W2UA 4AFBA 4O9GA 2A6ZA 1HRI3 1JOJA 3VDDA 1LU2A 2X5IC 5AVAA 3MF9A 4HVQA 5DUUA 3U14A 5I93A 4D6SA 5KC5A 3PUHA 4QX5A 1R081 3MPPG 3NV1A 4BK5A 4XZPA 1OH4A 4DMIA 2EIDA 3RJ2X 2JIJA 1ZRIA 1XNKA 1RUI1 4NJ4A 2A5ZA 3N9MA 4LO5B 3H8UA 1D4VB 1W8FA 2ZX0A 5A3MA 1RUH1 3AZZA 4IQPA 1JH5A 1UY2A 4AI2A 5JLVA 3AZWA 1YNAA 3AKTA 2YBSA 2VQ0A 3FUQA 1I5PA 3ZSKA 3T3YA 2ZEWA 4N53C 3ZSJA 5FPXA 1T6GC 3QLQA 4K8FA 4HK8A 3WEZA 1C28A 2WWSA 1YC61 3T30A 3I3EA 3VD3A 3V0AB 1BVVA 3ZFEA 5J96B 3OBZA 2P5BA 3E5UA 2G9GA 3H1MA 4MGQA 1AL23 3ZXKA 4DRRA 4AEKA 4YYOA 1L3JA 4CEWA 4RS5B 3TN93 2VVEA 1BEV2 3ECQA 1SLTA 4DRVA 2A73B 1QH6A 2YB7A 4YFZA 1BJQA 4YZ3A 4IERA 4NHMA 4FSJA 1Q8OA 2VOTA 4CEYA 3WOGA 2PHDA 3AYAA 4WVMB 2Z69A 3ZVXA 1UL9A 4NAOA 3BB6A 4BZ4A 5JCTA 1VB2A 4COUA 4ZU5A 5C71A 4EWAA 1APNA 1R1A3 3FFQA 3M70A 5JR7B 3B7MA 1MS8A 1EAH3 4BLJA 4CP0A 2VW2A 4JGYB 5LEJA 1UKRA 5JSOA 2F4LA 4EN9B 1UO9A 4GMP1 2X05A 2WFF1 2ZKLA 1OT5A 3MIGA 3C7FA 5A3PA 1TNRA 2HWE3 1D4M1 2Q8CA 2VTXJ 2R1BA 5JUVA 1ENQA 1GWLA 1S2BA 3POGA 3WNLA 3EB7A 5LY2A 2CWMA 2JECA 3O1VA 1JOBA 4LLOA 4MVTA 3FHQA 1VBD2 3LEIA 5J37A 5T5JA 4PI2A 1ZZ6A 2JG9C 4E4SA 3H8OA 1PK6C 4K40A 5C7GA 3V0BA 1UX6A 5FZKA 4JKMA 5FXZA 3K46A 1W6MB 2WL1A 5IUQA 2PHLA 3MW2A 4G9SB 1LU1A 1EAH2 1YI9A 4Q27A 3UL2A 4ORFA 2ET7A 3HD8B 3OUJA 5T50A 1RXGA 4LTAA 4ARXA 2ZGOA 1WMDA 4EWEA 3K75B 5ACA1 3KCYA 3HNBM 3FBYA 3T4VA 3UT0A 1NLSA 1UMHA 1FPN1 3BPSA 1W6OB 2DCYA 2EXKA 4NVPA 2W92A 3JB4C 3TOJA 1SPPB 2HWC3 5FZDA 1J83A 2MEV2 4XF0A 2YYOA 5FBZA 4DINB 1ONAA 1G9BA 3KD4A 5LASA 1ACCA 5E16A 1H1AA 3AXDA 1O4ZA 1ZZBA 5C8WA 2HWD3 2OXBA 1JMUB 5LA0A 3ZXDA 2ZKNA 1R1ZA 2DTWA 2BYVE 3K48A 5GLWA 3M8LA 1UOBA 1QNWA 3ILRA 2JB8A 3LB9A 1CJPA 1X9PA 3POBA 3MUZ1 1GZCA 2JE8A 1E5SA 3AMHA 1GR3A 3AVRA 3PUQA 4XYXA 3IIAA 4LOSA 5LRRA 1R093 4IEQA 1HJGA 4QX8A 4FP2A 5CG9A 1UF2C 1R083 2W3JA 1GWKA 3GF6A 2GN7A 4AFAA 5I0TA 1IOAA 3POFA 4ZXEA 2B45X 3VBOA 3I7DA 2PHXA 2YGLA 2F6BA 4HKWA 2XKPA 3RYKA 4QXKA 5F6LB 2JDZA 2VMIA 3OF1A 1VBE2 4BU2A 1O91A 1H9PA 3RZHA 5L7OC 1GKBA 3OUIA 2LUWA 5A1FA 3IZOA 1RUI3 2YROA 2VUDA 1BMV2 3IDBB 2VH9A 1CESA 2NMOA 4TLFA 5C4WB 4FOVA 3AJYA 4CP2A 4FXGB 5FY0A 5IVYA 4AI0A 4YPJA 1VRH3 2IZWA 1OH3A 4DXTA 4ES8A 3N7LA 2GP5A 4A3ZA 1GBGA 5CVRA 3H3UA 2DF7A 3A7QA 3OGJA 4Q0PA 1TVGA 4LIUA 3U75A 1UOFA 3ZYRA 3HQXA 5BNPC 2VAUA 3I2IA 1CJDA 4YWAA 3ZPYA 4C1WA 1QJY3 1YI7A 5BNNA 1KQRA 5IHRA 1SFYA 4AEDA 1PO21 3DPRC 1F8VA 1OF4A 2ZHNA 1R1A1 3KV6A 3I3BA 3OUHA 4EJRA 1J3RA 1RHI3 2C4XA 3JBG2 4JGZB 3MGUA 1HB2A 1ZZ9A 5EQUA 5GKAC 3WDVA 4DS0A 5A70A 3VKNA 1JYXA 4K21A 1AUYA 1UOGA 3TEZA 4JC1A 1IGOA 1QWRA 2A70A 1ST8A 2XBO2 4P9YA 4MG2A 3VHOA 2G19A 3C7GA 1ZRDA 2VNGA 1J3QA 2JD4A 2MPFA 4CDXA 1V6OA 2VMGA 1B35B 3CF6E 1YXWA 2CNAA 5DAVA 2JKXA 2Q4SA 2X09A 5F8PA 2A6XA 2HWB1 1VAKA 2Q1ZB 4HN1A 4YG6A 2A6WA 1H6XA 3NMBA 4TYSA 5CA6A 4B8EA 1UKGA 5FKCA 3K77A 2VUAA 2B46X 2VQTA 2ZJCA 1ZX5A 2RS11 4HK9A 1AR81 4AHZA 2ZMKA 4MO3M 2WLPA 1ZBA2 4BXSV 2HYKA 2VZQA 4Q4W3 3WW2A 3TNQA 2FCTA 3C7OA 1WMXA 1NXMA 4GAZA 4O7XA 4CUCA 1XE8A 3HQUA 2IVJA 5EZWA 3LCPA 1AJKA 1VMFA 3I54A 1COV1 2ZEXA 1ZREA 3KQRA 1Y4WA 1VLNA 1M4WA 5FXVA 2FQPA 1YUDA 3UKNA 2VMCA 1RUF1 1DZQA 1K45A 3AKRA 4RSUA 3ES1A 5EJZB 2W87A 2JDPA 3CL1A 4CUGA 5GLVA 1G86A 1OOPB 4QD2A 4ZHNA 1QDOA 1SLLA 1W6QA 4YG0A 2Y6LA 4A44A 4CUBA 5I8YA 5C6CA 3OGVA 4D7TA 1G9DA 3IDCB 2X8KA 3WG3A 5CFDB 5J3UA 1US3A 2OYZA 3O1PA 4XILA 1IG3A 2W0XA 1ZBA3 4FVVA 1IHMA 2B7YA 2UY8A 2VVDA 2W1UA 1JHJA 1BQPA 4OMDA 3MW4A 1NCQC 1BEV3 5A3TA 1WCSA 5JMOA 1IPJA 3HQRA 4HKOA 3EO6A 1J58A 1AR92 3USSA 4QX0A 3ZDSA 4DO0A 1CZTA 3DL3A 4IE6A 3VD9A 2LRPA 4FQ4A 3JZVA 2WNVC 4RR3A 4ZS3A 4D0QA 3HT1A 1WD4A 3SC7X 2J1VA 5C8CB 2ZMLA 2K9ZA 4XUQA 4GJYA 3RZJA 3I59A 3MHZA 2HBTA 5EHDA 2RJ2A 2YDEA 5GJ6A 5FYTA 4RHV2 4DZGA 2BWCA 1F2NA 4OHVA 5J98B 3RZZA 3NKTA 4GWJA 2I45A 1DGRN 3I97A 5B4XA 3JD71 4XDPA 2HWE2 1VBE3 2NMNA 2IXKA 3ZIXA 4SBVA 4UW3A 1ENSA 4NMIA 3CJIA 4OVEA 1SDDB 2GMEA 1NAEA 1H9WA 2EICA 2C5DA 4Y5Z0 3A22A 3SLIA 1REEA 4F7ZA 3M1HA 1NCQB 2WQ8A 1H2KA 3KMHA 1VBC3 4QPYA 3NO8A 4UFLA 2WT0A 2GALA 3MFCA 1LESA 4XAAA 2MEV1 2V4VA 2VZUA 4CPBD 1LEMA 2RR12 1MS4A 3MEPA 1AR72 2Y64A 2JDMA 1XSQA 1IG0A 3M3CA 4PQ9A 4QDSA 2JENA 5DAQA 3ZXJA 2R063 4YG3A 3BTZA 4JHZA 3N9NA 3OD0A 4IE7A 2DVAA 5ACA2 1MQTB 3MIFA 4Y33A 3SNMA 4HVOA 1FAYA 1UNBA 1C57A 3ZN6B 3VN4A 3R4UA 1W0OA 2FZ2A 1EAH1 4GWNA 1N1SA 4HONA 4UWDA 4BMBA 4CDQB 4XFGA 3VZMA 1TG7A 3ASIA 1VALA 2TNFA 1LULA 1U5YA 4LR4A 5DUXA 5FJHA 4BQ5A 1QKQA 4QPIA 4FFGA 4TXWA 1JN2P 1CVNA 1GV9A 2DCKA 3CNAA 3WF4A 4EN8B 4W65A 3VL9A 1LNSA 1QXRA 3VD4A 2RV9A 1OA2A 5ANNA 5IK8A 1PZ8A 4GZ9A 1S0IA 4I0BA 2WKKA 2K46A 4XC9A 1WZXA 5F2SA 4AVAA 1VAMA 2C6SA 2ZCWA 5FK8A 4XJ8A 4D6RA 3HVDA 4LE4A 3AP7A 3GXUA 2NP0A 1YJLA 1VBD3 1PGSA 3POIA 1RUD1 3WG1A 3MFAA 4LOTA 5FZLA 4N43A 3H8XA 4HN0A 4Y5TA 5AC91 5DZFA 3FZ3A 5JVVA 1S2KA 4ZONA 1M06G 1NCRB 2YG0A 2JG9A 2H6CA 3ABZA 4Q4W2 1NKGA 5JPNB 3HOBA 5FUIA 3BIEA 5HV0A 2EALA 3VKOA 2W91A 2OQ6A 1CAXA 2WYFA 2WO1A 4DY3A 2VOWA 1ZA4A 4RS5A 1YFWA 1U12A 1CPNA 1V00A 2RDRA 4R8HA 3R4DB 3POYA 4V2VA 4QPIB 4I0WB 2IUWA 1PIV3 5F37A 1H8TC 3IMMA 3URFA 4DOUA 1OUSA 1PO23 4INDA 1GFF2 3CDZB 3T2PA 4NOTA 4XFCA 2R073 3ITQA 3KM5A 2WJSA 4B7EA 1D2QA 1UPIA 1UU6A 1HRI2 2CGNA 3GBWA 3TN92 4CDXC 5FYVA 2PHWA 2UURA 3RZGA 2NPIA 5FYIA 3UYJA 2VPVA 1AYN1 3IPVB 1UZWA 1CD3G 2B9UA 1W8WA 1WBLA 1XQNA 3BPZA 4UFIA 2QZ3A 2FDFA 1A78A 5LBFA 3BI3A 1IQAA 3PDQA 2Z5WA 3CU7A 4UBGA 4BQXA 1HQWA 4QAWA 3UGHA 2P6CA 1R082 2V5DA 2XVKA 4FPLA 4LBNA 1VE0A 5L9RA 5A7OA 2ATFA 4MZUA 2ZGPA 1RINA 1TME1 4C90A 1Y9MA 5FOBB 1REFA 1SDWA 2LM3A 4QB2A 1ULFA 4CTEA 5FYSA 4AZZA 4E9KA 3O7OA 2GMMA 5EWSA 2J1AA 5FO7B 5FUNA 1GP4A 2AUYA 4JCKA 5CIRA 5F39A 5FWJA 1RYYA 1QJX2 1DF0A 4ASMB 1N3PA 5A3NA 2V4AA 5J36A 1RVF2 3J4UH 1H2MA 4FFHA 2ZXQA 1FNZA 1UY0A 3B94A 5LCWL 5AFEA 2IXIA 4CE8A 2E6VA 4QHBA 3NNGA 3KGZA 4CDXB 1IPSA 1V70A 1V6MA 2FMDA 2DTYA 4LUMA 2RS53 4PDWA 4BQ4A 3WUCA 1LTEA 1MEC1 1WUVA 4ZKTB 2FBEA 4Q0UA 2ARBA 3GYDA 3LEGA 3PMSA 1X33A 1RUJ1 2CY6A 2XLGA 2RS51 1NOVA 4AI3A 3FN9A 5JI9A 3DPRA 4BLIA 1OLME 4IE5A 4AAPA 4RYDA 3MO4A 2AENA 2WQ4A 1LENA 1XJAA 3FFZA 2WIIB 5EV7A 2QCSB 3R4SA 3F2ZA 2A6VA 1FMD2 4K7JA 2ZGLA 1QY4A 4YGCA 1NA1C 2R0FA 2FDHA 1CPMA 4XDQA 1HV0A 4E27A 2OZ6A 3ZXGA 4NROA 4CEYC 1HB4A 1AXZA 2XLFA 1NCRC 2JICA 4QHZA 3WW1A 3AKPA 3E97A 3BYWA 2OS2A 4YSFA 1LGCA 4W6WA 2YUEA 4UFMA 3VL8A 3QOPA 1GNZA 4MH0E 1SBFA 1UW8A 3KT1A 3M7AA 5IVVA 3RZMA 4AR2A 3AL5A 2BFUS 1VBA3 2G1MA 4EWDA 3HR9A 2XJVA 4XQ4A 5C3RA 5DAPA 1GUIA 1PX3A 1OBNA 1Z7S2 4LBJA 5A3OA 5L19A 4LA2A 2KM2A 2ZHLA 3NWKA 1UIKA 2FCVA 5ANQA 2ZABA 2O8QA 4QPGC 4XJ9A 1UZ0A 1QOTA 3CLPA 1F35A 2ZEYA 4HBNA 3LD8A 4CDUA 3AMNA 3M3EA 4GWMA 4RFRB 2VW1A 1Q56A 2GDFA 5C33A 1W6PA 1LHOA 1PIV1 3RSJA 3UV9A 4AOCA 2C9AA 3H7JA 3IPVA 2P3YA 4XJUA 1BLZA 3PVOA 1QJFA 1TZOA 3HNYM 4Y24A 3WUDA 1GLHA 5K8SA 5IFPA 4LULA 1S4CA 3AKQA 5FAXA 4UAPA 1SBDA 2VCBA 1NY72 4ZS2A 3NNFA 2GH2A 4Q4Y1 1PO12 1W0NA 5L36A 3EYPA 1ND3A 2XLAA 1PIV2 4LBOA 1MS9A 3WHTA 2WRAA 5LY1A 1MQTA 3OD4A 5C3PA 3GZTB 2Z42A 4K20A 2WQZC 4M3CE 2RR13 5HCFA 3VBOC 2VR4A 4DXSA 2E53A 5HCHA 3VGIA 1OLQA 4N53B 5T5LA 1DIWA 1FOD2 5DN2A 3NVCA 4BDVB 3KSCA 2WS92 4N43B 2XL9A 2NZ9A 1VB4A 2VQUA 1WA6X 5LBCA 3I2DA 3NV3A 3FLRA 1BBT3 5L9BA 3T0DA 2V72A 2HWC1 2HWF2 1PGL1 2P3JA 2VMFA 3VBUC 1FI2A 1XC6A 4QGMA 2VGDA 4XZUG 4UOJA 4CCKA 5GZFA 2RDQA 2W39A 2WC2A 3AP5A 3AP6A 1ASJ2 4ET7A 4CEWC 1C5IA 4Y1UA 3FLTA 3UJOA 3VBRC 1W9TA 1DHKB 4S2GA 3BCWA 4BXFA 4DY5A 1QMJA 2RVAA 1ULEA 5ERLA 2ZGSA 4Z2WA 3Q8CA 4A41A 5A6ZA 2XMLA 2WS93 3VD7A 1WW7A 4KG0A 4XTMA 3U4XA 5I8SA 1FMD1 3SMHA 4I3PA 1VRH1 1AYM1 2A7AA 1PZ7A 2JDHA 2TBVA 4NHYA 4XMIA 4XHBA 4YNIA 3WNXA 5EXOA 2XJUA 1RUE1 2E63A 5CFDC 1HN0A 5FO9B 3POSA 4KBZA 2VM9A 4LKEA 4TZDA 2GAUA 2XVLA 2R061 5IW0A 5GZCA 2OQ7A 1OOPC 5FP8A 1S0JA 3VDDC 3BVCA 2FZ1A 4YM1A 1YFXA 3CEWA 5LRSA 4CCOA 4QU2A 5T5PA 1ZYBA 4QPGA 4YVWA 1AF9A 1GICA 1VBB1 4A4AA 5CAZA 1ALYA 3O5SA 4XQDA 2I07B 5FZ9A 1E5RA 3GZEA 2CU5A 4IGPA 3GBFA 4JAAA 3VBRA 1QOSA 3I2KA 1JZ7A 1T2XA 3LDBA 3MLLA 2CDOA 2Q8DA 5JDBA 1OOPA 2AC1A 1CGPA 1OPOA 3HJRA 1W8UA 3WZ1A 4EQVA 3ZFFC 4WZCA 1EV13 2BPA2 1BHGA 1KS4A 2RM23 2OIIA 4Y1YA 1LKNA 2WN3A 4NO4A 3NJZA 4ONUA 1OC1A 4YZ5A 4PLNA 3WDTA 2SBAA 4HXCA 5FY9A 1BVP1 3WQ7A 2Q8OA 4IUGA 4Q1PA 1AYN2 3IAPA 1DDLA 4XF1A 1ND3B 4ISQA 4F83A 3NAPB 4XXPA 2NN8A 4I01A 5EPAA 1K12A 1PZ9A 1MQTC 3PMEA 1KS5A 3E1F1 4HT1T 5DG1A 2J22A 5I0DA 2WNOA 4K6BA 2EIEA 3PU3A 3T0BA 4E4HA 3KQ4B 2VC9A 3D4KA 1NZIA 4NE9A 3AXEA 1PNGA 3CZUA 2Q1FA 4N9HA 4IV1C 4NHKA 5JSPA 4I0AA 1PGW1 3PL0A 2ZTNA 1S1AA 1W6PB 1XPWA 2Q0AA 4YARA 1GQPA 1PNFA 1LOFC 4OZOA 1H1IA 1YQ5A 5I91A 2PQSA 5D1IA 4OI2A 2VVFA 2R6QA 4MYEA 2JB4A 1H2NA 4M4PA 3ZFFA 2B42B 4ATEA 3PUAA 4M4RA 4E8CA 3ST7A 3RI9A 4EROA 4YVSC 5FZOA 2VQAA 4Q4W1 5BXXA 1WMEA 4GB31 3WCSA 4FPEA 5CKQA 1D0HA 1DLLA 1E57A 3THCA 3VZKA 2BOIA 2J1SA 2R062 1LGBA 4N7IA 4Y1XA 2VE1A 2XJQA 1XYPA 2RMU3 4KL1A 3QCWA 1U5IA 1POV1 1PVXA 1SFNA 1EUUA 5FPUA 1W99A 2VTXA 4YM2A 2Y34A 3D6EA 1V0AA 2VOXA 2FDIA 1AYM2 4EZHA 1VRH2 4GJZA 2W1QA 5JOZA 3MIBA 1GZWB 1UYZA 1S0EA 5F6KA 1A8MA 4O9EA 1REDA 4XPVA 2ZOEB 1BBT2 3B69A 1SCSA 1PHMA 4NIGA 5DZGA 3GZAA 5JIAA 4D6QA 3WP4A 4BB3A 1GOHA 5E88A 5L73A 4XJWA 2V73A 4NIDA 3CQOA 2HEWF 1HW5A 1CIWA 4XUOA 1VJ2A 2JEMA 3S57A 3LIGA 4QKBA 2GC2A 1W90A 2PLV3 2W08A 4AYUA 5FO8B 5BV6A 3WDWA 2R0HA 2E51A 1MEC3 4AF9A 4NAMA 4ASKA 1JZ4A 2QQIA 4PDWB 1O59A 4B7KA 5JOXA 1N1TA 4MADA 3WQ1A 1OPMA 2DCJA 1G6NA 1JS9A 4DXZA 1G7YA 1SPPA 3L2YA 2WT1A 5T52A 3ZPOA 3NNLA 5HBAA 3OG2A 3DYMA 2FDKA 5FQ0B 1RUG1 4GH4A 1QHDA 3HWJA 1GYKA 2OPKA 4Y1VA 4LK6A 3BKZA 1JI6A 2WNEA 3ZKYA 2OW4A 3MIDA 2VJXA 5JR2A 1CAVB 2YZ4A 3MV01 2JJ6A 1UCXA 4SLIA 2R30A 3DECA 5FDBA 1JZ5A 3JU9A 2PLV2 4P9WA 2J7MA 1OHFA 1X7NA 5BPXA 2R072 3OGGA 1SHWB 1W6MA 3ATGA 4MLOA 3K3NA 1HB3A 3LE0A 2ZMNA 1ZA7A 1O8SA 2VZPA 3M3OA 4FOWA 3Q8EA 4KI5M 5APAA 3BTYA 1K5MB 4CYDA 4IEYA 3HNMA 3KB5A 5JXGA 2ERFA 3FLPA 4MSVA 2NLRA 1MVEA 5C5UA 2DCZA 4H2AA 3ZYBA 4IESA 3PNAA 3E5QA 3NV2A 1HQLA 1URXA 5FY1A 4AHXA 4AI8A 1E5HA 1DYPA 2BTVC 1AR83 4QXCA 1AR91 2UWBA 4M3CA 3A21A 3PVNA 4Q1RA 1BCXA 1W3VA 4YGDA 3HIFA 4AE2A 3OPTA 3J7HA 2DU0A 1CAVA 4YW2A 2F4PA 4JQRA 3ZXAC 3WQ0A 3C8XA 4DQAA 1RC6A 3IN9A 4L2NA 1XU1A 3BGAA 4PIYA 4IEZA 4A2UA 4OHYA 4X8NA 1QH7A 1WMFA 1S55A 1LHUA 2PAMA 4XUTA 4ZY9A 4V2WA 5C9AC 2VG9A 2RDNA 2E7TA 1DQ4A 3ILFA 5LA9A 1RUH3 1X9TA 1JBCA 4RS5C 1GQGA 2IXHA 1DU3D 4DUWA 4MGZE 4RR3B 4K1YA 1RUD3 1CZVA 1ULDA 2KD7A 4HLTA 4UFKA 4YW3A 2DUQA 4CXYA 3N7MA 5C70A 1POQA 1OA4A 2DURA 3H3ZA 5GLUA 4NR1A 2IXJA 3SEPA 2Q30A 1JUIA 5A32A 3BTXA 2WDBA 4TLGA 1O3QA 2XGXA 2J1RA 1F5FA 2DWRA 5FZMA 2AREA 3TWIA 2B8MA 5CZKA 2FD8A 5FPLA 5CEHA 3ZM8A 1IS6A 2D6KA 2XL7A 4KWLA 4A6SA 4GULA 4K9SA 2QBXA 1G8WA 2HWB2 5JWPA 3ON7A 3EBRA 4C0BA 4E8DA 4A7ZA 4FQZA 2BVBA 2XUMA 4XXAA 3AL6A 2A6YA 3ENRA 3IMNA 5F5IA 4QQ2A 2D44A 1PVC3 4AQ2A 2VOKA 1MS0A 1NCQA 2J42A 2XBO1 4FO9A 5FYCA 4YZ1A 5F7UA 4ZU4A 3ZYJB 2K2SA 1W39A 3WT3A 1UY3A 2GSYA 2UU8A 2Z79A 3EMRA 1ND2C 2VBDA 3JQWA 3WDUA 4XEZA 5GZEA 3U07A 3MZHA 4XF3A 3BOPA 5IK4A 3JBG1 2VNRA 2WNUA 5KXDA 2R16A 4LO4B 1R092 2KA3A 3J9SA 2ARCA 2R49A 3CIHA 1W06A 4ES9A 4AGVA 3I49A 4U2AA 5FPVA 5FYZA 1PM4A 3AYDA 4LXLA 1PO22 5FBJA 1GZTA 5A6YA 1WCDJ 4XMAA 1ZM1A 1UXZA 2ZACA 1V9U3 2WNVA 5FZGA 5KHKA 1H8VA 3KV9A 4LBMA 2H6BA 4QX7A 1Q5OA 3ZDVA 4XJAA 2DUOA 2WWJA 2XJTA 4CP1A 5E8AA 5I0RA 5FFOC 4I3GA 1AR93 1UXXX 3LA7A 5LATA 5FR3A 4XCAA 4PBOA 5L7OA 3TN91 4PJYA 3J7LA 1JXNA 2P37A 5CB7A 1ULGA 1HLCA 4EN7B 4OHXA 5E1RA 2VCAA 3B93A 1XE7A 2DV9A 4BH9A 2FMYA 1SQ4A 5IVCA 1ENXA 2Y0IA 2E7QA 3KVBA 1CX1A 4COZA 2I2SA 3TB0A 1U5XA 1RUC3 2XH6A 4NUBA 4UXAA 3VD5A 4LEJA 1CN1A 1WW5A 3JB8A 3ZFGC 4WBBA 2ET1A 5A7PA 4BQ2A 1TNFA 1QQP3 2VMHA 4FPKA 1YRZA 1OVSA 3SXWA 1WCUA 1O6UA 2QQMA 3GCXA 4CXWA 1VBA1 1LOEA 1CAXB 4HFSA 5SV5A 4BIOA 5AC92 5C4WC 1W04A 1RUD2 5DXDA 1IQDC 1RUG3 3S5AA 3LEMA 1O4TA 5FJKA 3ZMOA 2Q8EA 1WLWA 1AYN3 3HN3A 4KWUA 4AGGA 2BUKA 4YW5A 3WNMA 2WA4A 2VU9A 5FMBA 1OKOA 1W6OA 4A42A 5DMYA 5A1AA 1T6BX 3NKGA 2WFF3 1K3IA 4N43C 4QX1A 4QM9A 4W8JA 1GNYA 1NYWA 4NWVA 4BMEA 1UY4A 1FPN2 1F31A 2W46A 1BK1A 3VBOB 2JDNA 5LZ6A 2BV4A 5IT6A 3PU8A 1W2NA 4Y20A 3U78A 5KR7A 4R4ZA 2JDUA 2ZX2A 1PVC2 3ZSLA 4EE2A 3V65A 3Q8AA 1NLRA 2VNOA 2YBPA 4HL0A 1GSLA 3RRDA 3POJA 3ZYGA 4YW1A 2XOMA 3VHNA 1DZTA 4PIXA 5GZGA 1W0PA 2HWD1 1RIRA 1YYNA 4URTA 4NIHA 1AR71 1OD5A 4CDQA 2RR11 4QGNA 1XRUA 1KXGA 1OI6A 1J1TA 2ZPXA 3BU7A 3PUIA 5ABJA 2ID4A 3RJRA 2DVDA 3ILNA 3AFKA 4QGLA 5FY5A 4HANA 1XOYA 3WP3A 1J1LA 1W2AX 2RMU2 3LPGA 4Q29A 1FPN3 5FZIA 1RVF3 5KXCA 4PF5A 5F3EA 1RUJ3 2AEYA 4Q8LA 2X5IB 1C1LA 2XR4A 1D4M2 1KFUL 3WG4A 5J1XA 1QJY1 2C1FA 1U0AA 4XBLA 3D3AA 3WF0A 1IZ3A 4GB33 3VKLA 1SBEA 1ZZ8A 2VUJA 1EP0A 1EYBA 2RHPA 4CDWC 1YQ2A 3E6CC 3RZLA 3P3NA 1H8TA 4AL9A 4BPZA 2XBO3 5EIYB 2XG3A 5D8AC 1W9SA 2VZ1A 3BTAA 3NJXA 4Z07A 5IFTA 5JOYA 3JD72 5BNOA 2X29A 3VZLA 1AX1A 2Q5TA 3T1MA 5JAXA 2IXCA 3I2HA 1WGPA 2ZAHA 4HSJA 4Q2FA 4JQTA 3IDEA 4IEOA 4FBFA 3O0XA 3MYXA 3ZR6A 1O3RA 2VZVA 4RFT0 1RUC2 2ZBJA 2HYXA 1H6YA 1Q3EA 4FPJA 4NWWA 3R05A 3ZOIA 1YJKA 2WLQA 2XWBB 4KU7A 3X29B 3E6BA 4BQYA 2QQLA 1U5ZA 4GA9A 2DVGA 1PMIA 3MI8A 1FOD3 2LW8A 1ULCA 2XQRA 3F95A 2AEZA 5IAVA 2CGPA 1SCRA 2WZR2 4NRQA 2GC1A 2BEOA 4UT5A 1PX4A 1RUH2 3C7HA 4W50A 1N3QA 4HPKB 4KQ7A 1LEDA 5CYYA 5FIXA 5KHHA 3VHPA 1DCSA 4P9IA 4C8DA 1SZBA 2YU1A 1Z7S3 1CR7A 1SLBA 4OI1A 2FCUA 4XFIA 2ZHKA 4TSVA 2GNBA 4Q26A 1AJOA 2UYBA 1F15A 1R091 1W8OA 1XNBA 2WO2A 3GDBA 4AVTA 4CZSA 1RUF2 4CVUA 5K9YA 3WY6A 4B4PA 3UKVA 3K4ZA 1COV2 2BWAA 5IVBA 2R043 2VCCA 4XAEA 4AVSA 5FZEA 1RHI2 3JBG3 4HETA 4IEVA 4QB1A 1SLIA 4D8MA 4AG4A 3GM8A 4BISA 1ZRFA 3K3OA 1WWYA 2O0OA 2WYSA 3AZXA 4QX2A 5LEKA 5A6QA 3D8CA 1OFNA 3Q9OA 3S7EA 1ZZCA 3B9CA 5BNQA 3WD5A 2D97A 1DZRA 3CJXA 4CSWA 3C2UA 4FAHA 3FC0A 1VBB3 3S7IA 5B2GB 2PTMA 3ZXFA 1H1MA 5FLIA 3ZFEC 1RMU2 1JUHA 3O1RA 5J09A 5FV3A 5T5OA 4D7YA 3CMGA 3ROUA 4JDNA 3U1XA 1Q8VA 4MUVA 1FYUA 3H1WA 4XW3A 1N1VA 2BBAA 4LE3A 2ZX3A 3JUUA 4JRLA 3O0VA 3THDA 3ZSMA 1VMHA 4OHZA 1GZWA 2ILMA 2W52A 5JOWA 1XNTA 3DKQA 1CIYA 3OY8A 4MV2A 1C4RA 5IWFA 5FLJA 4BK4A 2YC2A 4QT6A 2C24A 1A3KA 2RS33 2BVVA 3LEKA 1JOPA 3ACFA 4RL7A 2QKDA 4XF9A 4R4XA 2BNNA 4CCEA 4R9CA 1QJEA 1X8MA 3MIHA 1C8NA 4L99A 4TWTA 2VZOA 5FY4A 4FOQA 1ND3C 2YY1A 4UYBA 2A75A 3A23A 1BXHA 3K51A 3PTYA 1GP6A 5JIUA 3H8RA 3CJIB 4K3UA 3N7JA 2O8OA 3KCXA 4AHYA 4LJHA 3O0WA 2OKXA 3EQEA 4G3YC 4OZXA 3L2HA 3VBSB 5FZ7A 4GXLA 1SFPA 2Y6GA 2WABA 5FMOS 1KJRA 5LBEA 1MZ6A 3P6BA 4LIVA 2RS32 4ARYA 3AK0A 1VBE1 2QJVA 3UNPA 3VBSC 3W58A 2UWAA 3V0BB 1YFUA 1PK6A 5EJ1B 5FY7A 3MW3A 4GALA 3N3HA 2QDRA 4LPLA 4J1XA 5A3LA 4J6GA 1FT9A 2XHKA 1F5JA 1KD7A 5C3SA 1NA1A 5SV8A 1C1FA 4DB5A 2R1DA 1ZRCA 4ITCA 4CU8A 1X36A 2PAEA 3KT4A 1SEFA 4LBQA 2ZA9A 2A3YA 4XUNA 2WSVA 1FXZA 4NN0A 1ODMA 1AL22 5F2WA 1JZ8A 1V9U2 4J25A 1L7RA 4NPRA 3LFIA 2JDKA 2Y38A 1ZVFA 3ZSEA 1XB9A 2A71A 4QMAA 1ZBE3 2ZZQA 4UFJA 3U11A 2W95A 4XHXA 5LA1A 1XYNA 2XXZA 4URAA 4IGQA 2OZJA 2WO7A 2RE9A 4Q4V2 3ETQA 4YGEA 2HEVF 5A32B 2DBIA 3J8F2 4BIFA 2G9ZA 3NV4A 4BCUA 5HPOA 2VULA 2B4KA 3WVJA 1MZ5A 3VBSA 1NLQA 3J7NA 5FQ0A 3ZYHA 4EN6B 3OEAA 3OOXA 4A7KA 1C5HA 3SCGA 5F5QA 1PMHX 5BNOB 1KJLA 4DUXA 5IVFA 4IETA 4UI9L 3B01A 2Y8KA 2V5YA 3GGLA 3H9AA 5FREA 3G7DA 3P3PA 2KR2A 1S0BA 4LKDA 1H4HA 1RUF3 3LAGA 1UD1A 1ZBE2 2BNMA 4NHLA 1STMA 3ZFEB 3GCWA 5K4LA 5HXMA 4FPGA 5CG8A 2VW0A 4Y26A 1K5JA 2EIBA 2VZRA 1QQP2 1CAWA 1AHSA 4OHWA 2CDPA 3GJAA 1LHWA 3VBUB 4WM8A 1BBT1 2J1TA 3RNSA 3AM2A 2L9LA 3AP4A 2RJLA 4XACA 5JMCA 4CCNA 4UF0B 3AVSA 2PA7A 4IDZA 5LBBA 4YVSA 1W8TA 3LFMA 3DXUA 3W5MA 2HBUA 1RL3A 4O61A 3CBNA 3CO2A 1VP6A 3AMQA 3PUSA 4H7MA 4S2HA 4HOOA 5T54A 3KHCA 4Y1ZA 1Q43A 4LQRA 4AI1A 4Y3OA 1W6QB 4E2SA 5C3QA 3BU0A 3SISA 4A3XA 1OSGA 5DQ0A 3NAPA 4JVAA 4XUPA 1WKYA 1S2EA 2D5HA 1Y7BA 1Q8QA 2D3PA 4YGBA 5GLTA 3VZOA 5KHJA 1YIPA 1AR73 4YLZA 2XPJA 4JKKA 5DDJ3 4QKDA 2MNGA 4CUAA 3WNKA 1UN1A 3N36A 1YHFA 5J48A 3RI8A 5ABJC 4BQ1A 3B02A 4DPNA 4NPLA 4PT6A 1IS4A 2TUNA 3FBMA 1W2TA 4CCJA 1I6XA 4CXXA 3TEWA 4DXRA 2PHUA 5A7QA 3INAA 3LKJA 4IV3C 5KHIA 2GC0A 5BNNB 3CHXA 3VBUA 1W05A 1BEV1 2IVIB 1AVBA 5T55A 2UYAA 2F17A 3RZKA 2Z2SB 3RDIA 4TTGA 4CDWA 2YC0A 4RGAA 1QJU3 3CKHA 4W4ZA 5I0UA 4BQWA 4YRDA 2JDYA 4WVMA 4AEJA 1GANA 5IYYA 3ZN4A 1UU4A 2Y6KA 4D69A 1QQP1 2EXJA 3ACGA 3KVAA 1CAUA 4QXHA 2BRTA 1S0GA 4OUSA 3O1UA 1ZBE1 4OUEA 4PBPA 1N1YA 3FX3A 4QDRA 4LO8A 3LOIA 1WLDA 3Q8BA 2ETEA 5TSWA 1UAIA 4CCMA 1IKPA 1OQDA 2P2KA 4OLLA 1WLCA 4P00B 4XF4A 4E4DX 3FE5A 4ZU7A 1A8DA 2PHRA 4LMFA 1G9AA 1CZSA 3DCQA 3T08A 5CU1A 4YVWC 3MLJA 1SLCA 2DBNA 5FWEA 1LAJA 2DFCA 1B35C 2JG8A 2ZX4A 3DF0A 4FP3A 5FZHA 1GU3A 4XE9A 4HZFA 5FMDA 4RA0A 1HIXA 1E5IA 1F4AA 4CPBA 2QQKA 3KZ4C 4MHUA 4Q4V1 1WD3A 5FZ1A 3UETA 3BOWA 1YEWA 4PF1A 5A3UA 3NJVA 4YZ2A 1DYKA 2FDJA 1NX9A 2HKXA 1SACA 5BNPA 3HBKA 2GNTA 3OB8A 4XTPA 3M3IA 5EFUA 1NA1B 4MGSA 1V9U1 2YMZA 1VBB2 1AL21 3LA3A 3PJQA 4JGZC 4LKFA 4UW5A 4XJZA 3MUY1 2A3WA 3UK9A 4FTEA 5A80A 3W9AA 5M0TA 5FZCA 3GHNA 3I8TA 4MGYE 4OI4A 2I74A 3GALA 2Y60A 3E6DA 3HEIA 1QGLA 1AX0A 4QPWA 4QB6A 1HRV3 2Y6HA 5FYUA 2BFUL 5H9QA 4S2DA 1MS1A 4FPCA 4Q0SA 1RGSA 2UWCA 2JDAA 1DBNA 5AVPA 2VUCA 3ETPA 3I2JA 3WR0A 4HSLA 1W6NA 1VIWB 5FP3A 2RS31 3AZVA 4YVWB 5F5CA 3AZYA 2VZ3A 2JKBA 5C9AA 3H3LA 3KGLA 2W47A 4BE3A 4CA9A 2O1QA 2D3SA 2NYYA 4GMP0 2Y6JA 1CQ9A 2FDGA 5C3OA 1UZZA 4GIQA 3QBQA 4KG8A 2W5FA 3AX4A 1XSRA 4EN0A 1DYOA 1ENRA 3HMYA 5FCCA 2XJSA 4FT8A 1ZZ7A 2Y33A 1FMD3 3TAYA 1WW4A 3IAQA 1OMIA 1Q8SA 3I59B 5DDJ2 1ODNA 3OCPA 3PTRB 1ASJ1 2QQNA 2G4IA 1O7FA 1VMJA 2VBPA 3SCHA 1HX6A 4NRMA 4AVBA 3W59A 3S0MA 4JTOA 2HWC2 3AJZA 4PQQA 4L0PA 2WN2A 4QQLA 3K4DA 4W6YA 1XNAA 4Z1VA 2LROA 2MEV3 4I02A 3VZJA 3WNOA 4AFDA 5BY5A 1NQDA 1AYM3 2P1BA 4OMCA 3N9QA 1QXPA 2D6OX 4PI0A 4CU9A 2BW8A 4IV3B 1A34A 1JYTA 3IKWA 5HI0A 2WS91 4JGYA 5GALA 3SEEA 4AWDA 1ASJ3 4PDWC 4OCTA 3DGTA 2N7GA 1AXKA 5DUVA 2E32A 3I2GA 2YC4A 3ZXEA 3GBGA 1S0CA 2WFPA 4L8QA 2AGSA 4EYUA 4DEQA 2R041 1RTVA 3APBA 4KMQA 5J7MA 4F8AA 4DEVA 2JXAA 2WZPP 2H0BA 1W03A 1H8TB 2EXHA 5JXIA 1RB8G 4Q4Y2 4L9BA 1NY71 1OLRA 5GM0A 3WV6A 4AAXA 2ADEA 3MBWA 2W9XA 3ZN5A 3VHRA 4WM7C 4Q0QA 4UBHA 5FZ0A 5FZOB 3T1LA 3RYPA 3WLUA 1US2A 2WO3A 3KCCA 3H42B 5FMCA 2VMDA 1RHI1 5AC93 4M3CB 1OD3A 2VXJA 4MOAA 1QEXA 1WA4A 5IK7A 2QNKA 2QZ2A 4JTNA 2GNMA 4CU6A 4XOGA 2Y6FA 2BU9A 3PURA 3RFRA 3TNPB 1XBFA 2WBKA 2YFUA 3WF3A 4Q4X2 1ULOA 4IEPA 3K4AA 4R52A 1Z7S1 1MZEA 3O1OA 1SLAA 4YW6A 4RN5A 5K0UA 4L92A 1ND2B 1UQXA 2GC3A 1Z0HA 1HJFA 2BGCA 3ZO0B 4KWKA 2VZSA 3LGRA 3SQOA 4RGGA 2D7FA 5H9PA 5DABA 3OGRA 2W1SA 2O14A 4CU7A 4LO7A 2WZR1 1GZ9A 1LHVA
chains in the Genus database with same CATH topology
3J7MA 1YC61 3J7NA 4OQ9A 1CWPA 1STMA 1JS9A 4NIAA 3J7LA 1ZA7A 1A34A 4OQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7M A;  1YC6 1;  3J7N A;  4OQ9 A;  1CWP A;  1STM A;  1JS9 A;  4NIA A;  3J7L A;  1ZA7 A;  1A34 A;  4OQ8 A; 
#chains in the Genus database with same CATH topology
 2NQY A;  1W6N B;  1DP0 A;  4YM3 A;  4IV1 B;  5JZG A;  1O3T A;  2PFW A;  2BNO A;  3THP A;  3VBH A;  3DV8 A;  5A6X A;  5IAT A;  4QQO A;  5FZ6 A;  4AED B;  3HPN A;  3PJY A;  3ZYP A;  1CWP A;  3VDC A;  4IEU A;  1AR6 2;  1FX5 A;  1RUC 1;  4GKY A;  3W20 A;  4AHW A;  3NAP C;  2VXR A;  4FPO B;  4OYU A;  4B4Q A;  1QJU 1;  2KXL A;  2QQW A;  1YQ8 A;  1VRB A;  1DFQ A;  1GP5 A;  1RUJ 2;  1KFX L;  2CHH A;  4NPM A;  5EJ3 A;  4LBQ B;  2CL2 A;  5CNA A;  1UX7 A;  1ZNP A;  2DVB A;  1MEC 2;  4BYY A;  1LB2 A;  4RR3 C;  1ND2 A;  3VZN A;  2X5I A;  2DCT A;  1TMF 2;  4XBN A;  4C0H A;  1JYV A;  4S2F A;  3D0S A;  3R6S A;  2E33 A;  2RM2 1;  2R7E B;  1XYO A;  4WM8 C;  4B3N A;  1HRV 1;  4MXV A;  2VEC A;  2E9Q A;  2HWF 3;  2VOV A;  3QAC A;  4XVH A;  1WLT A;  3O1S A;  1RVF 1;  4FXK B;  2YFZ A;  2ZEZ A;  1QXJ A;  1O5U A;  1QJY 2;  3U10 A;  3OEB A;  2OX0 A;  1AXY A;  1B09 A;  3N4M A;  5FZF A;  1Q8P A;  4ZPI A;  1QOO A;  1XXN A;  4R9B A;  2RMU 1;  4P9G A;  1NXD 1;  2D6P A;  3RQ0 A;  1TME 2;  3S30 A;  3ZFG A;  3I3Q A;  3JCI A;  5A33 B;  5I0S A;  5FKB A;  3U4S A;  3L9J T;  3NJY A;  4I09 A;  3VDD B;  1JZ6 A;  4JZR A;  4MGK E;  4N9I A;  4IE0 A;  1TMF 3;  1V6J A;  4XFB A;  2HWD 2;  5FYY A;  1DG6 A;  2D5F A;  4GD4 A;  4DFS A;  4E2G A;  1C8M 2;  1DQ0 A;  2P3I A;  4FPH A;  2BDR A;  1SMV A;  2RDS A;  2WWU A;  4COV A;  1PVC 1;  3RWK X;  4OQ9 A;  4AFM A;  2CAU A;  4LBQ D;  1LOB A;  4XIK A;  3THT A;  3VDB A;  2E26 A;  1LEC A;  2BP6 A;  1HRI 1;  3HT2 A;  2ZGM A;  4FPY A;  1J84 A;  4Y22 A;  4AFC A;  5KXB A;  1DGR A;  1QJZ A;  3FHA A;  1X50 A;  3AB0 A;  1JYC A;  4XFF A;  1PO1 3;  1HKD A;  2WAO A;  4P14 A;  4AQS A;  2CWS A;  4KBB A;  2E7A A;  4NII A;  4YZ4 A;  3VBR B;  1W9Y A;  3HAG A;  4UW4 A;  2W1W A;  5FZB A;  2C0Z A;  4WVW A;  4CEW B;  1Y3T A;  1KGY A;  2JG8 B;  2JE9 A;  3NW4 A;  3DXT A;  4H14 A;  2AH2 A;  1UIJ A;  2R32 A;  3EHK A;  1MAC A;  3UJQ A;  3LOB A;  1DGW A;  3IM0 A;  2D98 A;  2LTN A;  3VBF A;  1RXF A;  3AYE A;  5EYX A;  4D3W A;  3J8F 3;  5F9T A;  5A3W A;  5FP4 A;  2VL4 A;  1POV 0;  1EV1 2;  2VBB A;  3JQX A;  5KHG A;  2D40 A;  3S6P A;  1VBA 2;  1DGW X;  5D2A A;  3LQC A;  1O5L A;  4V1P A;  1EV1 1;  5FTT C;  2DU1 A;  1JU3 A;  4A7Y A;  4PLO A;  4AVV A;  1JHN A;  4WM8 B;  3POW A;  3WG2 A;  3T4H B;  1UY1 A;  2ZGQ A;  4E2Q A;  1NE4 A;  1JZ3 A;  1X82 A;  1LJ7 A;  3VBH C;  3LDK A;  4XIO A;  2W2I A;  1WCK A;  2FHR A;  4E4Z A;  4BHP A;  4LIT A;  5FYM A;  3N9L A;  1YQC A;  1J59 A;  1RUN A;  5E6H A;  3AMP A;  1P8J A;  4ATF A;  4GWI A;  5LK7 B;  1ULP A;  3M4F A;  3U37 A;  2GP3 A;  2PEL A;  3LIH A;  4ZZ8 A;  2A1X A;  3J7M A;  2HJI A;  3FHI B;  4BJ0 A;  1HN1 A;  5DAW A;  4Y20 B;  4LHS A;  4AXO A;  5ACA 3;  3K2O A;  1NZC A;  1A6C A;  4KH9 A;  5IVE A;  1O8P A;  2QVS B;  1UPS A;  1W9F A;  3ZX7 A;  5C8C A;  3CZJ A;  2WT2 A;  1VAV A;  2JIG A;  2YXS A;  2XON A;  2D93 A;  5E89 A;  3WX5 A;  4UW6 A;  2JE7 A;  3MPB A;  2EAK A;  3A0K A;  3C3V A;  4KWJ A;  1RIT A;  1C8M 1;  1VR3 A;  1TE1 B;  3LWC A;  1RJ7 A;  4RD7 A;  4QKF A;  1YO8 A;  5FXX A;  2HEY F;  1GWM A;  3PLQ A;  3AYC A;  2OT7 A;  1WW6 A;  4M0N A;  4AI9 A;  3V0A A;  2QQO A;  3MLK A;  3IWZ A;  4OUL A;  1AZD A;  5HV4 A;  3OSD A;  1UZV A;  4OI0 A;  3W5N A;  3VKM A;  3IT8 A;  3NRU A;  1QJX 3;  4YVS B;  4PCR A;  5FOJ B;  4Y4Y A;  3D5O A;  2ZGU A;  1V6L A;  4B29 A;  2D6M A;  5LK5 A;  2AZ5 A;  2MHF A;  5D21 A;  1XND A;  3KHB A;  4HG6 B;  1W8N A;  4XBQ A;  1KRI A;  1D2S A;  4JV4 A;  2CSG A;  5D8A B;  1VBC 2;  1W28 A;  3LPF A;  3N35 A;  3RVH A;  4HPK A;  1EUT A;  4GQ7 A;  2P3K A;  1NQJ A;  1FNY A;  2RM2 2;  1PM7 A;  3OBT A;  1YWK A;  4IGO A;  2IFR A;  2HWE 1;  3TBD A;  3ZKU A;  1TMF 1;  3T2T A;  5EP9 A;  1AL0 G;  4Y22 B;  4K8R B;  3J26 N;  3ZYI B;  2YU2 A;  3OBA A;  1QNY A;  4RHV 1;  5LW9 A;  1V6N A;  5L9V A;  4KGQ A;  4X6R B;  4AQT A;  5FZ4 A;  1OQE A;  1CON A;  1YQ6 A;  2AR6 A;  3SKJ E;  4CP9 B;  1UYY A;  3OYW A;  5A33 A;  5BNN C;  3IBM A;  4KNC A;  2WNU B;  1JYW A;  1MZF A;  1QU0 A;  1DQ2 A;  1N3O A;  5C4W A;  1OUX A;  4BA6 A;  3RGB A;  5KBF A;  1FV3 A;  1NUK A;  1OKQ A;  2B9V A;  1WCQ A;  3PIG A;  5FPA A;  2P6H A;  5H9R A;  3ZLI A;  5KC6 A;  3WIN E;  4C91 A;  4ZXK A;  4GKX A;  3QD6 A;  2C9K A;  4LBL A;  4Y4R A;  3USU B;  4RQP A;  5H9S A;  1HDK A;  1MS5 A;  5KXE A;  5KWR A;  4WZF A;  4Q4V 3;  3BAL A;  3JD7 3;  2LAL A;  3FJS A;  3RWN A;  3KT7 A;  1JW6 A;  4Q0V A;  2YHJ A;  4CDU C;  4Q8K A;  2XWJ B;  2X53 S;  3DYP A;  5FZ8 A;  3P1I A;  1TQ5 A;  1CX4 A;  1OQ1 A;  1N47 A;  4M00 A;  2BQP A;  4MET A;  3SIT A;  3WSO A;  4WVZ A;  5LWB A;  1AR6 3;  4QXB A;  4AW7 A;  3H50 A;  3SHR A;  3ALQ A;  5A1L A;  1QDC A;  3KV5 A;  5CKN A;  4DIQ A;  4P9J A;  3SH4 A;  2B39 A;  3FUO A;  1HB1 A;  1HV1 A;  2ARX A;  1MS3 A;  2VNV A;  4Q4X 1;  4QHO A;  1ZRR A;  2QUO A;  3AFG A;  4FFI A;  4N90 A;  3KS7 A;  3RS6 A;  2OA2 A;  4J1W A;  3ZR5 A;  5HCB A;  1OA3 A;  1OUR A;  2D43 A;  1OF3 A;  2Y0O A;  4Z92 B;  2QQJ A;  3N7K A;  1JOD A;  1BZW A;  1LOC A;  2IWG B;  4FTS A;  2ZAA A;  1DGL A;  1ZBA 1;  2WIN B;  4DNY A;  3EJK A;  4Z2A A;  1PK6 B;  4FPF A;  2BER A;  5CFC A;  3TEX A;  2JG9 B;  1AR8 2;  2RS1 2;  4CCL A;  4UF0 A;  3Q8F A;  1V6I A;  1S0F A;  2WUH A;  4JHT A;  2ENR A;  5FP7 A;  4FFF A;  3WW4 A;  4D94 A;  2PAK A;  1DQ6 A;  3PIJ A;  4BQ3 A;  4FAG A;  1JU4 A;  5B4N A;  4O65 A;  2Z4F A;  1IS5 A;  2R07 1;  1OVP A;  2Q1M A;  4LNV A;  4EV0 A;  5DG2 A;  3A0N A;  1W8Z A;  2PLV 1;  4XET A;  4JGY C;  4QPI C;  2R04 2;  1VBC 1;  4JDO A;  4XDO A;  3WF1 A;  3HN1 A;  2VD7 A;  4P02 B;  4LHN A;  2UY9 A;  3N9O A;  1O4Y A;  1RUG 2;  4P5H A;  2YV8 A;  5EYY A;  5CIS A;  1IPK A;  2BJS A;  5D8A A;  1XE0 A;  2H0V A;  5FPB A;  1Y9G A;  3ACI A;  3WP5 A;  5T3N A;  1R1A 2;  4LHL A;  5FZA A;  2VTF A;  2TEP A;  2RJK A;  1LOF A;  2DUP A;  5F3G A;  3OPW A;  3M3Q A;  1NT0 A;  3B00 A;  4KGG A;  3ZN6 A;  1BYH A;  2C26 A;  1VPH A;  3ZXL A;  2HH9 A;  1QF3 A;  4K1Z A;  4N7U A;  5F3C A;  3I2O A;  1JYI A;  2ZX1 A;  4Q4Y 3;  3ELN A;  4NHX A;  4CP9 A;  1KDM A;  2EIG A;  2ZS6 B;  4MGI E;  3GZU C;  4MXW B;  2WR9 A;  4NRP A;  3C7E A;  4L97 A;  3PHM A;  4JDM A;  2P4E A;  5FY8 A;  4ASL A;  3OBR A;  4COY A;  5CBL A;  5JPM B;  2W94 A;  5F1R A;  4BM8 A;  2PHF A;  3ACH A;  3CJI C;  3DYO A;  3KV4 A;  1YIF A;  2QDN A;  5IJR A;  1LRH A;  1YFY A;  2PN5 A;  4QQH A;  1BMV 1;  2XB6 C;  1H30 A;  2SLI A;  3GJB A;  4NIA A;  3WW3 A;  3GHM A;  1UMI A;  2XKO A;  1Y43 B;  4XUR A;  1EPZ A;  2ARA A;  3ES4 A;  3A4U A;  3LA2 A;  1G9C A;  2BBV A;  1W3X A;  1H2L A;  4EZ4 A;  1I3H A;  1TME 3;  4CRQ A;  4QPG B;  4Q4X 3;  4IEW A;  3ACL A;  5ISL A;  3T09 A;  1XU2 A;  3OY8 B;  4X6Q B;  5DPN A;  4GB3 2;  4GMP 3;  1NG0 A;  4IL7 A;  4KU8 A;  5F3I A;  2DVF A;  5ABJ B;  3DUI A;  4IXL A;  2CGO A;  4XFA A;  5A7S A;  4P08 A;  1COV 3;  3LF7 A;  4LA3 A;  5F32 A;  3I4I A;  1H0B A;  1MR5 A;  1K42 A;  5JZG C;  4LLF A;  4WM7 A;  3I3M A;  1GMM A;  5IAX A;  3T0A A;  4QKN A;  3BOD A;  1HXS 3;  2K0G A;  5C9A B;  1D0G A;  1PGW 2;  2RS1 3;  2ORZ A;  1I5Z A;  5A7W A;  5CAD A;  4CEY B;  3EXU A;  3WQB A;  4ISR A;  4JX0 A;  3S5Q A;  3WNP A;  2VY0 A;  1W8H A;  2DYC A;  4DUV A;  1GOG A;  4R9A A;  2V09 A;  2ADD A;  2WZ8 A;  5JXJ A;  2W68 A;  1EY2 A;  1KEX A;  4LO6 B;  2LS6 A;  2BOJ A;  3P5B A;  2WAA A;  3QH7 A;  3VKF C;  3KF5 A;  3IB3 A;  1LCL A;  2CYF A;  3O12 A;  3O1T A;  2QQP A;  2X10 A;  2ZGR A;  5LA2 A;  1V6K A;  2QQU A;  3WXP A;  3PVB B;  3OYW B;  5JI7 A;  3FWE A;  1G9F A;  2YGM A;  4ZZ5 A;  2EA7 A;  4I2O A;  3SH5 A;  1CAW B;  4Y5S A;  5BNO C;  2GMP A;  1L7Q A;  2ZHM A;  2GN3 A;  3KF3 A;  1DLC A;  1NE6 A;  1VBD 1;  1RUE 3;  2OPW A;  3JXS A;  5CFC B;  3UGG A;  3LSD A;  1K5M C;  3MDP A;  3MF6 A;  2OUJ A;  4LK7 A;  5CKM A;  4CCC A;  5A7W B;  5K0U C;  1LHN A;  1Z78 A;  3FMG A;  2WFF 2;  4YW7 A;  3H7Y A;  1DQ5 A;  4Z82 A;  1OFS A;  4XFH A;  5IVJ A;  3RG0 A;  1W2O A;  3OGS A;  3NST A;  2J1E A;  1HRV 2;  1IKQ A;  1D4M 3;  3MIC A;  4RQP C;  1UWW A;  4Q5O A;  1I9R A;  3WF2 A;  5FRA A;  4MGT A;  4IE4 A;  2AAC A;  2XUE A;  5FYB A;  1C8M 3;  1B35 A;  2JG8 C;  4LBK A;  4PLM A;  2YBK A;  3B9I A;  2GU9 A;  2D3R A;  3I3D A;  5GLZ A;  2HLE A;  3BIW E;  1LOA A;  1RUE 2;  3HBZ A;  2D6L X;  1WBF A;  3I2F A;  5FXW A;  1RUO A;  3RYR A;  2PYT A;  4JKL A;  1QJU 2;  5JXH A;  4CDU B;  1LGN A;  3ORJ A;  4GH4 B;  4HMZ A;  2WZE A;  4XAB A;  4I30 A;  2E31 A;  1RMU 3;  2VO5 A;  3TRS B;  3NNM A;  2IXL A;  1AR6 1;  5FMO L;  2GH8 A;  1UOJ A;  2ZZJ A;  4JGZ A;  5FPZ A;  4QDQ A;  1CAU B;  3VBF C;  4A6O A;  1MVQ A;  4B4R A;  3MV1 1;  2AYH A;  2HWB 3;  3AKS A;  5CFD A;  2ZGT A;  2BZD A;  2WNU C;  3VUO A;  3G6J B;  3BUC A;  4AVC A;  1RJ8 A;  5BUV A;  4M3C F;  4CDW B;  2BGP A;  4F3J A;  1LOD A;  3E5X A;  3H1Y A;  4QWN A;  3RPQ A;  3OTF A;  4QX3 A;  4FOY A;  1FAT A;  2J1U A;  4MXW A;  4U36 A;  1QIQ A;  1LOG A;  3RMX A;  2HWF 1;  2JD9 A;  2YPD A;  3UES A;  1UYP A;  5HCA A;  3T2O A;  2VCM A;  1PGL 2;  3ZIW A;  4AEM A;  5FP9 A;  4XQW A;  1RUI 2;  1UU5 A;  1HQN A;  4IV3 A;  2P34 A;  3TYJ A;  4WVV A;  3AMM A;  1DQ1 A;  2OUH A;  2PXJ A;  3IDA A;  5K7P A;  3POE A;  1GOF A;  1Y9Q A;  2XVG A;  3D82 A;  4PIZ A;  5FLH A;  3DEM A;  1BKZ A;  3J8F 1;  3WDX A;  5FUP A;  2XQX A;  1FOD 1;  3DPR B;  4H55 A;  4R9D A;  4FTB A;  2GND A;  3KLS A;  5DAX A;  3H0O A;  5I8T A;  5IK5 A;  4Z8B A;  4RHV 3;  2EVX A;  1UYX A;  5BNP B;  3VBF B;  2CAV A;  4LHK A;  4PHZ A;  3WHU A;  3WP6 A;  5JSR A;  1HXS 1;  1J3P A;  2ZGN A;  3N9P A;  3UKT A;  4OFG A;  1F9K A;  4OUM A;  1W9W A;  4N8M A;  3UGF A;  2IFW A;  4HVR A;  3USU A;  1K5M A;  1BK0 A;  1PO1 1;  1AX2 A;  3ZMN A;  4B1L A;  4GH4 C;  3SKV A;  1OLM A;  4IEX A;  4LT5 A;  1R64 A;  1H4G A;  2EF6 A;  3LZZ A;  2EXI A;  3R0R A;  2D6N A;  2OVU A;  3KWV A;  4CDQ C;  2WZR 3;  1UMZ A;  2CV6 A;  2P17 A;  2QQV A;  3NL1 A;  4LUK A;  2VME A;  5AFB A;  2RG4 A;  1FV2 A;  1SG3 A;  2B5H A;  5DZE A;  3V56 A;  3AC0 A;  5L7O B;  5C5T A;  1JYN A;  3OJB A;  4RQP B;  3FL7 A;  4L11 A;  2ES3 A;  3QH6 A;  4YFW A;  4AED C;  1JZ2 A;  4N53 A;  1S0D A;  2XJR A;  4G4F A;  1I1E A;  1O3S A;  4YM0 A;  2PQQ A;  2BGO A;  3B5L B;  4P9X A;  3WCR A;  5LB6 A;  3DKW A;  5HXV A;  2ZGK A;  1EPW A;  2GZW A;  3D0J A;  4M01 A;  2NM1 A;  3III A;  1GQH A;  2CTV A;  1D7P M;  3BN6 A;  3OPZ A;  4MHR A;  5K0U B;  3GNE A;  1F4H A;  3ME2 A;  1KDK A;  4YW4 A;  5CFC C;  4MX3 A;  4TN7 A;  3PVE A;  3ZYF A;  3ZFG B;  1UZY A;  2A3X A;  4AK3 A;  4B1M A;  3WDY A;  3VBH B;  2XDV A;  3O14 A;  4AGR A;  3LSE A;  2XJP A;  1PMJ X;  3ZFF B;  4HKL A;  5FYH A;  3DN7 A;  4P9L A;  4QQP A;  2PHT A;  2QE3 A;  4M0H A;  3VB9 A;  1IS3 A;  4UFH A;  5G04 L;  5FZ3 A;  4D7S A;  4WV8 A;  2ORX A;  4H7L A;  4C1X A;  4FI9 A;  5DDJ 1;  1C3H A;  2JX9 A;  5F5A A;  4BWO A;  2VZT A;  3V64 A;  1XNC A;  3MIE A;  5GZD A;  5G05 L;  3TEY A;  2WSU A;  4OQ8 A;  3SH3 A;  2PMW B;  1POV 3;  3NNJ A;  4XCB A;  1JTZ X;  2YPJ A;  3VV1 A;  4QU1 A;  3B3Q E;  2QFE A;  4WM7 B;  4CCD A;  1MPX A;  3NQH A;  5C8C C;  5JZG B;  1RMU 1;  2EAA A;  1NCR A;  4X8P A;  3VDA A;  2RS5 2;  2WNV B;  4JRA A;  4A45 A;  5A7N A;  3SCF A;  3U0Z A;  2WA3 A;  3RMY A;  2Y26 A;  4H3W A;  3WNN A;  3M2M A;  2QTW B;  1LR5 A;  4IV1 A;  1GNH A;  2JWP A;  2XHN A;  1TEI A;  4IW3 A;  4QM8 A;  4W6X A;  4AQ6 A;  3O1M A;  4BOW A;  4P5Y A;  4COW A;  1YLL A;  4LKS A;  3T2Q A;  2DFB A;  1X8E A;  4FCA A;  3VLB B;  1HXS 2;  5DUW A;  2DDU A;  3AP9 A;  1YCI A;  4RGK A;  1QJX 1;  3W21 A;  1KIT A;  1L7L A;  2IC1 A;  1OXC A;  4LOR A;  5FK7 A;  5BYN A;  3LDR A;  2G9F A;  1W2U A;  4AFB A;  4O9G A;  2A6Z A;  1HRI 3;  1JOJ A;  3VDD A;  1LU2 A;  2X5I C;  5AVA A;  3MF9 A;  4HVQ A;  5DUU A;  3U14 A;  5I93 A;  4D6S A;  5KC5 A;  3PUH A;  4QX5 A;  1R08 1;  3MPP G;  3NV1 A;  4BK5 A;  4XZP A;  1OH4 A;  4DMI A;  2EID A;  3RJ2 X;  2JIJ A;  1ZRI A;  1XNK A;  1RUI 1;  4NJ4 A;  2A5Z A;  3N9M A;  4LO5 B;  3H8U A;  1D4V B;  1W8F A;  2ZX0 A;  5A3M A;  1RUH 1;  3AZZ A;  4IQP A;  1JH5 A;  1UY2 A;  4AI2 A;  5JLV A;  3AZW A;  1YNA A;  3AKT A;  2YBS A;  2VQ0 A;  3FUQ A;  1I5P A;  3ZSK A;  3T3Y A;  2ZEW A;  4N53 C;  3ZSJ A;  5FPX A;  1T6G C;  3QLQ A;  4K8F A;  4HK8 A;  3WEZ A;  1C28 A;  2WWS A;  1YC6 1;  3T30 A;  3I3E A;  3VD3 A;  3V0A B;  1BVV A;  3ZFE A;  5J96 B;  3OBZ A;  2P5B A;  3E5U A;  2G9G A;  3H1M A;  4MGQ A;  1AL2 3;  3ZXK A;  4DRR A;  4AEK A;  4YYO A;  1L3J A;  4CEW A;  4RS5 B;  3TN9 3;  2VVE A;  1BEV 2;  3ECQ A;  1SLT A;  4DRV A;  2A73 B;  1QH6 A;  2YB7 A;  4YFZ A;  1BJQ A;  4YZ3 A;  4IER A;  4NHM A;  4FSJ A;  1Q8O A;  2VOT A;  4CEY A;  3WOG A;  2PHD A;  3AYA A;  4WVM B;  2Z69 A;  3ZVX A;  1UL9 A;  4NAO A;  3BB6 A;  4BZ4 A;  5JCT A;  1VB2 A;  4COU A;  4ZU5 A;  5C71 A;  4EWA A;  1APN A;  1R1A 3;  3FFQ A;  3M70 A;  5JR7 B;  3B7M A;  1MS8 A;  1EAH 3;  4BLJ A;  4CP0 A;  2VW2 A;  4JGY B;  5LEJ A;  1UKR A;  5JSO A;  2F4L A;  4EN9 B;  1UO9 A;  4GMP 1;  2X05 A;  2WFF 1;  2ZKL A;  1OT5 A;  3MIG A;  3C7F A;  5A3P A;  1TNR A;  2HWE 3;  1D4M 1;  2Q8C A;  2VTX J;  2R1B A;  5JUV A;  1ENQ A;  1GWL A;  1S2B A;  3POG A;  3WNL A;  3EB7 A;  5LY2 A;  2CWM A;  2JEC A;  3O1V A;  1JOB A;  4LLO A;  4MVT A;  3FHQ A;  1VBD 2;  3LEI A;  5J37 A;  5T5J A;  4PI2 A;  1ZZ6 A;  2JG9 C;  4E4S A;  3H8O A;  1PK6 C;  4K40 A;  5C7G A;  3V0B A;  1UX6 A;  5FZK A;  4JKM A;  5FXZ A;  3K46 A;  1W6M B;  2WL1 A;  5IUQ A;  2PHL A;  3MW2 A;  4G9S B;  1LU1 A;  1EAH 2;  1YI9 A;  4Q27 A;  3UL2 A;  4ORF A;  2ET7 A;  3HD8 B;  3OUJ A;  5T50 A;  1RXG A;  4LTA A;  4ARX A;  2ZGO A;  1WMD A;  4EWE A;  3K75 B;  5ACA 1;  3KCY A;  3HNB M;  3FBY A;  3T4V A;  3UT0 A;  1NLS A;  1UMH A;  1FPN 1;  3BPS A;  1W6O B;  2DCY A;  2EXK A;  4NVP A;  2W92 A;  3JB4 C;  3TOJ A;  1SPP B;  2HWC 3;  5FZD A;  1J83 A;  2MEV 2;  4XF0 A;  2YYO A;  5FBZ A;  4DIN B;  1ONA A;  1G9B A;  3KD4 A;  5LAS A;  1ACC A;  5E16 A;  1H1A A;  3AXD A;  1O4Z A;  1ZZB A;  5C8W A;  2HWD 3;  2OXB A;  1JMU B;  5LA0 A;  3ZXD A;  2ZKN A;  1R1Z A;  2DTW A;  2BYV E;  3K48 A;  5GLW A;  3M8L A;  1UOB A;  1QNW A;  3ILR A;  2JB8 A;  3LB9 A;  1CJP A;  1X9P A;  3POB A;  3MUZ 1;  1GZC A;  2JE8 A;  1E5S A;  3AMH A;  1GR3 A;  3AVR A;  3PUQ A;  4XYX A;  3IIA A;  4LOS A;  5LRR A;  1R09 3;  4IEQ A;  1HJG A;  4QX8 A;  4FP2 A;  5CG9 A;  1UF2 C;  1R08 3;  2W3J A;  1GWK A;  3GF6 A;  2GN7 A;  4AFA A;  5I0T A;  1IOA A;  3POF A;  4ZXE A;  2B45 X;  3VBO A;  3I7D A;  2PHX A;  2YGL A;  2F6B A;  4HKW A;  2XKP A;  3RYK A;  4QXK A;  5F6L B;  2JDZ A;  2VMI A;  3OF1 A;  1VBE 2;  4BU2 A;  1O91 A;  1H9P A;  3RZH A;  5L7O C;  1GKB A;  3OUI A;  2LUW A;  5A1F A;  3IZO A;  1RUI 3;  2YRO A;  2VUD A;  1BMV 2;  3IDB B;  2VH9 A;  1CES A;  2NMO A;  4TLF A;  5C4W B;  4FOV A;  3AJY A;  4CP2 A;  4FXG B;  5FY0 A;  5IVY A;  4AI0 A;  4YPJ A;  1VRH 3;  2IZW A;  1OH3 A;  4DXT A;  4ES8 A;  3N7L A;  2GP5 A;  4A3Z A;  1GBG A;  5CVR A;  3H3U A;  2DF7 A;  3A7Q A;  3OGJ A;  4Q0P A;  1TVG A;  4LIU A;  3U75 A;  1UOF A;  3ZYR A;  3HQX A;  5BNP C;  2VAU A;  3I2I A;  1CJD A;  4YWA A;  3ZPY A;  4C1W A;  1QJY 3;  1YI7 A;  5BNN A;  1KQR A;  5IHR A;  1SFY A;  4AED A;  1PO2 1;  3DPR C;  1F8V A;  1OF4 A;  2ZHN A;  1R1A 1;  3KV6 A;  3I3B A;  3OUH A;  4EJR A;  1J3R A;  1RHI 3;  2C4X A;  3JBG 2;  4JGZ B;  3MGU A;  1HB2 A;  1ZZ9 A;  5EQU A;  5GKA C;  3WDV A;  4DS0 A;  5A70 A;  3VKN A;  1JYX A;  4K21 A;  1AUY A;  1UOG A;  3TEZ A;  4JC1 A;  1IGO A;  1QWR A;  2A70 A;  1ST8 A;  2XBO 2;  4P9Y A;  4MG2 A;  3VHO A;  2G19 A;  3C7G A;  1ZRD A;  2VNG A;  1J3Q A;  2JD4 A;  2MPF A;  4CDX A;  1V6O A;  2VMG A;  1B35 B;  3CF6 E;  1YXW A;  2CNA A;  5DAV A;  2JKX A;  2Q4S A;  2X09 A;  5F8P A;  2A6X A;  2HWB 1;  1VAK A;  2Q1Z B;  4HN1 A;  4YG6 A;  2A6W A;  1H6X A;  3NMB A;  4TYS A;  5CA6 A;  4B8E A;  1UKG A;  5FKC A;  3K77 A;  2VUA A;  2B46 X;  2VQT A;  2ZJC A;  1ZX5 A;  2RS1 1;  4HK9 A;  1AR8 1;  4AHZ A;  2ZMK A;  4MO3 M;  2WLP A;  1ZBA 2;  4BXS V;  2HYK A;  2VZQ A;  4Q4W 3;  3WW2 A;  3TNQ A;  2FCT A;  3C7O A;  1WMX A;  1NXM A;  4GAZ A;  4O7X A;  4CUC A;  1XE8 A;  3HQU A;  2IVJ A;  5EZW A;  3LCP A;  1AJK A;  1VMF A;  3I54 A;  1COV 1;  2ZEX A;  1ZRE A;  3KQR A;  1Y4W A;  1VLN A;  1M4W A;  5FXV A;  2FQP A;  1YUD A;  3UKN A;  2VMC A;  1RUF 1;  1DZQ A;  1K45 A;  3AKR A;  4RSU A;  3ES1 A;  5EJZ B;  2W87 A;  2JDP A;  3CL1 A;  4CUG A;  5GLV A;  1G86 A;  1OOP B;  4QD2 A;  4ZHN A;  1QDO A;  1SLL A;  1W6Q A;  4YG0 A;  2Y6L A;  4A44 A;  4CUB A;  5I8Y A;  5C6C A;  3OGV A;  4D7T A;  1G9D A;  3IDC B;  2X8K A;  3WG3 A;  5CFD B;  5J3U A;  1US3 A;  2OYZ A;  3O1P A;  4XIL A;  1IG3 A;  2W0X A;  1ZBA 3;  4FVV A;  1IHM A;  2B7Y A;  2UY8 A;  2VVD A;  2W1U A;  1JHJ A;  1BQP A;  4OMD A;  3MW4 A;  1NCQ C;  1BEV 3;  5A3T A;  1WCS A;  5JMO A;  1IPJ A;  3HQR A;  4HKO A;  3EO6 A;  1J58 A;  1AR9 2;  3USS A;  4QX0 A;  3ZDS A;  4DO0 A;  1CZT A;  3DL3 A;  4IE6 A;  3VD9 A;  2LRP A;  4FQ4 A;  3JZV A;  2WNV C;  4RR3 A;  4ZS3 A;  4D0Q A;  3HT1 A;  1WD4 A;  3SC7 X;  2J1V A;  5C8C B;  2ZML A;  2K9Z A;  4XUQ A;  4GJY A;  3RZJ A;  3I59 A;  3MHZ A;  2HBT A;  5EHD A;  2RJ2 A;  2YDE A;  5GJ6 A;  5FYT A;  4RHV 2;  4DZG A;  2BWC A;  1F2N A;  4OHV A;  5J98 B;  3RZZ A;  3NKT A;  4GWJ A;  2I45 A;  1DGR N;  3I97 A;  5B4X A;  3JD7 1;  4XDP A;  2HWE 2;  1VBE 3;  2NMN A;  2IXK A;  3ZIX A;  4SBV A;  4UW3 A;  1ENS A;  4NMI A;  3CJI A;  4OVE A;  1SDD B;  2GME A;  1NAE A;  1H9W A;  2EIC A;  2C5D A;  4Y5Z 0;  3A22 A;  3SLI A;  1REE A;  4F7Z A;  3M1H A;  1NCQ B;  2WQ8 A;  1H2K A;  3KMH A;  1VBC 3;  4QPY A;  3NO8 A;  4UFL A;  2WT0 A;  2GAL A;  3MFC A;  1LES A;  4XAA A;  2MEV 1;  2V4V A;  2VZU A;  4CPB D;  1LEM A;  2RR1 2;  1MS4 A;  3MEP A;  1AR7 2;  2Y64 A;  2JDM A;  1XSQ A;  1IG0 A;  3M3C A;  4PQ9 A;  4QDS A;  2JEN A;  5DAQ A;  3ZXJ A;  2R06 3;  4YG3 A;  3BTZ A;  4JHZ A;  3N9N A;  3OD0 A;  4IE7 A;  2DVA A;  5ACA 2;  1MQT B;  3MIF A;  4Y33 A;  3SNM A;  4HVO A;  1FAY A;  1UNB A;  1C57 A;  3ZN6 B;  3VN4 A;  3R4U A;  1W0O A;  2FZ2 A;  1EAH 1;  4GWN A;  1N1S A;  4HON A;  4UWD A;  4BMB A;  4CDQ B;  4XFG A;  3VZM A;  1TG7 A;  3ASI A;  1VAL A;  2TNF A;  1LUL A;  1U5Y A;  4LR4 A;  5DUX A;  5FJH A;  4BQ5 A;  1QKQ A;  4QPI A;  4FFG A;  4TXW A;  1JN2 P;  1CVN A;  1GV9 A;  2DCK A;  3CNA A;  3WF4 A;  4EN8 B;  4W65 A;  3VL9 A;  1LNS A;  1QXR A;  3VD4 A;  2RV9 A;  1OA2 A;  5ANN A;  5IK8 A;  1PZ8 A;  4GZ9 A;  1S0I A;  4I0B A;  2WKK A;  2K46 A;  4XC9 A;  1WZX A;  5F2S A;  4AVA A;  1VAM A;  2C6S A;  2ZCW A;  5FK8 A;  4XJ8 A;  4D6R A;  3HVD A;  4LE4 A;  3AP7 A;  3GXU A;  2NP0 A;  1YJL A;  1VBD 3;  1PGS A;  3POI A;  1RUD 1;  3WG1 A;  3MFA A;  4LOT A;  5FZL A;  4N43 A;  3H8X A;  4HN0 A;  4Y5T A;  5AC9 1;  5DZF A;  3FZ3 A;  5JVV A;  1S2K A;  4ZON A;  1M06 G;  1NCR B;  2YG0 A;  2JG9 A;  2H6C A;  3ABZ A;  4Q4W 2;  1NKG A;  5JPN B;  3HOB A;  5FUI A;  3BIE A;  5HV0 A;  2EAL A;  3VKO A;  2W91 A;  2OQ6 A;  1CAX A;  2WYF A;  2WO1 A;  4DY3 A;  2VOW A;  1ZA4 A;  4RS5 A;  1YFW A;  1U12 A;  1CPN A;  1V00 A;  2RDR A;  4R8H A;  3R4D B;  3POY A;  4V2V A;  4QPI B;  4I0W B;  2IUW A;  1PIV 3;  5F37 A;  1H8T C;  3IMM A;  3URF A;  4DOU A;  1OUS A;  1PO2 3;  4IND A;  1GFF 2;  3CDZ B;  3T2P A;  4NOT A;  4XFC A;  2R07 3;  3ITQ A;  3KM5 A;  2WJS A;  4B7E A;  1D2Q A;  1UPI A;  1UU6 A;  1HRI 2;  2CGN A;  3GBW A;  3TN9 2;  4CDX C;  5FYV A;  2PHW A;  2UUR A;  3RZG A;  2NPI A;  5FYI A;  3UYJ A;  2VPV A;  1AYN 1;  3IPV B;  1UZW A;  1CD3 G;  2B9U A;  1W8W A;  1WBL A;  1XQN A;  3BPZ A;  4UFI A;  2QZ3 A;  2FDF A;  1A78 A;  5LBF A;  3BI3 A;  1IQA A;  3PDQ A;  2Z5W A;  3CU7 A;  4UBG A;  4BQX A;  1HQW A;  4QAW A;  3UGH A;  2P6C A;  1R08 2;  2V5D A;  2XVK A;  4FPL A;  4LBN A;  1VE0 A;  5L9R A;  5A7O A;  2ATF A;  4MZU A;  2ZGP A;  1RIN A;  1TME 1;  4C90 A;  1Y9M A;  5FOB B;  1REF A;  1SDW A;  2LM3 A;  4QB2 A;  1ULF A;  4CTE A;  5FYS A;  4AZZ A;  4E9K A;  3O7O A;  2GMM A;  5EWS A;  2J1A A;  5FO7 B;  5FUN A;  1GP4 A;  2AUY A;  4JCK A;  5CIR A;  5F39 A;  5FWJ A;  1RYY A;  1QJX 2;  1DF0 A;  4ASM B;  1N3P A;  5A3N A;  2V4A A;  5J36 A;  1RVF 2;  3J4U H;  1H2M A;  4FFH A;  2ZXQ A;  1FNZ A;  1UY0 A;  3B94 A;  5LCW L;  5AFE A;  2IXI A;  4CE8 A;  2E6V A;  4QHB A;  3NNG A;  3KGZ A;  4CDX B;  1IPS A;  1V70 A;  1V6M A;  2FMD A;  2DTY A;  4LUM A;  2RS5 3;  4PDW A;  4BQ4 A;  3WUC A;  1LTE A;  1MEC 1;  1WUV A;  4ZKT B;  2FBE A;  4Q0U A;  2ARB A;  3GYD A;  3LEG A;  3PMS A;  1X33 A;  1RUJ 1;  2CY6 A;  2XLG A;  2RS5 1;  1NOV A;  4AI3 A;  3FN9 A;  5JI9 A;  3DPR A;  4BLI A;  1OLM E;  4IE5 A;  4AAP A;  4RYD A;  3MO4 A;  2AEN A;  2WQ4 A;  1LEN A;  1XJA A;  3FFZ A;  2WII B;  5EV7 A;  2QCS B;  3R4S A;  3F2Z A;  2A6V A;  1FMD 2;  4K7J A;  2ZGL A;  1QY4 A;  4YGC A;  1NA1 C;  2R0F A;  2FDH A;  1CPM A;  4XDQ A;  1HV0 A;  4E27 A;  2OZ6 A;  3ZXG A;  4NRO A;  4CEY C;  1HB4 A;  1AXZ A;  2XLF A;  1NCR C;  2JIC A;  4QHZ A;  3WW1 A;  3AKP A;  3E97 A;  3BYW A;  2OS2 A;  4YSF A;  1LGC A;  4W6W A;  2YUE A;  4UFM A;  3VL8 A;  3QOP A;  1GNZ A;  4MH0 E;  1SBF A;  1UW8 A;  3KT1 A;  3M7A A;  5IVV A;  3RZM A;  4AR2 A;  3AL5 A;  2BFU S;  1VBA 3;  2G1M A;  4EWD A;  3HR9 A;  2XJV A;  4XQ4 A;  5C3R A;  5DAP A;  1GUI A;  1PX3 A;  1OBN A;  1Z7S 2;  4LBJ A;  5A3O A;  5L19 A;  4LA2 A;  2KM2 A;  2ZHL A;  3NWK A;  1UIK A;  2FCV A;  5ANQ A;  2ZAB A;  2O8Q A;  4QPG C;  4XJ9 A;  1UZ0 A;  1QOT A;  3CLP A;  1F35 A;  2ZEY A;  4HBN A;  3LD8 A;  4CDU A;  3AMN A;  3M3E A;  4GWM A;  4RFR B;  2VW1 A;  1Q56 A;  2GDF A;  5C33 A;  1W6P A;  1LHO A;  1PIV 1;  3RSJ A;  3UV9 A;  4AOC A;  2C9A A;  3H7J A;  3IPV A;  2P3Y A;  4XJU A;  1BLZ A;  3PVO A;  1QJF A;  1TZO A;  3HNY M;  4Y24 A;  3WUD A;  1GLH A;  5K8S A;  5IFP A;  4LUL A;  1S4C A;  3AKQ A;  5FAX A;  4UAP A;  1SBD A;  2VCB A;  1NY7 2;  4ZS2 A;  3NNF A;  2GH2 A;  4Q4Y 1;  1PO1 2;  1W0N A;  5L36 A;  3EYP A;  1ND3 A;  2XLA A;  1PIV 2;  4LBO A;  1MS9 A;  3WHT A;  2WRA A;  5LY1 A;  1MQT A;  3OD4 A;  5C3P A;  3GZT B;  2Z42 A;  4K20 A;  2WQZ C;  4M3C E;  2RR1 3;  5HCF A;  3VBO C;  2VR4 A;  4DXS A;  2E53 A;  5HCH A;  3VGI A;  1OLQ A;  4N53 B;  5T5L A;  1DIW A;  1FOD 2;  5DN2 A;  3NVC A;  4BDV B;  3KSC A;  2WS9 2;  4N43 B;  2XL9 A;  2NZ9 A;  1VB4 A;  2VQU A;  1WA6 X;  5LBC A;  3I2D A;  3NV3 A;  3FLR A;  1BBT 3;  5L9B A;  3T0D A;  2V72 A;  2HWC 1;  2HWF 2;  1PGL 1;  2P3J A;  2VMF A;  3VBU C;  1FI2 A;  1XC6 A;  4QGM A;  2VGD A;  4XZU G;  4UOJ A;  4CCK A;  5GZF A;  2RDQ A;  2W39 A;  2WC2 A;  3AP5 A;  3AP6 A;  1ASJ 2;  4ET7 A;  4CEW C;  1C5I A;  4Y1U A;  3FLT A;  3UJO A;  3VBR C;  1W9T A;  1DHK B;  4S2G A;  3BCW A;  4BXF A;  4DY5 A;  1QMJ A;  2RVA A;  1ULE A;  5ERL A;  2ZGS A;  4Z2W A;  3Q8C A;  4A41 A;  5A6Z A;  2XML A;  2WS9 3;  3VD7 A;  1WW7 A;  4KG0 A;  4XTM A;  3U4X A;  5I8S A;  1FMD 1;  3SMH A;  4I3P A;  1VRH 1;  1AYM 1;  2A7A A;  1PZ7 A;  2JDH A;  2TBV A;  4NHY A;  4XMI A;  4XHB A;  4YNI A;  3WNX A;  5EXO A;  2XJU A;  1RUE 1;  2E63 A;  5CFD C;  1HN0 A;  5FO9 B;  3POS A;  4KBZ A;  2VM9 A;  4LKE A;  4TZD A;  2GAU A;  2XVL A;  2R06 1;  5IW0 A;  5GZC A;  2OQ7 A;  1OOP C;  5FP8 A;  1S0J A;  3VDD C;  3BVC A;  2FZ1 A;  4YM1 A;  1YFX A;  3CEW A;  5LRS A;  4CCO A;  4QU2 A;  5T5P A;  1ZYB A;  4QPG A;  4YVW A;  1AF9 A;  1GIC A;  1VBB 1;  4A4A A;  5CAZ A;  1ALY A;  3O5S A;  4XQD A;  2I07 B;  5FZ9 A;  1E5R A;  3GZE A;  2CU5 A;  4IGP A;  3GBF A;  4JAA A;  3VBR A;  1QOS A;  3I2K A;  1JZ7 A;  1T2X A;  3LDB A;  3MLL A;  2CDO A;  2Q8D A;  5JDB A;  1OOP A;  2AC1 A;  1CGP A;  1OPO A;  3HJR A;  1W8U A;  3WZ1 A;  4EQV A;  3ZFF C;  4WZC A;  1EV1 3;  2BPA 2;  1BHG A;  1KS4 A;  2RM2 3;  2OII A;  4Y1Y A;  1LKN A;  2WN3 A;  4NO4 A;  3NJZ A;  4ONU A;  1OC1 A;  4YZ5 A;  4PLN A;  3WDT A;  2SBA A;  4HXC A;  5FY9 A;  1BVP 1;  3WQ7 A;  2Q8O A;  4IUG A;  4Q1P A;  1AYN 2;  3IAP A;  1DDL A;  4XF1 A;  1ND3 B;  4ISQ A;  4F83 A;  3NAP B;  4XXP A;  2NN8 A;  4I01 A;  5EPA A;  1K12 A;  1PZ9 A;  1MQT C;  3PME A;  1KS5 A;  3E1F 1;  4HT1 T;  5DG1 A;  2J22 A;  5I0D A;  2WNO A;  4K6B A;  2EIE A;  3PU3 A;  3T0B A;  4E4H A;  3KQ4 B;  2VC9 A;  3D4K A;  1NZI A;  4NE9 A;  3AXE A;  1PNG A;  3CZU A;  2Q1F A;  4N9H A;  4IV1 C;  4NHK A;  5JSP A;  4I0A A;  1PGW 1;  3PL0 A;  2ZTN A;  1S1A A;  1W6P B;  1XPW A;  2Q0A A;  4YAR A;  1GQP A;  1PNF A;  1LOF C;  4OZO A;  1H1I A;  1YQ5 A;  5I91 A;  2PQS A;  5D1I A;  4OI2 A;  2VVF A;  2R6Q A;  4MYE A;  2JB4 A;  1H2N A;  4M4P A;  3ZFF A;  2B42 B;  4ATE A;  3PUA A;  4M4R A;  4E8C A;  3ST7 A;  3RI9 A;  4ERO A;  4YVS C;  5FZO A;  2VQA A;  4Q4W 1;  5BXX A;  1WME A;  4GB3 1;  3WCS A;  4FPE A;  5CKQ A;  1D0H A;  1DLL A;  1E57 A;  3THC A;  3VZK A;  2BOI A;  2J1S A;  2R06 2;  1LGB A;  4N7I A;  4Y1X A;  2VE1 A;  2XJQ A;  1XYP A;  2RMU 3;  4KL1 A;  3QCW A;  1U5I A;  1POV 1;  1PVX A;  1SFN A;  1EUU A;  5FPU A;  1W99 A;  2VTX A;  4YM2 A;  2Y34 A;  3D6E A;  1V0A A;  2VOX A;  2FDI A;  1AYM 2;  4EZH A;  1VRH 2;  4GJZ A;  2W1Q A;  5JOZ A;  3MIB A;  1GZW B;  1UYZ A;  1S0E A;  5F6K A;  1A8M A;  4O9E A;  1RED A;  4XPV A;  2ZOE B;  1BBT 2;  3B69 A;  1SCS A;  1PHM A;  4NIG A;  5DZG A;  3GZA A;  5JIA A;  4D6Q A;  3WP4 A;  4BB3 A;  1GOH A;  5E88 A;  5L73 A;  4XJW A;  2V73 A;  4NID A;  3CQO A;  2HEW F;  1HW5 A;  1CIW A;  4XUO A;  1VJ2 A;  2JEM A;  3S57 A;  3LIG A;  4QKB A;  2GC2 A;  1W90 A;  2PLV 3;  2W08 A;  4AYU A;  5FO8 B;  5BV6 A;  3WDW A;  2R0H A;  2E51 A;  1MEC 3;  4AF9 A;  4NAM A;  4ASK A;  1JZ4 A;  2QQI A;  4PDW B;  1O59 A;  4B7K A;  5JOX A;  1N1T A;  4MAD A;  3WQ1 A;  1OPM A;  2DCJ A;  1G6N A;  1JS9 A;  4DXZ A;  1G7Y A;  1SPP A;  3L2Y A;  2WT1 A;  5T52 A;  3ZPO A;  3NNL A;  5HBA A;  3OG2 A;  3DYM A;  2FDK A;  5FQ0 B;  1RUG 1;  4GH4 A;  1QHD A;  3HWJ A;  1GYK A;  2OPK A;  4Y1V A;  4LK6 A;  3BKZ A;  1JI6 A;  2WNE A;  3ZKY A;  2OW4 A;  3MID A;  2VJX A;  5JR2 A;  1CAV B;  2YZ4 A;  3MV0 1;  2JJ6 A;  1UCX A;  4SLI A;  2R30 A;  3DEC A;  5FDB A;  1JZ5 A;  3JU9 A;  2PLV 2;  4P9W A;  2J7M A;  1OHF A;  1X7N A;  5BPX A;  2R07 2;  3OGG A;  1SHW B;  1W6M A;  3ATG A;  4MLO A;  3K3N A;  1HB3 A;  3LE0 A;  2ZMN A;  1ZA7 A;  1O8S A;  2VZP A;  3M3O A;  4FOW A;  3Q8E A;  4KI5 M;  5APA A;  3BTY A;  1K5M B;  4CYD A;  4IEY A;  3HNM A;  3KB5 A;  5JXG A;  2ERF A;  3FLP A;  4MSV A;  2NLR A;  1MVE A;  5C5U A;  2DCZ A;  4H2A A;  3ZYB A;  4IES A;  3PNA A;  3E5Q A;  3NV2 A;  1HQL A;  1URX A;  5FY1 A;  4AHX A;  4AI8 A;  1E5H A;  1DYP A;  2BTV C;  1AR8 3;  4QXC A;  1AR9 1;  2UWB A;  4M3C A;  3A21 A;  3PVN A;  4Q1R A;  1BCX A;  1W3V A;  4YGD A;  3HIF A;  4AE2 A;  3OPT A;  3J7H A;  2DU0 A;  1CAV A;  4YW2 A;  2F4P A;  4JQR A;  3ZXA C;  3WQ0 A;  3C8X A;  4DQA A;  1RC6 A;  3IN9 A;  4L2N A;  1XU1 A;  3BGA A;  4PIY A;  4IEZ A;  4A2U A;  4OHY A;  4X8N A;  1QH7 A;  1WMF A;  1S55 A;  1LHU A;  2PAM A;  4XUT A;  4ZY9 A;  4V2W A;  5C9A C;  2VG9 A;  2RDN A;  2E7T A;  1DQ4 A;  3ILF A;  5LA9 A;  1RUH 3;  1X9T A;  1JBC A;  4RS5 C;  1GQG A;  2IXH A;  1DU3 D;  4DUW A;  4MGZ E;  4RR3 B;  4K1Y A;  1RUD 3;  1CZV A;  1ULD A;  2KD7 A;  4HLT A;  4UFK A;  4YW3 A;  2DUQ A;  4CXY A;  3N7M A;  5C70 A;  1POQ A;  1OA4 A;  2DUR A;  3H3Z A;  5GLU A;  4NR1 A;  2IXJ A;  3SEP A;  2Q30 A;  1JUI A;  5A32 A;  3BTX A;  2WDB A;  4TLG A;  1O3Q A;  2XGX A;  2J1R A;  1F5F A;  2DWR A;  5FZM A;  2ARE A;  3TWI A;  2B8M A;  5CZK A;  2FD8 A;  5FPL A;  5CEH A;  3ZM8 A;  1IS6 A;  2D6K A;  2XL7 A;  4KWL A;  4A6S A;  4GUL A;  4K9S A;  2QBX A;  1G8W A;  2HWB 2;  5JWP A;  3ON7 A;  3EBR A;  4C0B A;  4E8D A;  4A7Z A;  4FQZ A;  2BVB A;  2XUM A;  4XXA A;  3AL6 A;  2A6Y A;  3ENR A;  3IMN A;  5F5I A;  4QQ2 A;  2D44 A;  1PVC 3;  4AQ2 A;  2VOK A;  1MS0 A;  1NCQ A;  2J42 A;  2XBO 1;  4FO9 A;  5FYC A;  4YZ1 A;  5F7U A;  4ZU4 A;  3ZYJ B;  2K2S A;  1W39 A;  3WT3 A;  1UY3 A;  2GSY A;  2UU8 A;  2Z79 A;  3EMR A;  1ND2 C;  2VBD A;  3JQW A;  3WDU A;  4XEZ A;  5GZE A;  3U07 A;  3MZH A;  4XF3 A;  3BOP A;  5IK4 A;  3JBG 1;  2VNR A;  2WNU A;  5KXD A;  2R16 A;  4LO4 B;  1R09 2;  2KA3 A;  3J9S A;  2ARC A;  2R49 A;  3CIH A;  1W06 A;  4ES9 A;  4AGV A;  3I49 A;  4U2A A;  5FPV A;  5FYZ A;  1PM4 A;  3AYD A;  4LXL A;  1PO2 2;  5FBJ A;  1GZT A;  5A6Y A;  1WCD J;  4XMA A;  1ZM1 A;  1UXZ A;  2ZAC A;  1V9U 3;  2WNV A;  5FZG A;  5KHK A;  1H8V A;  3KV9 A;  4LBM A;  2H6B A;  4QX7 A;  1Q5O A;  3ZDV A;  4XJA A;  2DUO A;  2WWJ A;  2XJT A;  4CP1 A;  5E8A A;  5I0R A;  5FFO C;  4I3G A;  1AR9 3;  1UXX X;  3LA7 A;  5LAT A;  5FR3 A;  4XCA A;  4PBO A;  5L7O A;  3TN9 1;  4PJY A;  3J7L A;  1JXN A;  2P37 A;  5CB7 A;  1ULG A;  1HLC A;  4EN7 B;  4OHX A;  5E1R A;  2VCA A;  3B93 A;  1XE7 A;  2DV9 A;  4BH9 A;  2FMY A;  1SQ4 A;  5IVC A;  1ENX A;  2Y0I A;  2E7Q A;  3KVB A;  1CX1 A;  4COZ A;  2I2S A;  3TB0 A;  1U5X A;  1RUC 3;  2XH6 A;  4NUB A;  4UXA A;  3VD5 A;  4LEJ A;  1CN1 A;  1WW5 A;  3JB8 A;  3ZFG C;  4WBB A;  2ET1 A;  5A7P A;  4BQ2 A;  1TNF A;  1QQP 3;  2VMH A;  4FPK A;  1YRZ A;  1OVS A;  3SXW A;  1WCU A;  1O6U A;  2QQM A;  3GCX A;  4CXW A;  1VBA 1;  1LOE A;  1CAX B;  4HFS A;  5SV5 A;  4BIO A;  5AC9 2;  5C4W C;  1W04 A;  1RUD 2;  5DXD A;  1IQD C;  1RUG 3;  3S5A A;  3LEM A;  1O4T A;  5FJK A;  3ZMO A;  2Q8E A;  1WLW A;  1AYN 3;  3HN3 A;  4KWU A;  4AGG A;  2BUK A;  4YW5 A;  3WNM A;  2WA4 A;  2VU9 A;  5FMB A;  1OKO A;  1W6O A;  4A42 A;  5DMY A;  5A1A A;  1T6B X;  3NKG A;  2WFF 3;  1K3I A;  4N43 C;  4QX1 A;  4QM9 A;  4W8J A;  1GNY A;  1NYW A;  4NWV A;  4BME A;  1UY4 A;  1FPN 2;  1F31 A;  2W46 A;  1BK1 A;  3VBO B;  2JDN A;  5LZ6 A;  2BV4 A;  5IT6 A;  3PU8 A;  1W2N A;  4Y20 A;  3U78 A;  5KR7 A;  4R4Z A;  2JDU A;  2ZX2 A;  1PVC 2;  3ZSL A;  4EE2 A;  3V65 A;  3Q8A A;  1NLR A;  2VNO A;  2YBP A;  4HL0 A;  1GSL A;  3RRD A;  3POJ A;  3ZYG A;  4YW1 A;  2XOM A;  3VHN A;  1DZT A;  4PIX A;  5GZG A;  1W0P A;  2HWD 1;  1RIR A;  1YYN A;  4URT A;  4NIH A;  1AR7 1;  1OD5 A;  4CDQ A;  2RR1 1;  4QGN A;  1XRU A;  1KXG A;  1OI6 A;  1J1T A;  2ZPX A;  3BU7 A;  3PUI A;  5ABJ A;  2ID4 A;  3RJR A;  2DVD A;  3ILN A;  3AFK A;  4QGL A;  5FY5 A;  4HAN A;  1XOY A;  3WP3 A;  1J1L A;  1W2A X;  2RMU 2;  3LPG A;  4Q29 A;  1FPN 3;  5FZI A;  1RVF 3;  5KXC A;  4PF5 A;  5F3E A;  1RUJ 3;  2AEY A;  4Q8L A;  2X5I B;  1C1L A;  2XR4 A;  1D4M 2;  1KFU L;  3WG4 A;  5J1X A;  1QJY 1;  2C1F A;  1U0A A;  4XBL A;  3D3A A;  3WF0 A;  1IZ3 A;  4GB3 3;  3VKL A;  1SBE A;  1ZZ8 A;  2VUJ A;  1EP0 A;  1EYB A;  2RHP A;  4CDW C;  1YQ2 A;  3E6C C;  3RZL A;  3P3N A;  1H8T A;  4AL9 A;  4BPZ A;  2XBO 3;  5EIY B;  2XG3 A;  5D8A C;  1W9S A;  2VZ1 A;  3BTA A;  3NJX A;  4Z07 A;  5IFT A;  5JOY A;  3JD7 2;  5BNO A;  2X29 A;  3VZL A;  1AX1 A;  2Q5T A;  3T1M A;  5JAX A;  2IXC A;  3I2H A;  1WGP A;  2ZAH A;  4HSJ A;  4Q2F A;  4JQT A;  3IDE A;  4IEO A;  4FBF A;  3O0X A;  3MYX A;  3ZR6 A;  1O3R A;  2VZV A;  4RFT 0;  1RUC 2;  2ZBJ A;  2HYX A;  1H6Y A;  1Q3E A;  4FPJ A;  4NWW A;  3R05 A;  3ZOI A;  1YJK A;  2WLQ A;  2XWB B;  4KU7 A;  3X29 B;  3E6B A;  4BQY A;  2QQL A;  1U5Z A;  4GA9 A;  2DVG A;  1PMI A;  3MI8 A;  1FOD 3;  2LW8 A;  1ULC A;  2XQR A;  3F95 A;  2AEZ A;  5IAV A;  2CGP A;  1SCR A;  2WZR 2;  4NRQ A;  2GC1 A;  2BEO A;  4UT5 A;  1PX4 A;  1RUH 2;  3C7H A;  4W50 A;  1N3Q A;  4HPK B;  4KQ7 A;  1LED A;  5CYY A;  5FIX A;  5KHH A;  3VHP A;  1DCS A;  4P9I A;  4C8D A;  1SZB A;  2YU1 A;  1Z7S 3;  1CR7 A;  1SLB A;  4OI1 A;  2FCU A;  4XFI A;  2ZHK A;  4TSV A;  2GNB A;  4Q26 A;  1AJO A;  2UYB A;  1F15 A;  1R09 1;  1W8O A;  1XNB A;  2WO2 A;  3GDB A;  4AVT A;  4CZS A;  1RUF 2;  4CVU A;  5K9Y A;  3WY6 A;  4B4P A;  3UKV A;  3K4Z A;  1COV 2;  2BWA A;  5IVB A;  2R04 3;  2VCC A;  4XAE A;  4AVS A;  5FZE A;  1RHI 2;  3JBG 3;  4HET A;  4IEV A;  4QB1 A;  1SLI A;  4D8M A;  4AG4 A;  3GM8 A;  4BIS A;  1ZRF A;  3K3O A;  1WWY A;  2O0O A;  2WYS A;  3AZX A;  4QX2 A;  5LEK A;  5A6Q A;  3D8C A;  1OFN A;  3Q9O A;  3S7E A;  1ZZC A;  3B9C A;  5BNQ A;  3WD5 A;  2D97 A;  1DZR A;  3CJX A;  4CSW A;  3C2U A;  4FAH A;  3FC0 A;  1VBB 3;  3S7I A;  5B2G B;  2PTM A;  3ZXF A;  1H1M A;  5FLI A;  3ZFE C;  1RMU 2;  1JUH A;  3O1R A;  5J09 A;  5FV3 A;  5T5O A;  4D7Y A;  3CMG A;  3ROU A;  4JDN A;  3U1X A;  1Q8V A;  4MUV A;  1FYU A;  3H1W A;  4XW3 A;  1N1V A;  2BBA A;  4LE3 A;  2ZX3 A;  3JUU A;  4JRL A;  3O0V A;  3THD A;  3ZSM A;  1VMH A;  4OHZ A;  1GZW A;  2ILM A;  2W52 A;  5JOW A;  1XNT A;  3DKQ A;  1CIY A;  3OY8 A;  4MV2 A;  1C4R A;  5IWF A;  5FLJ A;  4BK4 A;  2YC2 A;  4QT6 A;  2C24 A;  1A3K A;  2RS3 3;  2BVV A;  3LEK A;  1JOP A;  3ACF A;  4RL7 A;  2QKD A;  4XF9 A;  4R4X A;  2BNN A;  4CCE A;  4R9C A;  1QJE A;  1X8M A;  3MIH A;  1C8N A;  4L99 A;  4TWT A;  2VZO A;  5FY4 A;  4FOQ A;  1ND3 C;  2YY1 A;  4UYB A;  2A75 A;  3A23 A;  1BXH A;  3K51 A;  3PTY A;  1GP6 A;  5JIU A;  3H8R A;  3CJI B;  4K3U A;  3N7J A;  2O8O A;  3KCX A;  4AHY A;  4LJH A;  3O0W A;  2OKX A;  3EQE A;  4G3Y C;  4OZX A;  3L2H A;  3VBS B;  5FZ7 A;  4GXL A;  1SFP A;  2Y6G A;  2WAB A;  5FMO S;  1KJR A;  5LBE A;  1MZ6 A;  3P6B A;  4LIV A;  2RS3 2;  4ARY A;  3AK0 A;  1VBE 1;  2QJV A;  3UNP A;  3VBS C;  3W58 A;  2UWA A;  3V0B B;  1YFU A;  1PK6 A;  5EJ1 B;  5FY7 A;  3MW3 A;  4GAL A;  3N3H A;  2QDR A;  4LPL A;  4J1X A;  5A3L A;  4J6G A;  1FT9 A;  2XHK A;  1F5J A;  1KD7 A;  5C3S A;  1NA1 A;  5SV8 A;  1C1F A;  4DB5 A;  2R1D A;  1ZRC A;  4ITC A;  4CU8 A;  1X36 A;  2PAE A;  3KT4 A;  1SEF A;  4LBQ A;  2ZA9 A;  2A3Y A;  4XUN A;  2WSV A;  1FXZ A;  4NN0 A;  1ODM A;  1AL2 2;  5F2W A;  1JZ8 A;  1V9U 2;  4J25 A;  1L7R A;  4NPR A;  3LFI A;  2JDK A;  2Y38 A;  1ZVF A;  3ZSE A;  1XB9 A;  2A71 A;  4QMA A;  1ZBE 3;  2ZZQ A;  4UFJ A;  3U11 A;  2W95 A;  4XHX A;  5LA1 A;  1XYN A;  2XXZ A;  4URA A;  4IGQ A;  2OZJ A;  2WO7 A;  2RE9 A;  4Q4V 2;  3ETQ A;  4YGE A;  2HEV F;  5A32 B;  2DBI A;  3J8F 2;  4BIF A;  2G9Z A;  3NV4 A;  4BCU A;  5HPO A;  2VUL A;  2B4K A;  3WVJ A;  1MZ5 A;  3VBS A;  1NLQ A;  3J7N A;  5FQ0 A;  3ZYH A;  4EN6 B;  3OEA A;  3OOX A;  4A7K A;  1C5H A;  3SCG A;  5F5Q A;  1PMH X;  5BNO B;  1KJL A;  4DUX A;  5IVF A;  4IET A;  4UI9 L;  3B01 A;  2Y8K A;  2V5Y A;  3GGL A;  3H9A A;  5FRE A;  3G7D A;  3P3P A;  2KR2 A;  1S0B A;  4LKD A;  1H4H A;  1RUF 3;  3LAG A;  1UD1 A;  1ZBE 2;  2BNM A;  4NHL A;  1STM A;  3ZFE B;  3GCW A;  5K4L A;  5HXM A;  4FPG A;  5CG8 A;  2VW0 A;  4Y26 A;  1K5J A;  2EIB A;  2VZR A;  1QQP 2;  1CAW A;  1AHS A;  4OHW A;  2CDP A;  3GJA A;  1LHW A;  3VBU B;  4WM8 A;  1BBT 1;  2J1T A;  3RNS A;  3AM2 A;  2L9L A;  3AP4 A;  2RJL A;  4XAC A;  5JMC A;  4CCN A;  4UF0 B;  3AVS A;  2PA7 A;  4IDZ A;  5LBB A;  4YVS A;  1W8T A;  3LFM A;  3DXU A;  3W5M A;  2HBU A;  1RL3 A;  4O61 A;  3CBN A;  3CO2 A;  1VP6 A;  3AMQ A;  3PUS A;  4H7M A;  4S2H A;  4HOO A;  5T54 A;  3KHC A;  4Y1Z A;  1Q43 A;  4LQR A;  4AI1 A;  4Y3O A;  1W6Q B;  4E2S A;  5C3Q A;  3BU0 A;  3SIS A;  4A3X A;  1OSG A;  5DQ0 A;  3NAP A;  4JVA A;  4XUP A;  1WKY A;  1S2E A;  2D5H A;  1Y7B A;  1Q8Q A;  2D3P A;  4YGB A;  5GLT A;  3VZO A;  5KHJ A;  1YIP A;  1AR7 3;  4YLZ A;  2XPJ A;  4JKK A;  5DDJ 3;  4QKD A;  2MNG A;  4CUA A;  3WNK A;  1UN1 A;  3N36 A;  1YHF A;  5J48 A;  3RI8 A;  5ABJ C;  4BQ1 A;  3B02 A;  4DPN A;  4NPL A;  4PT6 A;  1IS4 A;  2TUN A;  3FBM A;  1W2T A;  4CCJ A;  1I6X A;  4CXX A;  3TEW A;  4DXR A;  2PHU A;  5A7Q A;  3INA A;  3LKJ A;  4IV3 C;  5KHI A;  2GC0 A;  5BNN B;  3CHX A;  3VBU A;  1W05 A;  1BEV 1;  2IVI B;  1AVB A;  5T55 A;  2UYA A;  2F17 A;  3RZK A;  2Z2S B;  3RDI A;  4TTG A;  4CDW A;  2YC0 A;  4RGA A;  1QJU 3;  3CKH A;  4W4Z A;  5I0U A;  4BQW A;  4YRD A;  2JDY A;  4WVM A;  4AEJ A;  1GAN A;  5IYY A;  3ZN4 A;  1UU4 A;  2Y6K A;  4D69 A;  1QQP 1;  2EXJ A;  3ACG A;  3KVA A;  1CAU A;  4QXH A;  2BRT A;  1S0G A;  4OUS A;  3O1U A;  1ZBE 1;  4OUE A;  4PBP A;  1N1Y A;  3FX3 A;  4QDR A;  4LO8 A;  3LOI A;  1WLD A;  3Q8B A;  2ETE A;  5TSW A;  1UAI A;  4CCM A;  1IKP A;  1OQD A;  2P2K A;  4OLL A;  1WLC A;  4P00 B;  4XF4 A;  4E4D X;  3FE5 A;  4ZU7 A;  1A8D A;  2PHR A;  4LMF A;  1G9A A;  1CZS A;  3DCQ A;  3T08 A;  5CU1 A;  4YVW C;  3MLJ A;  1SLC A;  2DBN A;  5FWE A;  1LAJ A;  2DFC A;  1B35 C;  2JG8 A;  2ZX4 A;  3DF0 A;  4FP3 A;  5FZH A;  1GU3 A;  4XE9 A;  4HZF A;  5FMD A;  4RA0 A;  1HIX A;  1E5I A;  1F4A A;  4CPB A;  2QQK A;  3KZ4 C;  4MHU A;  4Q4V 1;  1WD3 A;  5FZ1 A;  3UET A;  3BOW A;  1YEW A;  4PF1 A;  5A3U A;  3NJV A;  4YZ2 A;  1DYK A;  2FDJ A;  1NX9 A;  2HKX A;  1SAC A;  5BNP A;  3HBK A;  2GNT A;  3OB8 A;  4XTP A;  3M3I A;  5EFU A;  1NA1 B;  4MGS A;  1V9U 1;  2YMZ A;  1VBB 2;  1AL2 1;  3LA3 A;  3PJQ A;  4JGZ C;  4LKF A;  4UW5 A;  4XJZ A;  3MUY 1;  2A3W A;  3UK9 A;  4FTE A;  5A80 A;  3W9A A;  5M0T A;  5FZC A;  3GHN A;  3I8T A;  4MGY E;  4OI4 A;  2I74 A;  3GAL A;  2Y60 A;  3E6D A;  3HEI A;  1QGL A;  1AX0 A;  4QPW A;  4QB6 A;  1HRV 3;  2Y6H A;  5FYU A;  2BFU L;  5H9Q A;  4S2D A;  1MS1 A;  4FPC A;  4Q0S A;  1RGS A;  2UWC A;  2JDA A;  1DBN A;  5AVP A;  2VUC A;  3ETP A;  3I2J A;  3WR0 A;  4HSL A;  1W6N A;  1VIW B;  5FP3 A;  2RS3 1;  3AZV A;  4YVW B;  5F5C A;  3AZY A;  2VZ3 A;  2JKB A;  5C9A A;  3H3L A;  3KGL A;  2W47 A;  4BE3 A;  4CA9 A;  2O1Q A;  2D3S A;  2NYY A;  4GMP 0;  2Y6J A;  1CQ9 A;  2FDG A;  5C3O A;  1UZZ A;  4GIQ A;  3QBQ A;  4KG8 A;  2W5F A;  3AX4 A;  1XSR A;  4EN0 A;  1DYO A;  1ENR A;  3HMY A;  5FCC A;  2XJS A;  4FT8 A;  1ZZ7 A;  2Y33 A;  1FMD 3;  3TAY A;  1WW4 A;  3IAQ A;  1OMI A;  1Q8S A;  3I59 B;  5DDJ 2;  1ODN A;  3OCP A;  3PTR B;  1ASJ 1;  2QQN A;  2G4I A;  1O7F A;  1VMJ A;  2VBP A;  3SCH A;  1HX6 A;  4NRM A;  4AVB A;  3W59 A;  3S0M A;  4JTO A;  2HWC 2;  3AJZ A;  4PQQ A;  4L0P A;  2WN2 A;  4QQL A;  3K4D A;  4W6Y A;  1XNA A;  4Z1V A;  2LRO A;  2MEV 3;  4I02 A;  3VZJ A;  3WNO A;  4AFD A;  5BY5 A;  1NQD A;  1AYM 3;  2P1B A;  4OMC A;  3N9Q A;  1QXP A;  2D6O X;  4PI0 A;  4CU9 A;  2BW8 A;  4IV3 B;  1A34 A;  1JYT A;  3IKW A;  5HI0 A;  2WS9 1;  4JGY A;  5GAL A;  3SEE A;  4AWD A;  1ASJ 3;  4PDW C;  4OCT A;  3DGT A;  2N7G A;  1AXK A;  5DUV A;  2E32 A;  3I2G A;  2YC4 A;  3ZXE A;  3GBG A;  1S0C A;  2WFP A;  4L8Q A;  2AGS A;  4EYU A;  4DEQ A;  2R04 1;  1RTV A;  3APB A;  4KMQ A;  5J7M A;  4F8A A;  4DEV A;  2JXA A;  2WZP P;  2H0B A;  1W03 A;  1H8T B;  2EXH A;  5JXI A;  1RB8 G;  4Q4Y 2;  4L9B A;  1NY7 1;  1OLR A;  5GM0 A;  3WV6 A;  4AAX A;  2ADE A;  3MBW A;  2W9X A;  3ZN5 A;  3VHR A;  4WM7 C;  4Q0Q A;  4UBH A;  5FZ0 A;  5FZO B;  3T1L A;  3RYP A;  3WLU A;  1US2 A;  2WO3 A;  3KCC A;  3H42 B;  5FMC A;  2VMD A;  1RHI 1;  5AC9 3;  4M3C B;  1OD3 A;  2VXJ A;  4MOA A;  1QEX A;  1WA4 A;  5IK7 A;  2QNK A;  2QZ2 A;  4JTN A;  2GNM A;  4CU6 A;  4XOG A;  2Y6F A;  2BU9 A;  3PUR A;  3RFR A;  3TNP B;  1XBF A;  2WBK A;  2YFU A;  3WF3 A;  4Q4X 2;  1ULO A;  4IEP A;  3K4A A;  4R52 A;  1Z7S 1;  1MZE A;  3O1O A;  1SLA A;  4YW6 A;  4RN5 A;  5K0U A;  4L92 A;  1ND2 B;  1UQX A;  2GC3 A;  1Z0H A;  1HJF A;  2BGC A;  3ZO0 B;  4KWK A;  2VZS A;  3LGR A;  3SQO A;  4RGG A;  2D7F A;  5H9P A;  5DAB A;  3OGR A;  2W1S A;  2O14 A;  4CU7 A;  4LO7 A;  2WZR 1;  1GZ9 A;  1LHV A; 
#chains in the Genus database with same CATH homology
 3J7M A;  1YC6 1;  3J7N A;  4OQ9 A;  1CWP A;  1STM A;  1JS9 A;  4NIA A;  3J7L A;  1ZA7 A;  1A34 A;  4OQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...