1CX1A

Second n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, 22 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
b'ASLDSEVELLPHTSFAESLGPWSLYGTSEPVFADGRMCVDLPGGQGNPWDAGLVYNGVPVGEGESYVLSFTASATPDMPVRVLVGEGGGAYRTAFEQGSAPLTGEPATREYAFTSNLTFPPDGDAPGQVAFHLGKAGAYEFCISQVSLTTSAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE C
publication title Structure and binding specificity of the second N-terminal cellulose-binding domain from Cellulomonas fimi endoglucanase C.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1cx1A00
2WO3A 2WQ8A 4A44A 1JHJA 3PUHA 3W5MA 1UY3A 3WNPA 2QQOA 4A41A 4DEQA 2XOMA 2LS6A 1SDDB 4D0QA 1CIYA 1PMHX 1EUUA 2Y64A 3K4AA 2VOTA 2L9LA 4BK4A 2ZEXA 2HLEA 4PQQA 3ETPA 3LPFA 3MV01 1JYXA 3OEAA 3SKJE 2WO2A 4RN5A 1NAEA 2J1SA 4MO3M 2WAOA 1KEXA 2VMCA 2QQJA 2V72A 2ZXQA 3NJXA 3VD4A 3ZM8A 3DECA 5F7UA 4CU9A 1MPXA 1JYWA 1K45A 3I3DA 2W1SA 4JX0A 4E8DA 5I0DA 2QBXA 5DPNA 3VD5A 2VQUA 1UYZA 5B4NA 3DYOA 3LEIA 2VC9A 5G05L 1NKGA 3LPGA 1F4AA 2VZUA 5JUVA 3P6BA 3MV11 4JKMA 2VO5A 4QB6A 5DQ0A 4CUCA 4IUGA 2VZ3A 3HJRA 1W9WA 5IFPA 4KI5M 2B9VA 4BXSV 3ACFA 3I2KA 2W92A 5IYYA 3IAPA 3WF2A 3FN9A 4QDQA 2R7EB 1RYYA 3WEZA 1GOGA 2J7MA 3IIIA 2VZQA 1WCQA 3WNNA 1UY1A 1ULOA 1XC6A 2VZOA 3WQBA 4QDRA 1ULPA 4GWIA 5FUIA 5JXGA 3K46A 5IHRA 2RV9A 3A23A 3WF4A 4CU8A 2W94A 3I97A 3LQCA 1CX1A 1BHGA 1JZ6A 2W87A 3CDZB 1JU4A 2WBKA 1UX7A 1YQ2A 2Z4FA 3JXSA 3IDAA 3VDCA 3E1F1 2BGOA 4DXSA 4QB2A 3OB8A 1US3A 1W0NA 2J1TA 3EB7A 3I2GA 3BGAA 1UY0A 4AG4A 1OF4A 5EJ1B 2Y6JA 3MUY1 5HXMA 2QQMA 3NNGA 1SHWB 1OF3A 1SG3A 4CU6A 3F2ZA 4BK5A 3WNMA 2JKXA 2ZEZA 3K4DA 2OKXA 1IQDC 1UXZA 1JZ4A 1DYOA 2E31A 4JKLA 4OMDA 3T09A 4P02B 3LEKA 1UZ0A 1GOFA 4W8JA 3WNLA 4OUEA 2BERA 3NRUA 5C7GA 1O59A 4UI9L 1JU3A 4CUAA 4XZUG 1JZ2A 2V4VA 1J83A 4MOAA 3CIHA 4P00B 3SEEA 4QAWA 3I2JA 2W1QA 4OYUA 4QB1A 2WN3A 4DEVA 3VD7A 1XNTA 2W9XA 4LQRA 2JDAA 2BBAA 4QX3A 3FL7A 4BJ0A 1TG7A 1W99A 5JXIA 2HYXA 3I3BA 3AC0A 2E26A 2Y6GA 4GWJA 2EIEA 4QPWA 1H6XA 5LA1A 3WNKA 3K77A 4DXTA 3OGRA 1K42A 4KWUA 4L0PA 2XHNA 2WO1A 4CU7A 2VMEA 4XVHA 3CKHA 3HNMA 2YG0A 5LA0A 1US2A 2W95A 1JZ8A 1P8JA 5A1AA 2Y6KA 3K4ZA 3T2QA 3C7OA 4QDSA 3SKVA 4ARXA 1UMHA 3I3EA 2VZPA 2W5FA 4CVUA 1UYYA 4XUTA 1H6YA 1CZSA 1DLCA 5HPOA 4XUOA 1JZ5A 2J1EA 2PQSA 1O8SA 4A45A 3MO4A 2W3JA 3A21A 2JD9A 1UXXX 2CDOA 5JMOA 3HOBA 1L7QA 2WAAA 4P08A 2RVAA 2WN2A 3DYPA 1JZ7A 3P1IA 1CZTA 3GXUA 3NJVA 5J1XA 3C7HA 1WKYA 2VCAA 2DDUA 3ABZA 3T2PA 4PT6A 2X10A 1DP0A 2ORZA 3FHAA 1UWWA 4A6OA 4DUVA 4ZZ8A 4UAPA 2ZEYA 5JR2A 3T0DA 4HG6B 3BN6A 3PUIA 1KGYA 3MBWA 3OBAA 2DCJA 3GM8A 2C9KA 2Y6HA 3IB3A 3NQHA 2BZDA 2ZEWA 2Y6LA 4MGQA 4AAXA 4DUXA 4A42A 1O8PA 3UNPA 2W47A 4D8MA 1JI6A 5C70A 2J1UA 2J1AA 1I5PA 3VD9A 3CMGA 2W1WA 1UY4A 2W91A 3LE0A 3A7QA 4JKKA 2DCKA 2ID4A 3HEIA 3CQOA 1F4HA 4TXWA 3VDAA 2EIBA 4W50A 1GMMA 1L7RA 3IAQA 1XNAA 3C7GA 1J84A 5DN2A 4DXRA 4XURA 3I2HA 1UY2A 2C4XA 3W5NA 4TTGA 1R64A 1W9SA 3CZJA 1GU3A 3OG2A 4DUWA 2E33A 2JE8A 2CDPA 2QQKA 1W8OA 2YB7A 3SEPA 5EJZB 2YFZA 3ECQA 3DYMA 2VQTA 3WF0A 5CZKA 3LEGA 4MGSA 4QX2A 2C26A 1T2XA 2W46A 2J1RA 5IFTA 3HN3A 4XUNA 4ET7A 3THCA 5JXHA 3C7EA 1TVGA 3EYPA 3OEBA 2X05A 3C8XA 3VD3A 2ORXA 1NX9A 5G04L 1EUTA 1CZVA 2EIDA 1GNYA 2VM9A 5DMYA 3GGLA 2VTFA 4W4ZA 1JZ3A 4E8CA 4JHZA 3WSOA 2KD7A 1PMJX 3THDA 3UESA 4ZZ5A 4KMQA 1UYXA 2VMDA 1PX4A 4A4AA 5CYYA 4LHSA 4CUBA 4XUPA 1GUIA 1D7PM 1UMIA 2QQNA 3ACIA 1PX3A 5JXJA 1JYVA 3A22A 1OH4A 2VCCA 2J1VA 4ZY9A 4OZOA 5LCWL 4YPJA 2YFUA 4GZ9A 1GOHA 2WYSA 5LA2A 4QX0A 3I2FA 4LPLA 2VZVA 3ACHA 1K3IA 4M4RA 2X09A 3WF3A 2WZEA 3VDBA 2WABA 1LNSA 3HNBM 3WNOA 3FHQA 2V5DA 4A3ZA 5EIYB 3MUZ1 4P5YA 1NUKA 3UETA 4M4PA 2VZTA 2VMFA 3HPNA 2BGPA 2LW8A 1OD3A 4ARYA 4ZXEA 4LKSA 2YC2A 2XONA 2EICA 3J7HA 3T08A 1W9TA 2VZRA 4PF1A 3WF1A 2E32A 2J22A 4Z2AA 3C7FA 2VZSA 1W8NA 1XPWA 2VCBA 2VR4A 3OGSA 2VJXA 4QX1A 2QQIA 3T0AA 2WZ8A 2W1UA 5IJRA 2Y8KA 4XUQA 4OMCA 3U37A 2YC4A 1JYNA 4UOJA 4MADA 4BDVB 3OGVA 4RYDA 2WDBA 3K75B 3T2OA 4FI9A 2RJ2A 3CZUA 1K12A 2B4KA 1OT5A 3I2IA 3HNYM 5C71A 3T0BA 1GQPA 2WUHA 2XQXA 3D3AA 2QQLA 5B4XA 2VZ1A 2VL4A 3GDBA 1HN1A 3ACGA
chains in the Genus database with same CATH superfamily
4LBOA 5JWPA 4A44A 1UY3A 4A41A 1VRBA 1MS0A 1RUJ2 4I0AA 4D0QA 1WZXA 4CCMA 1DIWA 3ILFA 5APAA 1AR63 3FUOA 2GMMA 2DVFA 2VBBA 3DF0A 3CNAA 4PIZA 2YROA 3TB0A 2VNVA 2L9LA 2QCSB 1W8FA 1ALYA 2HLEA 1V9U2 3H0OA 4PQQA 3WD5A 1Z0HA 1DYKA 1OOPB 3POYA 1JYXA 4YW4A 3PIJA 2WO2A 2I2SA 4RGKA 2OUHA 4RN5A 1W6NA 2J1SA 4L97A 2FDKA 4P9JA 2WAOA 1KEXA 4NHLA 4A3XA 5BUVA 1VB2A 1W6QA 2ZXQA 5BNQA 3VD4A 5LRSA 4B1LA 1MACA 1V6KA 1C57A 3ES1A 1K45A 1TMF1 2W1SA 5C9AA 4FP2A 1IPKA 4OHZA 4FFGA 1RMU2 2DUPA 5F6LB 4CE8A 1TQ5A 5KHIA 4CCNA 5KXBA 2FBEA 3AX4A 4I3PA 4RA0A 2R063 4NHKA 1HQWA 3LEIA 2VC9A 2YBKA 3KVBA 5JUVA 2VZUA 3HBKA 2RS13 3P6BA 2XKOA 1LB2A 5FPXA 3M70A 4AI3A 5DQ0A 4D7TA 3AP4A 1FNYA 3HAGA 3PU3A 1MS1A 1BBT2 4JRAA 1W0PA 5IFPA 4MXVA 4CCJA 4KI5M 4D6QA 4HMZA 4LKEA 3V56A 4CEYC 5I8YA 4K40A 1PVC1 1DHKB 4X6QB 2ETEA 2Q5TA 2YMZA 2WS93 3FN9A 2ILMA 4QDQA 5FKCA 3ZDSA 3KQ4B 4FBFA 1RYYA 3ZXEA 4DQAA 1GOGA 1DQ1A 3WNNA 2AREA 2I07B 2QQVA 5FY8A 5FYBA 1Z7S2 2ARCA 4AI9A 2ZHNA 2HWD2 1NLSA 2VZOA 1C1LA 5FUIA 3Q8BA 4LIUA 4E2GA 1QJX1 1FI2A 1NYWA 1RUH3 4CDUB 3GCXA 1GFF2 5IW0A 4HKLA 3S5AA 2W94A 3I97A 1QEXA 3LQCA 4BQ2A 1O3QA 1DZRA 3AJZA 4FOVA 4JGZA 2QFEA 2W87A 3CDZB 1YLLA 4GH4C 2GNMA 4IEZA 5A3UA 3CLPA 2WR9A 4FFIA 4FSJA 5DUWA 5FZLA 3LCPA 2JG8B 4DXSA 1SLTA 2RMU1 4QGMA 5L9BA 4A6SA 4HVQA 2Z69A 1ODMA 1LTEA 5FP3A 1US3A 2J1TA 3EB7A 1PVXA 1ASJ2 1UY0A 4O9GA 5C5UA 1QJEA 3LA7A 2Y6JA 3LDBA 3R0RA 3NV4A 2QQMA 3NNGA 4XQ4A 5EJ1B 1RUC1 5A3NA 5FZKA 1ULDA 2QUOA 4QPGC 3OPZA 5FZFA 3ATGA 2VVDA 3AZWA 4Q4W2 1L3JA 5FZDA 2Q8DA 1NZIA 1OKQA 4I3GA 3MLKA 1AR82 4RSUA 1O3TA 1LGBA 3R4SA 1GR3A 1UPIA 3GJAA 4CDQB 5CISA 4XIOA 2JWPA 3PUAA 2HEWF 4JV4A 4LBQD 1BK1A 4LJHA 2RS52 1MEC3 4P02B 4PI0A 3NNLA 3U07A 4BQWA 1K5JA 1UZ0A 2WQZC 2BQPA 3H9AA 4P9YA 2WFF2 2R49A 1SLAA 1NA1C 3AYDA 1CESA 3S30A 1AL23 3WR0A 2RDNA 1C8M2 3H7YA 3NRUA 3VZNA 3ZXAC 3ZXJA 1GV9A 4NIAA 1VPHA 4CUAA 1GYKA 1X36A 3RDIA 2Z79A 1J3QA 3IDCB 1YQCA 1HB1A 2XL7A 4CDXC 3RZLA 4YGCA 4DMIA 4NRMA 2DVGA 2P5BA 3NSTA 3B5LB 3POIA 1WCKA 3QH6A 3IZOA 4M0NA 1J83A 1QDOA 2AENA 2IC1A 2RS33 1CGPA 4P00B 4QAWA 5FBZA 2BU9A 5FXWA 3KSCA 2R072 3RNSA 4D6RA 5CADA 5FP7A 4QT6A 1WLCA 1FPN1 1SBFA 2D6KA 2OVUA 3NV1A 1Q8QA 2AEZA 2JDAA 2ZMKA 4QM8A 4RHV2 3FL7A 1IHMA 2A75A 3I3BA 1OLRA 4QXKA 4YG6A 5FRAA 4R9AA 1AXZA 2Y6FA 2QZ2A 1XQNA 5FP9A 3BOPA 4HONA 3S7IA 1CAWA 2DCZA 4Z2WA 1J59A 3N36A 1ND3A 2RM21 4QPIC 3RFRA 3NV2A 4FPEA 4X6RB 1H8TB 2VD7A 5LA1A 4ES8A 2WSVA 5FV3A 3WDYA 4CEYA 4DXTA 1RVF3 4K1ZA 5GALA 2HWF2 1Y9MA 4IEOA 2G9ZA 3KGLA 5CA6A 4CU7A 5DAPA 1OURA 4KWKA 3WUCA 3KD4A 1RUF3 1SZBA 4FTEA 3AXEA 4CP9A 4FPYA 1QNWA 2PLV2 2YC0A 4A7YA 2XJPA 2Y33A 5DDJ3 3JBG2 3K4ZA 1RUE3 4AFBA 1GP5A 1ZZ6A 2JIJA 2ZGOA 4G4FA 3I8TA 3MFCA 1AXKA 4WVMB 5FYUA 3I3EA 5FWJA 2VZPA 3T4HB 2ARBA 1CAXA 4UFIA 1AYM1 2UYBA 4R9CA 4FPJA 3HQRA 4F7ZA 1AHSA 5HPOA 4BXFA 5FYSA 5BNOA 1BYHA 1U12A 1WW7A 2PHUA 4XUOA 3AZYA 1RUJ3 1QOSA 2J1EA 5FP8A 5FR3A 4A7ZA 1XJAA 2PQSA 4CCDA 4Y20A 2GN3A 3VBUC 3HBZA 5K4LA 3KF3A 3OBZA 1D4M2 5I0SA 4ZPIA 1V6LA 2CDOA 2PAEA 1YWKA 2XMLA 4Y33A 5EQUA 4XF1A 4U2AA 2NM1A 4EN6B 1VBE2 2GNTA 1J1LA 1STMA 2D3PA 4BCUA 1V9U3 2PHTA 2Y26A 4QPGA 3VGIA 1S0EA 3NAPC 4RL7A 2IXKA 1MQTC 4CEWC 1RUI1 1AZDA 1GNZA 1LGCA 2ZOEB 4Q26A 2DBNA 3D4KA 2GC2A 3A0KA 1FOD3 1S2BA 1W6NB 1UU4A 4WV8A 2PXJA 5JPNB 3ILNA 1W6QB 3AMQA 3T2PA 4Q4V2 4QKDA 3THTA 4DS0A 1RUOA 1IS4A 2A6ZA 1DP0A 2ZGRA 4OHYA 2ORZA 1RMU3 1NA1A 4R52A 5A1FA 1QOOA 4QU1A 4DUVA 2GN7A 2ZGUA 4AEDA 3DPRC 2FQPA 4XJAA 2WWSA 5A7OA 1ZA7A 4QMAA 3LKJA 1W2TA 3OBTA 5JOXA 2I45A 1JXNA 4BQ4A 4P9GA 5EXOA 1QF3A 4BQ3A 3T0DA 1BBT3 1LGNA 1YC61 5F6KA 4CDXA 1Y3TA 5FPBA 4MZUA 3K2OA 3BN6A 4JGYC 3V0AA 1A8DA 3PUIA 1AR71 1TNRA 1KGYA 3GM8A 2C9KA 4NIIA 5K0UB 3POGA 5T3NA 4CA9A 4FVVA 3SH5A 1JW6A 3W20A 5LK5A 3F95A 3MW3A 4IEVA 2Y6LA 1R083 3RS6A 4YVWB 3QBQA 1Z7S3 5CKMA 5CKQA 3T1LA 1BEV1 1HLCA 1KFXL 2HWD3 1LECA 2VW0A 3G6JB 3FE5A 1XE0A 4GMP3 3VBOA 3O1PA 1E5SA 2ZCWA 5IVJA 1F31A 2W47A 1ODNA 4QPYA 3WVJA 5BNNB 4D8MA 3NWKA 3POWA 2KA3A 4YYOA 4QPIA 2Q4SA 1CPNA 1J3PA 1YXWA 1H2MA 2WIIB 2JDNA 4D69A 3JCIA 4V2WA 4JGZB 1H9WA 5FBJA 3Q8FA 2QKDA 4YZ1A 5KWRA 1JYTA 2W91A 3BALA 1FAYA 3A7QA 3J9SA 3OJBA 2ID4A 3KWVA 1F5FA 2ATFA 4Q0PA 5T5JA 3WDUA 3N9LA 5L9VA 2EIBA 4Q0QA 1O3SA 1NCRA 1GMMA 3S6PA 1OOPC 4IEQA 2D6MA 5FMOL 5LBBA 2YGLA 2HEVF 4YVSA 1JYCA 1XB9A 1SCSA 2WNEA 2HWE3 1CAUA 3L2HA 3N7KA 5FWEA 3GZUC 1PGW2 5DN2A 4DXRA 5C33A 4IV1A 2Q8CA 5HV0A 4E4DX 1O4TA 1G9CA 1UY2A 3J8F1 3KT4A 3LFIA 1R1A2 3FX3A 4QQPA 2C4XA 3AVSA 3L9JT 4WBBA 1GU3A 1LULA 3OG2A 4DUWA 1VBA2 5KXCA 2CWSA 3VDDA 2E33A 1FV2A 1BQPA 4IERA 2RS53 1UNBA 3BTYA 2PFWA 4I0WB 3I59B 4WVZA 2MEV2 2WFF3 1AUYA 4EN9B 3WF0A 3VBUA 1A34A 1NZCA 2VNOA 2D40A 5CZKA 4UFKA 5FYVA 1OFNA 3SH3A 4LOSA 1T2XA 2X8KA 1RUD1 4P9LA 1QXJA 2VGDA 3WP6A 2EVXA 5IFTA 3CBNA 1POV3 2RHPA 4UBHA 4OI4A 4CYDA 5JXHA 1TVGA 4KG0A 5IWFA 1MQTA 3U4SA 1EAH2 3OEBA 3VD3A 4CEWA 1XYNA 2H6BA 2XJQA 2UWAA 4KQ7A 1YHFA 4YZ3A 5G04L 1EUTA 1CZVA 2AC1A 2E9QA 3FBYA 4M3CE 1ZBE3 5D21A 2NYYA 1PK6C 4XDPA 1JZ3A 1POV0 2HWB2 2R073 2WFPA 4FOYA 2ZBJA 3AKPA 4DY3A 1E5IA 4XF0A 1XE7A 1O3RA 3N7MA 4GD4A 4CDUC 4DXZA 2VMDA 4RHV3 1GZ9A 1VBD2 5CG9A 4LHSA 1GUIA 3JU9A 3D0JA 2OX0A 1D2QA 3MEPA 4MGIE 4NE9A 4AVVA 4AW7A 3H8XA 1W05A 1W8ZA 1MZ6A 1PX3A 3ZFEA 1HRI3 5JXJA 5FYZA 3A22A 2Y38A 1OH4A 1VRH3 2ZGMA 1AR93 5KR7A 4OZOA 1UKRA 2JG8C 1HKDA 1OLMA 1XNCA 4LE3A 4UWDA 3RI9A 1CAWB 1OA3A 1ND3B 1UKGA 5IAXA 2WYSA 4IW3A 3A4UA 3ZN4A 2V09A 2R041 3JD72 5F2WA 4DIQA 1IKPA 4YZ2A 1RHI3 1QIQA 2VZVA 1QJY1 2BNMA 4XJUA 2Z2SB 1JUIA 4LUMA 5JCTA 4FPOB 4YM2A 3AKRA 2AH2A 2WZEA 1HB3A 2PLV3 3VHPA 4BMEA 2WABA 1LNSA 1H2NA 1X8MA 2ET7A 3HNBM 3WNOA 3JBG3 4BZ4A 2EXJA 4CDQC 3SMHA 1DZQA 3LF7A 3P3NA 1OLME 3ELNA 3UETA 2VW2A 1G7YA 3OPWA 1ENSA 4LO6B 5C3OA 1LOCA 4PLMA 4GWNA 5CU1A 2TEPA 1XSQA 1NCQB 4XMIA 5FZ8A 3B01A 1AR81 1YFWA 2XONA 3TNPB 4LBQB 5H9SA 4Y1XA 4LKFA 1W9TA 1KFUL 1XXNA 2GZWA 4MGKE 2AEYA 4PF1A 2BRTA 2SBAA 2J22A 4MH0E 3WCSA 4FPFA 5BNOB 3NO8A 4C0HA 1ZRCA 3WG3A 1OMIA 3RPQA 1D4M3 1OOPA 4QU2A 4AI2A 3HIFA 2VNGA 3E6DA 3WLUA 4F3JA 4QM9A 2LUWA 4Y20B 4INDA 1GBGA 3IWZA 4AI1A 5C3PA 3KQRA 5KHKA 2NP0A 3VKOA 1C8M1 1H2KA 2JXAA 4I30A 3IPVB 1S4CA 3R05A 1NOVA 3ORJA 2ZKNA 1YO8A 4QX1A 1BMV2 2QQIA 4KBZA 1BVVA 2IWGB 5F5IA 2PQQA 2XLAA 1SLLA 2KXLA 4JRLA 4Y5TA 4BM8A 3AM2A 2D3SA 5IJRA 5FOBB 1N3PA 2Q1MA 5CAZA 2VOXA 3ENRA 1HB4A 2DF7A 1YRZA 4Q4V3 2HH9A 4ITCA 4RD7A 1H1IA 3RYRA 3OBRA 4RYDA 2WDBA 4AVBA 1C5IA 2IFRA 2VH9A 3T2OA 4UT5A 1YCIA 3OGJA 4CCKA 5IUQA 2RJ2A 1ENXA 4P9XA 1OT5A 4AEDB 4FTBA 3HNYM 4AQ6A 4XF9A 2GP3A 4Y1YA 4CCOA 4EWDA 4KGGA 1PGL2 1RUG1 2WUHA 4LBJA 3D3AA 3OYWA 4NR1A 4AK3A 4BQ5A 3LIGA 4AQTA 2VUDA 3T08A 3GDBA 3GYDA 4C91A 2VBDA 4JC1A 1JHJA 3Q9OA 3WNPA 3V0AB 2QQOA 4DEQA 2XBO1 1XNDA 1PK6A 3E6BA 2JB4A 3H8RA 2XJRA 3WG4A 5FZEA 1CIYA 4QHBA 2X53S 3E5QA 4HN1A 1EY2A 3MI8A 3NJYA 4TLGA 3ZIWA 3Q8CA 2GP5A 2OZ6A 3KT1A 4UXAA 4CDUA 4BU2A 3QLQA 1IKQA 2BNNA 3WZ1A 2Y0IA 2WWUA 2ZEXA 2GC1A 1OQDA 1RUH2 3LPFA 3RGBA 1PO22 2BYVE 2W08A 1CJPA 3OEAA 3SH4A 3SKJE 3IKWA 3N7LA 3VBOB 5JSOA 3ON7A 5ANQA 1DF0A 4H3WA 2B7YA 3NJXA 2V72A 3AZZA 1FNZA 2WJSA 2KR2A 2WZR1 3OPTA 3MLJA 3PMEA 4WZCA 2ZKLA 1MPXA 4XXAA 2CU5A 3NV3A 3USUB 4B4RA 1SPPA 1V70A 4CRQA 3I3DA 4HXCA 4E8DA 3LD8A 3ZVXA 5BYNA 3O1VA 2D93A 2IVJA 1Y43B 3VBRC 5B4NA 1VBC1 3PVNA 5JMCA 5J37A 5JIAA 4KH9A 3AFKA 1IOAA 1NXMA 1VMFA 3MV11 1NCRB 4NPLA 1YNAA 5A3OA 4XMAA 3KHBA 1GP4A 4BQYA 4IUGA 3BI3A 1QQP1 5F32A 3DCQA 4Y22A 1W9WA 4YVSB 1S0CA 4OFGA 3AP5A 2VE1A 4DB5A 4YM3A 4M0HA 1JS9A 4CUGA 3CJIB 5F3GA 1VBE1 2B9VA 1NXD1 2PAMA 3HQXA 2B9UA 2IVIB 4IV1B 4S2FA 3THPA 4A7KA 5LY1A 4Y5Z0 4QXCA 3IAPA 4UFLA 3WF2A 4FOWA 3WG1A 1OD5A 2F4LA 1COV2 2J7MA 2MEV3 3VDDB 1M06G 1E5RA 5A3LA 5EHDA 4Q8KA 3CL1A 3WP4A 1UY1A 3PLQA 4M3CB 4QQ2A 5GZCA 2D5FA 3N3HA 3FUQA 4GWIA 4Z07A 3K46A 3VKLA 2FMDA 5SV8A 1EV11 3RMXA 5EZWA 4CU8A 5EV7A 1QJZA 1OUXA 4FT8A 3ZDVA 5CIRA 3MYXA 3MPBA 1CX1A 1UOFA 5I93A 5K0UC 2K2SA 4JDMA 1EAH3 2AGSA 2WBKA 1UX7A 3EJKA 4HT1T 4NIDA 2Z4FA 1KDKA 3BIWE 1OI6A 3R6SA 1YI9A 2JENA 1CWPA 3JXSA 4GA9A 4EJRA 3KMHA 3UL2A 1G9AA 5IK5A 4FPGA 4QB2A 3OB8A 4Y1UA 4YVWC 4HPKB 2HWB3 3H8UA 4KWLA 5LRRA 4DRVA 4YZ4A 5KBFA 2VQ0A 5JSPA 2OXBA 4Q0SA 1OF4A 5BNNC 4FPKA 1VMHA 5FZ7A 2WSUA 1VBD3 2JE9A 1SHWB 1VR3A 2VMGA 3F2ZA 3VUOA 3ZYGA 4BK5A 4E2QA 1SEFA 3WNMA 3H3LA 2ZEZA 4JGZC 4MGYE 3MLLA 1IQDC 1UXZA 5FO9B 3ZFEB 3B93A 4B7KA 3SCGA 4XC9A 3O7OA 1OLQA 2E31A 2R30A 4AGRA 3T09A 2BJSA 1KD7A 2F17A 4HN0A 4W65A 2BNOA 5FUPA 5GLZA 2XJUA 4AQ2A 1XNBA 4GWMA 1QHDA 3JD73 2O14A 3KV4A 3U14A 5GZDA 2GMPA 2XUMA 3M3QA 4AFDA 1CD3G 1Q8VA 5E1RA 3ZPOA 2J42A 1HB2A 4UI9L 4YG0A 2JDHA 4CP1A 5FUNA 2Q1FA 2H0BA 3AYAA 5D8AA 1UPSA 3AMHA 5GZGA 4D7SA 4CCCA 2WQ4A 1PNFA 3CIHA 5FZ0A 4MGZE 5A7WB 5AFEA 2D97A 1E5HA 4N9HA 1SACA 3I2JA 2QZ3A 2GNBA 2CY6A 1V6IA 2V73A 2WN3A 3ASIA 2G19A 1D4VB 4TSVA 4RFT0 4DEVA 5JI9A 1X50A 1XNTA 2W9XA 4BH9A 5JLVA 3MF9A 1VBA1 5LASA 2ZACA 4AE2A 2MHFA 2BBAA 3DN7A 4QX3A 3VBRA 4BJ0A 1JOJA 1TG7A 1W99A 5J36A 2ZZQA 3AC0A 5JXIA 4XFAA 3ZSEA 4AVAA 2FD8A 1CR7A 4MGTA 1NE6A 2Y6GA 4GWJA 3ZYPA 4IGPA 1XNKA 3V0BB 1QJU2 3PVOA 3JZVA 4HBNA 5A7NA 3CEWA 3OCPA 3BU0A 4N53B 5LBCA 2ADDA 1QWRA 1HRV1 2ERFA 2VQAA 4IQPA 4YNIA 3WNKA 5KHGA 4HVRA 5ISLA 3J7LA 3JQXA 3PMSA 1K42A 1FOD2 4KWUA 4TN7A 5FZOA 1DQ6A 4L8QA 3TWIA 2GDFA 1PZ9A 1JOPA 3IBMA 4FP3A 2XWJB 1U5YA 5CNAA 4XVHA 3K48A 4LHNA 2E51A 3O12A 5KC5A 3POBA 4KG8A 3IMNA 3LA2A 2W95A 1WW6A 5T5PA 4PI2A 4XHBA 1SMVA 1OQ1A 1P8JA 3CO2A 4XAEA 2YBSA 3OD4A 3AFGA 1MZFA 5L7OA 1G9DA 4QQLA 1V6OA 2C5DA 3C7OA 5C3RA 4XHXA 1ND3C 4QDSA 3SKVA 3ZFFB 4ARXA 5LEJA 1ZNPA 3WDTA 2JKBA 2W5FA 4QWNA 5K0UA 4HSLA 3EXUA 1S2EA 4AHXA 1CZSA 2GC3A 5FCCA 1DLCA 1MVEA 3OYWB 3ZR6A 4A2UA 1MZEA 4AR2A 4NHMA 1PO13 3OD0A 4YVWA 2ZAHA 1JZ5A 2EXIA 2EALA 3NW4A 4A45A 2XJTA 2ZGQA 1YQ8A 3M3IA 1GZCA 3MO4A 1R082 2XGXA 3ETQA 3J26N 5H9PA 5A33A 4YM0A 1PK6B 1YJLA 4MSVA 1QY4A 2JD9A 2JG9B 3SC7X 5FQ0A 2QTWB 5BNNA 4KNCA 3BODA 4GB31 4XW3A 3WQ7A 2XR4A 5E89A 1HJGA 4N43B 1L7QA 2WAAA 3DL3A 5HCHA 1PO23 2LROA 1HX6A 1NCQC 3SISA 5IVVA 1CZTA 4YM1A 4MYEA 3RZZA 3RQ0A 4AFCA 1ZVFA 3BKZA 3NJVA 5J1XA 2DVDA 3C7HA 1D2SA 3ABZA 4KL1A 1W6MA 5JOZA 5BNOC 1QH7A 3MGUA 4UW3A 5BV6A 1KQRA 4FQ4A 1GANA 1Q56A 1BLZA 1SPPB 1QXPA 1PIV1 1W2UA 3UV9A 1UWWA 5ABJB 3RZJA 4LTAA 1TE1B 3B02A 3KCXA 2W0XA 2ZEYA 4ISQA 2HWE2 3NMBA 1PM7A 4Q1RA 4BA6A 1JODA 4NOTA 1AR61 4UW6A 1L7LA 2PA7A 4MLOA 3VBFB 3O1UA 3WDVA 4URTA 1W9FA 1E57A 4Y22B 1IG0A 3AL6A 4K8RB 3I59A 3MBWA 4Q4X2 4BHPA 1WLDA 2VUJA 4Q5OA 2TUNA 2BFUS 2Y6HA 2MPFA 5DZEA 1YIPA 3NQHA 2WT1A 5IK8A 1COV3 2ZEWA 5IVYA 3AK0A 3UGGA 3VKFC 5FZBA 1WMDA 1MS9A 4LMFA 4AAXA 1QKQA 1OPMA 4RGGA 4AEDC 4E9KA 3LSEA 4EZHA 4DUXA 5IVFA 4DY5A 3WCRA 4W6YA 2YV8A 4A42A 2BBVA 5A3TA 2K0GA 3PTRB 5FPAA 4RGAA 2R061 3UJOA 1DFQA 5FIXA 3BTXA 2RS11 2O0OA 3P3PA 1QOTA 2HBUA 2HWC2 3MIEA 2H6CA 4LIVA 3O1MA 3MIFA 1W2NA 2W1WA 1Q8SA 5FOJB 1IPJA 4OLLA 1ZBE2 3IT8A 5GZEA 2XVKA 4XOGA 3O1TA 4CPBD 3LE0A 5CBLA 4F8AA 1AL0G 3APBA 4TXWA 4XIKA 1IS3A 1ZRRA 2DCYA 3WW1A 4IEYA 3B69A 1KS5A 1L7RA 1GNHA 3IAQA 3O1SA 1XNAA 2WS91 3R4DB 3VBOC 4CDWC 5ACA2 3TAYA 5AC92 2D3RA 2DUQA 2DTWA 1HRI2 4ZS2A 3AKSA 5F3EA 5F5AA 1RUNA 1WA6X 5I8SA 1DYPA 1VRH2 4ZXKA 3W5NA 1AR92 4SLIA 4TTGA 3CZJA 3AMMA 3TRSB 5JPMB 2QQUA 4FQZA 2R0FA 5LZ6A 4X8PA 2HJIA 2CDPA 2QQKA 1W8OA 1FT9A 2YB7A 5I91A 5EJZB 3LAGA 4AVSA 3H1MA 3UGHA 1D0HA 1RHI2 3DYMA 1NCRC 2ZHLA 4RQPA 5A6XA 1TZOA 4XBNA 4P9WA 3LEGA 4TYSA 4QKNA 2YU1A 2C26A 3D0SA 5DZFA 2W46A 4YVSC 1W04A 3I2OA 1PZ8A 2R0HA 4LNVA 1SDWA 3CJIC 3HN3A 4IV1C 1UD1A 3FLRA 4Q29A 1MS4A 1H1MA 1NCQA 2PAKA 1KITA 3EYPA 3NNFA 1OH3A 4KBBA 5D8AB 2XWBB 4LBQA 3VDDC 4D7YA 5EFUA 5F2SA 4OI0A 5DMYA 4YGDA 3AMPA 4W4ZA 5CFDB 4E8CA 3RZKA 3D6EA 4COUA 1S55A 4IEWA 1WCSA 3ZOIA 4KMQA 5K8SA 1MEC1 1S0GA 3M8LA 3ZR5A 4B1MA 3W58A 4AI0A 4K3UA 4XUPA 1D7PM 4WVVA 1G8WA 2BWCA 3IPVA 3KHCA 3VBRB 1REEA 1UN1A 1GLHA 1AL21 1C4RA 1CQ9A 2WLQA 4UFMA 4IE5A 3RI8A 1UOGA 2C9AA 4NUBA 1QJU3 3VZOA 3OOXA 3S0MA 3H1YA 3PL0A 5LCWL 4Q4Y2 1Q43A 1NG0A 2DFCA 3AP7A 3SCFA 4ZKTB 1JTZX 2XG3A 4XE9A 2RDQA 3B9CA 1KDMA 5E8AA 4DPNA 5FZ9A 2AZ5A 5LA2A 1W03A 4HVOA 2ZGLA 4XDOA 2RS31 5FZOB 4BQ1A 5FP4A 5L9RA 4D3WA 3VKNA 2FDJA 4XAAA 4FCAA 4IDZA 2RJLA 1UZZA 1NY71 3IMMA 4N9IA 3WF3A 2JB8A 1LHWA 3VDBA 1YIFA 3HWJA 3MW4A 1XU1A 5A7QA 4BE3A 4AHWA 3ZFEC 1ND2B 1ZM1A 5FZ4A 1TME3 3MUZ1 4Y4YA 4CTEA 4P5HA 1NUKA 5FZMA 1W8UA 4EN0A 1UIKA 2PELA 1WD3A 5IATA 1MS8A 5L7OB 3HPNA 2BGPA 1OKOA 2LW8A 3N35A 3WY6A 4AYUA 4FPCA 4KU7A 1OD3A 3UT0A 1UZWA 4O9EA 1W06A 3KM5A 3NL1A 4NN0A 4FXKB 1PGSA 2EICA 4KU8A 3J7HA 1FMD2 3M1HA 1RXFA 3FC0A 4COYA 4NIGA 5BNPC 4AHZA 1RVF1 4Z2AA 2VW1A 4XCAA 4LA2A 2D6NA 3UK9A 2VZSA 1HXS2 2CTVA 4MHUA 1W8NA 5DUXA 4CDWA 3ZYBA 5A33B 2RDSA 4PHZA 1LEDA 1N1SA 2JECA 3GALA 1LOAA 4ZONA 2QQWA 5FQ0B 1RUF1 2XHKA 3ACLA 3GF6A 3AB0A 3USUA 4UFJA 3GBGA 4S2DA 3VHRA 4EZ4A 1YUDA 3AL5A 3HR9A 1V6NA 4FOQA 5DDJ1 1S0BA 5D1IA 1RUE1 2WZ8A 1ZBA2 2IXCA 3WINE 4AI8A 3GHNA 5J48A 5E16A 1LJ7A 2ZTNA 4K1YA 1U0AA 3QD6A 1KS4A 4IE4A 3OSDA 1JYNA 3LDRA 1CIWA 4I2OA 1IGOA 1W6MB 4JVAA 2ZGNA 5AVAA 1O7FA 3WDWA 2Y34A 4AF9A 4HFSA 1RUJ1 3ZSMA 4R8HA 3CZUA 3M7AA 4N53C 1K12A 3VHOA 2B4KA 3IN9A 4AFMA 5GM0A 2WT0A 1SLBA 1RL3A 2K46A 3CJIA 4LHKA 2OZJA 2P3IA 4KGQA 3ZSJA 5LK7B 1RGSA 1B35B 5FPUA 2ZMLA 1O4ZA 3PUQA 4R4XA 4Z92B 2VVFA 2VL4A 2YYOA 3MHZA 1V9U1 4XETA 3ACGA 4AHYA 1R093 5ERLA 5C5TA 3PUHA 4Q4X3 3INAA 2XH6A 1XBFA 2I74A 4BISA 2LS6A 1SDDB 2Y0OA 3GCWA 5DG1A 3LA3A 4M3CA 4R4ZA 1APNA 1VE0A 4CZSA 1EUUA 3AYCA 1FOD1 2VBPA 4NPMA 3VL9A 2Y64A 1GQHA 3EHKA 4ZU7A 1XSRA 2VOTA 1SBDA 3KV5A 1VBB2 2D5HA 3X29B 4OHXA 3ZFFC 2BVVA 3E6CC 2V4AA 1RMU1 4PBPA 4L9BA 5FZCA 5HCAA 3RZHA 2ZABA 5DAQA 4COVA 2UWCA 1OQEA 1SCRA 2VMCA 2QQJA 4ONUA 3ZM8A 3WV6A 3DECA 5F7UA 3O0WA 4ATEA 4CU9A 2Q8OA 1S0IA 2CGOA 2HWC3 4HPKA 4DFSA 3PHMA 4BQXA 1BBT1 1JYWA 3ZMOA 4G9SB 2QBXA 3K3OA 1VALA 2JG9C 4K9SA 5FZAA 3VBHA 4AAPA 3WHUA 4ASMB 3B94A 4OVEA 4L92A 3DYOA 1S0JA 4N43C 5G05L 5J96B 5IK7A 2XVLA 1AXYA 1EPZA 2BVBA 4XABA 5ACA3 4CUCA 5AC93 4LK6A 1N3QA 1R081 4LEJA 3HJRA 1TMF2 1Z7S1 2YDEA 1RTVA 1OPOA 1W8WA 2DVBA 2HWD1 2JIGA 4GMP1 3TN93 1W6PA 4NO4A 2HBTA 1W39A 3BTAA 3PIGA 5A1LA 5FO7B 3J4UH 1XYPA 4LBLA 2K9ZA 2W92A 4K7JA 2PHRA 2ARAA 1HV1A 1W8HA 5A3PA 4COZA 5ABJC 4LUKA 1H8VA 3WEZA 3U75A 2OA2A 3IIIA 1F9KA 2VZQA 1WCQA 2JDMA 4QXBA 5FXXA 3VZLA 5BNPA 3KGZA 1ONAA 4YARA 1ULOA 3I54A 3QH7A 2PTMA 3WQBA 3ZSLA 4QDRA 1ULPA 4FO9A 3GBFA 3GHMA 4RQPB 3ZYJB 5IHRA 3A23A 3LWCA 3VBFC 2ZX0A 2FHRA 1PVC2 2F6BA 3TNQA 4J25A 1F15A 1YJKA 5FMOS 1ASJ1 5A7WA 2Z42A 1LU1A 1BHGA 1HW5A 3FWEA 1JZ6A 4XF3A 3VHNA 3RYKA 2A3YA 5A70A 2RE9A 3ALQA 2P4EA 4JCKA 4Q4W1 3E1F1 3NJZA 2BGOA 1OVPA 4N7IA 1UYPA 3M3CA 4IV3A 3PU8A 1F8VA 2O8QA 2EIGA 1A3KA 3VB9A 4OUMA 2RS51 4HZFA 2FCUA 4CCLA 3EMRA 5HXMA 2JDPA 2PHXA 3O5SA 1DU3D 1N1YA 1OF3A 1SG3A 1WBLA 2WNUC 1Q5OA 4PDWA 2WFF1 3WOGA 4CU6A 1VAKA 4N53A 4UYBA 5JI7A 4AFAA 1ZRFA 1C5HA 2CYFA 3QCWA 2RDRA 5FAXA 2WA3A 2RMU2 1X7NA 1ZYBA 5FXZA 2D7FA 5LWBA 4HSJA 1OC1A 1JZ4A 4Q4Y3 1VBC3 2UU8A 5T54A 4JKLA 2VXRA 3ZYIB 1FV3A 3ZXDA 3KZ4C 3E97A 1RUC2 4W8JA 5GZFA 4OUEA 5T50A 4GAZA 2YU2A 2BERA 2WL1A 3BU7A 3PURA 1ZBE1 1GSLA 1O59A 1S1AA 2AYHA 2DU1A 2P6CA 2VNRA 3JUUA 4NJ4A 1UU6A 2R071 5A6ZA 3BOWA 4XCBA 3U10A 1G9FA 2VMIA 1JBCA 4PCRA 3ZFFA 1RJ8A 2YGMA 4XZUG 2BW8A 1CAVB 4RHV1 5FY9A 2A6VA 3ZXFA 5DZGA 3B3QE 2V4VA 3LIHA 2OS2A 1V00A 5TSWA 4XZPA 1N1TA 1BVP1 1HRI1 3S57A 5A3MA 3GZTB 5A3WA 4XBLA 2W1QA 2PHDA 4QB1A 2RR13 3K51A 3LDKA 5DAVA 1PO12 3VD7A 1FMD3 2KM2A 2JG9A 3OY8A 2DVAA 1RJ7A 3U11A 2O8OA 2HWF1 4YZ5A 5IT6A 1U5IA 3ES4A 2HYXA 4N43A 1X82A 2E26A 1CN1A 1HXS3 3PTYA 1MS5A 3CJXA 4W6WA 4H14A 5C8CB 3EQEA 5BY5A 2EIEA 4EE2A 4U36A 5FYYA 2X5IB 4BIOA 5SV5A 4OI2A 4MUVA 5D8AC 1WBFA 3BPSA 4CDWB 2BEOA 4FPHA 1FPN2 1OXCA 2PLV1 4IL7A 3MDPA 1QU0A 2XLFA 5CFDC 1OSGA 3JBG1 3OGRA 3TEZA 1YFXA 1ZBA3 4LK7A 4L0PA 3HN1A 4IXLA 2C6SA 1WW5A 2XUEA 1UOJA 2UYAA 2XJVA 3N9QA 4Q8LA 5ABJA 2VMEA 1N1VA 3FJSA 2JEMA 3V65A 3HQUA 3MIDA 4RR3B 1Y7BA 3CKHA 1AYN3 4LO8A 3DEMA 2YG0A 5LA0A 2RM22 5DAXA 5J7MA 5DUVA 4YW6A 1US2A 1ZZ9A 4BLJA 2XL9A 4O65A 5L19A 5A1AA 2Y6KA 1RINA 3VBFA 3T2QA 2ZGPA 1LOGA 1I9RA 1D4M1 2AACA 1TNFA 3NNJA 3MZHA 2CSGA 5FPVA 4JQRA 4CVUA 1UYYA 4XUTA 3VV1A 1H6YA 3ZYHA 5HBAA 3URFA 4MXWA 4W6XA 2GH2A 4IEXA 5DXDA 5C7GA 4N90A 1YQ5A 1O8SA 3T4VA 2BOJA 1OBNA 3AZXA 3HT2A 1CPMA 4LITA 4XYXA 3VLBB 4HANA 1ND2C 1WGPA 5A7SA 4S2GA 3FBMA 4Q4V1 2Q8EA 5C8WA 1VBB3 2QDRA 2WNUA 4FFFA 5JMOA 2E6VA 1AYM2 5L7OC 2ZA9A 1H2LA 4P08A 3SQOA 1A8MA 3ZXKA 2RVAA 2WN2A 3AKQA 1DZTA 1W8TA 1WUVA 2DWRA 3ILRA 2UY8A 4IE6A 4YW5A 3U78A 1EYBA 1CJDA 2VXJA 3MW2A 5F3CA 2VOWA 4BOWA 2D44A 2VCAA 5FREA 3PJQA 3O0VA 3VBSB 2C24A 3MF6A 5CB7A 1CONA 4WZFA 1Y9QA 2D98A 5FDBA 2ZJCA 4A6OA 4LO7A 1RUI2 2OT7A 3EO6A 4ZZ8A 4MG2A 5C4WA 3VBHB 3UJQA 1HRV3 5F3IA 1CVNA 4Y1ZA 3T1MA 4NHYA 4YFZA 4TZDA 1FX5A 4LXLA 5HCFA 1GQGA 5JR2A 1RIRA 5DAWA 5JOYA 3U0ZA 3V64A 1YQ6A 5JZGB 5DABA 5F37A 5LEKA 1POQA 3V0BA 1TMF3 4OI1A 4I09A 1ZX5A 3W9AA 4FAGA 4XTMA 1XE8A 2GNDA 1DGWX 1GICA 1NE4A 3HT1A 2FMYA 4NWVA 1W6PB 4DINB 5FXVA 3VKMA 3IB3A 3AP6A 1YI7A 1N47A 2BZDA 3ZN6B 3RMYA 4QGNA 4MGQA 5IVBA 1RB8G 2FZ2A 3RZGA 4Z1VA 4L2NA 2ET1A 1PM4A 2VECA 1AR72 5BNPB 1W9YA 1O8PA 4E4SA 4QHZA 1B35C 3JB8A 1VLNA 4JHTA 1DQ4A 1PVC3 1M4WA 5C70A 2XDVA 2J1AA 4Q27A 3KV6A 4LE4A 1I5PA 4L99A 3VD9A 1Q8OA 3PNAA 5CFDA 1PGW1 2YPDA 2BP6A 4GKXA 1YYNA 4GJYA 1GZWA 2FDIA 4WM8B 4WM7A 4XJ8A 3MPPG 4JDOA 1R1A1 3CQOA 3HEIA 1F4HA 1QJX3 4UW5A 3UKTA 1V6JA 2ZGSA 3TBDA 2NZ9A 2A6WA 1V0AA 4IV3B 3NNMA 3ZXGA 1HDKA 3MFAA 1B09A 2MEV1 5FY1A 2BTVC 2ZPXA 4RS5B 3POEA 5FZGA 3JB4C 4ASLA 5F1RA 2A3WA 1I1EA 4XURA 2UY9A 3I2HA 5FYMA 1EPWA 5FJHA 2VUAA 5J3UA 4PDWB 3RG0A 2PYTA 2RMU3 1O5UA 4XFGA 1R64A 1W9SA 2HYKA 3IM0A 4HETA 5ANNA 1PIV3 2JE8A 2P3YA 3OGGA 2YFZA 2QVSB 5FKBA 1RUC3 1MR5A 1EAH1 4OUSA 4YSFA 2W68A 1D0GA 3C2UA 4CCEA 3KCYA 1YEWA 1LU2A 2QE3A 3CU7A 1UX6A 3J8F2 2HKXA 1UIJA 1UZVA 3EBRA 5A6YA 2EAAA 2B46X 1ND2A 1UAIA 2HWB1 5I8TA 3KT7A 4AVTA 1K5MB 1ULGA 2A5ZA 2AR6A 3MIGA 4ET7A 1TME2 2BFUL 2WKKA 1BK0A 3MIBA 5F5QA 4HK8A 3ZKUA 1VBD1 2X05A 3C8XA 2ORXA 2DYCA 3P5BA 1NX9A 4PLNA 1ZZ8A 2EIDA 2WZPP 1HQLA 1ENRA 1SLIA 5BXXA 4K21A 2P37A 1RUD2 4NRQA 2BWAA 3NVCA 3RVHA 2E53A 4G3YC 1ZRIA 5FLHA 1PMJX 3THDA 1NQDA 2WC2A 1NT0A 2P1BA 4RQPC 4ZZ5A 4K20A 3WXPA 5A80A 1PX4A 4A4AA 3AZVA 3OY8B 1Q3EA 4GXLA 2NPIA 3JD71 3DGTA 4CXYA 1H0BA 3ACIA 1OVSA 1JYVA 3DV8A 2G9GA 1GWKA 5CFCB 2IXHA 4QQHA 2J1VA 4ZY9A 3POSA 3ZO0B 4YPJA 4E27A 1FPN3 5L36A 3D5OA 1YFYA 5DG2A 4YWAA 5FLIA 1GOHA 4K8FA 5EPAA 1UW8A 4QX0A 3I2FA 3FLTA 3H8OA 1WW4A 2DCTA 5FFOC 3S5QA 3ZPYA 4GKYA 1S0DA 3N4MA 2YHJA 4LPLA 3ACHA 4M4RA 4ASKA 2PMWB 1DDLA 3ZFGB 2X09A 4C0BA 2RM23 1S0FA 4XEZA 3TEYA 4QX5A 4AEJA 5LA9A 3OUIA 1DGLA 2V5DA 1B35A 2B39A 2WT2A 5I0TA 4J6GA 2JJ6A 4QKBA 5T5LA 3J7MA 1VIWB 2VZTA 4HKWA 2R042 4M4PA 4LLFA 5T52A 5IVCA 4XJWA 3TEWA 2FDHA 1U5XA 5FYIA 4EN8B 2WO7A 1QJY2 1SQ4A 2OPKA 1R092 2VOVA 4XQWA 4ARYA 4ZHNA 4XFBA 4ZXEA 1ACCA 4UW4A 4LKSA 2YC2A 2ZX2A 5C3QA 4XJZA 3M4FA 1VB4A 3WF1A 3ZSKA 1BMV1 1NQJA 2YZ4A 4QGLA 5KXEA 1W3VA 4MXWB 2P34A 5FMDA 4BMBA 3OTFA 1H4GA 3BVCA 4EWEA 1RXGA 5IVEA 1ZREA 1ULEA 1UL9A 2VVEA 2VR4A 5L73A 4I01A 2VOKA 4OQ8A 1H1AA 1JH5A 3FHIB 1AYM3 2ADEA 5JSRA 3KV9A 5E6HA 4YGEA 3GJBA 4XFIA 2A3XA 2VJXA 2WNUB 5F39A 3FMGA 4NROA 3T0AA 5GLUA 1W2OA 1HJFA 3KB5A 1XYOA 2Y8KA 2BV4A 2PHLA 1PGL1 3HD8B 3U37A 1SLCA 1ZZBA 2YC4A 4D6SA 2JICA 3B9IA 1OFSA 1O6UA 1DQ2A 4IGOA 1O4YA 2LALA 4BDVB 5C8CC 5FZIA 2DV9A 5FMBA 2X5IC 3K75B 2WYFA 2ZS6B 5HI0A 1RUI3 2R16A 3FLPA 4FI9A 1PO11 2CGPA 5HV4A 2C0ZA 2JE7A 3ZIXA 3NKTA 1FYUA 3I2IA 5C4WB 3T0BA 3GNEA 1GQPA 4BLIA 3TN92 3ZMNA 5K9YA 1KRIA 3ZN5A 1VMJA 4PIXA 5GKAC 2CGNA 1HN1A 3LPGA 4E4HA 1AX1A 2DU0A 1RUH1 2WO3A 2WQ8A 4PJYA 1PO21 3ZKYA 3W5MA 4RR3C 3UKVA 2CNAA 2FDGA 5FPZA 4XTPA 1OHFA 2XOMA 3H3ZA 3USSA 4Q0VA 3G7DA 3N9NA 4C1WA 2FDFA 5KHHA 1PMHX 3J7NA 1ULFA 3D8CA 5IAVA 1QDCA 2BPA2 2WNOA 1O5LA 1RUG2 3K4AA 1V6MA 3C3VA 3BB6A 4XFFA 3I49A 5GLWA 4BK4A 5KC6A 1MZ5A 4YLZA 5B2GB 1AR73 3ETPA 2OQ7A 3MV01 3E5XA 1LEMA 3W59A 5AVPA 2XBO2 4LBKA 1NAEA 1VP6A 2IZWA 4MO3M 1X9PA 5GLVA 4DOUA 4M00A 3LB9A 2EA7A 4JAAA 3H3UA 3E5UA 3SITA 3AXDA 3PUSA 4JX0A 1BEV3 2OUJA 2SLIA 5C6CA 3TYJA 5I0DA 1GKBA 1HIXA 5DPNA 1QJFA 4MVTA 5FK8A 2QDNA 1LENA 2VQUA 3VD5A 1UYZA 4NIHA 2WLPA 5LB6A 3WHTA 1GZWB 4CXXA 3LOIA 2GAUA 4GALA 4WM7B 1NKGA 2RJKA 1F4AA 1JYIA 3PVBB 4TLFA 4QKFA 1W90A 5M0TA 3H7JA 4Y24A 4JKMA 2VTXJ 2VY0A 2WZR2 4P14A 4HK9A 5K7PA 2VO5A 1COV1 3N9OA 4QB6A 2F4PA 2YY1A 2VZ3A 3IDBB 3POFA 4MHRA 5HCBA 4IE0A 2UURA 2WNVC 3GZEA 4C8DA 3VBSC 4GH4A 2C1FA 5T5OA 1LHUA 4BXSV 1AF9A 5A6QA 4Z82A 1VBC2 3K3NA 3ACFA 3I2KA 3LSDA 4BWOA 3O1OA 5IYYA 2LRPA 3FZ3A 1KXGA 1Y4WA 1KJRA 2R7EB 4AOCA 2VUCA 3FFQA 5LATA 1WMXA 2XJSA 1WMFA 1LKNA 2OPWA 3VZMA 3U4XA 3VBHC 3HMYA 3BIEA 1QQP2 4XBQA 5T55A 1SBEA 4ORFA 5DUUA 1XC6A 4UBGA 3ZX7A 1PMIA 3J8F3 5JZGC 1H9PA 5JXGA 1CAVA 2A7AA 2RV9A 3FFZA 1CX4A 1XRUA 3OF1A 5EYYA 3WF4A 3WW2A 3LFMA 4XACA 1C8NA 5EP9A 1AJOA 2ZAAA 3H1WA 4OULA 1Z78A 2GC0A 2WINB 4I02A 3DKWA 4Z8BA 5KHJA 3AMNA 1JU4A 1FXZA 1YQ2A 3DKQA 5D2AA 2TNFA 1J1TA 3IDAA 4TWTA 5GLTA 3VDCA 2FCVA 1LOFC 1WA4A 4COWA 2RR12 3B7MA 3DUIA 4L11A 1RUD3 1QNYA 2OIIA 2ARXA 4AGVA 1EV12 1PHMA 3H42B 1W0NA 5C9AB 2B5HA 1JHNA 3I2GA 3BGAA 3MIHA 4QHOA 4ZS3A 5C8CA 2YBPA 3T2TA 4AG4A 5FPLA 2X5IA 3MUY1 5FY5A 2P3JA 1F35A 2G4IA 2QJVA 1HV0A 2EAKA 1REFA 4M01A 4Y3OA 3N7JA 2JKXA 3K4DA 2VAUA 2OKXA 3PJYA 4YW3A 2JDUA 3TOJA 4DRRA 4H2AA 1AX2A 4WM8C 5JAXA 1A6CA 3AYEA 2PHFA 1DYOA 2XXZA 4AQSA 3KCCA 4OMDA 4B3NA 2V5YA 3ZXLA 2YXSA 4IEUA 4CP0A 2XQRA 3LEKA 4QX8A 4RR3A 1BZWA 1GOFA 1DQ0A 3LEMA 3Q8AA 3I3MA 2NN8A 2QNKA 4IV3C 3WNLA 3WG2A 3BTZA 1RC6A 1AYN2 3QOPA 1LR5A 4OZXA 4RS5C 3RYPA 2G9FA 2A73B 3QACA 4DZGA 1JU3A 1LOEA 1DGRN 3ST7A 1DQ5A 4NWWA 4PDWC 4XILA 4ES9A 2Q0AA 3LZZA 1WLTA 2ZX1A 3Q8EA 2XB6C 4LT5A 4FXGB 1JZ2A 2R043 5JIUA 4GMP0 4MOAA 4S2HA 5LBEA 2ZHKA 4I0BA 4JZRA 1QJY3 4Y4RA 1UQXA 1X8EA 3SEEA 4Y1VA 4META 1QJU1 4OYUA 5JDBA 3ZYFA 2BDRA 2D6OX 4DO0A 2R6QA 4R9BA 4LQRA 4CSWA 1ASJ3 1K5MC 5CVRA 4Q1PA 4XDQA 1WMEA 4LR4A 1UZYA 4QXHA 4YW7A 2FCTA 2WA4A 2ZX4A 4QPWA 4QQOA 3AJYA 3T3YA 1H6XA 3BCWA 2B42B 4Q4W3 3WNXA 4XFCA 3WQ1A 4QX7A 1AR83 4ISRA 4NPRA 3WQ0A 2LTNA 2WNVA 3GBWA 4V1PA 5EWSA 3VBSA 3LOBA 3K77A 2P2KA 5H9QA 4B29A 5LBFA 4OHWA 1TME1 1BKZA 1H30A 2GU9A 4OCTA 4YW1A 2XHNA 2B8MA 3KF5A 1DCSA 2WO1A 2DBIA 5FYHA 1LHVA 1SFPA 4NVPA 4FFHA 3W21A 1W0OA 3HNMA 1C8M3 5C3SA 2DTYA 3M3EA 4O7XA 3DXTA 1JZ8A 5JZGA 1HRV2 4LORA 4Y5SA 2D6PA 3CHXA 5F8PA 1A78A 5CFCC 4ATFA 4URAA 2W52A 4B4QA 4JDNA 5CG8A 2R1DA 1XOYA 4AEKA 3NAPA 1JUHA 1UMHA 2W39A 3M2MA 5FK7A 2GH8A 5FZ6A 2AUYA 3I2DA 4R9DA 1MVQA 3ZN6A 1W6OA 4EN7B 3D82A 1UO9A 1XU2A 1LOFA 4AL9A 3WX5A 4XPVA 3SLIA 3N9PA 3ZFGC 1HN0A 4FAHA 4UF0A 5I0RA 5FYTA 4YG3A 5A32A 1NLQA 5FO8B 5LY2A 2W3JA 1NLRA 3A21A 4J1XA 3IIAA 3ME2A 4Q0UA 5AFBA 1UXXX 3DPRA 1RUG3 1WLWA 3WT3A 2WWJA 3KS7A 4ZU5A 3HOBA 1VJ2A 3DYPA 2XBO3 1JZ7A 1OA4A 5CKNA 4JGYA 3P1IA 3SHRA 3GXUA 1I6XA 2CHHA 2HWE1 4WM8A 3RJRA 2HWF3 4KWJA 1WKYA 2DDUA 2FZ1A 4NHXA 4CEYB 1ZZ7A 4PT6A 5JOWA 4GIQA 3SXWA 4GB32 4LKDA 4PLOA 4IESA 2X10A 2PHWA 1QJX2 4LA3A 4XF4A 1W3XA 4QD2A 3FHAA 4OQ9A 2A71A 4YW2A 1R091 3I3QA 4AVCA 4Q4X1 1AVBA 2O1QA 1I5ZA 4RS5A 4UAPA 4NAMA 1LOBA 2P6HA 4E4ZA 2HEYF 1DG6A 1YFUA 2WZR3 4CP9B 4CXWA 3SCHA 1IS6A 1GWMA 3BPZA 2JDZA 4MX3A 1DGRA 2VCMA 4HG6B 1UOBA 1AJKA 4IE7A 2BUKA 4NRPA 2NMNA 4PIYA 1ST8A 1IZ3A 4IETA 1PIV2 3OBAA 3RSJA 2DCJA 1WCDJ 2CAVA 1POV1 3RJ2X 5KXDA 4GH4B 2IFWA 4MV2A 2NLRA 2D6LX 1CAXB 1F5JA 3LGRA 1QXRA 4IEPA 2VPVA 2VULA 3SNMA 1C1FA 3S7EA 3VZKA 2HWC1 1QQP3 3L2YA 4BIFA 4CPBA 1AR62 1KJLA 1WD4A 1DLLA 4B8EA 2DUOA 1K5MA 2CAUA 3POJA 3UYJA 1JN2P 4LO5B 4B7EA 5C4WC 2GALA 1VBE3 3NKGA 5FZHA 1AX0A 5F5CA 1GWLA 3UNPA 3MICA 2NQYA 1IPSA 1G86A 3KVAA 3PVEA 2DFBA 3VZJA 4CP2A 2E63A 2CL2A 1UMZA 2J1UA 4QPGB 1BJQA 2W2IA 5ACA1 3M3OA 5AC91 1X9TA 3IDEA 4GULA 4XJ9A 3CMGA 1R1ZA 2Z5WA 1ULCA 1UY4A 4LHLA 5FYCA 4JKKA 2ENRA 1VRH1 2DCKA 2IXIA 3H50A 3TN91 3VDAA 1AR91 5I0UA 4NMIA 2XVGA 1UU5A 1TEIA 1WCUA 2YPJA 2P17A 2IXJA 4W50A 2R062 1EV13 2G1MA 4H7MA 4LLOA 1W28A 2OYZA 2OQ6A 1ZZCA 2B45X 2RS12 1J58A 1QH6A 1NA1B 4PQ9A 4Y26A 3O0XA 3C7GA 3ZLIA 1H4HA 3OUHA 5LW9A 1H8TC 4JTOA 2E7QA 5CFCA 4PF5A 3AKTA 1RHI1 2OW4A 1J84A 3R4UA 4EROA 3UKNA 2GMEA 5FY4A 4EYUA 1VAMA 4HOOA 4BYYA 1G6NA 2A1XA 5BPXA 5E88A 4CDXB 2XPJA 1G9BA 1N3OA 1UF2C 1T6GC 2WS92 4UFHA 2IXLA 3SEPA 4WM7C 4JTNA 1F2NA 1W2AX 3OUJA 3TEXA 3ECQA 3ZFGA 4EV0A 2VQTA 4O61A 1QGLA 5CEHA 4MGSA 4QX2A 1SFNA 2ZZJA 2XLGA 3T30A 2MNGA 1REDA 2J1RA 3I4IA 3WP3A 5GJ6A 2ZMNA 4LBNA 4XUNA 1LODA 3THCA 2VTXA 2JDKA 3C7EA 4EWAA 4GQ7A 4YRDA 2JG8A 2R1BA 5JR7B 4HKOA 2CWMA 2PN5A 2A6YA 3KLSA 1GNYA 4QPIB 4N7UA 2VM9A 4C90A 3GGLA 2VTFA 5EJ3A 2H0VA 2JX9A 4AZZA 3RRDA 4JHZA 4XXPA 1T6BX 2KD7A 2EXKA 1DGWA 4JQTA 4Q4Y1 3WSOA 2GSYA 1GZTA 1LHOA 3CF6E 1EP0A 4LOTA 3UESA 4AGGA 1OA2A 1UYXA 2EXHA 2LM3A 5FJKA 5CYYA 4CUBA 1FATA 4D94A 4LULA 1JOBA 2Q1ZB 1UMIA 1JMUB 2QQNA 4CDQA 3BYWA 3U1XA 2VCCA 3PDQA 1Y9GA 2XKPA 1CAUB 1SFYA 5A7PA 1R1A3 5H9RA 1C28A 1PNGA 2DURA 1J3RA 1ZRDA 1LESA 2YFUA 1VBA3 2WRAA 5FLJA 1MEC2 3JQWA 4OHVA 4YGBA 3VN4A 1IS5A 4GZ9A 3WW3A 4AWDA 2BOIA 4Q2FA 5C9AC 2WNVB 2R32A 3RZMA 4X8NA 5J09A 4ZU4A 1MS3A 2Q30A 4WVWA 5JVVA 1AL22 4AXOA 1QMJA 3WDXA 1K3IA 2D43A 5HXVA 3N9MA 4AEMA 2RR11 4V2VA 3VBUB 1RITA 5FZ3A 4NAOA 2E7AA 1FMD1 1WWYA 2P3KA 1LAJA 5IK4A 3FHQA 4A3ZA 4H55A 2EF6A 4H7LA 5FTTC 5FY7A 2ZX3A 4LO4B 4P5YA 5EIYB 2E7TA 1HXS1 1Q8PA 2VMFA 3HVDA 2RS32 5FZ1A 1I3HA 3NAPB 1ENQA 3BUCA 1ZA4A 1LHNA 1MQTB 4CEWB 2CV6A 1NY72 2ZHMA 3AVRA 4GJZA 2UWBA 2TBVA 2VZRA 3DXUA 5FY0A 2E32A 1UCXA 4XQDA 4PBOA 3RWNA 3C7FA 1W6OB 1ZBA1 4P9IA 2ZGTA 2JD4A 1PZ7A 4J1WA 4UF0B 3WW4A 3WP5A 5A32B 3RWKX 1XPWA 2VCBA 1HQNA 4E2SA 1H8TA 1IQAA 2IUWA 1AYN1 3O1RA 3DPRB 3OGSA 3VL8A 1OUSA 2NMOA 1DBNA 3I7DA 2A70A 2RG4A 4SBVA 3WUDA 1RVF2 3B00A 4F83A 4B4PA 4IGQA 4BPZA 4HL0A 2W1UA 2YUEA 4DNYA 4LBMA 2QQPA 4JGYB 4XUQA 3ROUA 4M3CF 3AP9A 2Y60A 4N8MA 4OMCA 5FMCA 1BEV2 5F9TA 2JDYA 4GB33 3A0NA 1GP6A 4UOJA 1S2KA 4XFHA 1X33A 4MADA 1LRHA 1RUF2 2VU9A 3OGVA 4EQVA 2VMHA 4RFRB 4K6BA 2BGCA 4YFWA 2ZGKA 3O14A 3UGFA 1U5ZA 2ES3A 5DDJ2 4WVMA 1C3HA 1IG3A 1RUE2 1O91A 1VAVA 5EYXA 2VG9A 2X29A 4BB3A 5C71A 4HLTA 1URXA 5J98B 1BCXA 1BXHA 2A6XA 2XQXA 3ITQA 3ZYRA 4C1XA 1LCLA 2QQLA 4FTSA 5B4XA 1VBB1 2VZ1A 4FPLA 1JI6A 3GZAA 2N7GA
chains in the Genus database with same CATH topology
2WO3A 2WQ8A 4A44A 1JHJA 3PUHA 3W5MA 1UY3A 3WNPA 2QQOA 4A41A 4DEQA 2XOMA 2LS6A 1SDDB 4D0QA 1CIYA 1PMHX 1EUUA 2Y64A 3K4AA 2VOTA 2L9LA 4BK4A 2ZEXA 2HLEA 4PQQA 3ETPA 3LPFA 3MV01 1JYXA 3OEAA 3SKJE 2WO2A 4RN5A 1NAEA 2J1SA 4MO3M 2WAOA 1KEXA 2VMCA 2QQJA 2V72A 2ZXQA 3NJXA 3VD4A 3ZM8A 3DECA 5F7UA 4CU9A 1MPXA 1JYWA 1K45A 3I3DA 2W1SA 4JX0A 4E8DA 5I0DA 2QBXA 5DPNA 3VD5A 2VQUA 1UYZA 5B4NA 3DYOA 3LEIA 2VC9A 5G05L 1NKGA 3LPGA 1F4AA 2VZUA 5JUVA 3P6BA 3MV11 4JKMA 2VO5A 4QB6A 5DQ0A 4CUCA 4IUGA 2VZ3A 3HJRA 1W9WA 5IFPA 4KI5M 2B9VA 4BXSV 3ACFA 3I2KA 2W92A 5IYYA 3IAPA 3WF2A 3FN9A 4QDQA 2R7EB 1RYYA 3WEZA 1GOGA 2J7MA 3IIIA 2VZQA 1WCQA 3WNNA 1UY1A 1ULOA 1XC6A 2VZOA 3WQBA 4QDRA 1ULPA 4GWIA 5FUIA 5JXGA 3K46A 5IHRA 2RV9A 3A23A 3WF4A 4CU8A 2W94A 3I97A 3LQCA 1CX1A 1BHGA 1JZ6A 2W87A 3CDZB 1JU4A 2WBKA 1UX7A 1YQ2A 2Z4FA 3JXSA 3IDAA 3VDCA 3E1F1 2BGOA 4DXSA 4QB2A 3OB8A 1US3A 1W0NA 2J1TA 3EB7A 3I2GA 3BGAA 1UY0A 4AG4A 1OF4A 5EJ1B 2Y6JA 3MUY1 5HXMA 2QQMA 3NNGA 1SHWB 1OF3A 1SG3A 4CU6A 3F2ZA 4BK5A 3WNMA 2JKXA 2ZEZA 3K4DA 2OKXA 1IQDC 1UXZA 1JZ4A 1DYOA 2E31A 4JKLA 4OMDA 3T09A 4P02B 3LEKA 1UZ0A 1GOFA 4W8JA 3WNLA 4OUEA 2BERA 3NRUA 5C7GA 1O59A 4UI9L 1JU3A 4CUAA 4XZUG 1JZ2A 2V4VA 1J83A 4MOAA 3CIHA 4P00B 3SEEA 4QAWA 3I2JA 2W1QA 4OYUA 4QB1A 2WN3A 4DEVA 3VD7A 1XNTA 2W9XA 4LQRA 2JDAA 2BBAA 4QX3A 3FL7A 4BJ0A 1TG7A 1W99A 5JXIA 2HYXA 3I3BA 3AC0A 2E26A 2Y6GA 4GWJA 2EIEA 4QPWA 1H6XA 5LA1A 3WNKA 3K77A 4DXTA 3OGRA 1K42A 4KWUA 4L0PA 2XHNA 2WO1A 4CU7A 2VMEA 4XVHA 3CKHA 3HNMA 2YG0A 5LA0A 1US2A 2W95A 1JZ8A 1P8JA 5A1AA 2Y6KA 3K4ZA 3T2QA 3C7OA 4QDSA 3SKVA 4ARXA 1UMHA 3I3EA 2VZPA 2W5FA 4CVUA 1UYYA 4XUTA 1H6YA 1CZSA 1DLCA 5HPOA 4XUOA 1JZ5A 2J1EA 2PQSA 1O8SA 4A45A 3MO4A 2W3JA 3A21A 2JD9A 1UXXX 2CDOA 5JMOA 3HOBA 1L7QA 2WAAA 4P08A 2RVAA 2WN2A 3DYPA 1JZ7A 3P1IA 1CZTA 3GXUA 3NJVA 5J1XA 3C7HA 1WKYA 2VCAA 2DDUA 3ABZA 3T2PA 4PT6A 2X10A 1DP0A 2ORZA 3FHAA 1UWWA 4A6OA 4DUVA 4ZZ8A 4UAPA 2ZEYA 5JR2A 3T0DA 4HG6B 3BN6A 3PUIA 1KGYA 3MBWA 3OBAA 2DCJA 3GM8A 2C9KA 2Y6HA 3IB3A 3NQHA 2BZDA 2ZEWA 2Y6LA 4MGQA 4AAXA 4DUXA 4A42A 1O8PA 3UNPA 2W47A 4D8MA 1JI6A 5C70A 2J1UA 2J1AA 1I5PA 3VD9A 3CMGA 2W1WA 1UY4A 2W91A 3LE0A 3A7QA 4JKKA 2DCKA 2ID4A 3HEIA 3CQOA 1F4HA 4TXWA 3VDAA 2EIBA 4W50A 1GMMA 1L7RA 3IAQA 1XNAA 3C7GA 1J84A 5DN2A 4DXRA 4XURA 3I2HA 1UY2A 2C4XA 3W5NA 4TTGA 1R64A 1W9SA 3CZJA 1GU3A 3OG2A 4DUWA 2E33A 2JE8A 2CDPA 2QQKA 1W8OA 2YB7A 3SEPA 5EJZB 2YFZA 3ECQA 3DYMA 2VQTA 3WF0A 5CZKA 3LEGA 4MGSA 4QX2A 2C26A 1T2XA 2W46A 2J1RA 5IFTA 3HN3A 4XUNA 4ET7A 3THCA 5JXHA 3C7EA 1TVGA 3EYPA 3OEBA 2X05A 3C8XA 3VD3A 2ORXA 1NX9A 5G04L 1EUTA 1CZVA 2EIDA 1GNYA 2VM9A 5DMYA 3GGLA 2VTFA 4W4ZA 1JZ3A 4E8CA 4JHZA 3WSOA 2KD7A 1PMJX 3THDA 3UESA 4ZZ5A 4KMQA 1UYXA 2VMDA 1PX4A 4A4AA 5CYYA 4LHSA 4CUBA 4XUPA 1GUIA 1D7PM 1UMIA 2QQNA 3ACIA 1PX3A 5JXJA 1JYVA 3A22A 1OH4A 2VCCA 2J1VA 4ZY9A 4OZOA 5LCWL 4YPJA 2YFUA 4GZ9A 1GOHA 2WYSA 5LA2A 4QX0A 3I2FA 4LPLA 2VZVA 3ACHA 1K3IA 4M4RA 2X09A 3WF3A 2WZEA 3VDBA 2WABA 1LNSA 3HNBM 3WNOA 3FHQA 2V5DA 4A3ZA 5EIYB 3MUZ1 4P5YA 1NUKA 3UETA 4M4PA 2VZTA 2VMFA 3HPNA 2BGPA 2LW8A 1OD3A 4ARYA 4ZXEA 4LKSA 2YC2A 2XONA 2EICA 3J7HA 3T08A 1W9TA 2VZRA 4PF1A 3WF1A 2E32A 2J22A 4Z2AA 3C7FA 2VZSA 1W8NA 1XPWA 2VCBA 2VR4A 3OGSA 2VJXA 4QX1A 2QQIA 3T0AA 2WZ8A 2W1UA 5IJRA 2Y8KA 4XUQA 4OMCA 3U37A 2YC4A 1JYNA 4UOJA 4MADA 4BDVB 3OGVA 4RYDA 2WDBA 3K75B 3T2OA 4FI9A 2RJ2A 3CZUA 1K12A 2B4KA 1OT5A 3I2IA 3HNYM 5C71A 3T0BA 1GQPA 2WUHA 2XQXA 3D3AA 2QQLA 5B4XA 2VZ1A 2VL4A 3GDBA 1HN1A 3ACGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO3 A;  2WQ8 A;  4A44 A;  1JHJ A;  3PUH A;  3W5M A;  1UY3 A;  3WNP A;  2QQO A;  4A41 A;  4DEQ A;  2XOM A;  2LS6 A;  1SDD B;  4D0Q A;  1CIY A;  1PMH X;  1EUU A;  2Y64 A;  3K4A A;  2VOT A;  2L9L A;  4BK4 A;  2ZEX A;  2HLE A;  4PQQ A;  3ETP A;  3LPF A;  3MV0 1;  1JYX A;  3OEA A;  3SKJ E;  2WO2 A;  4RN5 A;  1NAE A;  2J1S A;  4MO3 M;  2WAO A;  1KEX A;  2VMC A;  2QQJ A;  2V72 A;  2ZXQ A;  3NJX A;  3VD4 A;  3ZM8 A;  3DEC A;  5F7U A;  4CU9 A;  1MPX A;  1JYW A;  1K45 A;  3I3D A;  2W1S A;  4JX0 A;  4E8D A;  5I0D A;  2QBX A;  5DPN A;  3VD5 A;  2VQU A;  1UYZ A;  5B4N A;  3DYO A;  3LEI A;  2VC9 A;  5G05 L;  1NKG A;  3LPG A;  1F4A A;  2VZU A;  5JUV A;  3P6B A;  3MV1 1;  4JKM A;  2VO5 A;  4QB6 A;  5DQ0 A;  4CUC A;  4IUG A;  2VZ3 A;  3HJR A;  1W9W A;  5IFP A;  4KI5 M;  2B9V A;  4BXS V;  3ACF A;  3I2K A;  2W92 A;  5IYY A;  3IAP A;  3WF2 A;  3FN9 A;  4QDQ A;  2R7E B;  1RYY A;  3WEZ A;  1GOG A;  2J7M A;  3III A;  2VZQ A;  1WCQ A;  3WNN A;  1UY1 A;  1ULO A;  1XC6 A;  2VZO A;  3WQB A;  4QDR A;  1ULP A;  4GWI A;  5FUI A;  5JXG A;  3K46 A;  5IHR A;  2RV9 A;  3A23 A;  3WF4 A;  4CU8 A;  2W94 A;  3I97 A;  3LQC A;  1CX1 A;  1BHG A;  1JZ6 A;  2W87 A;  3CDZ B;  1JU4 A;  2WBK A;  1UX7 A;  1YQ2 A;  2Z4F A;  3JXS A;  3IDA A;  3VDC A;  3E1F 1;  2BGO A;  4DXS A;  4QB2 A;  3OB8 A;  1US3 A;  1W0N A;  2J1T A;  3EB7 A;  3I2G A;  3BGA A;  1UY0 A;  4AG4 A;  1OF4 A;  5EJ1 B;  2Y6J A;  3MUY 1;  5HXM A;  2QQM A;  3NNG A;  1SHW B;  1OF3 A;  1SG3 A;  4CU6 A;  3F2Z A;  4BK5 A;  3WNM A;  2JKX A;  2ZEZ A;  3K4D A;  2OKX A;  1IQD C;  1UXZ A;  1JZ4 A;  1DYO A;  2E31 A;  4JKL A;  4OMD A;  3T09 A;  4P02 B;  3LEK A;  1UZ0 A;  1GOF A;  4W8J A;  3WNL A;  4OUE A;  2BER A;  3NRU A;  5C7G A;  1O59 A;  4UI9 L;  1JU3 A;  4CUA A;  4XZU G;  1JZ2 A;  2V4V A;  1J83 A;  4MOA A;  3CIH A;  4P00 B;  3SEE A;  4QAW A;  3I2J A;  2W1Q A;  4OYU A;  4QB1 A;  2WN3 A;  4DEV A;  3VD7 A;  1XNT A;  2W9X A;  4LQR A;  2JDA A;  2BBA A;  4QX3 A;  3FL7 A;  4BJ0 A;  1TG7 A;  1W99 A;  5JXI A;  2HYX A;  3I3B A;  3AC0 A;  2E26 A;  2Y6G A;  4GWJ A;  2EIE A;  4QPW A;  1H6X A;  5LA1 A;  3WNK A;  3K77 A;  4DXT A;  3OGR A;  1K42 A;  4KWU A;  4L0P A;  2XHN A;  2WO1 A;  4CU7 A;  2VME A;  4XVH A;  3CKH A;  3HNM A;  2YG0 A;  5LA0 A;  1US2 A;  2W95 A;  1JZ8 A;  1P8J A;  5A1A A;  2Y6K A;  3K4Z A;  3T2Q A;  3C7O A;  4QDS A;  3SKV A;  4ARX A;  1UMH A;  3I3E A;  2VZP A;  2W5F A;  4CVU A;  1UYY A;  4XUT A;  1H6Y A;  1CZS A;  1DLC A;  5HPO A;  4XUO A;  1JZ5 A;  2J1E A;  2PQS A;  1O8S A;  4A45 A;  3MO4 A;  2W3J A;  3A21 A;  2JD9 A;  1UXX X;  2CDO A;  5JMO A;  3HOB A;  1L7Q A;  2WAA A;  4P08 A;  2RVA A;  2WN2 A;  3DYP A;  1JZ7 A;  3P1I A;  1CZT A;  3GXU A;  3NJV A;  5J1X A;  3C7H A;  1WKY A;  2VCA A;  2DDU A;  3ABZ A;  3T2P A;  4PT6 A;  2X10 A;  1DP0 A;  2ORZ A;  3FHA A;  1UWW A;  4A6O A;  4DUV A;  4ZZ8 A;  4UAP A;  2ZEY A;  5JR2 A;  3T0D A;  4HG6 B;  3BN6 A;  3PUI A;  1KGY A;  3MBW A;  3OBA A;  2DCJ A;  3GM8 A;  2C9K A;  2Y6H A;  3IB3 A;  3NQH A;  2BZD A;  2ZEW A;  2Y6L A;  4MGQ A;  4AAX A;  4DUX A;  4A42 A;  1O8P A;  3UNP A;  2W47 A;  4D8M A;  1JI6 A;  5C70 A;  2J1U A;  2J1A A;  1I5P A;  3VD9 A;  3CMG A;  2W1W A;  1UY4 A;  2W91 A;  3LE0 A;  3A7Q A;  4JKK A;  2DCK A;  2ID4 A;  3HEI A;  3CQO A;  1F4H A;  4TXW A;  3VDA A;  2EIB A;  4W50 A;  1GMM A;  1L7R A;  3IAQ A;  1XNA A;  3C7G A;  1J84 A;  5DN2 A;  4DXR A;  4XUR A;  3I2H A;  1UY2 A;  2C4X A;  3W5N A;  4TTG A;  1R64 A;  1W9S A;  3CZJ A;  1GU3 A;  3OG2 A;  4DUW A;  2E33 A;  2JE8 A;  2CDP A;  2QQK A;  1W8O A;  2YB7 A;  3SEP A;  5EJZ B;  2YFZ A;  3ECQ A;  3DYM A;  2VQT A;  3WF0 A;  5CZK A;  3LEG A;  4MGS A;  4QX2 A;  2C26 A;  1T2X A;  2W46 A;  2J1R A;  5IFT A;  3HN3 A;  4XUN A;  4ET7 A;  3THC A;  5JXH A;  3C7E A;  1TVG A;  3EYP A;  3OEB A;  2X05 A;  3C8X A;  3VD3 A;  2ORX A;  1NX9 A;  5G04 L;  1EUT A;  1CZV A;  2EID A;  1GNY A;  2VM9 A;  5DMY A;  3GGL A;  2VTF A;  4W4Z A;  1JZ3 A;  4E8C A;  4JHZ A;  3WSO A;  2KD7 A;  1PMJ X;  3THD A;  3UES A;  4ZZ5 A;  4KMQ A;  1UYX A;  2VMD A;  1PX4 A;  4A4A A;  5CYY A;  4LHS A;  4CUB A;  4XUP A;  1GUI A;  1D7P M;  1UMI A;  2QQN A;  3ACI A;  1PX3 A;  5JXJ A;  1JYV A;  3A22 A;  1OH4 A;  2VCC A;  2J1V A;  4ZY9 A;  4OZO A;  5LCW L;  4YPJ A;  2YFU A;  4GZ9 A;  1GOH A;  2WYS A;  5LA2 A;  4QX0 A;  3I2F A;  4LPL A;  2VZV A;  3ACH A;  1K3I A;  4M4R A;  2X09 A;  3WF3 A;  2WZE A;  3VDB A;  2WAB A;  1LNS A;  3HNB M;  3WNO A;  3FHQ A;  2V5D A;  4A3Z A;  5EIY B;  3MUZ 1;  4P5Y A;  1NUK A;  3UET A;  4M4P A;  2VZT A;  2VMF A;  3HPN A;  2BGP A;  2LW8 A;  1OD3 A;  4ARY A;  4ZXE A;  4LKS A;  2YC2 A;  2XON A;  2EIC A;  3J7H A;  3T08 A;  1W9T A;  2VZR A;  4PF1 A;  3WF1 A;  2E32 A;  2J22 A;  4Z2A A;  3C7F A;  2VZS A;  1W8N A;  1XPW A;  2VCB A;  2VR4 A;  3OGS A;  2VJX A;  4QX1 A;  2QQI A;  3T0A A;  2WZ8 A;  2W1U A;  5IJR A;  2Y8K A;  4XUQ A;  4OMC A;  3U37 A;  2YC4 A;  1JYN A;  4UOJ A;  4MAD A;  4BDV B;  3OGV A;  4RYD A;  2WDB A;  3K75 B;  3T2O A;  4FI9 A;  2RJ2 A;  3CZU A;  1K12 A;  2B4K A;  1OT5 A;  3I2I A;  3HNY M;  5C71 A;  3T0B A;  1GQP A;  2WUH A;  2XQX A;  3D3A A;  2QQL A;  5B4X A;  2VZ1 A;  2VL4 A;  3GDB A;  1HN1 A;  3ACG A; 
#chains in the Genus database with same CATH topology
 4LBO A;  5JWP A;  4A44 A;  1UY3 A;  4A41 A;  1VRB A;  1MS0 A;  1RUJ 2;  4I0A A;  4D0Q A;  1WZX A;  4CCM A;  1DIW A;  3ILF A;  5APA A;  1AR6 3;  3FUO A;  2GMM A;  2DVF A;  2VBB A;  3DF0 A;  3CNA A;  4PIZ A;  2YRO A;  3TB0 A;  2VNV A;  2L9L A;  2QCS B;  1W8F A;  1ALY A;  2HLE A;  1V9U 2;  3H0O A;  4PQQ A;  3WD5 A;  1Z0H A;  1DYK A;  1OOP B;  3POY A;  1JYX A;  4YW4 A;  3PIJ A;  2WO2 A;  2I2S A;  4RGK A;  2OUH A;  4RN5 A;  1W6N A;  2J1S A;  4L97 A;  2FDK A;  4P9J A;  2WAO A;  1KEX A;  4NHL A;  4A3X A;  5BUV A;  1VB2 A;  1W6Q A;  2ZXQ A;  5BNQ A;  3VD4 A;  5LRS A;  4B1L A;  1MAC A;  1V6K A;  1C57 A;  3ES1 A;  1K45 A;  1TMF 1;  2W1S A;  5C9A A;  4FP2 A;  1IPK A;  4OHZ A;  4FFG A;  1RMU 2;  2DUP A;  5F6L B;  4CE8 A;  1TQ5 A;  5KHI A;  4CCN A;  5KXB A;  2FBE A;  3AX4 A;  4I3P A;  4RA0 A;  2R06 3;  4NHK A;  1HQW A;  3LEI A;  2VC9 A;  2YBK A;  3KVB A;  5JUV A;  2VZU A;  3HBK A;  2RS1 3;  3P6B A;  2XKO A;  1LB2 A;  5FPX A;  3M70 A;  4AI3 A;  5DQ0 A;  4D7T A;  3AP4 A;  1FNY A;  3HAG A;  3PU3 A;  1MS1 A;  1BBT 2;  4JRA A;  1W0P A;  5IFP A;  4MXV A;  4CCJ A;  4KI5 M;  4D6Q A;  4HMZ A;  4LKE A;  3V56 A;  4CEY C;  5I8Y A;  4K40 A;  1PVC 1;  1DHK B;  4X6Q B;  2ETE A;  2Q5T A;  2YMZ A;  2WS9 3;  3FN9 A;  2ILM A;  4QDQ A;  5FKC A;  3ZDS A;  3KQ4 B;  4FBF A;  1RYY A;  3ZXE A;  4DQA A;  1GOG A;  1DQ1 A;  3WNN A;  2ARE A;  2I07 B;  2QQV A;  5FY8 A;  5FYB A;  1Z7S 2;  2ARC A;  4AI9 A;  2ZHN A;  2HWD 2;  1NLS A;  2VZO A;  1C1L A;  5FUI A;  3Q8B A;  4LIU A;  4E2G A;  1QJX 1;  1FI2 A;  1NYW A;  1RUH 3;  4CDU B;  3GCX A;  1GFF 2;  5IW0 A;  4HKL A;  3S5A A;  2W94 A;  3I97 A;  1QEX A;  3LQC A;  4BQ2 A;  1O3Q A;  1DZR A;  3AJZ A;  4FOV A;  4JGZ A;  2QFE A;  2W87 A;  3CDZ B;  1YLL A;  4GH4 C;  2GNM A;  4IEZ A;  5A3U A;  3CLP A;  2WR9 A;  4FFI A;  4FSJ A;  5DUW A;  5FZL A;  3LCP A;  2JG8 B;  4DXS A;  1SLT A;  2RMU 1;  4QGM A;  5L9B A;  4A6S A;  4HVQ A;  2Z69 A;  1ODM A;  1LTE A;  5FP3 A;  1US3 A;  2J1T A;  3EB7 A;  1PVX A;  1ASJ 2;  1UY0 A;  4O9G A;  5C5U A;  1QJE A;  3LA7 A;  2Y6J A;  3LDB A;  3R0R A;  3NV4 A;  2QQM A;  3NNG A;  4XQ4 A;  5EJ1 B;  1RUC 1;  5A3N A;  5FZK A;  1ULD A;  2QUO A;  4QPG C;  3OPZ A;  5FZF A;  3ATG A;  2VVD A;  3AZW A;  4Q4W 2;  1L3J A;  5FZD A;  2Q8D A;  1NZI A;  1OKQ A;  4I3G A;  3MLK A;  1AR8 2;  4RSU A;  1O3T A;  1LGB A;  3R4S A;  1GR3 A;  1UPI A;  3GJA A;  4CDQ B;  5CIS A;  4XIO A;  2JWP A;  3PUA A;  2HEW F;  4JV4 A;  4LBQ D;  1BK1 A;  4LJH A;  2RS5 2;  1MEC 3;  4P02 B;  4PI0 A;  3NNL A;  3U07 A;  4BQW A;  1K5J A;  1UZ0 A;  2WQZ C;  2BQP A;  3H9A A;  4P9Y A;  2WFF 2;  2R49 A;  1SLA A;  1NA1 C;  3AYD A;  1CES A;  3S30 A;  1AL2 3;  3WR0 A;  2RDN A;  1C8M 2;  3H7Y A;  3NRU A;  3VZN A;  3ZXA C;  3ZXJ A;  1GV9 A;  4NIA A;  1VPH A;  4CUA A;  1GYK A;  1X36 A;  3RDI A;  2Z79 A;  1J3Q A;  3IDC B;  1YQC A;  1HB1 A;  2XL7 A;  4CDX C;  3RZL A;  4YGC A;  4DMI A;  4NRM A;  2DVG A;  2P5B A;  3NST A;  3B5L B;  3POI A;  1WCK A;  3QH6 A;  3IZO A;  4M0N A;  1J83 A;  1QDO A;  2AEN A;  2IC1 A;  2RS3 3;  1CGP A;  4P00 B;  4QAW A;  5FBZ A;  2BU9 A;  5FXW A;  3KSC A;  2R07 2;  3RNS A;  4D6R A;  5CAD A;  5FP7 A;  4QT6 A;  1WLC A;  1FPN 1;  1SBF A;  2D6K A;  2OVU A;  3NV1 A;  1Q8Q A;  2AEZ A;  2JDA A;  2ZMK A;  4QM8 A;  4RHV 2;  3FL7 A;  1IHM A;  2A75 A;  3I3B A;  1OLR A;  4QXK A;  4YG6 A;  5FRA A;  4R9A A;  1AXZ A;  2Y6F A;  2QZ2 A;  1XQN A;  5FP9 A;  3BOP A;  4HON A;  3S7I A;  1CAW A;  2DCZ A;  4Z2W A;  1J59 A;  3N36 A;  1ND3 A;  2RM2 1;  4QPI C;  3RFR A;  3NV2 A;  4FPE A;  4X6R B;  1H8T B;  2VD7 A;  5LA1 A;  4ES8 A;  2WSV A;  5FV3 A;  3WDY A;  4CEY A;  4DXT A;  1RVF 3;  4K1Z A;  5GAL A;  2HWF 2;  1Y9M A;  4IEO A;  2G9Z A;  3KGL A;  5CA6 A;  4CU7 A;  5DAP A;  1OUR A;  4KWK A;  3WUC A;  3KD4 A;  1RUF 3;  1SZB A;  4FTE A;  3AXE A;  4CP9 A;  4FPY A;  1QNW A;  2PLV 2;  2YC0 A;  4A7Y A;  2XJP A;  2Y33 A;  5DDJ 3;  3JBG 2;  3K4Z A;  1RUE 3;  4AFB A;  1GP5 A;  1ZZ6 A;  2JIJ A;  2ZGO A;  4G4F A;  3I8T A;  3MFC A;  1AXK A;  4WVM B;  5FYU A;  3I3E A;  5FWJ A;  2VZP A;  3T4H B;  2ARB A;  1CAX A;  4UFI A;  1AYM 1;  2UYB A;  4R9C A;  4FPJ A;  3HQR A;  4F7Z A;  1AHS A;  5HPO A;  4BXF A;  5FYS A;  5BNO A;  1BYH A;  1U12 A;  1WW7 A;  2PHU A;  4XUO A;  3AZY A;  1RUJ 3;  1QOS A;  2J1E A;  5FP8 A;  5FR3 A;  4A7Z A;  1XJA A;  2PQS A;  4CCD A;  4Y20 A;  2GN3 A;  3VBU C;  3HBZ A;  5K4L A;  3KF3 A;  3OBZ A;  1D4M 2;  5I0S A;  4ZPI A;  1V6L A;  2CDO A;  2PAE A;  1YWK A;  2XML A;  4Y33 A;  5EQU A;  4XF1 A;  4U2A A;  2NM1 A;  4EN6 B;  1VBE 2;  2GNT A;  1J1L A;  1STM A;  2D3P A;  4BCU A;  1V9U 3;  2PHT A;  2Y26 A;  4QPG A;  3VGI A;  1S0E A;  3NAP C;  4RL7 A;  2IXK A;  1MQT C;  4CEW C;  1RUI 1;  1AZD A;  1GNZ A;  1LGC A;  2ZOE B;  4Q26 A;  2DBN A;  3D4K A;  2GC2 A;  3A0K A;  1FOD 3;  1S2B A;  1W6N B;  1UU4 A;  4WV8 A;  2PXJ A;  5JPN B;  3ILN A;  1W6Q B;  3AMQ A;  3T2P A;  4Q4V 2;  4QKD A;  3THT A;  4DS0 A;  1RUO A;  1IS4 A;  2A6Z A;  1DP0 A;  2ZGR A;  4OHY A;  2ORZ A;  1RMU 3;  1NA1 A;  4R52 A;  5A1F A;  1QOO A;  4QU1 A;  4DUV A;  2GN7 A;  2ZGU A;  4AED A;  3DPR C;  2FQP A;  4XJA A;  2WWS A;  5A7O A;  1ZA7 A;  4QMA A;  3LKJ A;  1W2T A;  3OBT A;  5JOX A;  2I45 A;  1JXN A;  4BQ4 A;  4P9G A;  5EXO A;  1QF3 A;  4BQ3 A;  3T0D A;  1BBT 3;  1LGN A;  1YC6 1;  5F6K A;  4CDX A;  1Y3T A;  5FPB A;  4MZU A;  3K2O A;  3BN6 A;  4JGY C;  3V0A A;  1A8D A;  3PUI A;  1AR7 1;  1TNR A;  1KGY A;  3GM8 A;  2C9K A;  4NII A;  5K0U B;  3POG A;  5T3N A;  4CA9 A;  4FVV A;  3SH5 A;  1JW6 A;  3W20 A;  5LK5 A;  3F95 A;  3MW3 A;  4IEV A;  2Y6L A;  1R08 3;  3RS6 A;  4YVW B;  3QBQ A;  1Z7S 3;  5CKM A;  5CKQ A;  3T1L A;  1BEV 1;  1HLC A;  1KFX L;  2HWD 3;  1LEC A;  2VW0 A;  3G6J B;  3FE5 A;  1XE0 A;  4GMP 3;  3VBO A;  3O1P A;  1E5S A;  2ZCW A;  5IVJ A;  1F31 A;  2W47 A;  1ODN A;  4QPY A;  3WVJ A;  5BNN B;  4D8M A;  3NWK A;  3POW A;  2KA3 A;  4YYO A;  4QPI A;  2Q4S A;  1CPN A;  1J3P A;  1YXW A;  1H2M A;  2WII B;  2JDN A;  4D69 A;  3JCI A;  4V2W A;  4JGZ B;  1H9W A;  5FBJ A;  3Q8F A;  2QKD A;  4YZ1 A;  5KWR A;  1JYT A;  2W91 A;  3BAL A;  1FAY A;  3A7Q A;  3J9S A;  3OJB A;  2ID4 A;  3KWV A;  1F5F A;  2ATF A;  4Q0P A;  5T5J A;  3WDU A;  3N9L A;  5L9V A;  2EIB A;  4Q0Q A;  1O3S A;  1NCR A;  1GMM A;  3S6P A;  1OOP C;  4IEQ A;  2D6M A;  5FMO L;  5LBB A;  2YGL A;  2HEV F;  4YVS A;  1JYC A;  1XB9 A;  1SCS A;  2WNE A;  2HWE 3;  1CAU A;  3L2H A;  3N7K A;  5FWE A;  3GZU C;  1PGW 2;  5DN2 A;  4DXR A;  5C33 A;  4IV1 A;  2Q8C A;  5HV0 A;  4E4D X;  1O4T A;  1G9C A;  1UY2 A;  3J8F 1;  3KT4 A;  3LFI A;  1R1A 2;  3FX3 A;  4QQP A;  2C4X A;  3AVS A;  3L9J T;  4WBB A;  1GU3 A;  1LUL A;  3OG2 A;  4DUW A;  1VBA 2;  5KXC A;  2CWS A;  3VDD A;  2E33 A;  1FV2 A;  1BQP A;  4IER A;  2RS5 3;  1UNB A;  3BTY A;  2PFW A;  4I0W B;  3I59 B;  4WVZ A;  2MEV 2;  2WFF 3;  1AUY A;  4EN9 B;  3WF0 A;  3VBU A;  1A34 A;  1NZC A;  2VNO A;  2D40 A;  5CZK A;  4UFK A;  5FYV A;  1OFN A;  3SH3 A;  4LOS A;  1T2X A;  2X8K A;  1RUD 1;  4P9L A;  1QXJ A;  2VGD A;  3WP6 A;  2EVX A;  5IFT A;  3CBN A;  1POV 3;  2RHP A;  4UBH A;  4OI4 A;  4CYD A;  5JXH A;  1TVG A;  4KG0 A;  5IWF A;  1MQT A;  3U4S A;  1EAH 2;  3OEB A;  3VD3 A;  4CEW A;  1XYN A;  2H6B A;  2XJQ A;  2UWA A;  4KQ7 A;  1YHF A;  4YZ3 A;  5G04 L;  1EUT A;  1CZV A;  2AC1 A;  2E9Q A;  3FBY A;  4M3C E;  1ZBE 3;  5D21 A;  2NYY A;  1PK6 C;  4XDP A;  1JZ3 A;  1POV 0;  2HWB 2;  2R07 3;  2WFP A;  4FOY A;  2ZBJ A;  3AKP A;  4DY3 A;  1E5I A;  4XF0 A;  1XE7 A;  1O3R A;  3N7M A;  4GD4 A;  4CDU C;  4DXZ A;  2VMD A;  4RHV 3;  1GZ9 A;  1VBD 2;  5CG9 A;  4LHS A;  1GUI A;  3JU9 A;  3D0J A;  2OX0 A;  1D2Q A;  3MEP A;  4MGI E;  4NE9 A;  4AVV A;  4AW7 A;  3H8X A;  1W05 A;  1W8Z A;  1MZ6 A;  1PX3 A;  3ZFE A;  1HRI 3;  5JXJ A;  5FYZ A;  3A22 A;  2Y38 A;  1OH4 A;  1VRH 3;  2ZGM A;  1AR9 3;  5KR7 A;  4OZO A;  1UKR A;  2JG8 C;  1HKD A;  1OLM A;  1XNC A;  4LE3 A;  4UWD A;  3RI9 A;  1CAW B;  1OA3 A;  1ND3 B;  1UKG A;  5IAX A;  2WYS A;  4IW3 A;  3A4U A;  3ZN4 A;  2V09 A;  2R04 1;  3JD7 2;  5F2W A;  4DIQ A;  1IKP A;  4YZ2 A;  1RHI 3;  1QIQ A;  2VZV A;  1QJY 1;  2BNM A;  4XJU A;  2Z2S B;  1JUI A;  4LUM A;  5JCT A;  4FPO B;  4YM2 A;  3AKR A;  2AH2 A;  2WZE A;  1HB3 A;  2PLV 3;  3VHP A;  4BME A;  2WAB A;  1LNS A;  1H2N A;  1X8M A;  2ET7 A;  3HNB M;  3WNO A;  3JBG 3;  4BZ4 A;  2EXJ A;  4CDQ C;  3SMH A;  1DZQ A;  3LF7 A;  3P3N A;  1OLM E;  3ELN A;  3UET A;  2VW2 A;  1G7Y A;  3OPW A;  1ENS A;  4LO6 B;  5C3O A;  1LOC A;  4PLM A;  4GWN A;  5CU1 A;  2TEP A;  1XSQ A;  1NCQ B;  4XMI A;  5FZ8 A;  3B01 A;  1AR8 1;  1YFW A;  2XON A;  3TNP B;  4LBQ B;  5H9S A;  4Y1X A;  4LKF A;  1W9T A;  1KFU L;  1XXN A;  2GZW A;  4MGK E;  2AEY A;  4PF1 A;  2BRT A;  2SBA A;  2J22 A;  4MH0 E;  3WCS A;  4FPF A;  5BNO B;  3NO8 A;  4C0H A;  1ZRC A;  3WG3 A;  1OMI A;  3RPQ A;  1D4M 3;  1OOP A;  4QU2 A;  4AI2 A;  3HIF A;  2VNG A;  3E6D A;  3WLU A;  4F3J A;  4QM9 A;  2LUW A;  4Y20 B;  4IND A;  1GBG A;  3IWZ A;  4AI1 A;  5C3P A;  3KQR A;  5KHK A;  2NP0 A;  3VKO A;  1C8M 1;  1H2K A;  2JXA A;  4I30 A;  3IPV B;  1S4C A;  3R05 A;  1NOV A;  3ORJ A;  2ZKN A;  1YO8 A;  4QX1 A;  1BMV 2;  2QQI A;  4KBZ A;  1BVV A;  2IWG B;  5F5I A;  2PQQ A;  2XLA A;  1SLL A;  2KXL A;  4JRL A;  4Y5T A;  4BM8 A;  3AM2 A;  2D3S A;  5IJR A;  5FOB B;  1N3P A;  2Q1M A;  5CAZ A;  2VOX A;  3ENR A;  1HB4 A;  2DF7 A;  1YRZ A;  4Q4V 3;  2HH9 A;  4ITC A;  4RD7 A;  1H1I A;  3RYR A;  3OBR A;  4RYD A;  2WDB A;  4AVB A;  1C5I A;  2IFR A;  2VH9 A;  3T2O A;  4UT5 A;  1YCI A;  3OGJ A;  4CCK A;  5IUQ A;  2RJ2 A;  1ENX A;  4P9X A;  1OT5 A;  4AED B;  4FTB A;  3HNY M;  4AQ6 A;  4XF9 A;  2GP3 A;  4Y1Y A;  4CCO A;  4EWD A;  4KGG A;  1PGL 2;  1RUG 1;  2WUH A;  4LBJ A;  3D3A A;  3OYW A;  4NR1 A;  4AK3 A;  4BQ5 A;  3LIG A;  4AQT A;  2VUD A;  3T08 A;  3GDB A;  3GYD A;  4C91 A;  2VBD A;  4JC1 A;  1JHJ A;  3Q9O A;  3WNP A;  3V0A B;  2QQO A;  4DEQ A;  2XBO 1;  1XND A;  1PK6 A;  3E6B A;  2JB4 A;  3H8R A;  2XJR A;  3WG4 A;  5FZE A;  1CIY A;  4QHB A;  2X53 S;  3E5Q A;  4HN1 A;  1EY2 A;  3MI8 A;  3NJY A;  4TLG A;  3ZIW A;  3Q8C A;  2GP5 A;  2OZ6 A;  3KT1 A;  4UXA A;  4CDU A;  4BU2 A;  3QLQ A;  1IKQ A;  2BNN A;  3WZ1 A;  2Y0I A;  2WWU A;  2ZEX A;  2GC1 A;  1OQD A;  1RUH 2;  3LPF A;  3RGB A;  1PO2 2;  2BYV E;  2W08 A;  1CJP A;  3OEA A;  3SH4 A;  3SKJ E;  3IKW A;  3N7L A;  3VBO B;  5JSO A;  3ON7 A;  5ANQ A;  1DF0 A;  4H3W A;  2B7Y A;  3NJX A;  2V72 A;  3AZZ A;  1FNZ A;  2WJS A;  2KR2 A;  2WZR 1;  3OPT A;  3MLJ A;  3PME A;  4WZC A;  2ZKL A;  1MPX A;  4XXA A;  2CU5 A;  3NV3 A;  3USU B;  4B4R A;  1SPP A;  1V70 A;  4CRQ A;  3I3D A;  4HXC A;  4E8D A;  3LD8 A;  3ZVX A;  5BYN A;  3O1V A;  2D93 A;  2IVJ A;  1Y43 B;  3VBR C;  5B4N A;  1VBC 1;  3PVN A;  5JMC A;  5J37 A;  5JIA A;  4KH9 A;  3AFK A;  1IOA A;  1NXM A;  1VMF A;  3MV1 1;  1NCR B;  4NPL A;  1YNA A;  5A3O A;  4XMA A;  3KHB A;  1GP4 A;  4BQY A;  4IUG A;  3BI3 A;  1QQP 1;  5F32 A;  3DCQ A;  4Y22 A;  1W9W A;  4YVS B;  1S0C A;  4OFG A;  3AP5 A;  2VE1 A;  4DB5 A;  4YM3 A;  4M0H A;  1JS9 A;  4CUG A;  3CJI B;  5F3G A;  1VBE 1;  2B9V A;  1NXD 1;  2PAM A;  3HQX A;  2B9U A;  2IVI B;  4IV1 B;  4S2F A;  3THP A;  4A7K A;  5LY1 A;  4Y5Z 0;  4QXC A;  3IAP A;  4UFL A;  3WF2 A;  4FOW A;  3WG1 A;  1OD5 A;  2F4L A;  1COV 2;  2J7M A;  2MEV 3;  3VDD B;  1M06 G;  1E5R A;  5A3L A;  5EHD A;  4Q8K A;  3CL1 A;  3WP4 A;  1UY1 A;  3PLQ A;  4M3C B;  4QQ2 A;  5GZC A;  2D5F A;  3N3H A;  3FUQ A;  4GWI A;  4Z07 A;  3K46 A;  3VKL A;  2FMD A;  5SV8 A;  1EV1 1;  3RMX A;  5EZW A;  4CU8 A;  5EV7 A;  1QJZ A;  1OUX A;  4FT8 A;  3ZDV A;  5CIR A;  3MYX A;  3MPB A;  1CX1 A;  1UOF A;  5I93 A;  5K0U C;  2K2S A;  4JDM A;  1EAH 3;  2AGS A;  2WBK A;  1UX7 A;  3EJK A;  4HT1 T;  4NID A;  2Z4F A;  1KDK A;  3BIW E;  1OI6 A;  3R6S A;  1YI9 A;  2JEN A;  1CWP A;  3JXS A;  4GA9 A;  4EJR A;  3KMH A;  3UL2 A;  1G9A A;  5IK5 A;  4FPG A;  4QB2 A;  3OB8 A;  4Y1U A;  4YVW C;  4HPK B;  2HWB 3;  3H8U A;  4KWL A;  5LRR A;  4DRV A;  4YZ4 A;  5KBF A;  2VQ0 A;  5JSP A;  2OXB A;  4Q0S A;  1OF4 A;  5BNN C;  4FPK A;  1VMH A;  5FZ7 A;  2WSU A;  1VBD 3;  2JE9 A;  1SHW B;  1VR3 A;  2VMG A;  3F2Z A;  3VUO A;  3ZYG A;  4BK5 A;  4E2Q A;  1SEF A;  3WNM A;  3H3L A;  2ZEZ A;  4JGZ C;  4MGY E;  3MLL A;  1IQD C;  1UXZ A;  5FO9 B;  3ZFE B;  3B93 A;  4B7K A;  3SCG A;  4XC9 A;  3O7O A;  1OLQ A;  2E31 A;  2R30 A;  4AGR A;  3T09 A;  2BJS A;  1KD7 A;  2F17 A;  4HN0 A;  4W65 A;  2BNO A;  5FUP A;  5GLZ A;  2XJU A;  4AQ2 A;  1XNB A;  4GWM A;  1QHD A;  3JD7 3;  2O14 A;  3KV4 A;  3U14 A;  5GZD A;  2GMP A;  2XUM A;  3M3Q A;  4AFD A;  1CD3 G;  1Q8V A;  5E1R A;  3ZPO A;  2J42 A;  1HB2 A;  4UI9 L;  4YG0 A;  2JDH A;  4CP1 A;  5FUN A;  2Q1F A;  2H0B A;  3AYA A;  5D8A A;  1UPS A;  3AMH A;  5GZG A;  4D7S A;  4CCC A;  2WQ4 A;  1PNF A;  3CIH A;  5FZ0 A;  4MGZ E;  5A7W B;  5AFE A;  2D97 A;  1E5H A;  4N9H A;  1SAC A;  3I2J A;  2QZ3 A;  2GNB A;  2CY6 A;  1V6I A;  2V73 A;  2WN3 A;  3ASI A;  2G19 A;  1D4V B;  4TSV A;  4RFT 0;  4DEV A;  5JI9 A;  1X50 A;  1XNT A;  2W9X A;  4BH9 A;  5JLV A;  3MF9 A;  1VBA 1;  5LAS A;  2ZAC A;  4AE2 A;  2MHF A;  2BBA A;  3DN7 A;  4QX3 A;  3VBR A;  4BJ0 A;  1JOJ A;  1TG7 A;  1W99 A;  5J36 A;  2ZZQ A;  3AC0 A;  5JXI A;  4XFA A;  3ZSE A;  4AVA A;  2FD8 A;  1CR7 A;  4MGT A;  1NE6 A;  2Y6G A;  4GWJ A;  3ZYP A;  4IGP A;  1XNK A;  3V0B B;  1QJU 2;  3PVO A;  3JZV A;  4HBN A;  5A7N A;  3CEW A;  3OCP A;  3BU0 A;  4N53 B;  5LBC A;  2ADD A;  1QWR A;  1HRV 1;  2ERF A;  2VQA A;  4IQP A;  4YNI A;  3WNK A;  5KHG A;  4HVR A;  5ISL A;  3J7L A;  3JQX A;  3PMS A;  1K42 A;  1FOD 2;  4KWU A;  4TN7 A;  5FZO A;  1DQ6 A;  4L8Q A;  3TWI A;  2GDF A;  1PZ9 A;  1JOP A;  3IBM A;  4FP3 A;  2XWJ B;  1U5Y A;  5CNA A;  4XVH A;  3K48 A;  4LHN A;  2E51 A;  3O12 A;  5KC5 A;  3POB A;  4KG8 A;  3IMN A;  3LA2 A;  2W95 A;  1WW6 A;  5T5P A;  4PI2 A;  4XHB A;  1SMV A;  1OQ1 A;  1P8J A;  3CO2 A;  4XAE A;  2YBS A;  3OD4 A;  3AFG A;  1MZF A;  5L7O A;  1G9D A;  4QQL A;  1V6O A;  2C5D A;  3C7O A;  5C3R A;  4XHX A;  1ND3 C;  4QDS A;  3SKV A;  3ZFF B;  4ARX A;  5LEJ A;  1ZNP A;  3WDT A;  2JKB A;  2W5F A;  4QWN A;  5K0U A;  4HSL A;  3EXU A;  1S2E A;  4AHX A;  1CZS A;  2GC3 A;  5FCC A;  1DLC A;  1MVE A;  3OYW B;  3ZR6 A;  4A2U A;  1MZE A;  4AR2 A;  4NHM A;  1PO1 3;  3OD0 A;  4YVW A;  2ZAH A;  1JZ5 A;  2EXI A;  2EAL A;  3NW4 A;  4A45 A;  2XJT A;  2ZGQ A;  1YQ8 A;  3M3I A;  1GZC A;  3MO4 A;  1R08 2;  2XGX A;  3ETQ A;  3J26 N;  5H9P A;  5A33 A;  4YM0 A;  1PK6 B;  1YJL A;  4MSV A;  1QY4 A;  2JD9 A;  2JG9 B;  3SC7 X;  5FQ0 A;  2QTW B;  5BNN A;  4KNC A;  3BOD A;  4GB3 1;  4XW3 A;  3WQ7 A;  2XR4 A;  5E89 A;  1HJG A;  4N43 B;  1L7Q A;  2WAA A;  3DL3 A;  5HCH A;  1PO2 3;  2LRO A;  1HX6 A;  1NCQ C;  3SIS A;  5IVV A;  1CZT A;  4YM1 A;  4MYE A;  3RZZ A;  3RQ0 A;  4AFC A;  1ZVF A;  3BKZ A;  3NJV A;  5J1X A;  2DVD A;  3C7H A;  1D2S A;  3ABZ A;  4KL1 A;  1W6M A;  5JOZ A;  5BNO C;  1QH7 A;  3MGU A;  4UW3 A;  5BV6 A;  1KQR A;  4FQ4 A;  1GAN A;  1Q56 A;  1BLZ A;  1SPP B;  1QXP A;  1PIV 1;  1W2U A;  3UV9 A;  1UWW A;  5ABJ B;  3RZJ A;  4LTA A;  1TE1 B;  3B02 A;  3KCX A;  2W0X A;  2ZEY A;  4ISQ A;  2HWE 2;  3NMB A;  1PM7 A;  4Q1R A;  4BA6 A;  1JOD A;  4NOT A;  1AR6 1;  4UW6 A;  1L7L A;  2PA7 A;  4MLO A;  3VBF B;  3O1U A;  3WDV A;  4URT A;  1W9F A;  1E57 A;  4Y22 B;  1IG0 A;  3AL6 A;  4K8R B;  3I59 A;  3MBW A;  4Q4X 2;  4BHP A;  1WLD A;  2VUJ A;  4Q5O A;  2TUN A;  2BFU S;  2Y6H A;  2MPF A;  5DZE A;  1YIP A;  3NQH A;  2WT1 A;  5IK8 A;  1COV 3;  2ZEW A;  5IVY A;  3AK0 A;  3UGG A;  3VKF C;  5FZB A;  1WMD A;  1MS9 A;  4LMF A;  4AAX A;  1QKQ A;  1OPM A;  4RGG A;  4AED C;  4E9K A;  3LSE A;  4EZH A;  4DUX A;  5IVF A;  4DY5 A;  3WCR A;  4W6Y A;  2YV8 A;  4A42 A;  2BBV A;  5A3T A;  2K0G A;  3PTR B;  5FPA A;  4RGA A;  2R06 1;  3UJO A;  1DFQ A;  5FIX A;  3BTX A;  2RS1 1;  2O0O A;  3P3P A;  1QOT A;  2HBU A;  2HWC 2;  3MIE A;  2H6C A;  4LIV A;  3O1M A;  3MIF A;  1W2N A;  2W1W A;  1Q8S A;  5FOJ B;  1IPJ A;  4OLL A;  1ZBE 2;  3IT8 A;  5GZE A;  2XVK A;  4XOG A;  3O1T A;  4CPB D;  3LE0 A;  5CBL A;  4F8A A;  1AL0 G;  3APB A;  4TXW A;  4XIK A;  1IS3 A;  1ZRR A;  2DCY A;  3WW1 A;  4IEY A;  3B69 A;  1KS5 A;  1L7R A;  1GNH A;  3IAQ A;  3O1S A;  1XNA A;  2WS9 1;  3R4D B;  3VBO C;  4CDW C;  5ACA 2;  3TAY A;  5AC9 2;  2D3R A;  2DUQ A;  2DTW A;  1HRI 2;  4ZS2 A;  3AKS A;  5F3E A;  5F5A A;  1RUN A;  1WA6 X;  5I8S A;  1DYP A;  1VRH 2;  4ZXK A;  3W5N A;  1AR9 2;  4SLI A;  4TTG A;  3CZJ A;  3AMM A;  3TRS B;  5JPM B;  2QQU A;  4FQZ A;  2R0F A;  5LZ6 A;  4X8P A;  2HJI A;  2CDP A;  2QQK A;  1W8O A;  1FT9 A;  2YB7 A;  5I91 A;  5EJZ B;  3LAG A;  4AVS A;  3H1M A;  3UGH A;  1D0H A;  1RHI 2;  3DYM A;  1NCR C;  2ZHL A;  4RQP A;  5A6X A;  1TZO A;  4XBN A;  4P9W A;  3LEG A;  4TYS A;  4QKN A;  2YU1 A;  2C26 A;  3D0S A;  5DZF A;  2W46 A;  4YVS C;  1W04 A;  3I2O A;  1PZ8 A;  2R0H A;  4LNV A;  1SDW A;  3CJI C;  3HN3 A;  4IV1 C;  1UD1 A;  3FLR A;  4Q29 A;  1MS4 A;  1H1M A;  1NCQ A;  2PAK A;  1KIT A;  3EYP A;  3NNF A;  1OH3 A;  4KBB A;  5D8A B;  2XWB B;  4LBQ A;  3VDD C;  4D7Y A;  5EFU A;  5F2S A;  4OI0 A;  5DMY A;  4YGD A;  3AMP A;  4W4Z A;  5CFD B;  4E8C A;  3RZK A;  3D6E A;  4COU A;  1S55 A;  4IEW A;  1WCS A;  3ZOI A;  4KMQ A;  5K8S A;  1MEC 1;  1S0G A;  3M8L A;  3ZR5 A;  4B1M A;  3W58 A;  4AI0 A;  4K3U A;  4XUP A;  1D7P M;  4WVV A;  1G8W A;  2BWC A;  3IPV A;  3KHC A;  3VBR B;  1REE A;  1UN1 A;  1GLH A;  1AL2 1;  1C4R A;  1CQ9 A;  2WLQ A;  4UFM A;  4IE5 A;  3RI8 A;  1UOG A;  2C9A A;  4NUB A;  1QJU 3;  3VZO A;  3OOX A;  3S0M A;  3H1Y A;  3PL0 A;  5LCW L;  4Q4Y 2;  1Q43 A;  1NG0 A;  2DFC A;  3AP7 A;  3SCF A;  4ZKT B;  1JTZ X;  2XG3 A;  4XE9 A;  2RDQ A;  3B9C A;  1KDM A;  5E8A A;  4DPN A;  5FZ9 A;  2AZ5 A;  5LA2 A;  1W03 A;  4HVO A;  2ZGL A;  4XDO A;  2RS3 1;  5FZO B;  4BQ1 A;  5FP4 A;  5L9R A;  4D3W A;  3VKN A;  2FDJ A;  4XAA A;  4FCA A;  4IDZ A;  2RJL A;  1UZZ A;  1NY7 1;  3IMM A;  4N9I A;  3WF3 A;  2JB8 A;  1LHW A;  3VDB A;  1YIF A;  3HWJ A;  3MW4 A;  1XU1 A;  5A7Q A;  4BE3 A;  4AHW A;  3ZFE C;  1ND2 B;  1ZM1 A;  5FZ4 A;  1TME 3;  3MUZ 1;  4Y4Y A;  4CTE A;  4P5H A;  1NUK A;  5FZM A;  1W8U A;  4EN0 A;  1UIK A;  2PEL A;  1WD3 A;  5IAT A;  1MS8 A;  5L7O B;  3HPN A;  2BGP A;  1OKO A;  2LW8 A;  3N35 A;  3WY6 A;  4AYU A;  4FPC A;  4KU7 A;  1OD3 A;  3UT0 A;  1UZW A;  4O9E A;  1W06 A;  3KM5 A;  3NL1 A;  4NN0 A;  4FXK B;  1PGS A;  2EIC A;  4KU8 A;  3J7H A;  1FMD 2;  3M1H A;  1RXF A;  3FC0 A;  4COY A;  4NIG A;  5BNP C;  4AHZ A;  1RVF 1;  4Z2A A;  2VW1 A;  4XCA A;  4LA2 A;  2D6N A;  3UK9 A;  2VZS A;  1HXS 2;  2CTV A;  4MHU A;  1W8N A;  5DUX A;  4CDW A;  3ZYB A;  5A33 B;  2RDS A;  4PHZ A;  1LED A;  1N1S A;  2JEC A;  3GAL A;  1LOA A;  4ZON A;  2QQW A;  5FQ0 B;  1RUF 1;  2XHK A;  3ACL A;  3GF6 A;  3AB0 A;  3USU A;  4UFJ A;  3GBG A;  4S2D A;  3VHR A;  4EZ4 A;  1YUD A;  3AL5 A;  3HR9 A;  1V6N A;  4FOQ A;  5DDJ 1;  1S0B A;  5D1I A;  1RUE 1;  2WZ8 A;  1ZBA 2;  2IXC A;  3WIN E;  4AI8 A;  3GHN A;  5J48 A;  5E16 A;  1LJ7 A;  2ZTN A;  4K1Y A;  1U0A A;  3QD6 A;  1KS4 A;  4IE4 A;  3OSD A;  1JYN A;  3LDR A;  1CIW A;  4I2O A;  1IGO A;  1W6M B;  4JVA A;  2ZGN A;  5AVA A;  1O7F A;  3WDW A;  2Y34 A;  4AF9 A;  4HFS A;  1RUJ 1;  3ZSM A;  4R8H A;  3CZU A;  3M7A A;  4N53 C;  1K12 A;  3VHO A;  2B4K A;  3IN9 A;  4AFM A;  5GM0 A;  2WT0 A;  1SLB A;  1RL3 A;  2K46 A;  3CJI A;  4LHK A;  2OZJ A;  2P3I A;  4KGQ A;  3ZSJ A;  5LK7 B;  1RGS A;  1B35 B;  5FPU A;  2ZML A;  1O4Z A;  3PUQ A;  4R4X A;  4Z92 B;  2VVF A;  2VL4 A;  2YYO A;  3MHZ A;  1V9U 1;  4XET A;  3ACG A;  4AHY A;  1R09 3;  5ERL A;  5C5T A;  3PUH A;  4Q4X 3;  3INA A;  2XH6 A;  1XBF A;  2I74 A;  4BIS A;  2LS6 A;  1SDD B;  2Y0O A;  3GCW A;  5DG1 A;  3LA3 A;  4M3C A;  4R4Z A;  1APN A;  1VE0 A;  4CZS A;  1EUU A;  3AYC A;  1FOD 1;  2VBP A;  4NPM A;  3VL9 A;  2Y64 A;  1GQH A;  3EHK A;  4ZU7 A;  1XSR A;  2VOT A;  1SBD A;  3KV5 A;  1VBB 2;  2D5H A;  3X29 B;  4OHX A;  3ZFF C;  2BVV A;  3E6C C;  2V4A A;  1RMU 1;  4PBP A;  4L9B A;  5FZC A;  5HCA A;  3RZH A;  2ZAB A;  5DAQ A;  4COV A;  2UWC A;  1OQE A;  1SCR A;  2VMC A;  2QQJ A;  4ONU A;  3ZM8 A;  3WV6 A;  3DEC A;  5F7U A;  3O0W A;  4ATE A;  4CU9 A;  2Q8O A;  1S0I A;  2CGO A;  2HWC 3;  4HPK A;  4DFS A;  3PHM A;  4BQX A;  1BBT 1;  1JYW A;  3ZMO A;  4G9S B;  2QBX A;  3K3O A;  1VAL A;  2JG9 C;  4K9S A;  5FZA A;  3VBH A;  4AAP A;  3WHU A;  4ASM B;  3B94 A;  4OVE A;  4L92 A;  3DYO A;  1S0J A;  4N43 C;  5G05 L;  5J96 B;  5IK7 A;  2XVL A;  1AXY A;  1EPZ A;  2BVB A;  4XAB A;  5ACA 3;  4CUC A;  5AC9 3;  4LK6 A;  1N3Q A;  1R08 1;  4LEJ A;  3HJR A;  1TMF 2;  1Z7S 1;  2YDE A;  1RTV A;  1OPO A;  1W8W A;  2DVB A;  2HWD 1;  2JIG A;  4GMP 1;  3TN9 3;  1W6P A;  4NO4 A;  2HBT A;  1W39 A;  3BTA A;  3PIG A;  5A1L A;  5FO7 B;  3J4U H;  1XYP A;  4LBL A;  2K9Z A;  2W92 A;  4K7J A;  2PHR A;  2ARA A;  1HV1 A;  1W8H A;  5A3P A;  4COZ A;  5ABJ C;  4LUK A;  1H8V A;  3WEZ A;  3U75 A;  2OA2 A;  3III A;  1F9K A;  2VZQ A;  1WCQ A;  2JDM A;  4QXB A;  5FXX A;  3VZL A;  5BNP A;  3KGZ A;  1ONA A;  4YAR A;  1ULO A;  3I54 A;  3QH7 A;  2PTM A;  3WQB A;  3ZSL A;  4QDR A;  1ULP A;  4FO9 A;  3GBF A;  3GHM A;  4RQP B;  3ZYJ B;  5IHR A;  3A23 A;  3LWC A;  3VBF C;  2ZX0 A;  2FHR A;  1PVC 2;  2F6B A;  3TNQ A;  4J25 A;  1F15 A;  1YJK A;  5FMO S;  1ASJ 1;  5A7W A;  2Z42 A;  1LU1 A;  1BHG A;  1HW5 A;  3FWE A;  1JZ6 A;  4XF3 A;  3VHN A;  3RYK A;  2A3Y A;  5A70 A;  2RE9 A;  3ALQ A;  2P4E A;  4JCK A;  4Q4W 1;  3E1F 1;  3NJZ A;  2BGO A;  1OVP A;  4N7I A;  1UYP A;  3M3C A;  4IV3 A;  3PU8 A;  1F8V A;  2O8Q A;  2EIG A;  1A3K A;  3VB9 A;  4OUM A;  2RS5 1;  4HZF A;  2FCU A;  4CCL A;  3EMR A;  5HXM A;  2JDP A;  2PHX A;  3O5S A;  1DU3 D;  1N1Y A;  1OF3 A;  1SG3 A;  1WBL A;  2WNU C;  1Q5O A;  4PDW A;  2WFF 1;  3WOG A;  4CU6 A;  1VAK A;  4N53 A;  4UYB A;  5JI7 A;  4AFA A;  1ZRF A;  1C5H A;  2CYF A;  3QCW A;  2RDR A;  5FAX A;  2WA3 A;  2RMU 2;  1X7N A;  1ZYB A;  5FXZ A;  2D7F A;  5LWB A;  4HSJ A;  1OC1 A;  1JZ4 A;  4Q4Y 3;  1VBC 3;  2UU8 A;  5T54 A;  4JKL A;  2VXR A;  3ZYI B;  1FV3 A;  3ZXD A;  3KZ4 C;  3E97 A;  1RUC 2;  4W8J A;  5GZF A;  4OUE A;  5T50 A;  4GAZ A;  2YU2 A;  2BER A;  2WL1 A;  3BU7 A;  3PUR A;  1ZBE 1;  1GSL A;  1O59 A;  1S1A A;  2AYH A;  2DU1 A;  2P6C A;  2VNR A;  3JUU A;  4NJ4 A;  1UU6 A;  2R07 1;  5A6Z A;  3BOW A;  4XCB A;  3U10 A;  1G9F A;  2VMI A;  1JBC A;  4PCR A;  3ZFF A;  1RJ8 A;  2YGM A;  4XZU G;  2BW8 A;  1CAV B;  4RHV 1;  5FY9 A;  2A6V A;  3ZXF A;  5DZG A;  3B3Q E;  2V4V A;  3LIH A;  2OS2 A;  1V00 A;  5TSW A;  4XZP A;  1N1T A;  1BVP 1;  1HRI 1;  3S57 A;  5A3M A;  3GZT B;  5A3W A;  4XBL A;  2W1Q A;  2PHD A;  4QB1 A;  2RR1 3;  3K51 A;  3LDK A;  5DAV A;  1PO1 2;  3VD7 A;  1FMD 3;  2KM2 A;  2JG9 A;  3OY8 A;  2DVA A;  1RJ7 A;  3U11 A;  2O8O A;  2HWF 1;  4YZ5 A;  5IT6 A;  1U5I A;  3ES4 A;  2HYX A;  4N43 A;  1X82 A;  2E26 A;  1CN1 A;  1HXS 3;  3PTY A;  1MS5 A;  3CJX A;  4W6W A;  4H14 A;  5C8C B;  3EQE A;  5BY5 A;  2EIE A;  4EE2 A;  4U36 A;  5FYY A;  2X5I B;  4BIO A;  5SV5 A;  4OI2 A;  4MUV A;  5D8A C;  1WBF A;  3BPS A;  4CDW B;  2BEO A;  4FPH A;  1FPN 2;  1OXC A;  2PLV 1;  4IL7 A;  3MDP A;  1QU0 A;  2XLF A;  5CFD C;  1OSG A;  3JBG 1;  3OGR A;  3TEZ A;  1YFX A;  1ZBA 3;  4LK7 A;  4L0P A;  3HN1 A;  4IXL A;  2C6S A;  1WW5 A;  2XUE A;  1UOJ A;  2UYA A;  2XJV A;  3N9Q A;  4Q8L A;  5ABJ A;  2VME A;  1N1V A;  3FJS A;  2JEM A;  3V65 A;  3HQU A;  3MID A;  4RR3 B;  1Y7B A;  3CKH A;  1AYN 3;  4LO8 A;  3DEM A;  2YG0 A;  5LA0 A;  2RM2 2;  5DAX A;  5J7M A;  5DUV A;  4YW6 A;  1US2 A;  1ZZ9 A;  4BLJ A;  2XL9 A;  4O65 A;  5L19 A;  5A1A A;  2Y6K A;  1RIN A;  3VBF A;  3T2Q A;  2ZGP A;  1LOG A;  1I9R A;  1D4M 1;  2AAC A;  1TNF A;  3NNJ A;  3MZH A;  2CSG A;  5FPV A;  4JQR A;  4CVU A;  1UYY A;  4XUT A;  3VV1 A;  1H6Y A;  3ZYH A;  5HBA A;  3URF A;  4MXW A;  4W6X A;  2GH2 A;  4IEX A;  5DXD A;  5C7G A;  4N90 A;  1YQ5 A;  1O8S A;  3T4V A;  2BOJ A;  1OBN A;  3AZX A;  3HT2 A;  1CPM A;  4LIT A;  4XYX A;  3VLB B;  4HAN A;  1ND2 C;  1WGP A;  5A7S A;  4S2G A;  3FBM A;  4Q4V 1;  2Q8E A;  5C8W A;  1VBB 3;  2QDR A;  2WNU A;  4FFF A;  5JMO A;  2E6V A;  1AYM 2;  5L7O C;  2ZA9 A;  1H2L A;  4P08 A;  3SQO A;  1A8M A;  3ZXK A;  2RVA A;  2WN2 A;  3AKQ A;  1DZT A;  1W8T A;  1WUV A;  2DWR A;  3ILR A;  2UY8 A;  4IE6 A;  4YW5 A;  3U78 A;  1EYB A;  1CJD A;  2VXJ A;  3MW2 A;  5F3C A;  2VOW A;  4BOW A;  2D44 A;  2VCA A;  5FRE A;  3PJQ A;  3O0V A;  3VBS B;  2C24 A;  3MF6 A;  5CB7 A;  1CON A;  4WZF A;  1Y9Q A;  2D98 A;  5FDB A;  2ZJC A;  4A6O A;  4LO7 A;  1RUI 2;  2OT7 A;  3EO6 A;  4ZZ8 A;  4MG2 A;  5C4W A;  3VBH B;  3UJQ A;  1HRV 3;  5F3I A;  1CVN A;  4Y1Z A;  3T1M A;  4NHY A;  4YFZ A;  4TZD A;  1FX5 A;  4LXL A;  5HCF A;  1GQG A;  5JR2 A;  1RIR A;  5DAW A;  5JOY A;  3U0Z A;  3V64 A;  1YQ6 A;  5JZG B;  5DAB A;  5F37 A;  5LEK A;  1POQ A;  3V0B A;  1TMF 3;  4OI1 A;  4I09 A;  1ZX5 A;  3W9A A;  4FAG A;  4XTM A;  1XE8 A;  2GND A;  1DGW X;  1GIC A;  1NE4 A;  3HT1 A;  2FMY A;  4NWV A;  1W6P B;  4DIN B;  5FXV A;  3VKM A;  3IB3 A;  3AP6 A;  1YI7 A;  1N47 A;  2BZD A;  3ZN6 B;  3RMY A;  4QGN A;  4MGQ A;  5IVB A;  1RB8 G;  2FZ2 A;  3RZG A;  4Z1V A;  4L2N A;  2ET1 A;  1PM4 A;  2VEC A;  1AR7 2;  5BNP B;  1W9Y A;  1O8P A;  4E4S A;  4QHZ A;  1B35 C;  3JB8 A;  1VLN A;  4JHT A;  1DQ4 A;  1PVC 3;  1M4W A;  5C70 A;  2XDV A;  2J1A A;  4Q27 A;  3KV6 A;  4LE4 A;  1I5P A;  4L99 A;  3VD9 A;  1Q8O A;  3PNA A;  5CFD A;  1PGW 1;  2YPD A;  2BP6 A;  4GKX A;  1YYN A;  4GJY A;  1GZW A;  2FDI A;  4WM8 B;  4WM7 A;  4XJ8 A;  3MPP G;  4JDO A;  1R1A 1;  3CQO A;  3HEI A;  1F4H A;  1QJX 3;  4UW5 A;  3UKT A;  1V6J A;  2ZGS A;  3TBD A;  2NZ9 A;  2A6W A;  1V0A A;  4IV3 B;  3NNM A;  3ZXG A;  1HDK A;  3MFA A;  1B09 A;  2MEV 1;  5FY1 A;  2BTV C;  2ZPX A;  4RS5 B;  3POE A;  5FZG A;  3JB4 C;  4ASL A;  5F1R A;  2A3W A;  1I1E A;  4XUR A;  2UY9 A;  3I2H A;  5FYM A;  1EPW A;  5FJH A;  2VUA A;  5J3U A;  4PDW B;  3RG0 A;  2PYT A;  2RMU 3;  1O5U A;  4XFG A;  1R64 A;  1W9S A;  2HYK A;  3IM0 A;  4HET A;  5ANN A;  1PIV 3;  2JE8 A;  2P3Y A;  3OGG A;  2YFZ A;  2QVS B;  5FKB A;  1RUC 3;  1MR5 A;  1EAH 1;  4OUS A;  4YSF A;  2W68 A;  1D0G A;  3C2U A;  4CCE A;  3KCY A;  1YEW A;  1LU2 A;  2QE3 A;  3CU7 A;  1UX6 A;  3J8F 2;  2HKX A;  1UIJ A;  1UZV A;  3EBR A;  5A6Y A;  2EAA A;  2B46 X;  1ND2 A;  1UAI A;  2HWB 1;  5I8T A;  3KT7 A;  4AVT A;  1K5M B;  1ULG A;  2A5Z A;  2AR6 A;  3MIG A;  4ET7 A;  1TME 2;  2BFU L;  2WKK A;  1BK0 A;  3MIB A;  5F5Q A;  4HK8 A;  3ZKU A;  1VBD 1;  2X05 A;  3C8X A;  2ORX A;  2DYC A;  3P5B A;  1NX9 A;  4PLN A;  1ZZ8 A;  2EID A;  2WZP P;  1HQL A;  1ENR A;  1SLI A;  5BXX A;  4K21 A;  2P37 A;  1RUD 2;  4NRQ A;  2BWA A;  3NVC A;  3RVH A;  2E53 A;  4G3Y C;  1ZRI A;  5FLH A;  1PMJ X;  3THD A;  1NQD A;  2WC2 A;  1NT0 A;  2P1B A;  4RQP C;  4ZZ5 A;  4K20 A;  3WXP A;  5A80 A;  1PX4 A;  4A4A A;  3AZV A;  3OY8 B;  1Q3E A;  4GXL A;  2NPI A;  3JD7 1;  3DGT A;  4CXY A;  1H0B A;  3ACI A;  1OVS A;  1JYV A;  3DV8 A;  2G9G A;  1GWK A;  5CFC B;  2IXH A;  4QQH A;  2J1V A;  4ZY9 A;  3POS A;  3ZO0 B;  4YPJ A;  4E27 A;  1FPN 3;  5L36 A;  3D5O A;  1YFY A;  5DG2 A;  4YWA A;  5FLI A;  1GOH A;  4K8F A;  5EPA A;  1UW8 A;  4QX0 A;  3I2F A;  3FLT A;  3H8O A;  1WW4 A;  2DCT A;  5FFO C;  3S5Q A;  3ZPY A;  4GKY A;  1S0D A;  3N4M A;  2YHJ A;  4LPL A;  3ACH A;  4M4R A;  4ASK A;  2PMW B;  1DDL A;  3ZFG B;  2X09 A;  4C0B A;  2RM2 3;  1S0F A;  4XEZ A;  3TEY A;  4QX5 A;  4AEJ A;  5LA9 A;  3OUI A;  1DGL A;  2V5D A;  1B35 A;  2B39 A;  2WT2 A;  5I0T A;  4J6G A;  2JJ6 A;  4QKB A;  5T5L A;  3J7M A;  1VIW B;  2VZT A;  4HKW A;  2R04 2;  4M4P A;  4LLF A;  5T52 A;  5IVC A;  4XJW A;  3TEW A;  2FDH A;  1U5X A;  5FYI A;  4EN8 B;  2WO7 A;  1QJY 2;  1SQ4 A;  2OPK A;  1R09 2;  2VOV A;  4XQW A;  4ARY A;  4ZHN A;  4XFB A;  4ZXE A;  1ACC A;  4UW4 A;  4LKS A;  2YC2 A;  2ZX2 A;  5C3Q A;  4XJZ A;  3M4F A;  1VB4 A;  3WF1 A;  3ZSK A;  1BMV 1;  1NQJ A;  2YZ4 A;  4QGL A;  5KXE A;  1W3V A;  4MXW B;  2P34 A;  5FMD A;  4BMB A;  3OTF A;  1H4G A;  3BVC A;  4EWE A;  1RXG A;  5IVE A;  1ZRE A;  1ULE A;  1UL9 A;  2VVE A;  2VR4 A;  5L73 A;  4I01 A;  2VOK A;  4OQ8 A;  1H1A A;  1JH5 A;  3FHI B;  1AYM 3;  2ADE A;  5JSR A;  3KV9 A;  5E6H A;  4YGE A;  3GJB A;  4XFI A;  2A3X A;  2VJX A;  2WNU B;  5F39 A;  3FMG A;  4NRO A;  3T0A A;  5GLU A;  1W2O A;  1HJF A;  3KB5 A;  1XYO A;  2Y8K A;  2BV4 A;  2PHL A;  1PGL 1;  3HD8 B;  3U37 A;  1SLC A;  1ZZB A;  2YC4 A;  4D6S A;  2JIC A;  3B9I A;  1OFS A;  1O6U A;  1DQ2 A;  4IGO A;  1O4Y A;  2LAL A;  4BDV B;  5C8C C;  5FZI A;  2DV9 A;  5FMB A;  2X5I C;  3K75 B;  2WYF A;  2ZS6 B;  5HI0 A;  1RUI 3;  2R16 A;  3FLP A;  4FI9 A;  1PO1 1;  2CGP A;  5HV4 A;  2C0Z A;  2JE7 A;  3ZIX A;  3NKT A;  1FYU A;  3I2I A;  5C4W B;  3T0B A;  3GNE A;  1GQP A;  4BLI A;  3TN9 2;  3ZMN A;  5K9Y A;  1KRI A;  3ZN5 A;  1VMJ A;  4PIX A;  5GKA C;  2CGN A;  1HN1 A;  3LPG A;  4E4H A;  1AX1 A;  2DU0 A;  1RUH 1;  2WO3 A;  2WQ8 A;  4PJY A;  1PO2 1;  3ZKY A;  3W5M A;  4RR3 C;  3UKV A;  2CNA A;  2FDG A;  5FPZ A;  4XTP A;  1OHF A;  2XOM A;  3H3Z A;  3USS A;  4Q0V A;  3G7D A;  3N9N A;  4C1W A;  2FDF A;  5KHH A;  1PMH X;  3J7N A;  1ULF A;  3D8C A;  5IAV A;  1QDC A;  2BPA 2;  2WNO A;  1O5L A;  1RUG 2;  3K4A A;  1V6M A;  3C3V A;  3BB6 A;  4XFF A;  3I49 A;  5GLW A;  4BK4 A;  5KC6 A;  1MZ5 A;  4YLZ A;  5B2G B;  1AR7 3;  3ETP A;  2OQ7 A;  3MV0 1;  3E5X A;  1LEM A;  3W59 A;  5AVP A;  2XBO 2;  4LBK A;  1NAE A;  1VP6 A;  2IZW A;  4MO3 M;  1X9P A;  5GLV A;  4DOU A;  4M00 A;  3LB9 A;  2EA7 A;  4JAA A;  3H3U A;  3E5U A;  3SIT A;  3AXD A;  3PUS A;  4JX0 A;  1BEV 3;  2OUJ A;  2SLI A;  5C6C A;  3TYJ A;  5I0D A;  1GKB A;  1HIX A;  5DPN A;  1QJF A;  4MVT A;  5FK8 A;  2QDN A;  1LEN A;  2VQU A;  3VD5 A;  1UYZ A;  4NIH A;  2WLP A;  5LB6 A;  3WHT A;  1GZW B;  4CXX A;  3LOI A;  2GAU A;  4GAL A;  4WM7 B;  1NKG A;  2RJK A;  1F4A A;  1JYI A;  3PVB B;  4TLF A;  4QKF A;  1W90 A;  5M0T A;  3H7J A;  4Y24 A;  4JKM A;  2VTX J;  2VY0 A;  2WZR 2;  4P14 A;  4HK9 A;  5K7P A;  2VO5 A;  1COV 1;  3N9O A;  4QB6 A;  2F4P A;  2YY1 A;  2VZ3 A;  3IDB B;  3POF A;  4MHR A;  5HCB A;  4IE0 A;  2UUR A;  2WNV C;  3GZE A;  4C8D A;  3VBS C;  4GH4 A;  2C1F A;  5T5O A;  1LHU A;  4BXS V;  1AF9 A;  5A6Q A;  4Z82 A;  1VBC 2;  3K3N A;  3ACF A;  3I2K A;  3LSD A;  4BWO A;  3O1O A;  5IYY A;  2LRP A;  3FZ3 A;  1KXG A;  1Y4W A;  1KJR A;  2R7E B;  4AOC A;  2VUC A;  3FFQ A;  5LAT A;  1WMX A;  2XJS A;  1WMF A;  1LKN A;  2OPW A;  3VZM A;  3U4X A;  3VBH C;  3HMY A;  3BIE A;  1QQP 2;  4XBQ A;  5T55 A;  1SBE A;  4ORF A;  5DUU A;  1XC6 A;  4UBG A;  3ZX7 A;  1PMI A;  3J8F 3;  5JZG C;  1H9P A;  5JXG A;  1CAV A;  2A7A A;  2RV9 A;  3FFZ A;  1CX4 A;  1XRU A;  3OF1 A;  5EYY A;  3WF4 A;  3WW2 A;  3LFM A;  4XAC A;  1C8N A;  5EP9 A;  1AJO A;  2ZAA A;  3H1W A;  4OUL A;  1Z78 A;  2GC0 A;  2WIN B;  4I02 A;  3DKW A;  4Z8B A;  5KHJ A;  3AMN A;  1JU4 A;  1FXZ A;  1YQ2 A;  3DKQ A;  5D2A A;  2TNF A;  1J1T A;  3IDA A;  4TWT A;  5GLT A;  3VDC A;  2FCV A;  1LOF C;  1WA4 A;  4COW A;  2RR1 2;  3B7M A;  3DUI A;  4L11 A;  1RUD 3;  1QNY A;  2OII A;  2ARX A;  4AGV A;  1EV1 2;  1PHM A;  3H42 B;  1W0N A;  5C9A B;  2B5H A;  1JHN A;  3I2G A;  3BGA A;  3MIH A;  4QHO A;  4ZS3 A;  5C8C A;  2YBP A;  3T2T A;  4AG4 A;  5FPL A;  2X5I A;  3MUY 1;  5FY5 A;  2P3J A;  1F35 A;  2G4I A;  2QJV A;  1HV0 A;  2EAK A;  1REF A;  4M01 A;  4Y3O A;  3N7J A;  2JKX A;  3K4D A;  2VAU A;  2OKX A;  3PJY A;  4YW3 A;  2JDU A;  3TOJ A;  4DRR A;  4H2A A;  1AX2 A;  4WM8 C;  5JAX A;  1A6C A;  3AYE A;  2PHF A;  1DYO A;  2XXZ A;  4AQS A;  3KCC A;  4OMD A;  4B3N A;  2V5Y A;  3ZXL A;  2YXS A;  4IEU A;  4CP0 A;  2XQR A;  3LEK A;  4QX8 A;  4RR3 A;  1BZW A;  1GOF A;  1DQ0 A;  3LEM A;  3Q8A A;  3I3M A;  2NN8 A;  2QNK A;  4IV3 C;  3WNL A;  3WG2 A;  3BTZ A;  1RC6 A;  1AYN 2;  3QOP A;  1LR5 A;  4OZX A;  4RS5 C;  3RYP A;  2G9F A;  2A73 B;  3QAC A;  4DZG A;  1JU3 A;  1LOE A;  1DGR N;  3ST7 A;  1DQ5 A;  4NWW A;  4PDW C;  4XIL A;  4ES9 A;  2Q0A A;  3LZZ A;  1WLT A;  2ZX1 A;  3Q8E A;  2XB6 C;  4LT5 A;  4FXG B;  1JZ2 A;  2R04 3;  5JIU A;  4GMP 0;  4MOA A;  4S2H A;  5LBE A;  2ZHK A;  4I0B A;  4JZR A;  1QJY 3;  4Y4R A;  1UQX A;  1X8E A;  3SEE A;  4Y1V A;  4MET A;  1QJU 1;  4OYU A;  5JDB A;  3ZYF A;  2BDR A;  2D6O X;  4DO0 A;  2R6Q A;  4R9B A;  4LQR A;  4CSW A;  1ASJ 3;  1K5M C;  5CVR A;  4Q1P A;  4XDQ A;  1WME A;  4LR4 A;  1UZY A;  4QXH A;  4YW7 A;  2FCT A;  2WA4 A;  2ZX4 A;  4QPW A;  4QQO A;  3AJY A;  3T3Y A;  1H6X A;  3BCW A;  2B42 B;  4Q4W 3;  3WNX A;  4XFC A;  3WQ1 A;  4QX7 A;  1AR8 3;  4ISR A;  4NPR A;  3WQ0 A;  2LTN A;  2WNV A;  3GBW A;  4V1P A;  5EWS A;  3VBS A;  3LOB A;  3K77 A;  2P2K A;  5H9Q A;  4B29 A;  5LBF A;  4OHW A;  1TME 1;  1BKZ A;  1H30 A;  2GU9 A;  4OCT A;  4YW1 A;  2XHN A;  2B8M A;  3KF5 A;  1DCS A;  2WO1 A;  2DBI A;  5FYH A;  1LHV A;  1SFP A;  4NVP A;  4FFH A;  3W21 A;  1W0O A;  3HNM A;  1C8M 3;  5C3S A;  2DTY A;  3M3E A;  4O7X A;  3DXT A;  1JZ8 A;  5JZG A;  1HRV 2;  4LOR A;  4Y5S A;  2D6P A;  3CHX A;  5F8P A;  1A78 A;  5CFC C;  4ATF A;  4URA A;  2W52 A;  4B4Q A;  4JDN A;  5CG8 A;  2R1D A;  1XOY A;  4AEK A;  3NAP A;  1JUH A;  1UMH A;  2W39 A;  3M2M A;  5FK7 A;  2GH8 A;  5FZ6 A;  2AUY A;  3I2D A;  4R9D A;  1MVQ A;  3ZN6 A;  1W6O A;  4EN7 B;  3D82 A;  1UO9 A;  1XU2 A;  1LOF A;  4AL9 A;  3WX5 A;  4XPV A;  3SLI A;  3N9P A;  3ZFG C;  1HN0 A;  4FAH A;  4UF0 A;  5I0R A;  5FYT A;  4YG3 A;  5A32 A;  1NLQ A;  5FO8 B;  5LY2 A;  2W3J A;  1NLR A;  3A21 A;  4J1X A;  3IIA A;  3ME2 A;  4Q0U A;  5AFB A;  1UXX X;  3DPR A;  1RUG 3;  1WLW A;  3WT3 A;  2WWJ A;  3KS7 A;  4ZU5 A;  3HOB A;  1VJ2 A;  3DYP A;  2XBO 3;  1JZ7 A;  1OA4 A;  5CKN A;  4JGY A;  3P1I A;  3SHR A;  3GXU A;  1I6X A;  2CHH A;  2HWE 1;  4WM8 A;  3RJR A;  2HWF 3;  4KWJ A;  1WKY A;  2DDU A;  2FZ1 A;  4NHX A;  4CEY B;  1ZZ7 A;  4PT6 A;  5JOW A;  4GIQ A;  3SXW A;  4GB3 2;  4LKD A;  4PLO A;  4IES A;  2X10 A;  2PHW A;  1QJX 2;  4LA3 A;  4XF4 A;  1W3X A;  4QD2 A;  3FHA A;  4OQ9 A;  2A71 A;  4YW2 A;  1R09 1;  3I3Q A;  4AVC A;  4Q4X 1;  1AVB A;  2O1Q A;  1I5Z A;  4RS5 A;  4UAP A;  4NAM A;  1LOB A;  2P6H A;  4E4Z A;  2HEY F;  1DG6 A;  1YFU A;  2WZR 3;  4CP9 B;  4CXW A;  3SCH A;  1IS6 A;  1GWM A;  3BPZ A;  2JDZ A;  4MX3 A;  1DGR A;  2VCM A;  4HG6 B;  1UOB A;  1AJK A;  4IE7 A;  2BUK A;  4NRP A;  2NMN A;  4PIY A;  1ST8 A;  1IZ3 A;  4IET A;  1PIV 2;  3OBA A;  3RSJ A;  2DCJ A;  1WCD J;  2CAV A;  1POV 1;  3RJ2 X;  5KXD A;  4GH4 B;  2IFW A;  4MV2 A;  2NLR A;  2D6L X;  1CAX B;  1F5J A;  3LGR A;  1QXR A;  4IEP A;  2VPV A;  2VUL A;  3SNM A;  1C1F A;  3S7E A;  3VZK A;  2HWC 1;  1QQP 3;  3L2Y A;  4BIF A;  4CPB A;  1AR6 2;  1KJL A;  1WD4 A;  1DLL A;  4B8E A;  2DUO A;  1K5M A;  2CAU A;  3POJ A;  3UYJ A;  1JN2 P;  4LO5 B;  4B7E A;  5C4W C;  2GAL A;  1VBE 3;  3NKG A;  5FZH A;  1AX0 A;  5F5C A;  1GWL A;  3UNP A;  3MIC A;  2NQY A;  1IPS A;  1G86 A;  3KVA A;  3PVE A;  2DFB A;  3VZJ A;  4CP2 A;  2E63 A;  2CL2 A;  1UMZ A;  2J1U A;  4QPG B;  1BJQ A;  2W2I A;  5ACA 1;  3M3O A;  5AC9 1;  1X9T A;  3IDE A;  4GUL A;  4XJ9 A;  3CMG A;  1R1Z A;  2Z5W A;  1ULC A;  1UY4 A;  4LHL A;  5FYC A;  4JKK A;  2ENR A;  1VRH 1;  2DCK A;  2IXI A;  3H50 A;  3TN9 1;  3VDA A;  1AR9 1;  5I0U A;  4NMI A;  2XVG A;  1UU5 A;  1TEI A;  1WCU A;  2YPJ A;  2P17 A;  2IXJ A;  4W50 A;  2R06 2;  1EV1 3;  2G1M A;  4H7M A;  4LLO A;  1W28 A;  2OYZ A;  2OQ6 A;  1ZZC A;  2B45 X;  2RS1 2;  1J58 A;  1QH6 A;  1NA1 B;  4PQ9 A;  4Y26 A;  3O0X A;  3C7G A;  3ZLI A;  1H4H A;  3OUH A;  5LW9 A;  1H8T C;  4JTO A;  2E7Q A;  5CFC A;  4PF5 A;  3AKT A;  1RHI 1;  2OW4 A;  1J84 A;  3R4U A;  4ERO A;  3UKN A;  2GME A;  5FY4 A;  4EYU A;  1VAM A;  4HOO A;  4BYY A;  1G6N A;  2A1X A;  5BPX A;  5E88 A;  4CDX B;  2XPJ A;  1G9B A;  1N3O A;  1UF2 C;  1T6G C;  2WS9 2;  4UFH A;  2IXL A;  3SEP A;  4WM7 C;  4JTN A;  1F2N A;  1W2A X;  3OUJ A;  3TEX A;  3ECQ A;  3ZFG A;  4EV0 A;  2VQT A;  4O61 A;  1QGL A;  5CEH A;  4MGS A;  4QX2 A;  1SFN A;  2ZZJ A;  2XLG A;  3T30 A;  2MNG A;  1RED A;  2J1R A;  3I4I A;  3WP3 A;  5GJ6 A;  2ZMN A;  4LBN A;  4XUN A;  1LOD A;  3THC A;  2VTX A;  2JDK A;  3C7E A;  4EWA A;  4GQ7 A;  4YRD A;  2JG8 A;  2R1B A;  5JR7 B;  4HKO A;  2CWM A;  2PN5 A;  2A6Y A;  3KLS A;  1GNY A;  4QPI B;  4N7U A;  2VM9 A;  4C90 A;  3GGL A;  2VTF A;  5EJ3 A;  2H0V A;  2JX9 A;  4AZZ A;  3RRD A;  4JHZ A;  4XXP A;  1T6B X;  2KD7 A;  2EXK A;  1DGW A;  4JQT A;  4Q4Y 1;  3WSO A;  2GSY A;  1GZT A;  1LHO A;  3CF6 E;  1EP0 A;  4LOT A;  3UES A;  4AGG A;  1OA2 A;  1UYX A;  2EXH A;  2LM3 A;  5FJK A;  5CYY A;  4CUB A;  1FAT A;  4D94 A;  4LUL A;  1JOB A;  2Q1Z B;  1UMI A;  1JMU B;  2QQN A;  4CDQ A;  3BYW A;  3U1X A;  2VCC A;  3PDQ A;  1Y9G A;  2XKP A;  1CAU B;  1SFY A;  5A7P A;  1R1A 3;  5H9R A;  1C28 A;  1PNG A;  2DUR A;  1J3R A;  1ZRD A;  1LES A;  2YFU A;  1VBA 3;  2WRA A;  5FLJ A;  1MEC 2;  3JQW A;  4OHV A;  4YGB A;  3VN4 A;  1IS5 A;  4GZ9 A;  3WW3 A;  4AWD A;  2BOI A;  4Q2F A;  5C9A C;  2WNV B;  2R32 A;  3RZM A;  4X8N A;  5J09 A;  4ZU4 A;  1MS3 A;  2Q30 A;  4WVW A;  5JVV A;  1AL2 2;  4AXO A;  1QMJ A;  3WDX A;  1K3I A;  2D43 A;  5HXV A;  3N9M A;  4AEM A;  2RR1 1;  4V2V A;  3VBU B;  1RIT A;  5FZ3 A;  4NAO A;  2E7A A;  1FMD 1;  1WWY A;  2P3K A;  1LAJ A;  5IK4 A;  3FHQ A;  4A3Z A;  4H55 A;  2EF6 A;  4H7L A;  5FTT C;  5FY7 A;  2ZX3 A;  4LO4 B;  4P5Y A;  5EIY B;  2E7T A;  1HXS 1;  1Q8P A;  2VMF A;  3HVD A;  2RS3 2;  5FZ1 A;  1I3H A;  3NAP B;  1ENQ A;  3BUC A;  1ZA4 A;  1LHN A;  1MQT B;  4CEW B;  2CV6 A;  1NY7 2;  2ZHM A;  3AVR A;  4GJZ A;  2UWB A;  2TBV A;  2VZR A;  3DXU A;  5FY0 A;  2E32 A;  1UCX A;  4XQD A;  4PBO A;  3RWN A;  3C7F A;  1W6O B;  1ZBA 1;  4P9I A;  2ZGT A;  2JD4 A;  1PZ7 A;  4J1W A;  4UF0 B;  3WW4 A;  3WP5 A;  5A32 B;  3RWK X;  1XPW A;  2VCB A;  1HQN A;  4E2S A;  1H8T A;  1IQA A;  2IUW A;  1AYN 1;  3O1R A;  3DPR B;  3OGS A;  3VL8 A;  1OUS A;  2NMO A;  1DBN A;  3I7D A;  2A70 A;  2RG4 A;  4SBV A;  3WUD A;  1RVF 2;  3B00 A;  4F83 A;  4B4P A;  4IGQ A;  4BPZ A;  4HL0 A;  2W1U A;  2YUE A;  4DNY A;  4LBM A;  2QQP A;  4JGY B;  4XUQ A;  3ROU A;  4M3C F;  3AP9 A;  2Y60 A;  4N8M A;  4OMC A;  5FMC A;  1BEV 2;  5F9T A;  2JDY A;  4GB3 3;  3A0N A;  1GP6 A;  4UOJ A;  1S2K A;  4XFH A;  1X33 A;  4MAD A;  1LRH A;  1RUF 2;  2VU9 A;  3OGV A;  4EQV A;  2VMH A;  4RFR B;  4K6B A;  2BGC A;  4YFW A;  2ZGK A;  3O14 A;  3UGF A;  1U5Z A;  2ES3 A;  5DDJ 2;  4WVM A;  1C3H A;  1IG3 A;  1RUE 2;  1O91 A;  1VAV A;  5EYX A;  2VG9 A;  2X29 A;  4BB3 A;  5C71 A;  4HLT A;  1URX A;  5J98 B;  1BCX A;  1BXH A;  2A6X A;  2XQX A;  3ITQ A;  3ZYR A;  4C1X A;  1LCL A;  2QQL A;  4FTS A;  5B4X A;  1VBB 1;  2VZ1 A;  4FPL A;  1JI6 A;  3GZA A;  2N7G A; 
#chains in the Genus database with same CATH homology
 2WO3 A;  2WQ8 A;  4A44 A;  1JHJ A;  3PUH A;  3W5M A;  1UY3 A;  3WNP A;  2QQO A;  4A41 A;  4DEQ A;  2XOM A;  2LS6 A;  1SDD B;  4D0Q A;  1CIY A;  1PMH X;  1EUU A;  2Y64 A;  3K4A A;  2VOT A;  2L9L A;  4BK4 A;  2ZEX A;  2HLE A;  4PQQ A;  3ETP A;  3LPF A;  3MV0 1;  1JYX A;  3OEA A;  3SKJ E;  2WO2 A;  4RN5 A;  1NAE A;  2J1S A;  4MO3 M;  2WAO A;  1KEX A;  2VMC A;  2QQJ A;  2V72 A;  2ZXQ A;  3NJX A;  3VD4 A;  3ZM8 A;  3DEC A;  5F7U A;  4CU9 A;  1MPX A;  1JYW A;  1K45 A;  3I3D A;  2W1S A;  4JX0 A;  4E8D A;  5I0D A;  2QBX A;  5DPN A;  3VD5 A;  2VQU A;  1UYZ A;  5B4N A;  3DYO A;  3LEI A;  2VC9 A;  5G05 L;  1NKG A;  3LPG A;  1F4A A;  2VZU A;  5JUV A;  3P6B A;  3MV1 1;  4JKM A;  2VO5 A;  4QB6 A;  5DQ0 A;  4CUC A;  4IUG A;  2VZ3 A;  3HJR A;  1W9W A;  5IFP A;  4KI5 M;  2B9V A;  4BXS V;  3ACF A;  3I2K A;  2W92 A;  5IYY A;  3IAP A;  3WF2 A;  3FN9 A;  4QDQ A;  2R7E B;  1RYY A;  3WEZ A;  1GOG A;  2J7M A;  3III A;  2VZQ A;  1WCQ A;  3WNN A;  1UY1 A;  1ULO A;  1XC6 A;  2VZO A;  3WQB A;  4QDR A;  1ULP A;  4GWI A;  5FUI A;  5JXG A;  3K46 A;  5IHR A;  2RV9 A;  3A23 A;  3WF4 A;  4CU8 A;  2W94 A;  3I97 A;  3LQC A;  1CX1 A;  1BHG A;  1JZ6 A;  2W87 A;  3CDZ B;  1JU4 A;  2WBK A;  1UX7 A;  1YQ2 A;  2Z4F A;  3JXS A;  3IDA A;  3VDC A;  3E1F 1;  2BGO A;  4DXS A;  4QB2 A;  3OB8 A;  1US3 A;  1W0N A;  2J1T A;  3EB7 A;  3I2G A;  3BGA A;  1UY0 A;  4AG4 A;  1OF4 A;  5EJ1 B;  2Y6J A;  3MUY 1;  5HXM A;  2QQM A;  3NNG A;  1SHW B;  1OF3 A;  1SG3 A;  4CU6 A;  3F2Z A;  4BK5 A;  3WNM A;  2JKX A;  2ZEZ A;  3K4D A;  2OKX A;  1IQD C;  1UXZ A;  1JZ4 A;  1DYO A;  2E31 A;  4JKL A;  4OMD A;  3T09 A;  4P02 B;  3LEK A;  1UZ0 A;  1GOF A;  4W8J A;  3WNL A;  4OUE A;  2BER A;  3NRU A;  5C7G A;  1O59 A;  4UI9 L;  1JU3 A;  4CUA A;  4XZU G;  1JZ2 A;  2V4V A;  1J83 A;  4MOA A;  3CIH A;  4P00 B;  3SEE A;  4QAW A;  3I2J A;  2W1Q A;  4OYU A;  4QB1 A;  2WN3 A;  4DEV A;  3VD7 A;  1XNT A;  2W9X A;  4LQR A;  2JDA A;  2BBA A;  4QX3 A;  3FL7 A;  4BJ0 A;  1TG7 A;  1W99 A;  5JXI A;  2HYX A;  3I3B A;  3AC0 A;  2E26 A;  2Y6G A;  4GWJ A;  2EIE A;  4QPW A;  1H6X A;  5LA1 A;  3WNK A;  3K77 A;  4DXT A;  3OGR A;  1K42 A;  4KWU A;  4L0P A;  2XHN A;  2WO1 A;  4CU7 A;  2VME A;  4XVH A;  3CKH A;  3HNM A;  2YG0 A;  5LA0 A;  1US2 A;  2W95 A;  1JZ8 A;  1P8J A;  5A1A A;  2Y6K A;  3K4Z A;  3T2Q A;  3C7O A;  4QDS A;  3SKV A;  4ARX A;  1UMH A;  3I3E A;  2VZP A;  2W5F A;  4CVU A;  1UYY A;  4XUT A;  1H6Y A;  1CZS A;  1DLC A;  5HPO A;  4XUO A;  1JZ5 A;  2J1E A;  2PQS A;  1O8S A;  4A45 A;  3MO4 A;  2W3J A;  3A21 A;  2JD9 A;  1UXX X;  2CDO A;  5JMO A;  3HOB A;  1L7Q A;  2WAA A;  4P08 A;  2RVA A;  2WN2 A;  3DYP A;  1JZ7 A;  3P1I A;  1CZT A;  3GXU A;  3NJV A;  5J1X A;  3C7H A;  1WKY A;  2VCA A;  2DDU A;  3ABZ A;  3T2P A;  4PT6 A;  2X10 A;  1DP0 A;  2ORZ A;  3FHA A;  1UWW A;  4A6O A;  4DUV A;  4ZZ8 A;  4UAP A;  2ZEY A;  5JR2 A;  3T0D A;  4HG6 B;  3BN6 A;  3PUI A;  1KGY A;  3MBW A;  3OBA A;  2DCJ A;  3GM8 A;  2C9K A;  2Y6H A;  3IB3 A;  3NQH A;  2BZD A;  2ZEW A;  2Y6L A;  4MGQ A;  4AAX A;  4DUX A;  4A42 A;  1O8P A;  3UNP A;  2W47 A;  4D8M A;  1JI6 A;  5C70 A;  2J1U A;  2J1A A;  1I5P A;  3VD9 A;  3CMG A;  2W1W A;  1UY4 A;  2W91 A;  3LE0 A;  3A7Q A;  4JKK A;  2DCK A;  2ID4 A;  3HEI A;  3CQO A;  1F4H A;  4TXW A;  3VDA A;  2EIB A;  4W50 A;  1GMM A;  1L7R A;  3IAQ A;  1XNA A;  3C7G A;  1J84 A;  5DN2 A;  4DXR A;  4XUR A;  3I2H A;  1UY2 A;  2C4X A;  3W5N A;  4TTG A;  1R64 A;  1W9S A;  3CZJ A;  1GU3 A;  3OG2 A;  4DUW A;  2E33 A;  2JE8 A;  2CDP A;  2QQK A;  1W8O A;  2YB7 A;  3SEP A;  5EJZ B;  2YFZ A;  3ECQ A;  3DYM A;  2VQT A;  3WF0 A;  5CZK A;  3LEG A;  4MGS A;  4QX2 A;  2C26 A;  1T2X A;  2W46 A;  2J1R A;  5IFT A;  3HN3 A;  4XUN A;  4ET7 A;  3THC A;  5JXH A;  3C7E A;  1TVG A;  3EYP A;  3OEB A;  2X05 A;  3C8X A;  3VD3 A;  2ORX A;  1NX9 A;  5G04 L;  1EUT A;  1CZV A;  2EID A;  1GNY A;  2VM9 A;  5DMY A;  3GGL A;  2VTF A;  4W4Z A;  1JZ3 A;  4E8C A;  4JHZ A;  3WSO A;  2KD7 A;  1PMJ X;  3THD A;  3UES A;  4ZZ5 A;  4KMQ A;  1UYX A;  2VMD A;  1PX4 A;  4A4A A;  5CYY A;  4LHS A;  4CUB A;  4XUP A;  1GUI A;  1D7P M;  1UMI A;  2QQN A;  3ACI A;  1PX3 A;  5JXJ A;  1JYV A;  3A22 A;  1OH4 A;  2VCC A;  2J1V A;  4ZY9 A;  4OZO A;  5LCW L;  4YPJ A;  2YFU A;  4GZ9 A;  1GOH A;  2WYS A;  5LA2 A;  4QX0 A;  3I2F A;  4LPL A;  2VZV A;  3ACH A;  1K3I A;  4M4R A;  2X09 A;  3WF3 A;  2WZE A;  3VDB A;  2WAB A;  1LNS A;  3HNB M;  3WNO A;  3FHQ A;  2V5D A;  4A3Z A;  5EIY B;  3MUZ 1;  4P5Y A;  1NUK A;  3UET A;  4M4P A;  2VZT A;  2VMF A;  3HPN A;  2BGP A;  2LW8 A;  1OD3 A;  4ARY A;  4ZXE A;  4LKS A;  2YC2 A;  2XON A;  2EIC A;  3J7H A;  3T08 A;  1W9T A;  2VZR A;  4PF1 A;  3WF1 A;  2E32 A;  2J22 A;  4Z2A A;  3C7F A;  2VZS A;  1W8N A;  1XPW A;  2VCB A;  2VR4 A;  3OGS A;  2VJX A;  4QX1 A;  2QQI A;  3T0A A;  2WZ8 A;  2W1U A;  5IJR A;  2Y8K A;  4XUQ A;  4OMC A;  3U37 A;  2YC4 A;  1JYN A;  4UOJ A;  4MAD A;  4BDV B;  3OGV A;  4RYD A;  2WDB A;  3K75 B;  3T2O A;  4FI9 A;  2RJ2 A;  3CZU A;  1K12 A;  2B4K A;  1OT5 A;  3I2I A;  3HNY M;  5C71 A;  3T0B A;  1GQP A;  2WUH A;  2XQX A;  3D3A A;  2QQL A;  5B4X A;  2VZ1 A;  2VL4 A;  3GDB A;  1HN1 A;  3ACG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...