1CWUA

Brassica napus enoyl acp reductase a138g mutant complexed with nad+ and thienodiazaborine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLGNGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor binding studies on enoyl reductase reveal conformational changes related to substrate recognition.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
molecule keywords ENOYL ACP REDUCTASE
total genus 97
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cwuA00
3NTRA 3WTCA 2IODA 3IKTA 3A9WA 3JQ8A 3HN2A 4P22A 5F5LA 1PU2A 4MIYA 3EMKA 1K0UA 3L77A 1NQTA 4UVHA 3QA9A 2WD8A 4H3VA 2G0TA 1C3VA 4XB2A 5G4LA 4ZVVA 4CLXA 1LXCA 3NTQA 3ZI0A 2QRLA 4FC6A 3VAZA 4DYDA 1HE3A 1Z74A 5DCUA 2BFPA 4RZHA 1Q0LA 4YQZA 4JN6B 2DBZA 1ZNQO 2I66A 3PHHA 3B70A 1YJ8A 1EK6A 3RFVA 3MTGA 3BHJA 2ZTUA 4U0JA 4BV8A 4XB1A 5COBA 5EQFA 3PK0A 2Z95A 4OXNA 3DBRB 4IDFA 4WECA 2VYVD 1PQUA 3IUPA 2Q45A 3PHLA 4WCFA 4U7WA 2H1SA 3FWZA 4XRGA 5CPFA 3U09A 1GADO 1KS9A 1E1KA 1OC2A 3ZHXA 3V5NA 3DHYA 3K2EA 3BMOB 4YT5A 4DPKA 4O1MA 1G0OA 2PA3A 3CMMA 1HEUA 1V8BA 3AY3A 5LCXA 2VYVA 3TZQA 3OJEA 2G5CA 1GYRA 4BV9A 5C37A 4P4LA 1EDOA 1KY4A 4HFMA 2EWMA 4A7PA 2FHSA 2DPGA 3O03A 2GRAA 2JJYA 5DOVA 4IJVA 5DBFA 5TT0A 3D64A 1LC3A 1KC3A 2H5LA 5KJFA 5CDSA 4AJ4A 4ALLA 1PR3A 4PZCA 3W8EA 3IP1A 1HE5A 2BD0A 2WEKA 3GGGA 4AICA 2FR1A 1E1MA 2RAFA 3JSAA 3V1UA 4DBZA 2D4AA 1BWSA 1DRVA 3I4FA 1E7YA 4I5GA 4CR8A 4MINA 3RVDA 5LDHA 1IHYA 1WMAA 4B8ZA 1RYEA 1J5PA 5J23A 1YOVA 2DBQA 3LYLA 3KRTA 3T4EA 2CY0A 3FR7A 1YB5A 3OQ1A 3TZHA 2CUKA 1S7CA 2Q2WA 3I9NA 1K6XA 2VYND 4NIMA 1YH3A 3MWDB 5JLAA 4CLOB 3DL2A 1KVUA 1AHHA 1GZ6A 2PZJA 4WKGA 3WLFA 1V3VA 4RPLA 4B3IA 3IAHA 3R1IA 4PG6A 4XJTA 5A4DA 4N7RA 4FFNA 2EKLA 1FMCA 3OA0A 4RPJA 4E0BA 4J4TA 4BO3A 5JYEA 3FRJA 4DGSA 5AYVA 3ON5A 3GN1A 3RUHA 3H3FA 4FFOA 3QSGA 3QRWA 3GRKA 1QORA 3BMQB 1L1FA 2O3JA 2RH4A 3MCVA 3HSKA 3QVXA 2QQ5A 5T5QA 5TRTA 4D46A 3S55A 3VZQA 5BSFA 2BI7A 1ZBQA 2UAGA 4PG8A 4QFDA 3PWSA 3TZKA 1IULA 1NXQA 1NQAO 5IZCC 4EGFA 1NPYA 1LLQA 4YXFA 8ADHA 3OICA 2LDXA 3OEWA 2DQ4A 3PWZA 2PKRA 3WWZA 1X0XA 3PQEA 3VH3A 5EMHA 3WGOA 4R51A 1LDGA 4PG5A 5HTOA 3DMTA 1YWGO 5IXSA 4IS3A 1WZIA 4U0KA 4BIIA 4UUPA 3KYCA 4Z9FA 4BVAA 4AJPA 3ICPA 4AJIA 1UAYA 1ZEJA 1Q2XA 4JP3A 2YDYA 4XQEA 3TL2A 1X14A 2CD9A 3OIDA 1ADFA 4MP3A 3W6UA 2NTJA 4EJ6A 4II3A 4R4JA 1PS9A 1DIGA 3QWBA 2H6EA 4IUYA 2C7VA 3ULKA 3UICA 4KWHA 5T67A 4RJTA 1E6UA 6LDHA 3DBLB 1UXGA 4IIUA 1U5AA 2FR8A 1E7RA 2ZCUA 4AJ1A 4L4RA 1DOHA 4A10A 4CM9A 4J9VA 5K0ZA 2HSDA 5B4TA 3CH6A 1VLLA 1E3WA 1H94A 1I01A 4WLOA 4DLBA 3FF4A 2ET6A 3PRJA 2NU7A 3C7AA 3GOHA 2FPIA 5A06A 5A3VA 3VH4A 2W2KA 3WIEA 2TMDA 1R0KA 5DF1A 1AGNA 1ZK1A 1WDKA 1NX6A 3CTMA 3G79A 4GGPA 2YV3A 4O6VA 3RUCA 4CUZA 5CEJA 1GYQA 2HAEA 3WGIA 1OC4A 3DB2A 4I1IA 3OJ0A 4RVDA 3KUXA 3KXDA 4BGVA 2HO5A 4M55A 4R1UA 1LUAA 3UOGA 1FK8A 5ENDA 2NADA 4R01A 3LZ6A 4IGFA 1GCOA 1MXHA 1CDOA 1ZVMA 3VOSA 1OI7A 4DRYA 1U28A 3QE3A 3UVEA 1M6HA 4HUJA 3I9KA 5DOZA 1ISJA 2W4QA 5B4UA 5KVCA 1VJ0A 3U9LA 4CODB 1TVEA 2ILTA 1MA0A 1R12A 5H83A 3WGQA 4ZQFA 1HSZA 1W0CA 4KDFA 1MP0A 3ABIA 3ETDA 3BMOA 3VPHA 1NWCA 4CQLA 2D59A 1LDYA 3ANMA 5TC4A 3PJEA 3OMLA 4D42A 6ADHA 1C0KA 2XPCA 1SZJG 4KQXA 1ZJYA 1VPDA 2OXIA 1BGVA 2Y0CA 2PY6A 3GFGA 1NVMB 1XYGA 4ITUA 4DVJA 4UVIA 3Q2KA 4BNFA 5JW6A 1JWBB 4XA8A 2UVDA 4GVLA 4BB5A 1MX3A 2IRWA 3ZNQA 1BVRA 2PK3A 3NRCA 1XU7A 2PLAA 1T1RA 1GUFA 2GNAA 3COSA 5DP2A 2VZ8A 2JD2A 5JDCC 5K9ZA 1NQ5A 1PL8A 1E7WA 1U1IA 2D1YA 4EI2A 3U4IA 2B4RO 1R6DA 5HRUA 4FS3A 4OKIA 2D0IA 3JQAA 1W8DA 4CQLB 4R1NA 2CF5A 4XJSA 4BS9A 1O0SA 4YDRA 1NPTO 2OP1A 4NI5A 3FPLA 2V6MA 4IJWA 3UAGA 4CLRB 1UXHA 2VT3A 2JHFA 1T25A 1C0PA 3FTNA 2O50A 3WBBA 5FFFA 4CMBA 3DBLA 3I3OA 5C5IA 1SC6A 1GUYA 1YGYA 2OOSA 3JD3A 4LSWA 4QSMA 3W6ZA 3AJRA 3I9MA 3FWNA 3O8QB 2GPTA 3PDJA 4ILKA 5F1PA 2W2LA 4W9NA 4BO7A 3QVSA 2PD3A 1EBFA 1JAYA 2GLXA 2EHDA 2OBYA 5EIOA 1XWFA 2EXXA 3ZW9A 1GQQA 3DZGA 2IYPA 2HK7A 4PLWA 3HDYA 3V2UA 4J7CA 5I9LA 1LX6A 2GYYA 2X5KO 1I36A 1F17A 3INGA 4JCOA 1VM6A 1JW9B 4Z6KA 2DUWA 4GBJA 4OOFA 3ZV6A 3UCFA 1ZK4A 2FP4A 1BDMA 1ONPA 3RC2A 4WGGA 4UEKA 3EW7A 2ZYGA 3V8BA 2DKNA 2X58A 2R6JA 3NAQA 2VRBA 2DM6A 1NNUA 4BO1A 1W73A 2W90A 2LDBA 1PJ4A 4RDHA 1GY8A 3JQ9A 4H7PA 4JJFA 5ICMA 2DPHA 3GZ4A 4MKRA 5L4LA 2P4HX 4IDCA 4ZA2A 3JQ7A 1LEHA 2AEFA 5DZSA 4N5LA 1P1KA 4WOJA 1C1XB 3INRA 4LMRA 4Y98A 3WB9A 5L9AA 3KVOA 1QLJA 1B26A 4ONEA 1EBUA 3D3WB 3KO8A 1EQUA 3GNTA 2B4TO 2WYUA 4L76A 3VTZA 3CEAA 2V6FA 1C14A 4AJHA 2AQIA 4W7HA 3DAFA 5LDGA 2NTVA 2ZKLA 2O3UA 5KOIA 3LC1O 1QV6A 2A9FA 3C1AA 3AUAA 4LCJA 1UXKA 1Y7TA 2FZWA 3JYNA 3ONFA 5EL0A 1D1TA 2V7PA 4NPCA 5K6AA 4NG5A 1PJ3A 4BO5A 1ADCA 3TDKA 4U6QA 5EN4A 2WE7A 3SVTA 3ZNNA 2EKQA 3PI7A 4ALKA 2VT2A 4GSLA 3SLGA 1I8TA 1LBEA 2B35A 4UVEA 3FNEA 4WASA 3UHAA 2VTEA 4WEQA 3OIFA 3IKVA 3NEPX 4JNKA 2PGDA 2J3KA 3UCXA 2QZZA 2V6GA 1ADGA 2EG9A 4PIVA 4F6CA 1GL3A 1YL7A 4HNGA 3MJEA 3VVCA 3DHEA 4OQYA 1U3UA 1P33A 3D4NA 1VKNA 2RHCA 4QO8A 5HS4A 3HJAA 1ZH8A 2EV9A 2P5UA 4MVJM 4OL9A 3E5MA 1RWBA 4RPHA 3TZCA 1Y8QB 1UAGA 3DBVO 3RC9A 4DWVA 5I8WA 5JAMA 4YJFB 2H63A 3I83A 3PPIA 3IJPA 3HUDA 4QFCA 1VC2A 1E3EA 3BTUA 2PZMA 4R1SA 2DU8A 2I3GA 1F0YA 5CG2A 1B14A 3DBRA 1GPJA 4J1TA 1BW9B 1LSUA 1BHSA 4FFMA 3GNQA 1DIAA 2Y68A 3IS3A 2ZQZA 1H6AA 1P0CA 4WLUA 3RUAA 3VZPA 4E5NA 1IY8A 4YACA 4C7JA 1PJ2A 3K92A 2O23A 5JDIC 2ZB3A 2ZYDA 3ZWMA 4CM8B 4LMPA 3AFMA 4GWGA 1VI2A 4TRJA 1PJSA 1RPNA 2P68A 1P1JA 4ALNA 5FI3A 4CMJA 3GHHA 1CRWG 4DQVA 1PWXA 2RH8A 3EDMA 1K6IA 1P77A 1U7HA 1QRRA 4BMSA 2A4KA 4E6PA 3RBZA 1IL0A 4YB8A 4CQMD 4E13A 2X1HA 4PLZA 1LQUA 1RYDA 3LLVA 5AXCA 1HZZA 2AHRA 5JY6A 2YZ7A 4BNJA 3DAPA 3TPCA 4NJOA 4NQZA 1V3TA 1KEPA 3GG9A 3L4BC 2VHVA 4XKJA 3E9NA 5A5EA 1WXDA 3T4XA 1GYPA 1YBVA 1ZFNA 1VJTA 1DEHA 4UVGA 4MIEA 4G5HA 5KTKA 1A9YA 1EUDA 2VHYA 4J7XA 3DO5A 4R69A 1GUZA 2GUGA 3DOJA 2OHXA 3CSDA 2EW2A 4RF2A 3H65A 1IZ0A 3JQFA 3VVBA 1E6EA 3T7EA 5IF3A 5AXAA 1PS0A 1YQDA 3RWBA 3VPFA 1KIFA 3ADPA 2W2KB 3LT0A 3PGJA 2WDZA 4RPKA 3RC1A 5BSEA 4XQGA 3E18A 3EGOA 4WEOA 2CDCA 1VL0A 3F3SA 3U5TA 1S6YA 3ZHBA 1MG5A 2C59A 1LDEA 3NDJA 5I8ZA 3L4SO 3WS7A 4TZTA 3I9OA 4D79A 1DHTA 2WMDA 4EDFA 3JD2A 5KKCA 3SC4A 3NUGA 4TQGA 1AN9A 3VC7A 1KC1A 4PRLA 3HB5X 3NT2A 1PTJA 2R2GA 1H9AA 1BMDA 1ONOA 5C7LO 5L3ZA 1R0LA 4QQRA 2GZ1A 5TNXA 3UGKA 1K5HA 3WQSB 2O2SA 1ZMOA 2G1UA 2G17A 3L6EA 1ZCJA 4M86A 1A7KA 3JQDA 1I30A 1NAHA 3FI9A 1G0NA 4XCVA 2VWQA 5BQFA 2E49A 4EW6A 2E82A 3PJGA 3D5QA 2YV2A 1X1TA 3ZV3A 4B3JA 4A0SA 1KY5A 4DQUA 1LLCA 3ENKA 4IQGA 3Q3CA 4BB6A 3WQQA 4Q3AA 2BF7A 3MOGA 3B6ZA 4BNGA 2IYOA 3PHIA 3E9MA 1CETA 3AU8A 1VL6A 3UUWA 4CMKA 2ZB7A 3L6OO 3ANNA 4FOSA 3PXXA 3AUUA 3U4HA 4XIYA 4HWKA 4KOAA 2PH5A 3DZKA 1CIVA 2W98A 4XGIA 4R68A 2Q1TA 2PKQP 3M6IA 5A03A 1PZGA 2EF1A 1XLTA 1HXHA 4KUEA 2HMVA 3BYZA 3E03A 2QW8A 4L4XA 1DFGA 2OO5A 2BGKA 5ER6A 1N9GA 5AXDA 4AJOA 1O5IA 3EZYA 4FPXA 4ZGWA 1O8CA 2J3HA 2HQ1A 3KLMX 5H82A 3LT4A 3QJ5A 1SOWA 4EUHA 4M87A 5KWEA 5JBIA 1C1XA 3BXXA 1ADBA 3K30A 3INTA 4U8GA 2OP0A 4CM1A 2HMSA 2PZKA 1XQ6A 4PLGA 4XQ9A 2GN9A 4S1VA 3JQAB 2QHXA 5I9MA 4Q3NA 3F9IA 3PVZA 1CJCA 4D7AA 1EUCA 1YL6A 2Y1CA 2VCYA 2Y66A 5KKAA 5JE8A 3PDUA 4W9NC 3UFXA 3UXYA 3HFGA 2HCTA 3AWDA 1EQ2A 1ZZEA 2Q4EA 1IPFA 3A28A 4URFA 4Q39A 3UF0A 4M1QA 4J4BA 3BMQA 5IAAA 2VWHA 4EJMA 4YAKA 3RQSA 1U2GA 1WAMA 1DAPA 3K9QO 4QXMA 3ZWBA 3F47A 3WYCA 2NU8A 5FI5A 4D41A 4YAJA 4PVDA 5JAQA 4KTVE 2V65A 4BQRA 1SPXA 4D44A 4CLRA 1Z7BA 1DFIA 2DFDA 4JBIA 1K3TA 4CJXA 1IUKA 4IQ8A 4R9RA 5A9RA 1GEEA 4OMUA 4CMIA 1EVIA 3LQFA 3G1TA 1HRDA 4ZICA 4GMGA 4NBVA 4A03A 2BH9A 2GR9A 3GGPA 1H6CA 2Y0EA 1LDMA 1WLYA 5U9CA 1A27A 5TJ9A 3K6JA 2BHLA 2NQTA 3V1YA 4CL8A 4F6LA 4IMRA 3HN7A 3KBOA 1DPGA 4E2ZA 2CDBA 3GY0A 4EJ0A 3OIGA 3OETA 2FN7A 2ZTVA 1E1LA 1GV0A 3KB6A 5U1PA 3DTYA 1DAOA 1P1IA 4I5FA 5G0TA 4YR9A 1E3LA 1YQGA 2ZIZA 1ENYA 3E5RA 2BELA 1CEQA 4BNLA 1EVYA 1ZSYA 1IPEA 4WLFA 5CEFA 2D3TA 1DLJA 4TWRA 1XDWA 4XGNA 3RAJA 3RFXA 1NHGA 3U49A 1ZKMA 4L4SA 3GVIA 1E6WA 1TB4A 3GUCA 4JXKA 4ALMA 4LK3A 3GT0A 3DBHB 2ZB8A 5JNLA 4BGEA 4TRMA 4Y8VA 2DBRA 3WYBA 3ROKA 3CMCO 3EC7A 5BR7A 2PD4A 1X0VA 3GMDA 1HTBA 4N54A 4XX0A 4CMEA 2YDXA 3CZMA 4BKUA 4YJDA 1W4ZA 4EEZA 4YT8A 1ISFA 2VWPA 3K8ZA 4TKLA 2DFVA 3GA0A 4W7IA 2CVOA 2EIHA 5ES3A 1WMBA 2VUUA 4CLDA 3S2EA 2C5AA 2X8LA 1DJQA 3DR3A 4NBRA 2B0JA 1BDBA 3F5SA 4OGWA 4NBWA 4OKNA 4P38A 4DC0A 4DIFA 4ND2A 4RPGA 3P2OA 1B16A 2VTDA 2CNBA 1RJWA 4P8RA 1EE2A 1DIHA 2VNAA 1YONA 1DC4A 1Y8RA 1FF9A 2AA3A 1QV7A 1GU7A 3R6DA 1YRLA 1NFFA 3H9GA 2I3AA 2PWZA 3QLJA 5KNLA 1O95A 4C4OA 2VQ3A 1T1SA 2GO1A 2F1KA 4R9SA 1N92A 3SC6A 3Q6IA 3M1AA 4RF3A 1F8GA 1XGKA 1J6UA 4FDAA 2EERA 2C29D 4K9DA 5ILOA 4DREA 1JVBA 4WNCA 3G0OA 3JCZA 4KDEA 1Q1NA 2AG8A 5KJ6A 2X0NA 2Y1DA 3OM9A 3CINA 5KVSA 4R5MA 5EESA 3K96A 2UV8A 3ADOA 1PZEA 3DMYA 2JFHA 3OH8A 5I7FA 5IN4A 1SCUA 3WIDA 1HYHA 2YV1A 2ZJ0A 5DP1A 4KTTE 3RFTA 2GERA 3SJ7A 5CAEA 4DMLA 4GKVA 2NVWA 4BL5A 1V0JA 1PGQA 1Z6ZA 3AM5A 3PYLA 1T4BA 4PG4A 2DT5A 3OJOA 4GL4A 1RKXA 1FDVA 4ZN6A 5JFOA 3B1KA 4MO2A 4IDEA 3KEOA 2GN8A 1NVTA 3LT2A 4IPTA 4J1QA 4BMNA 2HRBA 1XEAA 4E5PA 2JCXA 3DZBA 4L74A 1NR7A 2Q1WA 1ZEMA 2CDAA 3S2IA 1ZIDA 1EUZA 3D4OA 2RIRA 5CPBA 2OGUA 3GFBA 3FNHA 4M49A 4LN1A 3GLQA 4NJMA 1U7TA 1G1AA 3HWRA 3RU7A 3QQPA 1EZ4A 4ZHSA 5AVOA 3JYLA 2UYYA 2Q46A 4WLVA 3OECA 1Y5RA 1HWYA 3BHMA 4K26A 5EJ2A 4E2XA 4EYEA 4KUGA 4FFLA 4B4UA 4GX1A 5FWNA 3H5RA 1J4AA 4UVDA 4JQCA 5BNFA 4AJNA 2FWMX 4EZBA 1KETA 4YA6A 1KEWA 3MZ0A 3WFJA 1CQIA 1TT5A 1F8FA 4B4WA 4A2CA 3G17A 3WX0A 3JQGA 4Q3CA 5A5FA 1H0KA 1I3KA 2DAPA 3QHAA 1RM4A 1R37A 4BKQA 4WCFB 3Q9UA 1ISIA 3VPGA 3NX4A 2A94A 1TI7A 4OSPA 1BSVA 3U62A 1JKIA 4F45A 4HKTA 1MC5A 3ITKA 3FCOA 1CERA 2I6TA 4YYZA 2EKPA 1SAYA 2P5YA 3BMCB 1QXSA 1LNQA 1JDJA 1HLDA 1QR6A 3AM3A 3JD0A 4LRSB 4WJZA 3L4BA 1PJQA 3BZUA 3ENNA 4XEHA 3KYBA 3NGXA 2P9GA 5F5NA 4CMEC 4K1LA 2I5PO 4DC1A 3EK2A 2F00A 3ZU2A 3IL2A 3L9WA 3S2FA 2GZ2A 3GVXA 4R1TA 1DC5A 3W4KA 4EITA 1HDGO 1KVQA 1SB8A 1NPDA 3W1VA 1ZO8A 2PKQO 4NMHA 2PGJA 4CM5A 1V9LA 1FDSA 1DDOA 1H2HA 4GWKA 4IDDA 4DPLA 3AY7A 1DRUA 3W4IA 5DCYA 1RM0A 4FFPA 4J4HA 1W6UA 1QKIA 4N5MA 4MVJP 4TVOA 3X2EA 1GZ4A 3NJ8A 3PLNA 3DEYX 1ENOA 2AQHA 5IJZA 1WP4A 4RQTA 4S3MA 3DXFA 4II2A 4MVJD 4ND1A 2IZ0A 5L4NA 2JD1A 2X86A 4NBUA 4CMIB 2YFHA 1KYQA 3N58A 4I9NA 4CV3A 4BO4A 1YQXA 3HE3A 1UUFA 4LRTB 1BXGA 5KJCA 2A92A 1UZLA 3EY4A 4MJLA 3HQ4O 3JD4A 4RL6A 2C0CA 3ZU5A 1E3SA 2BFAA 1U8XX 4D0SA 1KVTA 4TZKA 1BVUA 4DL9A 1GTMA 4QT0A 4YAGA 1AE1A 1H6DA 3D7LA 2V6BA 3R3JA 4CUKA 1PGOA 4XYBA 1U4OA 2NVUB 4ZJUA 2X7HA 4EEXA 1ZSNA 3QW2A 3WGYA 3S1LA 2AE1A 2SCUA 4UAGA 4I9UA 4PG7A 3PHGA 4R3WA 1ZUD1 4K6FA 3GVCA 3RJ5A 2QYSA 1T2EA 3WTBA 3FTPA 4PLFA 4J0FA 3QWAA 2IDZA 1YXMA 4OYRA 3QVWA 4BNHA 2EEZA 3BAZA 1ID1A 5G0VA 3I5MA 1JKFA 3AI3A 3DC2A 1E7QA 2O3TA 4YJHB 3OA2A 5GZ1A 3ZWPA 4WUVA 2UUPA 3JQ7B 2YQ4A 4IQ0A 3ZU4A 4WCDA 2P2SA 3QP9A 4YRDA 3KYCB 5A1TA 3JQCA 1QYWA 2AMFA 1AXEA 4J1NA 1FDUA 1NP3A 5IDYA 2W8ZA 1R4NB 1IYZA 3A4VA 1ONNA 5IDWA 4GX0A 4J43A 5MDHA 1HKUA 3ETEA 9LDTA 4D3FA 3H9EO 1E3WB 1NTOA 4YWJA 2Y0DA 2X6TA 3Q0EA 3M2TA 3RUIA 4OM8A 5G4KA 2HDHA 3AOEC 2VRCD 2AXQA 2XXJA 3MWEB 4IDBA 4JP2A 4ZRNA 4CR6A 1F12A 3B1FA 1H93A 2JAHA 1QMGA 3GZNA 4NHEA 4DYVA 3ORFA 4TRRA 3JYOA 3L9XA 1YBMA 4BOYA 1QG6A 1KEUA 2GDZA 2I76A 2PNFA 1J0XO 3WMWA 4G81A 1M76A 5IDXA 3AU9A 4J49A 2C2XA 4OSOA 4RVGA 4B4OA 4RDIA 4ZQBA 2YUTA 3DOOA 4Z0PA 3ZWCA 4FW8A 4FC7A 4HV4A 1DHRA 3NDRA 4CM6A 4WNIA 5GZ3A 1ZW1A 5I7EA 3TOZA 1UR5A 4PLTA 3L0DA 1EFLA 1N7GA 3MJCA 4BQPA 3NDIA 1T24A 1WWKA 2GN4A 2J5QA 3EZLA 4G65A 2BKAA 3U0BA 3ZDFA 1WW8A 1MC4A 1KEVA 1ARZA 3AFNA 5I7VA 4GLOA 4J90A 4BKPA 4ZU3A 5JAZA 2VNSA 3F6YA 3GQVA 4XYMA 1MB4A 4E30A 5IG2A 1WPQA 5EINA 3CZRA 2Y1GA 4NK5A 4H15A 1ULUA 4IMPA 5A9TA 1R0SA 4ROSA 3ROPA 4BNZA 3KYDA 3OHSX 4LGVA 1A7AA 3U3XA 1HYGA 4A5OA 5JPIA 2NUAA 4Z9XA 1HDXA 4IIVA 3PFWO 5IFLA 4D43A 2JHGA 4UEOA 3K5PA 2GN6A 1ZMTA 3JQEA 3RROA 2YYYA 1Q0QA 1IB6A 3DQPA 1VSUA 1D4FA 4NU5A 1B0AA 3DAGA 1SO8A 1I24A 2GGSA 4GI2A 4XYLA 1U4SA 4I8XA 3QIVA 4CM7A 3IDSA 5DBIA 1E7SA 1P44A 3QVTA 3OEYA 1T2CA 3Q11A 1XELA 4CMGA 2CZCA 3NT5A 1H2BA 1NAIA 1CYDA 3OP4A 3WGHA 3ZWWA 3FBGA 1QP8A 2BGMA 3UKOA 3A1NA 4ND4A 2HRZA 1NM5A 3HFSA 1EEHA 3VKUA 3GF4A 4XD2A 3E9QA 5CFZA 1NASA 3JQBC 2O2YA 4UUOA 3HNPA 2WWRA 4KZPA 3GAFA 4YPOA 2GSDA 4B3HA 3D5TA 4D3SA 1JWAB 3DOCA 1GPDG 3E48A 4OOEA 4X54A 3GH3A 5GZ6A 4RZIA 3WDSA 4KMSA 5CP8A 3GVHA 3DZHA 2X5OA 1B15A 1M67A 1P45A 2D5CA 2C07A 3WFIA 3H5NA 5JY1A 1G6KA 4YJFA 1PL6A 4A73A 4DXHA 3JQ8B 1I2BA 2I67A 5ITWA 1WZEA 1IOLA 2B4QA 3KEQA 4NH4A 4F46A 3WXBA 3JYQA 5JC8A 3OF2A 2NV6A 1JQBA 2X9NA 4RLHA 4QEDA 5BSGA 2IZ1A 1HF3A 2X9VA 5JDCA 1VRWA 3TZ6A 3PZBA 4KP7A 4C7KA 5B37A 1X7DA 4WOKA 1HSOA 2NLOA 5EPOA 3HG7A 4E31A 3GDGA 1JA9A 1LQTA 3LSYA 1EDZA 3H4VA 1OOEA 4MPDA 3PIDA 3FBTA 3IJRA 4BNXA 2Q1UA 3BTSA 3P5SA 4TKMA 4YJGB 1LRLA 4R5HA 1WVGA 1Y9AA 3EUWA 4WLEA 4B4VA 1FXSA 4QUKA 2FY8A 1ENZA 1DRWA 2FMUA 4CLEA 4XR4A 4CV1A 4O5OA 5EERA 4CLOA 3WLEA 2HLPA 3C85A 5DNAA 1XCBA 1I3MA 1HETA 3AOEA 1LLUA 2GF2A 3RU9A 3ANLA 4Z0HO 4IZIA 3DONA 3A14A 2YW9A 4PLHA 4RLSA 4XIJA 2XAAA 1AUPA 2OORA 2B37A 2WYVA 1YJQA 4P4NA 1JKJA 4Z3KA 4RVFA 4Y67A 1NBOA 2VYNA 4QX6A 3ZN2A 4XRRA 5BNTA 5KIAA 4ZQHA 4CQMB 1C0LA 3TJRA 4UEJA 2NTNA 1M2WA 1TLTA 1VL8A 2VWGA 4TROA 3DMTC 4GX5A 3WGGA 2GASA 2YHUA 2G82A 2NNLD 5ENVA 1ZXLA 2VZ9A 1JVSA 5C7IO 5L95A 1U3TA 5BNIA 1P74A 4IY1A 3VH2A 2EJWA 2HK9A 3B20A 2EGGA 5K6AC 3NTOA 5KJ1A 2Q50A 5IZCA 1ULSA 3T7CA 4D3DA 3VTFA 3VPSA 3AK4A 1PJLA 1PQPA 1LRKA 1UDBA 4B7UA 3IC5A 1ISGA 1ZK3A 3I4CA 5I7SA 2NACA 4CMAA 3ZWYA 3ONDA 3PLRA 4DPMA 1SMKA 1U9JA 1C1DB 3EAGA 1A9ZA 2WSBA 3VDQA 1V6AA 1XR3A 3W8FA 2VRCA 4AJLA 2PFGA 3GPIA 5ILGA 2QYTA 4E2YA 3HZZA 3UCEA 3C1OA 4J91A 5JO9A 3JD1A 4WCFC 3QWHA 2O3QA 4GKBA 1EK5A 1L7EA 1BRMA 1T2FA 4ALJA 5I9NA 3WICA 2E48A 4XGKA 4HFJA 4J1SA 4AL4A 3P19A 1NFRA 3IMFA 1E0DA 3RIHA 5CG1A 3DFZA 4JJGA 1Q7CA 2PGLA 4OH1A 1E77A 5HBRA 1R4MB 1UP4A 1GAEO 3PZRA 4E4YA 2QIOA 5L51A 3MOIA 5CDTA 1TT5B 5JDIA 3P7MA 4INAA 2WTBA 4BGIA 1JU9A 4L73A 4EUFA 4HADA 2BI8A 4N5NA 4YRAA 5KVVA 3WWYA 3BIOA 3GR6A 4JGBA 2AQKA 4WE3A 2POQX 3GG2A 2HJRA 4W82A 4FGSA 5AXBA 1NVGA 3AOGA 1LTHR 1BTOA 2A35A 2AEMA 3V2HA 3C7CB 3V1TC 5B1YA 1BG6A 4J0EA 4KWIA 2BRUA 1JN0A 1MFPA 1P31A 4A27A 4IJKA 4B7CA 4BO6A 2DLDA 4DLAA 4CM8A 3SLKA 1NYTA 1O94A 3ZW8A 1I3LA 2B69A 4HFRA 4D0RA 1X7GA 1Y1PA 2P91A 5LC1A 2CF6A 4FN4A 4CV0A 1UXJA 1VKOA 2IEDA 4ZD6A 4BGUA 2YFQA 5F3RA 4L0QA 2NVUA 3MJSA 4MDHA 2JCVA 3FSRA 5G4KB 1C1DA 4DMMA 5TS3A 3WQRA 1Q7GA 2AE2A 5THQA 4YT4A 2FSSA 3OQ6A 1A72A 1E1NA 4IDGA 4P4GA 5B12A 2EP5A 4E21A 1D7OA 3RASA 4YAIA 2XOXA 3JTMA 1F06A 4HXYA 3Q9NA 3ZHYA 4LISA 3ZZNA 3ASVA 2FSVA 1NR1A 5IN5A 3CKYA 4Z9YA 3FPCA 3G3EA 3TRIA 2B36A 4D45A 1LC0A 5JCJD 3GAZA 4AG3A 1EVJA 4KUHA 1T2DA 5L40A 3OSUA 4YJHA 2CSUA 1KBZA 1ZSVA 4RQUA 1DJNA 2OUIA 2JAPA 3BHIA 1N9GB 3K31A 3KSZO 2NQ8A 3OBBA 1DXYA 3LVFO 5A04A 2OL4A 4O63O 4MP8A 2VOJA 3WJ7A 2Z5LA 4OQZA 1ORRA 3F1LA 4R16A 3A06A 5L7TA 4ESOA 5G2OA 5JCXA 1PIWA 1QLHA 3RC7A 3S2GA 3EHEA 3L07A 3PGXA 3MEQA 2UUOA 3O26A 4NFHA 1Y5MA 4PRKA 1E92A 5T8KC 1X1EA 3UH1A 1SBYA 3Q1LA 3FD8A 2PZLA 4GVXA 3VZSA 2NM0A 4JBHA 2J3IA 5FF9A 5KJEA 1Z82A 2JL1A 1NFQA 2Q3EA 5GMOA 1PZHA 3RKRA 3ZWVA 3KYDB 2C20A 2ZQYA 3NT4A 1B7GO 1B3RA 4BNKA 1A71A 1ZJZA 2X0JA 4NNJA 4Q9NA 4M54A 4TMFA 1MLDA 3FN4A 4YBZA 2EW8A 4OXYA 2BLLA 1DIRA 3JQBA 1R16A 2HMUA 3HDQA 2ZYAA 4L75A 3E82A 5B4VA 3QVOA 2D2IA 3NYWA 4RF5A 3ZWOA 1KERA 3O4RA 3LC7O 4FBGA 2OFPA 1HDRA 5TJHA 4RVHA 2WD7A 3N7UA 4U5QA 3PTZA 1K2WA 4BO8A 1I10A 3D4PA 1Y81A 3GVPA 2Z1NA 2FPPA 5TLSA 1YDWA 1X15A 1TA4A 1NWHA 2VHZA 1T26A 3IOYA 5DT9A 3RBVA 4CR7A 3BTVA 2PR2A 2NWQA 4HP8A 4MOWA 4GMFA 1LLDA 3NV9A 3LLSA 3PQDA 1QYCA 1XQ1A 4E5MA 7ADHA 5G0UA 3AM4A 2EGHA 5T8KA 4OAQA 1GFSA 5HS6A 1ISHA 3PJFA 2P9EA 1M66A 1D8AA 3GHYA 3JYPA 3BMCA 4AFNA 4WK6A 3ZCXA 2VOEA 2C7GA 3WGZA 2W2LD 4TVBA 3AW9A 4IDAA 1GZ3A 2O4CA 3KHUA 4YQYA 2R00A 5KVQA 4PGFA 3LDHA 3ZHZA 2YQ5A 2WYWA 2Y99A 2WD7B 1UZNA 2PD6A 5JS6A 1PGPA 3GEDA 2X23A 3I1JA 4RORA 1PZFA 4QTZA 1P1FA 2O4UX 3BTOA 4UUMA 4PLYA 4PCVA 3M2PA 4FSHA 1UDAA 3H5AA 1I32A 4CUJA 1UXIA 4QECA 4MVJA 4AVYA 1LDBA 4FR5A 4RVUA 1I3NA 4DLLA 3MJVA 2VN8A 1KVSA 2OZPA 3JQ9C 1VJ1A 3H8VA 5TX7A 4B8WA 3G1UA 4GH5A 1PQWA 4B7XA 1Z7EA 3JQGB 4IINA 4RO0A 4O0LA 4NFSA 4I5EA 2HUNA 4NZ9A 1DFHA 3G49A 4PLCA 4O59O 1N7HA 1LDNA 3BMNB 4G2NA 1EE9A 3TNLA 2JFGA 3LC2O 4RF4A 1PJBA 4NJMB 1R4NA 4IXWA 4PLVA 4ZQEA 3NJ4A 5DN9A 3GDFA 1T4DA 3RSHA 3KM0A 1SNYA 3H2SA 5AOVA 5T57A 4E33A 3JQAD 4FGWA 3I23A 4TSKA 2TMGA 2X9GA 1R15A 3WBFA 1SOVA 4Y6SA 1K6JA 4JROA 1E7MA 1Y8QA 2NU9A 1N1GA 2FR0A 3KSUA 3OQBA 3RJ9A 4BNTA 3FNFA 1Y6JA 1UH5A 3D1LA 1E3IA 3D3WA 5JCJA 2Y1EA 4Z0TA 3X2FA 5JYDA 1PR9A 4R54A 4FFRA 5TT1A 2XF8A 2AQ8A 1SEVA 3AUTA 4YJGA 3MJ4A 4XDYA 2CFCA 1H9BA 4R41A 2CMDA 1E5QA 3PYMA 3FHLA 1QYDA 3FR8A 1EFKA 2I9PA 2JCYA 1XHLA 3QV1A 1YVEI 1ISMA 2VZ0A 3ZV5A 3PFFA 3ZNOA 2C2YA 5KCZA 4KQWA 4ZQGA 3PWKA 1HDYA 3Q2IA 5C3MA 2FOIA 2X0RA 4E32A 3H6KA 2Y05A 2YHIB 5DULA 1HLPA 4IS2A 4DBVO 5IXYA 2JKVA 1GQYA 3AY6A 2H9IA 3GPDG 4DUPA 1OMOA 1OZAA 1R66A 1WDLA 1P3DA 3E6AA 1DLIA 3KV3O 4LW8A 4BUCA 4DA9A 4PN3A 2DUUA 2Q49A 3TF5A 1N1EA 5BT9A 1QYXA 1GEGA 2DTXA 1UZMA 4CM9D 4FQ8A 1A4UA 1LSJA 4Q3EA 2Q2VA 3C24A 4B79A 2GZ3A 3LU1A 3PIIA 4CLHA 5TF4A 4Q3BA 3H2ZA 4OO3A 4FB5A 1WDMA 3O9ZA 3KZVA 4LCEA 3DZJA 5G0WA 2X22A 1I33A 2VHXA 1LU9A 2J3JA 4XR9A 4FIZA 4I9HA 4OHUA 3FNGA 1PX0A 4DIBA 1P1HA 1GD1O 1NHWA 5DDIP 3F5QA 3V2GA 1YKFA 1N5DA 4MIOA 3N74A 2ZCVA 1B8VA 1UP7A 1HL3A 1R4MA 4Q3DA 4FJ0A 4I5DA 3LK7A 1E5LA 1XG5A 2ZATA 2J8ZA 3IIEA 2NSDA 2EJVA 2IXAA 1FDWA 1YOVB 5GY7A 3D0OA 5H81A 2DBVO 4WPGA 4DIOA 5JC1A 3KTDA 4LVUA 5HA5A 2EP7A 4F3YA 3AI1A 1KOLA 4JIGA 3U4CA 4J6FA 4XQCA 1IZ9A 3R0IA 3PP8A 4JBGA 1M75A 4FJ2A 4HY3A 2GD1O 3VH1A 2IZZA 2WE8A 2X4GA 4PZDA 3BMNA 3HDHA 5L4SA 3I9JA 1HDOA 3GGOA 4N18A 3F4BA 3F1KA 3ZH2A 3TOXA 2J5KA 3I9LA 3CPSA 2Y1OA 4EBFA 4YT2A 3LF1A 4XDZA 5ADHA 3OJFA 5JAIA 3VHRA 4W4TA 2Y1FA 4J2HA 4YRBA 1XU9A 5IDQA 1KVRA 2E6UX 5CDUA 4LVCA 1UJMA 4YAEA 2BGLA 3ZWNA 3ZNPA 4NDNE 5EQDA 4ND3A 1TEHA 2RHRA 3I6IA 4AJKA 3RUEA 3KETA 1YBAA 2NU6A 3H7AA 3RD5A 2D5AA 3DHNA 1LI4A 5THKA 3OJLA 4AJEA 2B5VA 5L7YA 4BMVA 4E5KA 1UDCA 2Q4BA 1X13A 1BXZA 2DC1A 4XYGA 2B83A 4HX5A 2WM3A 1SEPA 3DFUA 4AJJA 5L45A 1B2LA 4BO9A 5CEEA 1A4IA 5ICSA 3ZV4A 3SEFA 1Z45A 3ASUA 5F21A 2PTGA 4ID9A 8LDHA 2BFMA 1VSVA 5TGDA 5L53A 3HB4X 4PZEA 2C5EA 4TRNA 3NGLA 2D8AA 2IXBA 2HKIA 3B1JA 3RBXA 2PH3A 4IXTA 1LJ8A 1M6WA 5A05A 4MVJI 4BNYA 1JTVA 3I6QA 1DB3A 2JFFA 1BW9A 2OMEA 2Z1MA 5DCWA 3WOHA 1GV1A 1Y8RB 1E3JA 4NFYA 1YDEA 4JLWA 1DC3A 3F4LA 4YVFA 4QO7A 1U8FO 3PHJA 4BNNA 1YE3A 3AUSA 4YTEA 2CVQA 1YO6A 2YJZA 4M8SA 1Y9EA 5HWSA 1WNTA 3K2BA 1CQJA 1U3WA 1NQOA 1HYEA 4Y9DA 4J16A 1ZK0A 2RBEA 1PL7A 1AHIA 4JK3A 3H3JA 1ML3A 1PJTA 4BHTA 2ZTMA 2QRKA 5JMWA 1QYVA 4PVCA 3LT1A 4E2WA 3KLPX 3CUKA 5FYDA 3KOUA 1L7DA 5HM8A 3R3SA 5COAA 4I08A 4BNWA 4Y6PA 4FCCA 5F1KA 3GZNB 3WJAA 2VUTA 4CV2A 1SB9A 3ITDA 3SXPA 3S8MA 4HNHA 2HMWA 3E8XA 3O38A 1ZXBA 4Z3DA 1Z73A 3GEMA 2PV7A 5F1OA 3RUDA 1PJCA 3VDRA 4PFJA 7MDHA 2O7SA 2I99A 1HDZA 3QWIA 1RM3A 1HZJA 3TWOA 2G76A 4XWYA 1TT7A 4HFNA 4A26A 3WNQA 4BKRA 1HDCA 2Q99A 3M1LA 3BA1A 3VKVA 5FEUA 1EVZA 1PGJA 5JO0A 1P0FA 3H9JA 3MTJA 3GNSA 4GAEA 3RI3A 1DSSG 2O7QA 2YY7A 1H5QA 4FJ1A 1JLLA 5G0SA 3RUFA 4BO2A 2IE0A 4CM4B 5T64A 3ZGYA 3QWFA 4ND5A 2Q2QA 1V3UA 2QX7A 3H9QA 4BNMA 1IE3A 4J3FA 1CF2O 4DTIA 3MJTA 1I2ZA 3GDOA 4IGEA 2C54A 3GMSA 4RGBA 2UDPA 3LF2A 4IM7A 4AJ2A 3PYXA 3P2YA 3KSDO 4J7UA 4CL3A 1GR0A 3WYEA 1PSDA 3H9UA 3K73O 3TQHA 3UW3A 1K89A 1YL5A 1B3BA 3DBHA 4M89A 4LSMA 3JV7A 4RVSA 1IHXA 2VHWA 1D1SA 1I0ZA 1B8PA 3OFSA 4UREA 2J6IA 1MUUA 3HADA 3GN2A 3EVTA 5A9SA 4DQXA 1BXGB 5CDYA 1Z75A 3TL3A 1Q7BA 2Q1SA 4UUNA 4YEDA 3GUYA 1DIBA 4GLLA 5AQ1A 2FZEA 4OXKA 4PLPA 1VE9A 4MKZA 4ALIA 1TXGA 3C1TA 4IZHA 3UN1A 3ROQA 3GRPA 2AEJA 1PGNA 2XXBA 4EUEA 4OJNA 1N8KA 2QG4A 2X0IA 3ZU3A 1XKQA 3VPXA 5JSFA 9LDBA 1O9BA 1LRJA 2C82A 3DWFA 3IP3A 1PWZA 3IUSA 2IEBA 2CVZA 4GSKA 3I52A 4RCVA 5U4QA 4JJIA 5ITVA 3C7DB 4CM3A 2E4AA 3SX2A 4MVJH 4K6CA 3D3EA 3C8MA 5JMPA 4E3ZA 1XIVA 3ONEA 4CPDA 3CE6A 4MP6A 2AG5A 5TSDA 4BNUA 1QSGA 1T2AA 1MFZA 1XSEA 4NU6A 4XZ3A 2VUSA 3VZRA 4W6ZA 1FJHA 4XYEA 1HE4A 2RCYA 2WJPA 1FDTA 4MVJG 2I65A 1EMDA 1O6ZA 3WG9A 3E1KA 1MGOA 5T6BA 4FOOA 4GGOA 2OBNA 5A9SB 2O3SA 5A3JA 4GQAA 4K28A 5C7OO 1MG0A 1PS8A 3GK3A 1Q0HA 3ICCA 1CWUA 3DZIA 3U4DA 1I5RA 1F14A 1N2SA 3WGTA 5ER9A 1AXGA 2R00C 2E37A 2O48X 1JAXA 1V35A 2ZJ1A 4H16A 2FRDA 1GQ2A 2YHIA 5MGBA 3NKLA 3TSCA 1OBFO 1I2CA 1P1RA 4MVJF 1U2DA 2B5WA 1A5ZA 4OIMA 4U6SA 4BNIA 1U3VA 2DTDA 4NR0A 3W8DA 1X7HA 2NVBA 5COQA 3ROMA 2DVMA 3DTTA 1YS4A 3PJDA 3TN7A 3CIFA 2FPGA 1C0IA 2HJSA 3TFOA 4CM4A 4CQMA 1MXFA 3EYWA 4FD3A 3WNVA 4JX8A 2JD0A 3EVNA 3L6DA 2HU2A 1BXKA 3ST7A 5A02A 4MKXA 1U5CA 2ZB4A 1LA2A 5TQVA 4MVJE 1D3AA 3W4JA 3ZWAA 1P9LA 1YB1A 1UP6A 1DO8A 3RCBA 3WSVA 3DZFA 4J2OA 3ZWXA 2HK8A 2P4QA 4IBOA 2AW5A 4BKOA 5IZ4A 3STHA 3CXRA 2QRJA 1ENPA 3WMXA 4UULA 3GEGA 4L9RA 1PEDA 4BO0A 3JQ6A 1GCUA 2J5RA 4ZRMA 3TFQA 3RKUA 3PEFA 3JQFC 3GC6A 1J49A 3SBOA 3AI2A 2P9CA 5BSHA 1O89A 2GCGA 4L8VA 2DTEA 3ETGA 5DBGA 4R3NA 5L7WA 4Y6RA 4CMHA 3HHPA 4J9UE 1DBVO 2HMTA 5CDGA 3F46A 3QY9A 5JXWA 1OAAA 4NBTA 1GDHA 3DDNA 3WR5A 1OFGA 1H6BA 1LSSA 2Y93A 4CMCA 1RM5A 4RV9A 2ZK7A 3HDJA 4GX2A 3WSWA 3O8QA 4BNVA 3C3XA 3IQDB 1HT0A 4GPD1 3PQFA 4NK4A 2O3RA 4W99A 5CHEA 2QZ9A 2Y67A 1B8UA 4IJUA 4WLNA 1ZK2A 4HBGA 2ZTLA 1LSOA 4YCAA 1DC6A 2BMAA 4E5YA 1XA0A 1HE2A 3SJUA 5TIIA 1YB4A 1MV8A 2BFOA 2X5JO 4E12A
chains in the Genus database with same CATH superfamily
1TKBA 2P1DA 2IIQA 3GLHE 3KJNA 3AR6A 3AEKA 4G5GA 2B9EA 2IODA 3A9WA 3P2MA 2HLDD 4DR4B 4XTCS 1XDSA 3NEAA 3AJ9A 5ALNA 1Z08A 3EMKA 1UCFA 2HQSA 3FRIA 2IH2A 1LBHA 2RC5A 2ZRFA 5HQTA 1G5RA 5KOHB 4BJ1A 3ZGZA 2WD8A 4H3VA 4UHFA 1KRXA 2W2OA 1FS5A 3MINA 1EJ2A 5F2EA 4C22A 5KQPA 4JODA 3HBLA 4NCJA 4JLJA 3VAZA 2P6MA 1B0UA 3WHPA 3VJRA 5DCUA 1N2CE 4B84A 2BFPA 2N9UA 4YCSA 3KKNA 5FBQB 3IDZA 2I66A 1F1BA 4RBNA 3RAPR 4D8UA 3T7IA 1AJEA 1SBCA 3S2SA 1DL5A 4U0JA 1QCDA 4FHEA 3ITNA 5JSHA 4RYLA 4CKBA 3F3YA 4IDFA 5IVIA 1M8GA 1U2ZA 3H1EA 2VYVD 1PQUA 1T0UA 4P3PA 1OA0A 2Q45A 4OJQA 1YRYE 3D9QX 3QKWA 5KO2A 3N28A 3VOBA 1NMYA 2C2BA 4UFNA 2BGJA 2IIVA 3OQMA 2E1PA 3U7JA 2OZVA 1VG1A 3V5NA 4R2HA 3BMOB 2IHBA 4DV0B 1ZA2A 3MWDA 2ZUUA 3I39X 1O58A 1G0OA 1SULA 1E3TA 2B1JA 3EQ9A 3MSCA 1HEUA 1V8BA 4BCBA 3EPPA 3HUUA 1DI0A 2KS6A 2VYVA 5C37A 2JF0A 2MOKA 2WB4A 1YIDA 5EWMA 3ZXUB 2DPGA 3GCGA 1K98A 4PE5B 2GRAA 1RAFA 4UOQA 2CWDA 1E1YA 3EGCA 5TT0A 5JEDA 3U81A 3SQLA 2W2XA 1GPBA 1VE3A 5CDSA 1M34E 1G7TA 1XVAA 3HCAA 1PR3A 3B9PA 3QV2A 4PZCA 4FFWA 2P9FA 3LAWA 5I5GA 3QEOA 2HADA 4FYIA 1E1MA 4IRXA 1QO7A 2D4AA 2DY1A 3L7CA 1DINA 3VI4B 3LHFA 2QP4A 3H11A 2QOEA 4I19A 1WEHA 4QTYA 4KVGA 3VYVA 3OEHD 1WCXA 1G21E 1L5HB 1AKQA 1IHYA 1ZGGA 3OX2A 5A62A 4NCKA 4Q93A 2H4HA 2DBQA 4QOGA 4EFLA 1XCOA 3HXLA 3KRTA 4CRWB 4KR3A 1YA8A 1A4RA 1CUXA 4L6CA 1TAGA 3DMHA 3AF1A 4UOZA 4DDUA 1U9YA 5B7QA 5FV4A 4IDOA 4HJXA 4CLOB 3MWDB 2OVBA 1OPRA 1SXPA 2RAUA 1AHHA 1P8JA 5JWOA 2H1HA 1G9XA 2JI9A 3L8EA 3CJRA 4IV8A 2IH4A 4A0HA 5A4DA 4X1YB 1Y6QA 4KXVA 2EKLA 3ZCVA 4EX6A 4BO3A 3FPAA 3G2HA 3TDMA 5CYGA 2V7EA 1O97C 1TZMA 1V1RA 3SDBA 1TGYA 3ON5A 4I9FA 4TV9A 2A9RA 2XJ9A 3GXOA 4F3TA 2D5BA 2G71A 1EHIA 2BFDB 2UUAB 5LP6F 1QAQA 3DYVA 3WAKA 1WV0A 3ZIUA 3QSGA 2C9YA 2FN8A 3T5AA 4UCXA 2Z09A 1VKJA 4OFBA 4LJ4A 4RS3A 5AI0A 1UBSB 3GELA 1QIMA 5T5QA 1I51A 5TRTA 3U7QA 2CXRA 1X7WA 4FGZA 2QXTA 4CXMA 1G5QA 1ZWKA 4JGIA 3CU5A 2LCQA 3PWSA 1ZN7A 3W1EA 1DKLA 5TQJA 3Q15C 1ES9A 1LLQA 2H2WA 2NO0A 1P4AA 3OICA 2LDXA 3OEWA 5BXYA 4PCUA 4L0MA 3LDFA 1R6BX 1V6CA 4OH7A 2PKRA 1TYBE 2QQFA 4I4NA 4KN8A 2OBMA 4S1TA 3WWZA 3UY4A 1WP9A 1CRPA 4AUEA 4IKPA 5K8VA 2FMFA 3T3OA 2CFTA 1CY6A 2BKUA 1S2GA 1YTUA 1Q57A 3ETLA 3DMTA 2UVPA 4BVFA 3B1WA 1AZLA 2V6JA 1DO0A 1WZIA 4KIUA 2VTBB 4DLYA 2Y4NA 4UUPA 5EHNA 3WLMA 4BVAA 3PFNA 1RFLA 3AZOA 3TL2A 2YDYA 4XQEA 1X14A 3D8TA 3O6VA 4O4HB 2NUBA 3K15A 2AMLA 1A8UA 3A9UA 3B1YA 3R74A 2ATIA 3AP3A 2NTJA 4EJ6A 2O59A 4U2BA 2FHPA 1TM2A 3B53X 1E6LA 2XKKA 3B82A 2GO7A 5BWNA 1KP2A 2WTMA 3UICA 4RJTA 1E6UA 5JXGA 5DEOA 1L5ZA 4LMAA 5FIUA 1UAAA 1M8PA 2XT6A 3COZA 3K32A 5K05A 2HQRA 3PXCX 1G18A 1E7RA 1YOBA 2ZCUA 3M5WA 3DVAA 4I1VA 3U6BA 2JLZA 5BPHA 4B34A 3ZE6A 1F8XA 3DFKA 1JMVA 3OUZA 4E70A 3GGJA 1DV2A 2X42A 4DLBA 1C50A 4JR1A 3LCRA 4X65B 5FFNA 5A06A 1NSFA 5BRJA 1E9SA 2FPIA 2X8AA 2PVPA 4RHEA 1JTEA 3SS7X 4HLNA 3WB0A 1Z26A 4OB6A 3G7UA 1JFVA 4KODA 4UUAA 1MJ5A 4XVHA 2R6FA 1KMMA 2XXAB 1Z4NA 3H5OA 2LCIA 3NW9A 5AW3A 3NNNA 3ZDYB 1T1EA 3OOHA 4M0DA 2HAEA 3G0DA 4IUDS 1II9A 2IEYA 3OT1A 9ABPA 4I3GA 2YKGA 1LNZA 3IURA 3KXDA 5GADl 1C3EA 1VCOA 2HO5A 3N70A 4UNIA 1EPUA 3UOGA 2EYUA 3W9UA 4C29A 4C21A 2NADA 3LZ6A 4IGFA 2GS9A 1MXHA 3KSRA 3TD6A 2B25A 1ZVMA 1ZHHA 3FMPB 1X38A 4Z51A 3QUQA 4DRYA 1LH0A 3BH7A 3EIFA 1H1LA 3I9KA 3L5OA 3PNLA 5KOJB 1GXSB 5B2FA 1I4WA 1QHHA 2E4WA 3AIKA 5D6NA 1VYUA 2BGNA 2A5FA 5JANA 2AC2A 3GRRA 4WIAA 3L4EA 3NH9A 1R12A 5AK6A 1T9GR 1YA4A 1HSZA 3R7BA 5FH9A 2HF9A 3LZCA 2Y0BA 3CUVA 5B7PA 4KQJA 1QVVA 1H8HD 4WCVA 2W0MA 1NP6A 3TJMA 1W5TA 1D9XA 1LDYA 1KZ1A 1T29A 1YS7A 4G8CA 3ZY6A 1F51E 1Y9ZA 1ZH4A 2WHQA 3SX4A 4QVIA 3HP4A 4LBVA 2J9GA 1SZJG 2QA5A 5CCBA 2B4AA 3G88A 3ABSB 1HI9A 3SM3A 5KWJA 1VPDA 1ZVKA 2GBPA 1BGVA 2ENWA 2WUEA 3PUZA 4JDUA 4AQ7A 1QRUA 1E94E 5E8JA 3WP1B 3R4VA 2QRHA 2WA2A 2X3YA 4XLZA 1VXRA 2X40A 4DVJA 4H60A 1CVIA 3Q2KA 2XUZA 3CZCA 3EXFB 4BNFA 2FI1A 4G1UC 1BGXT 3GEPA 4ZVNA 3WP0A 4B2LA 2UVDA 4MVYA 4A5SA 4YQEA 4LF6B 4BB5A 2IRWA 2WJWA 5KWVA 3ZNQA 3GOQA 3HJRA 4NXMB 1RLJA 3TTSA 1L5OA 2QMZA 1SG6A 1SQ5A 3ICVA 1T1RA 1R3DA 3KLBA 3DTVB 3LLMA 3VTKA 2VZ8A 3VI3B 4K03A 2JD2A 2OQRA 5JDCC 3OQJA 1G5TA 4EI2A 4X20A 4YP7A 3C6KA 1STOA 2CDRA 2FWIA 2AH5A 3LOQA 1AHNA 3NHYA 3OCXA 4JJ4A 4OKIA 3B2NA 4OLAA 4PTLA 1EDEA 1C9NA 5BR1A 4KFSA 4LHZA 4LHSA 4EUKA 2O05A 1O0SA 2H9AA 5C5EA 5KTRA 2CNNA 2OP1A 2Q0QA 5DYIA 3FPLA 3RNOA 2JIQA 2DJIA 2HX1A 2JHFA 4P5DA 2O50A 3JQRA 5FFFA 4CMBA 2FPWA 4X85A 3I3OA 3UXMA 1T34A 4M60A 1VGVA 2DR3A 2IC5A 2P41A 4JDPA 3T7AA 3ZK7A 4L8LA 4QSMA 4ARZA 4YUXA 2DR2A 1IM5A 2EFDB 3O8QB 2A0WA 3PDJA 3E8MA 1H05A 1Q19A 2EZUA 3R3XA 4OF4A 5F1PA 2W2LA 3BT7A 3LCMA 2PD3A 2P5SA 4B3RB 2YOHA 2GLXA 2EHDA 2GJAA 3L41A 1U04A 3DQZA 1U7ZA 2QN8A 3JX9A 1XWFA 2R1TB 1GQQA 2VR1A 3CF4G 4E14A 4BFVA 3HPQA 3E05A 4J7CA 1KI2A 3ROGA 1ZJWA 3EZNA 3JPYA 4PHCA 1CIJA 3PTLA 5KTSA 1NOKA 1VM6A 1JW9B 2DUWA 4GBJA 4F8EA 1XPRA 4BBZA 1ZK4A 4I81A 2V5UA 2XWPA 4G8DA 3VR3A 2JJ1D 3MF4A 1VG9B 3VRHA 5JHHB 2WPDA 2GVDC 1VE6A 1PK7A 1V8FA 3AP1A 3CZ4A 3IDFA 3WLAA 2R6JA 3X43A 2B6HA 3ET4A 4DE5A 1JXMA 2VRBA 3T95A 1NNUA 3BL6A 1PNVA 5BSTA 4IDHA 4ZMBA 1R8QA 4JJFA 3JQ9A 5ICMA 4OXIA 1DEXA 1G8FA 2P4HX 2AJLI 4ZA2A 5DZSA 3AX6A 3LYUA 4N5LA 1U8UA 3C3DA 4WOJA 1NGSA 4LMRA 3MS7A 5AHWA 4QASA 1V71A 5CAEB 1EFHA 2VQFB 2HU8A 1B26A 1ZOOA 3V4LA 3QF7A 1P61B 3UK2A 5EWLB 4R7TA 2FMXA 3DW3X 4G56A 3B3AA 2REOA 3VHLB 1M8KA 4GHWA 4DV1B 4L9SA 1JPNA 2I22A 3I3SR 2WW8A 2AJDA 1C9KA 3N8DA 2XF2A 3KZMA 3OZAA 1GRVA 4H17A 5KOIA 2JHPA 3HKCB 1EP2B 2DYKA 3R7LA 1QV6A 2UZ1A 1J7JA 4W1QA 5DX8A 3AUAA 3KDSE 1DDGA 1H2EA 2PZ8A 5CH3A 3JYNA 1IZ8A 4X91A 1L4YA 1DV1A 1C3XA 3WWPA 2V7PA 4AZ3B 3QXHA 3FY4A 4NPCA 1PJ3A 4ZGBA 5ADUS 1OV4A 2WTXA 5T41A 1O6FA 4GYJA 4BO5A 2HCRA 2H2DA 4K81B 4W5JA 1C7IA 2Z9DA 4OU4A 5A5VA 4LRXA 1RJDA 1U8AA 2QL6A 1DTEA 1FQOA 3GEIA 3M5DA 4FHGA 2RONA 2B35A 4M0LA 5CFMA 2XZDA 3N0TA 3FNEA 3AHHA 4HXFB 4IHJB 3G5UA 4HPWA 4WI1A 2OCLA 2Z5VA 4WHMA 4AP6A 3UHAA 2CHQA 5KYXA 1G8KA 3VJLA 3DF9A 3KVYA 3BIXA 2ZPAA 5TGTA 3ZY2A 5F9FA 3KZCA 4EHDA 4Z7JA 4NQRA 4OUDB 3ORYA 4Z9BA 2J3KA 5SY9A 4J16C 1F4PA 1OBCA 2VAWA 1KQOA 4MW7A 2JLBA 3RR2A 3RRZA 2G70A 3L05A 3ZZ0A 2BTQB 5TF0A 1JFSA 2HLHA 5CFPA 3BN3A 3VVCA 4H6PA 5FTLA 3PNYA 4OQYA 3K8OE 2XLBA 3TXAA 3D4NA 3E4DA 4QO8A 1XZFA 1T5OA 5K0FA 3HJAA 3RC8A 4KLZA 3E5MA 1YR1A 2BFFB 2VJYA 1KI1A 1Y8QB 1GL7A 1T8RA 3WLHA 2FW9A 1RAAA 1CPYA 4DWVA 1KGSA 5TDHA 4Z99A 5SZKB 2H2FA 3V7YA 1BCRB 4QFCA 4UZFA 4ZARA 2HFKA 5KAPA 4JI5B 1SVKA 3DEHA 3TX6A 5C4IA 4B32A 3KSMA 5C52B 3KAKA 3DBRA 3DEAA 2QZJA 3R8CA 3CH4B 1GRQA 3GL9A 5JBNA 2VK8A 4J0QA 1RWKA 2YHBA 1V7ZA 4JI7B 4EZEA 3IS3A 3VZPA 4AS1A 2E4VA 4R9NA 4JJ8A 3PCRB 2VAPA 5SYMA 2ZYDA 4CM8B 1K27A 2IP1A 1ODFA 1RCUA 3GLSA 2XCQA 1ADYA 1VI2A 3DLPX 1XI2A 3JZDA 1I1NA 1PJSA 1WOMA 3KC2A 1REQB 3PXDA 4J94A 3SHOA 2XZTA 4Z8XA 4A9AA 5BVHA 3I62A 2XVAA 4K40A 1U8EA 3GHHA 2FPPB 2E55A 4MQ4A 2D2EA 3AGQA 4M8KA 5EJMA 4F5EA 3PUKA 1QRRA 3RTDA 1IEVA 4NG4A 2VDLB 1Z5UA 1FP6A 1UDXA 4Z4CA 2JAQA 1MH1A 4PLZA 5AK3A 2VNKA 4UMVA 2C2GA 3SSOA 3ZE1B 1VB3A 3QH4A 3OTGA 4JKIA 1HZZA 4ZWNA 1L5GB 1GG5A 2E7ZA 3EEFA 5JY6A 1ZM3A 5LKRA 3SIWA 4C87A 3GRCA 1EINA 5C51B 3TPCA 7GPBA 1SQFA 3L4BC 1AK1A 1KEPA 4XKJA 1TJNA 3B9QA 5A5EA 5MN6A 1U7PA 1VGRA 1V25A 5C4MA 4IFEA 4IDQA 4YN3A 2WILA 3B52X 2AXNA 4WESA 1KFBB 1DEHA 1HDEA 3K70B 4MIEA 2ZBGA 3QY0A 5DFAA 4KAFA 2E4ZA 3SIRA 3RTBA 1CNMA 1EUDA 2FX3A 5F3WB 4R69A 1FPQA 2GUGA 5JZ9A 1EUQA 1UWCA 3OLQA 2DMRA 3DOJA 2JIRA 1WQ3A 2PL9A 4N8SA 2EW2A 4FZRA 4NAUA 2L18A 1C2YA 1FFAA 3HP7A 3IV9A 2RDMA 1A8QA 4HAXA 3VVBA 4G24A 2A84A 2VJDA 4JYMA 5IF3A 4EHLA 3EWNA 3MB5A 3RWBA 3T15A 2V7VA 2WF7A 1NMXA 3NHRA 5UKDA 5KPJA 2VYCA 1N8TA 3AC0A 1SBTA 2QWXA 3RC1A 1CS0A 2Z2JA 3QOFA 3R3VA 4BWFB 1O96A 5HQJA 4WKPA 4B82A 1VL0A 4U2EA 1A2BA 4JVNA 4KO3S 3WA6A 2IGTA 4G86A 4M9RA 4HL6A 1WPGA 3MMPA 3WS7A 4D79A 1O6GA 1DPFA 2WMDA 2ZVDA 4WD3A 5DB4A 4EDFA 2G88A 5HFNA 3HYNA 1V8ZA 3ZLTA 1KSJA 2PL3A 1NE2A 1ONBA 1UFRA 4MH0R 4PRLA 2KX7A 2PUAA 1PTJA 2R2GA 5SYAA 1JSXA 1H9AA 4JLAA 3C5WP 3EC1A 1BMDA 3JW8A 2ZBFA 5EHQA 9GPBA 3MT8A 1JEDA 4QQRA 1KOJA 3ET5A 4QUHA 3WKCA 3B7WA 3WQSB 3A2LA 5MHTA 2C42A 2G1UA 4DR3B 3ZLUA 2HREA 4MUXA 2CGEA 1IG3A 4XWAA 3K70C 4I4CA 3ZD9A 1CS4C 4FGJA 1NAHA 1II8A 1X1AA 2VWQA 2ZDHA 1LW6E 2E49A 3ZUPA 3WMFA 2EBUA 2EWWA 3TE7A 4B47A 3PJGA 3DFFA 2YV2A 1X1TA 4M8IA 4MAMA 4WAUA 3RW9A 5ITZA 1LX7A 2J5XA 3OE5A 4H7IA 2BSXA 1JQAA 3Q3CA 3M4JA 4JS0A 4C0WA 2C8VA 2BF7A 3VSAA 2BEJA 3PHIA 5CNJA 4DM4A 1F0PA 5AM4A 3UUWA 3ANNA 2W6MA 3CUWA 5D85A 4WV3A 1Y98A 4OM7A 5I9IA 3K6SA 1ZXXA 4FNGA 3DZKA 4Z7OB 3T54A 5AW5A 1BOOA 4GMHA 3KHTA 2BFCB 5A03A 1NUQA 2WU1A 2G36A 5L3RA 1NVBA 2XTMA 2YNMA 3BGSA 4OK3A 1GDTA 2JHAA 4KUEA 3E03A 2C3YA 4MWBA 3G5AA 4RM2A 1NW6A 2YRWA 2G09A 1L4BA 2VPXA 5ER6A 3UQZA 4QBGB 1DAKA 3EGIA 2QL7A 1GN9A 3EZYA 4MTCA 3T41A 3VU1A 3ZG6A 3UUFA 5F4ZA 2HQ1A 4Q1BA 3KLMX 2AF4C 3LQQA 4MJ7A 5BN1A 1XRMA 3K0BA 4MV6A 2QVBA 1Q0ZA 3RSZA 2IQIA 3X3HA 1IIRA 4DCMA 4LQCA 4LGYA 5P8WA 4DAEA 2EFCB 1DEAA 1U98A 2OP0A 2P7HA 2PZKA 2RIPA 1HPLA 3DNFA 2E4YA 3G0IA 5REQB 3OZBA 3OHMA 3KQWA 3GLTA 3NHAA 1N4DA 2QHXA 1HY3A 4HYTA 3F9IA 3E3LA 5IC4A 2Y1CA 4AY5A 3P9RA 5FNVA 2GCOB 1U90A 1XTPA 3D6UA 2GTIA 2CMHA 3TINA 3AFGA 3UXYA 5LNK6 3IESA 1H0RA 1TE2A 3WE7A 1TVCA 1WQ1R 2Q4EA 5LLSA 4DY6A 3LIPA 3DSRA 2P35A 5F7JA 4URFA 1F3OA 2P6UA 5FPYA 3L0YA 3UF0A 4MYRA 5LZ8A 4DYHA 1MNQA 5KX5B 4R2JA 1J8MF 1NDQA 4RGQA 1XXHA 3L7IA 4GOND 4OQDA 3V4ZA 3RQSA 4DLSA 4YAKA 4BFYA 3JRNA 3K9QO 1TEXA 1DWOA 2WFAA 3AQIA 1M2VA 3OIUA 4L85A 4R0NA 4PX5A 3SSMA 1JB9A 1Q7TA 3REOA 4DJEC 4JMLA 2PUTA 3BXHA 1NXPA 3OZXA 3NBYC 2DY0A 4TLDA 4CEHA 1J2RA 1NV8A 3F0TA 2GHQA 2LIVA 2QDKA 1N32B 2WFMA 2FTKE 2IU4A 5DLQC 4ES6A 1EFDN 2P2CA 1EM8A 5A0TA 1A8PA 3M89A 3WXMA 1DFIA 1R0BA 1IOZA 4IQ8A 4R9RA 1GEEA 2KHZA 3I6ZA 3IUJA 3BFKA 3G1TA 3R3UA 1VCIA 4NBVA 5DLYA 3BC1A 2BH9A 5CBPB 5K03A 4JQYA 2BSQA 4OX9B 4Q0MA 5HKBA 1OLSA 2Y0EA 4G4SP 6AT1A 1GG2A 3BXFA 4G0OA 1AA9A 4YY3B 4DT1A 1XHEA 1VPEA 2IDJA 3AF4A 2H00A 5HQ3A 3K6JA 1SVIA 1G3RA 1Z8HA 3FUCA 1ZUIA 3ROEA 1XEXB 1MJHA 4RD1A 3M1YA 4CL8A 4EPXA 2ZIXA 4EKNB 4IJ5A 2CHVA 3U4MA 2Y1XA 3U61B 4E2ZA 3GY0A 3CWQA 1DKOA 2VNHA 5H4HA 2Z3ZA 1R4AA 4DJFC 4YX9A 3KB6A 1M2VB 3D2BA 1PLLA 1Q0PA 4DXDA 1IN4A 1XTIA 2K5UA 2NTYC 5G0TA 5ICCA 4ETMA 3ZLVA 3QF4B 2F55A 2AOTA 1U8TA 1ENYA 3E5RA 4TTJA 3HDVA 1IPEA 1XD8A 2AEEA 1DLJA 2R85A 2QRQA 1XDWA 4HAYA 4XGNA 3RAJA 1ZKMA 5HK9A 2BFCA 3M81A 2XMSA 3GUCA 3R6GA 3TGPA 4ALMA 5LUAA 4HGZA 3GT0A 2ALJA 1WPRA 4LK3A 5BQXA 4G4GA 2OO5C 2ZB8A 3EFOA 4D9BA 2B4KA 3OX3A 4ZYUA 5EJ8A 3LP6A 4L8WB 1ORDA 2ZIGA 4F93B 5AVRA 2C00A 4MUBA 2FWJA 2P69A 3UQYS 4QICA 1VHWA 3A6LA 1NM5C 3ROKA 3RREA 5AI5A 3CVYA 1ID8A 5ESRA 1BQ4A 4B9AA 4KGZA 3RF6A 4YAUA 4UMFA 3IP7A 3MRTA 2G72A 2AYZA 3P8ZA 2V7QA 3CZMA 4YJDA 3UBTA 4O08A 4F86A 2B7LA 2GJSA 5K3FB 2I7XA 2IQ5A 3OM8A 3K8ZA 3ZY5A 5CM9C 5EJFA 3GA0A 4YMIA 2CVOA 3L8YA 4AX4A 4CLDA 3S2EA 1ZISA 1J90A 3R3WA 5JZVA 3LUPA 3Q3VA 3IJEB 2HN9A 4WBXC 2AOUA 1Y3DE 2ZU6A 1BDBA 4GXQA 1KWKA 1ULBA 2X3FA 3CLRD 2A0KA 4OKNA 4EMBA 3EN0A 5BW8A 4GOXA 1E2DA 3OEED 5DMXA 2PWPA 1KZYC 4US2R 1EE2A 1DIHA 1QGED 1IVYA 2BKXA 5TQ0A 1DC4A 4IHJF 3U3DA 1M8FA 1JXAA 1FF9A 1ZJ5A 4MROA 1YQUA 2PN1A 1TX4B 1N3YA 2BEVB 2GN2A 3UT5A 1U0BB 2WJZB 1WBDA 4KE9A 2VVTA 3H1PA 2A9JA 5JSQA 2A9KA 2PWZA 1WB5A 5EXTA 3ZX4A 1O95A 1GQFA 1T1SA 4OFXA 2FEWB 3CCBA 4R9SA 5KTTA 2C77A 3EDYA 1PX2A 3X1KA 3SC6A 2FQXA 4QOIA 4HNAB 3M1AA 4RF3A 1F8GA 3HXOA 1J6UA 4Q3LA 3AIOA 4UXIA 2EGUA 2OD2A 4MW9A 1PW5A 4Q00A 5ILOA 4I50A 1JVBA 1EESA 2QY9A 3G0OA 1TYDE 1KJ9A 2AG8A 2X0NA 3K1JA 2Y1DA 2P75A 4FYHA 5KVSA 4ZVKA 3ABQB 1AD2A 1NUAA 4IH9A 4KO4S 1V5FA 2GCIA 3OH8A 3OMXA 2FQ1A 1SCUA 2OWEA 3F7MA 1HYHA 3TOCA 1V2HE 1JEEA 1XD9A 2YV1A 4GVPA 4H7HA 4RFVA 4XX1A 4X1YA 1DARA 2XT0A 4WH0A 3MBOA 5J2UF 4OG2A 4UFOA 1RSZA 3DZ8A 3EIXA 3QBTA 3S5UA 4AMVA 1QZ3A 4BL5A 1GGHA 4N9QA 1H69A 2HT1A 4UBLA 1Z6ZA 1W85A 3ONVA 3VPDA 3EEBA 4ESHA 2H5IA 4C7BA 3OT5A 3EVAA 2CNDA 1Y8CA 3KEOA 1Q7RA 2JLRA 4ARUA 3LT2A 2PX6A 2E85A 3ZBQA 4GYWA 1GIAA 5ALUA 8ATCA 2PZAA 4E5PA 2JCXA 3IPLA 2Q6KA 4WDRA 3AHGA 4L74A 1T3GA 2CUZA 1NW4A 1HURA 2Q1WA 3IDQA 1MV5A 1ZEMA 2BW0A 3HGQA 3MYYA 1SA0A 1ZY2A 2G9ZA 1FMTA 2RIRA 4GC9A 2OGUA 3OPYA 5CPBA 4J3NA 2J1LA 4Q1AA 5TR9A 4ACBA 4LN1A 3FGNA 3MCZA 3RU7A 4WJLA 5I5EA 1U31A 1XJWA 4DLWA 1XAJA 5FWAA 2XUOA 3JU3A 4WLVA 3KL2A 5DO9A 4E2XA 5EJ2A 1Y3HA 4B4UA 2OO7A 3EMDA 1JIVA 4BEVA 4QBHA 1IWOA 5LQJA 1CUAA 3WLJA 4V3BA 5EGSA 2O2EA 721PA 1XTTA 1OX6A 2R7AA 3L7YA 3PCXA 1EEXB 2C5FA 2WA1A 3OKAA 4EVRA 1LLFA 2E2WA 4J0JA 4KRYA 1NDUA 1CQIA 3EARA 4PWZA 2E18A 3L4KA 4B4WA 3EDCA 4A2CA 1IBRA 4LOAA 1WHTA 1DCTA 1DWPA 4F96A 3RS5A 3G17A 3PDCA 3C8ZA 1S1MA 4Q3CA 3PUXA 1UK8A 3QZUA 2HEGA 3IOEA 4UFPA 1H0KA 1L5FA 2DAPA 1TEVA 1JEJA 3W5IA 3F6SA 3KKLA 2IV3A 1ISIA 5AW8A 1BSVA 2AI1A 2PANA 1T1JA 3UPTA 3BWYA 3ZLBA 4MRSA 3U4QA 4WXEA 2GJKA 2IWHA 5A5DA 2A0FA 5KNDD 4LYYA 3ITKA 3FCOA 4GUAA 5I7AA 4D26A 2RC6A 4FZ5A 3CY6A 1WUJS 1ZGHA 3X44A 1LNQA 4PS1A 1JDJA 3AIMA 3KZKA 4NKRA 4R7ZA 4IOJA 1ZD2P 4IXNA 4LXHA 1Y1QA 5B1SA 4CFSA 3NVKI 1QR6A 3I5YA 2J9ZB 3TCNA 1Q92A 2EZ4A 3L4BA 1PJQA 4AG6A 1VBKA 3IHTA 1W75A 2VJQA 3A9TA 2EP8A 1H8EA 3KYBA 3Q5EA 5JQGA 4CMEC 2J0SA 3ORRA 4DC1A 4WNYA 2OAQ1 2V7BA 3OT1B 4Q7EA 1GL6A 4L27A 1HDGO 2L69A 4BN5A 3W1VA 3THYB 3R7SA 2PGJA 3RVQA 4DPLA 1H2HA 4UU1A 4N3AA 1BCRA 3GEBA 4XVCA 3SNKA 3HH8A 1X8JA 1MTOA 1U7XA 3OZDA 3W4IA 3WY9A 4JEUA 3WWOA 4MRAA 4N5MA 1V5WA 4P36A 1GZ4A 3E4CA 1MT3A 1V2GA 4IFBA 3AEKB 5TV2A 2WWWA 1U9IC 4BYGA 2Z2ZA 3S4YA 4OQPA 1FS6A 3TIGA 2JFYA 3PQ6A 4LYEA 3HJCA 1GFIA 3ADKA 1GZDA 2QN6A 3ESAA 2WIDA 4HYEA 2K4MA 2YIVX 5LZ7A 2A9PA 1XZJA 2IZ0A 4QJ5A 2YYZA 5IULC 5IJ0A 4CTJA 3QVJA 3T9AA 4CGYA 5EHZA 3TI9A 5IMSA 2QW1A 1E66A 4KH0A 2BI4A 2XQJA 4BQEA 4R1PA 3BIFA 4W5QA 2ADMA 2HB6A 2PL5A 2A2ZA 4CF5A 4CV3A 5FI0B 1L4FA 2Q6TA 4OHOA 3R3ZA 1YQXA 4BO4A 1HFJA 2C7QA 3AM1A 4DMUB 2FCRA 1D5WA 1UZLA 2CHFA 4RL6A 2C3UA 3G8BA 4X1IA 3DV9A 3H84A 2BFAA 2IW3A 1B93A 4GM1A 1KSFX 1RWOA 4MKFA 3TZBA 4D0SA 4JI8B 4QFBA 1NJ6A 4Y2GA 5HX7A 3DMRA 1AE1A 4XAQA 3D7LA 4OEHA 2B34A 4D9MA 4RTOA 3IRVA 1Q77A 4NS1A 1FFWA 2M6LA 2NXEA 1YJCA 1YVPA 1PGOA 3L8DA 5DXFA 3H16A 2FPIB 2AD5A 4Q7MB 2I2WA 4ZJUA 5BR8B 4D9FA 1Z7GA 2IOFK 1S01A 4LZWA 4G9EA 4G0UA 1XF9A 5B64A 2AE1A 2IU6A 4UAGA 3TSOA 4CKEB 3PHGA 3L79A 4UASA 4K6FA 1N6IA 5E7JA 3GVCA 3U4AA 4C0AC 4ADSG 4JI6B 1URPA 2WG2A 3RJ5A 4L50A 1QHNA 4ZVQA 5FWXB 3TD2A 4IIFA 4B35A 4D9CA 4DRXA 4TT3A 4ZMSA 4YYEA 3FHTA 1IN6A 2DKOA 4PLFA 2RGYA 4J0FA 1V96A 3QWAA 1PJ8A 2PPLA 4YFVA 2FCAA 2EEZA 4HEA6 2YV5A 1QBKC 3DE3X 1U3GA 3BAZA 4NBKA 2V98A 1JKFA 1SUPA 3KDAA 1N5RA 3ESBA 2VLIA 1E6CA 4JC4A 3GCZA 4QUIA 4YH1A 4EG6A 2BMJA 2QJTA 3K0AB 4ITVA 3RJZA 5IWAB 4WUVA 5E6RB 4DCNA 2YQ4A 4UPDA 4DA7A 2WU3A 4LDQA 1NRJB 2W6OA 4LJ8A 4YRDA 1CHNA 1T4CA 3HYLA 4FS8A 2GETA 2IHYA 4AWXA 3E9ZA 5EP3A 1J42A 2HYDA 2CNWA 2EEPA 1DADA 2X2FA 2FUNB 2C94A 2QE6A 2XBUA 3LS2A 5LIRA 4KQEA 4O4HA 3SIPA 3L8GA 4YCLA 1J9GA 3A4VA 4Q18A 1BMTA 1VXOA 4GSYA 4GX0A 5B57C 3I34X 1J07A 2ZGVA 3AH8A 2RJOA 1L5KA 2CCGA 3ETEA 3LCUA 4EECA 3G9UA 1KYTA 3J7TA 1NX9A 4FONA 3ZVMA 1NTOA 3FOWA 3HUEA 1DUIA 2K87A 5G02A 2AX4A 2V1XA 3PTAA 2HDHA 2G5GX 2QTNA 2AOTB 3NAZA 4YJ3F 5E3JA 2IPNA 3U1VA 4MQFB 2AXQA 1S3GA 4MNTA 3HCRA 4O4JF 4KQIA 2ZUFA 2MHCA 3QU4A 1KJNA 2ISSD 1E79A 3GZNA 4OYYA 1ZIPA 3H0CA 3ORFA 3JYOA 1WUHS 1O4VA 3CZAA 5LZ4A 4I1PA 2PZBA 4HWGA 4F3CA 5LP6B 4OK6A 1KO1A 2V0NA 1NXOA 1QTQA 2IPXA 2XD4A 3TLGB 4AYXA 1C9DB 3MYRA 2XYPA 4P4UA 4O4LF 2PNFA 4HZUB 2EKZA 3WMWA 2FPMA 2CV1A 3AU9A 1JLKA 3S68A 1V6SA 2XWJI 4PZ9A 4RVGA 4RDIA 4XUGB 3E23A 2YUTA 3B51X 5IUNC 2C03A 3L1IA 4TVKA 4AURA 2WFLA 4HV4A 1E5XA 2O8EA 3WHKA 2VKQA 5HE8A 1OBVA 4ZCTA 1W0KD 2CL0X 1QGAA 2QYOA 2ROQA 1KYZA 2XCLA 1RI2A 1V48A 1Z07A 4WMLA 1VMAA 1N7GA 3MJCA 3WIVA 5CYFA 1WWKA 2GN4A 2O1XA 1DVRA 2J7PA 2BKAA 2XYHA 4G65A 4HH1A 4PR3A 1ZCBA 2Q7XA 4TLLB 1KAEA 2C1EA 3OZWA 4UHJA 5HBGA 2PUDA 3P0IA 4BLWA 5JCOC 4WZBB 1EB9A 2CT8A 1J56A 2RGAA 3S5JA 5JAZA 1SWWA 3HEMA 4C4ZA 1YASA 1GSOA 3UKDA 1WXQA 3LP5A 4CKBB 5IG2A 1DKNA 4RTQA 3SDZA 2N42A 1V3QE 1TFRA 2XUIA 5CUQA 2Y1GA 4B74A 2XNSA 1YR2A 4ROSA 4W6QA 4RY8A 1OW3B 2YWHA 4X1KA 5MF6A 4LGVA 1GM5A 4UEQA 1HYGA 1JP7A 2OECA 2DHQA 3F5MA 1RXCA 4JYCA 3D2CA 5JPIA 4Z9XA 2VC2B 3VXKA 4DLRA 1U28C 1UBNA 2FUKA 1RYYA 4ZANA 5J2TA 3K5PA 1ZMTA 4LKOA 1G8AA 3DQPA 2BCJQ 2RGGA 3K0FB 1VSUA 1D4FA 4DMCA 4WK0B 1ZRHA 2Q1YA 4G3XA 2YRXA 3KTOA 1Z2PX 1AUVA 2VT6A 4HQKA 4N7MA 4J8PA 5BMVF 1I24A 2PUCA 3I76A 4GI2A 4QRIA 3ISTA 4XYLA 1LPMA 4WN9B 5BSRA 2VI5A 3IDSA 4GDMA 1ZNYA 3OEYA 4RESA 4LDRA 3WK4A 2R6HA 2CZCA 3RIYA 1NAIA 2Q27A 1F7UA 4V39A 1QH0A 2NP7A 3FBGA 4G26A 4D4JA 3D6VA 2OK7A 3L7LA 3A1NA 1ECJA 3NLLA 4IFTA 4ND4A 1P1BA 2EQ5A 1L0BA 5EKTA 3PFCA 3VV3A 4YMHA 2O2YA 2D54A 4UUOA 3L93A 4B7ZA 2HK6A 3ANXA 1J2YA 3FPBA 3THOA 5LP1A 4B3HA 2ZJ6A 1JWAB 5DHSA 2ZLBA 4RGVA 2P4SA 1CUUA 1NVVQ 2HGZA 2QX6A 4FI3F 1J1UA 2H8KA 2QTCA 1MBZA 3C8UA 3GH3A 3TR0A 5JXIA 1AK2A 3PEYA 4QUEA 3G23A 1PI3A 4RZIA 3WDSA 1OU4A 1GCAA 1WIWA 4OHKA 1YZKA 5CP8A 3DZHA 2H29A 3KQVA 1B15A 1M67A 1N5IA 1A82A 1FLDA 3NUQA 3PDIA 3OPYB 2D5CA 3SQNA 5LQDA 1ZESA 2ZE7A 1WMSA 1XRPA 1DT5A 2WV7A 3C70A 1PL6A 4GQBA 1QFZA 4PINA 4YJFA 3JQ8B 5IPFA 2R65A 3ZE0B 5FHRA 4MYTA 5JCOA 3JVVA 4BMZA 1WY5A 3A27A 3I01M 3DLAA 3HMKA 1J09A 2G8LA 2JDIA 2XH8A 5JC8A 4JBNA 3OF2A 2FQQA 4RLHA 4QEDA 1XLTC 4UTPA 4LX0A 2YXEA 3W2GA 1U4NA 3U7QB 3K9WA 1F7VA 4C7KA 1L7RA 3RU3A 5B37A 3K8YA 4EIWA 3MMNA 1Q21A 4MUMA 3KL4A 1SUDA 1E4EA 1NG9A 4PX2A 2BHNA 3GDGA 1JA9A 1LQTA 2GJ4A 4OIFA 3H4VA 3SKVA 2JASA 4C5BA 2B20A 3IA2A 2DG2A 5CXXA 3VNAA 4N0PA 5KJEA 2WHXA 3RSOA 2FN4A 1BHJA 1LB1B 2MIIA 3MGGA 4BNXA 1GGFA 3B9RA 5EJ5A 1IC6A 1W48A 3KAQA 3PGKA 4TKMA 4YJGB 4BMOB 3BSYA 1T5SA 1WVGA 3IT2A 4Q4AB 4QUKA 1QONA 2UVPB 3ZE7A 3QLTA 1ENZA 1YQTA 2BC9A 3O8DA 1L8LA 3IHKA 5EERA 4B31A 3V6LA 1EP1B 2O5VA 2HLPA 3FDJA 3WLEA 5JAOA 2QMUA 1XNGA 3PX3A 5EMLA 1ZCZA 4DA6A 5HR5A 4R2KA 5ALLA 3SBEA 1WETA 3HMQA 4D25A 3Q7TA 1JJIA 1ZINA 2CLEB 3A14A 3QUAA 4BFCA 3K8QA 4HB0A 3B78A 1N0WA 4FQ7A 2P79A 4XIJA 3CQ9A 2XAAA 4KXUA 1UJ6A 1PSZA 1UKYA 2WYVA 1JDZA 1YJQA 4P4NA 1IN5A 1RRFA 5P21A 3KB2A 4RVFA 2PYIA 5K20A 3ZN2A 4PHFA 5K3EA 3TJRA 2QTZA 1Z0ZA 3IBSA 1VL8A 1KJ8A 4QVGA 3SYKA 2JZOA 3DMTC 2PLFA 1N34B 3WGGA 3U1BA 4WACA 2VZLA 2GASA 4DIMA 2YHUA 2G82A 3TLAA 3QEMB 3K9CA 1HMYA 2X19A 1OREA 4RIFA 4I4TF 3UMJA 4YCCA 1W0KA 5D7NA 4NZNA 3T06B 3CG0A 3P94A 1E0AA 1P74A 2FG6C 4IY1A 5HDBB 2EGGA 3GJRA 1G9TA 2OO3A 3C14C 1E63A 3ENQA 5EGNA 1ULZA 1WX1A 2ECFA 2H2AA 2V74B 3VMMA 4D3DA 4Q24A 3BE4A 2ZVJA 3K6RA 4X8HA 1LRKA 4X44A 2FEKA 2Y6VA 1YR9A 4B7UA 3M82A 1YJXA 1BU5A 1FU7A 1KK0A 3V4VB 2WSLA 3GYBA 3I4CA 3HK2A 1VJDA 3CIOA 3IB3A 4IDNA 4IRMA 1XMOB 3IYLW 4MCJA 2RI0A 4DCGA 4H6VA 1O57A 1SMKA 4WVFA 1U9JA 1UK7A 4KN9S 5LZ2A 4DR1B 2PAFA 1P1CA 3HY6A 5TEWA 1V9SA 3VDQA 1H2ZA 2VSNA 3SC3A 1LVGA 4A82A 2LVBA 3CPJB 5TPWB 4AJLA 3FMFA 3OPXA 4K88A 5ILGA 2QYTA 3LKVA 2QRNA 3FX2A 1OXKB 5HHTA 1XYVA 3C1OA 3Q85A 4WCFC 5BWOA 5FR1A 2O3QA 4GKBA 3BB3A 4NNPA 1QC5A 5I9NA 2E48A 4XGKA 3WDLA 5IKEA 4GR9A 1NMEA 4QA9A 1YJAA 3LCCA 2DULA 5ALXA 3FZNA 5SY6A 1AO3A 5DI3B 4JQOA 5IBRA 1JJAA 2WKQA 4J07A 3EXIB 4QDJA 3LC0A 2DPLA 2W6PA 4PZLA 2ZSAA 2XUJA 5ED4A 4NCHA 1UP4A 3WOVA 2OC9A 4RIHA 3K6KA 3BIJA 5SZIA 3S3TA 5T7BA 1ONSA 3MOIA 1DO2A 1IHPA 1IBKB 1N6OA 1FL9A 2QRMA 4XM0A 4PIMA 3ELUA 2WTBA 4D4HA 4HDQB 1JU9A 1J0DA 4L73A 4HADA 2BI8A 5JQWA 1B1CA 4RY0A 2ZANA