1CXKA

Complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxkA01
3QO0A 5SV4A 2X1WL 4GZEA 4CRPA 1B3ZA 1II4E 4JREC 4BS0A 2EIZA 1UWIA 3MFGB 1ZJBA 2R8SH 2ICWB 1W9PA 1TJGL 3FQWB 4PLKC 4Y88A 2FB4H 4I2XA 1DWGM 3DYOA 5DMJB 3KPSE 4DZ8A 1I4FB 4PRID 3VIIA 3FT3B 3QWOA 4P2RD 1FFPA 4R4ND 3CZGA 3IETA 4FQLH 5HVFB 2BV9A 4L29B 1UKQA 1WIPA 2NT1A 3IFOA 1XFPA 4Z76A 4NZDA 4M8UA 4AJ0A 2FGWH 3JV6B 4PRAA 2X2JA 2EPOA 3AIRA 4P4KA 2P47B 4N8VB 3WMBA 5F9OL 5F9JB 5C2BL 2IAMC 4MX7A 1X9QA 4L8SA 1R5WB 4Z7UF 2E7LC 4I9WE 3IJYA 3MBEB 3RIAF 5D1XD 2VNCA 4BH7B 3TN0D 3P11H 2P49B 1EVTC 5J3HC 1Z0NA 4H0HB 2ZUVA 5E8DH 2GITB 4UNIA 1H09A 3VIGA 3OGCA 5TDNA 3AIBA 1D5ZB 1RULH 3M1BB 2Y06L 3WH5A 3HTLX 5ENWB 3L7EA 3LEXA 4K3JL 4OD3L 8A3HA 3CLWA 1EGJA 5E2TH 3FQXB 1EVUA 4QRUA 3QFJD 4CVZB 4AD5A 1OWRM 2OJZH 1UJ3B 4S1RH 4U2ZA 3RUGA 3ZJ6A 1RUKH 4X7SH 5HTSA 3BW9A 1E3XA 4PJFA 3NN8B 5B3JF 2OYKA 5IK3B 3HZVB 3S5LB 1E4WL 2BSSA 2K7PA 4J1UA 4PJAB 2BVQA 3VO0A 5FOOA 4S3JA 3E3QE 2BCKA 4JFHD 4KRPB 2GSGB 1PY4A 1N7MH 1VFAA 4NQTA 4JO3L 1JV5B 2XZCH 1FL3B 1EOKA 4PJIF 3RO8A 1GGYA 1UT9A 5FO9A 4OF0A 3QT2A 1M6OB 1YQ2A 2H8PB 3SEPA 3BWAB 3QHFH 2ESVB 4O5LL 4XAWL 3JVGC 3PWPB 2WUBH 4LQFL 3CZEA 4HIJA 4WCYL 4P48A 5ABFB 3FQUB 3NCYP 2NY6D 3RZWA 3DX0A 4FNQA 3ZYJA 5C09D 2AEWA 1NDMB 1TENA 4JY4A 2GTZA 2F54B 2YUXA 4LCWB 4QHUA 5DFAA 1T7WA 3HFML 3QIBA 3L2MA 3MYZA 3FB7A 1AFVL 3IDIA 4F7CB 3VSUA 4PP1C 1HN1A 5FDWA 4AMCA 4ZUVA 3X3GL 4LOUC 2EEDA 4GXVH 1MUJB 1P9MC 1I8MB 4M6NH 5EUKA 3OKEB 4Z7WE 1N5AA 2EXOA 4K3DL 1I8IA 1OPGL 3W6MA 3X13A 3MV11 4XCYB 3SBWA 3WEZA 1S5IL 1BVKA 1WDQA 3WFBH 1MLBB 4KQ4L 2VZ1A 1PX8A 1QTYT 3DVGA 2HA1A 2DJUA 1CLOH 1F58L 2H6PB 1YEFL 1SY6L 2OXHA 4LLUA 1EJOL 1WEJH 4U5IA 1DBAH 5KJRH 4XPGH 3QDGD 7CGTA 5EB8A 4POUB 3WIHA 4PJ7E 5DQJB 3DLQR 1B3VA 4Y4FB 1VGEL 2X44D 1R7OA 1PZ5A 1A14L 1UQSA 2ZUQC 3QDJB 2H9GB 2P1YA 3BZDA 1FNEB 3SDYL 1AVAA 3L3GB 4JDVA 4MNGB 1KBGH 1QNZH 1H41A 2V5CA 3C5JA 2HG5B 5BOPA 5C8JB 3SGEI 3RWGB 4XAKD 1MHPH 4ELME 5GRYA 4NSKB 3FCTB 1ND0B 4C56E 1UB5B 5ID1A 1JMZA 3P30L 3UBXA 1MFCH 5E5MB 4HWEL 4LPCA 2Q7YB 3F7PC 1OSZB 3V6OA 2OM5A 3TFKC 1UCBH 1U33A 4HUWA 2BJML 1UKOA 1LK2B 3C60C 5BQ7B 3TH3T 3VWKC 1HXMB 3F7RA 2A83B 4P2OB 2GJZB 3H9SB 3G5ZA 5CINL 1DQQA 3OKMB 3QUMH 5FM5M 2IH1A 5FUCE 5J0BA 1FNAA 5INDA 2GJ6D 2VN7A 5EU3B 1R85A 4D6CA 4ODTH 2GUOA 4Y1AD 5AZEH 5IBTL 3NZ8B 4PTXA 1AO7E 3FZUD 1P4BH 3TIEA 4AQOA 4J4PD 5ID0B 4RGNB 1L9MA 4PRHE 1KTLA 3GTNA 4H8WL 4H25B 5DJDB 3BE1L 2IADA 4G9FB 4XBPA 1RZKH 5HYIA 4N1CA 4DM2A 1QUNA 1SYSB 5EZIL 2WBJC 2GDUA 1K9DA 4M24A 2LTQC 4CD8A 1I8LC 5IW6A 1EOMA 4R26H 5IB3A 4QXUL 1PKQE 4UIMB 4P5TD 5C0AD 4YR6B 3FQTA 4PB0L 4F7TB 2OJEA 4V2XA 5A2JH 1QRND 4P59L 5D7JB 1DJSA 1LO0H 1Y6KR 1DBJL 4IRJC 3RZCC 1WBYB 4ZUWA 5EO1A 4DUVA 3NGBC 4RMQA 4XCCH 5HYSA 5C0NC 2HLAA 1UM5H 2ZUUA 3TCLA 3LRSA 1P53A 1BFTA 2HWZH 1D5MA 2J62A 1YEJL 3L4WA 1BQHA 1N0XH 5C0CA 1JFXA 3VRIA 3AC0A 3DX6A 3PGFH 4WU5B 1ZANH 4MA1C 3WIJA 5E09A 4RWHA 1FZKB 5JBDA 4Q9RH 4M7KH 4XX1E 1V8HA 3RWJA 2BDNL 3ARPA 3BC9A 3GMPA 1YEGL 2XKNA 4OIIH 1CWYA 1HQ4B 5C08A 1RZJL 3UESA 2ITCB 1DBBH 1CLZH 2CH8A 3KE0A 1JNNL 1A6ZB 1ETZB 1BYCA 1EERB 3VFNB 4WI4A 5I71C 5CEZD 5EU5A 1WKYA 2DQEH 4JL2A 2XGBA 1EEQA 4U1SB 5CQ1A 1A7RH 4BUHA 3ZTJH 2NY3B 1WNOA 4J3TA 1W3HA 1V3KA 4AIUA 1BREA 3PIQA 4YHKH 2ADGB 2IXVA 2A6KA 3RGVB 3ZJKA 2CLRB 2EXWC 5DD5L 4U3CA 3OG2A 4U6HA 5F7UA 2ZZUT 4GMSH 1N5YH 1T83C 4BF7A 3MLWL 4XWOD 4AIXA 1QLEH 4JFEA 3DVNB 3TVMB 2J7EA 1Q6CA 4Z78A 4ZUUB 4Q2ZB 2K9UA 2NY5L 1R3KA 1GJUA 5I23A 2OZ4H 3SDXA 2MJWA 3H3BC 3VXQA 4Z2IA 4KK8D 5FOBA 4ATDA 3EOYG 1EJ6A 3DNKA 3HNTH 5D5MA 3ZE0F 2R69L 2KH2B 5F7EL 4AZ8A 5CJQH 4GS7C 1Z2KA 5E8OB 4I1NB 4A6YA 3O6FA 2CD0A 3BKCH 3DRTA 4GBXA 1CXIA 1JNDA 4HJJL 5IEHB 1LQ0A 1TZGH 4O9HH 2F5AL 1QNPA 2DT3A 2NW2B 5D7KE 4ZOCA 5DQDL 5DT1H 4AY0A 1HIMH 1I7ZA 3TJEL 4WHTB 1MW0A 2VWEE 4U0QB 5KVEL 3U46A 4APQB 2FIRT 4PJ8A 5TDPB 1E0WA 4QHMB 5C9JA 3LXAA 4HA4A 1FL6B 1LP9F 3OR7A 1UD3A 4ODUB 4QXGH 4PGCB 5EU4A 3QI9C 3DUHA 3X12B 5LA0A 5MP6H 2X5PA 4Z77B 2VDKH 3EFFB 4WU7A 4TVDA 5F7DB 2DLEA 2J8UF 3TBVA 2D7MA 1A9BA 2DI8A 3SY0B 4QTIH 1HHIB 3FAWA 12E8L 2XN2A 1EAPB 3CU1A 2GQHA 4DFIA 1LG2A 1UR0A 5ACMA 2EE3A 4HGWA 5FHBL 4G8FB 1HHGA 4I4WA 3MBED 4R8WH 3V7MA 5T3XL 1ED3B 3LS5H 3ARGC 3VCLB 5EU6B 1MWAB 2JKXA 1TZHA 3CFJA 3HE6B 1I1AD 4GUPB 1ZHLA 3MFFB 1BQCA 5TDOA 1E6OH 4CKVX 3ZMRA 2ADIB 4PRWA 3HAEG 2H26A 2BOCA 4JEGB 5I1AA 3L5IA 4R4FH 4R9HA 4X9GA 4TVSa 1KGUA 3TT3L 1G7PB 2JK5B 3QNXB 4WWKB 4HS3A 4XVUD 3VIFA 5IMOB 2V2TA 1T7XA 4Y5YC 5E2UL 1NFKA 1LGVA 3PZ9A 2H41A 4IHOB 3NIFE 4IIQA 1OTSC 4LSRH 1D5BB 2IH3A 3BQUB 1HDMA 3SE9L 3QQ3B 2A0LC 4LIQE 3N1FC 1C08A 2YN5A 3V8CA 3WF2A 3ZIZA 2NR6D 4XRCB 1NSNL 3GMNA 3JTSB 4KRPD 2VAAB 2DI7A 1CU4L 2EIZB 2A6IA 5FYKE 5AZ2L 1BAFL 3VA6A 5KOVC 3HZ3A 4XP5H 1BM3L 3GO1L 3UJIH 4U6YA 4OIFA 4GW4B 1MRDH 4M7LT 5F3BA 3S98A 4M8VA 4HUXB 4XXDB 2GDVA 5L7XL 2DQHH 4Z76B 3UYOD 5DO8A 3W4RA 2ESVD 4LEOB 5JPNB 2NYYC 1OSEA 3PV7A 2X4UB 3W6LA 1XGYL 4P2CG 4P4KB 4JHAL 1BIIA 4XBGB 2X4NB 4F58H 1JGLL 1YEEL 5DWUL 2F54D 1UYWH 4ZSOA 3OR6A 5EA0L 3I3DA 4QT5A 4JKPL 3VX1A 1FO0A 2B7DT 3QUZA 4HLJA 4HPYL 3IAQA 5LWYH 3BVXA 1FIGH 1BEYH 4W93A 1UB6B 3ZDXE 2ZUNA 1WC7A 3C5ZA 2DM4A 4OFYD 2OS7A 3KXFB 5F7FA 1LP9B 3OG6B 3L1OL 4OB5L 4K7FB 3AM8C 3WY1A 5L6YH 3KNBA 3MRLA 5DEGA 3IB4A 4IRSD 4ZODA 4KHXL 2FX7H 4D3CH 3EO0B 4LPVA 4JAWA 4FQCH 1UH4A 4MCYB 2VX5A 1MHCB 3VXNA 2BSSB 3MJ7B 4Y4FD 4AEIL 1JVKA 1WF5A 5CD3A 3U4AA 1AD9A 4L4VB 3BGFC 2OL3A 2DT1A 4AL8H 4UAOC 4Y4HA 5DUMH 4P5KB 3ARBB 1J5OL 3E2HB 1FCCA 8FABB 3LN4A 3GRWH 1A1NA 2CR6A 5CEYB 5CJ8A 4N0RA 3ZDYF 5FO9B 5KSAA 1WJ3A 1UR1A 5FUOH 5I5RA 2WINB 5A16A 3WQWA 4GI9A 1JF5A 2YUVA 1KTRL 4GW1A 3BPOB 1CCZA 2EDQA 5A6BD 3VXRD 2BNRA 2YUWA 1OAXH 4R7DB 2X70B 3QYCA 1OAKH 4JY4B 1BGXL 3DSFL 4OZHE 4P2OD 3FB7B 3H9SD 4M9OA 4OD1H 2Z4QA 3I02B 3MYJA 1LF1A 4OLZH 2VXTL 5FDWB 3TEUA 4AEHL 4PUBH 4LVHB 5DJZA 2UVEA 2W0LA 4G6KH 4PBWD 3H7LA 1LWJA 2VDNH 3DDFA 3EMZA 4PN2A 4G43A 3VM5A 4FA8A 3D51A 5KSBF 4FNTA 1GGCL 4OZGE 3O6LH 3ESVF 3D48R 4MA8H 5HI3D 2YKLL 3EO1B 3MU7A 1BVKB 3D2UA 3QQNA 4ZS6D 5D8JH 1JAKA 2D31A 3VXUD 3MJ6A 3DVGB 2OXGA 4G9FD 4LF3B 4JZ5A 2CRYA 4NHUB 4PLOB 5T5NG 3IKKA 5TFSL 4LLUB 3RWDA 4U6TA 3HMXL 1IAMA 1IZJA 2C1OA 5EFFA 3DXAD 3CTTA 1BPLB 1B2WH 3GXDA 4POYA 1UQSB 1AGDB 3CVIL 1LG1A 2EDXA 1TQCB 1G7IA 1E4IA 4JDVB 1ROWA 1N64L 3N9KA 3NDZA 1CL7I 4OSUL 3V52H 1XCQA 2BY0A 2IAMA 3M17A 1B4JL 5EULV 4XB7A 3N1PC 4ONGL 1ZVSB 1XYZA 1N4XH 3NIYA 4LSUL 2HJLB 1G7HA 3OPZL 5ID1B 4NRXA 4LIQH 5C9KA 4DGIH 5HI4D 3B9KB 3T0VA 4DQOL 1H1NA 2VI0A 5LGHL 3STBA 1FFRA 2FGZA 4WEMB 4X5WA 4GRLB 1F4YL 5FYKH 5GRJH 3VXTA 1CN4A 4HUWB 4Y8AA 3CDCA 1QWNA 4KUZL 5DI8B 4EANA 2W5FA 3G6AB 2DLTA 4FQ2L 1NUDA 5ECJE 1BVNP 4MAUH 1NC2A 4O02H 4F7MA 3U7WL 1DQQB 1CXKA 3Q3GB 4WUKL 3FB8B 4X4ZA 5INDB 4FK9A 3I9GL 4YO0A 5D71H 1FV1A 4AXNA 2HRLA 2GUOB 4PRIE 1JPSH 3OKLA 3RKDD 5C0JB 4BQ4A 1E5NA 2DEPA 3T4AA 3I2CH 3WD1A 3LKRB 3DV6A 1UEMA 2QQKH 3ZKNC 1KV3A 1K8DB 4AMKL 4M6ML 2FECI 4C83A 3VFUA 1EZVY 5I1GL 4E2OA 1KTLB 1UWEH 4OLVL 3GSRA 3EYQC 4RMSA 3RGVD 3X3FL 4DM1A 3NTCL 1FC2D 1TJGH 2EC8A 1YPZB 3WN5C 1E6PA 2Y5TB 5LKNA 2P5EB 4UU9B 5IW6B 1ADQA 4P23A 4FQIL 1TPXB 3SGDH 3TVMD 1MWOA 4PG2C 2XFRA 5DF0A 4P7QA 4KKLC 4YUEL 3L7FA 5J56B 4QCIA 3VWJB 4FFZL 1CTNA 2KDGA 3L3IA 1U8QB 1K9EA 4O2EB 3TO2A 5E8NA 1MRCH 1W8NA 5EO1B 5I73C 1F00I 5F9OH 5HYSB 5C2BH 2HLAB 3GKWH 4G7YL 2W63A 1LO2H 3MV7D 2EC9T 4P0DA 3QFJE 4MJ6B 3ULSA 3SO3C 4XNMB 5C0CB 4G8IA 1P9MA 3DX6B 5DC4B 4G7VL 5I16A 3KJ6H 2CGRL 5EFIB 1OT2A 5KOMC 3VGEA 3LIZL 5FF6B 1P7HL 4APQD 3NMEA 2BVTA 3EMQA 1F3RB 4PREA 1US2A 1G7MA 4QHNA 4JJHA 4BH8B 2VL5B 1DQJA 2PYEE 2PO6D 4K3JH 2F2HA 1CZ8L 2EKJA 4LSPH 3ZKMC 2HFGH 1DUYB 3GMPB 1HXJA 2HJFA 4R2GD 2XKNB 3D18B 4FQJH 2DDQL 5C08B 4HKZB 2MPAL 1U58A 2IUZA 1X5ZA 3WELA 2HT2D 4QRSA 2V9RA 1KQYA 5F6IC 4FLQA 1FNGB 1H3VA 5HHPA 1ZHBB 2YPLD 5GSVB 2P8PA 4ZAKB 2W9LA 1R3IH 2K1MA 3WJLC 3MRMA 2ERJC 1OINA 2XVLA 3PIQB 5DEFB 5BO1H 3PQYA 4Z7VE 2EDYA 3SE8H 4M5ZH 2ZX7A 3UPAA 1P2CA 2PWGA 1UR2A 1ZGLA 2VRAA 3ULUF 4JPWL 4R0LA 5EU6D 1GOOA 2J2ZA 1KF9B 3DMMD 4UOQA 3HE6D 3PXHA 1U91A 1XIWB 5I8KL 4PRPB 4XCEA 4DEPB 3FNDA 1WCGA 5E6IC 4OJFL 4U6XB 3SDXB 1FL5B 3RMEA 2UWEA 5L0QB 3KPMA 4JIEA 3EW3B 5AUMB 3C60A 4WWKD 3W25A 1NFDE 2DQCL 1T5XB 4ACZA 1S3KH 4KKNA 1D6EA 4NWUL 2G5BB 3O6FB 4GQQA 1V7MH 1JNJA 3BQUD 1UD2A 1XF4A 1MCEA 2ATPB 1L6ZA 1CICA 2P46B 3QUYC 1V6VA 3BP4A 2VX6A 2NY4C 3DVFA 3AHZA 1ITXA 4OD2B 3QDGE 1WBXA 3ARQA 1NOFA 1M1SA 4LRIC 4HULB 3SKOA 2CUHA 3OR7B 2FE0A 4G6FB 3F12A 5C0EB 5EU4B 1KT2A 4L9LC 2Q8XA 2D9QB 1EGZA 4JQXC 4O51B 1VSCA 2JIEA 4WU7B 3SCMC 4YIQA 1F58H 2W92A 2WBJA 5C7XL 1SY6H 4G8EB 1I8LA 1EJOH 3T8XA 3PE9A 4I48B 3T3PF 1IC4L 1I7TA 4D94A 3SDCA 4P4KD 1VGEH 4MD4A 4WEUD 4PRDB 1A14H 1WCBB 3PTKA 3BUBA 4MXVF 4BQ2A 3MMEA 1HHGB 1IGIL 1UZ8A 2R4RL 4IRJA 3TZVC 3RZCA 5CP3H 3AU1A 4KI5F 1C8PA 3RY6C 3O2DA 1F6FB 3KS0H 1JGEB 3IF1A 2XICA 5DFVC 5TDOB 2MTPA 4QNPF 4UUJA 3P30H 4QHLA 1QKZL 5MENE 1C92A 1GQLA 5A2KH 4LLAA 5F6HI 5K59E 1G7QB 3KXFD 4KROB 3RVXD 5DJ2A 4HWEH 5I1AB 4Y1AE 5MI0C 1QI3A 5MEQA 4FLSA 5GRVL 4EDXA 1KJMA 4MQ7A 5F21B 3RIKA 1QYGH 4M81A 3VI3F 5CBEA 3ZT6A 1XGTB 3KZSA 5FYJL 1J11A 2WHJA 3MSGA 2Y72A 3TH4T 4F2MA 4HOZA 4W89A 4IJ3B 1AXSA 3V4PH 2ZOLA 2BY2A 4YNYA 2AEQL 1BFSA 5HHOE 4L4VD 5JLZA 2HVMA 4G80A 4PJHF 2ZOKB 3OL2A 2A6IB 5T1LA 5JQ6H 2OR9L 4GQ9L 3B6SA 2F7RA 1RZKC 4TSBL 3RRQA 3STZA 1G1CA 4S2SA 1E43A 1QRNE 4JFWA 5D7IB 5EZJA 1CFVH 4H8WH 1QA9A 1PY9A 5F3BB 3TESA 1BVLA 3BE1H 1BBDH 2X4QB 3B9AA 4P2QA 2CKBB 4UNTA 4TQEL 3LHPL 5CPQA 1O7AA 3TBWA 1XV8A 1U8NA 5D9MA 3SDDB 4JRXA 1G9NL 3W37A 2G3MA 3KLKA 1U36A 3SJVB 5DJAB 2F74A 1E6XM 4HT1L 1RP8A 4J12A 3EHBC 1BIIB 2V2XB 1U42A 2Z9TA 3OZ9L 3BH9A 4PB0H 3QP3A 4PJIA 3RX5A 3QIBD 3CH9A 5GS0C 2C0HA 4B9ZA 2EYTA 3ARYA 2YEZB 1ZLVH 4QT5B 1DBJH 2DJSA 2QSTA 4YHNA 3VI4E 1I1XA 5IMMA 4MQXD 1GGUA 1A47A 4PP2A 3NFNA 2JIXB 4MJ4A 1NCCL 3V0WL 4NZCA 2QADC 1ISYA 5DZNA 4H0GA 2N56A 1YEJH 4GW5A 1NKOA 4KKCC 2DH2A 2W1NA 4ODXA 5H2BA 5T33H 1A21A 2D4FA 2VDOL 5C86A 3BKMH 1U2HA 2ZUTA 2FYYA 3HC3L 4M62H 3KNBB 5DEGB 5DYOB 1SEQH 1J12A 4Q6IC 4WEBL 4KDVA 5JOFA 3NSMA 2IALA 4Q22A 3Q6FA 4LSDA 3CFKA 1RMFL 4RFNB 4UQ2A 3PWLA 2BDNH 1MY7A 3BVNA 4NUJB 4D0DA 3F7QA 3DPBA 5IW1A 1OB0A 4DVRH 4JRYE 5EOCL 4E0RB 2XFXB 5GPRA 4HF5L 3CXHK 5AYIA 1E4MM 3CVHB 2BVYA 2BFGA 1JNNH 2VE6B 2FWOB 4EEEA 4P46C 4NZRH 1UOKA 1NBYA 4P4RA 2E9BA 3LN4B 3U9PH 3JUZA 4JFOB 5B8CC 5BS0B 1F4XL 4LSVL 3SGKC 1CI5A 1H5BC 1U8MB 1BIHA 3QEGL 4JFUA 5FL0A 3ARGA 4M4PA 3F58H 2F8VA 4DTGL 3WMSA 4GW1B 3FRUB 5FKAA 1KLUA 4UQEA 3BDYL 1RJZA 2MCPL 5EBMB 4HX1A 3ULUC 5A3HA 2OBGA 4NUGH 2Y07L 4MNQA 2Z4QB 3MYJB 2PR4H 3HAEH 1S7SB 1S7TA 5DJZB 5F7EH 5ALBL 4YDKL 5FK9A 1EUUA 1U8IB 4U1KB 1Q0XL 5HI5C 4UFKA 1TQUA 3CPLA 4NJ9H 1I9JH 4YXLL 5DQDH 3L5WB 3WSQH 3D2UB 3TJEH 1N0LA 1XGZA 4WHYG 5KVEH 4HQQH 1J1OL 3C8HA 3NCJH 2NXZB 4PEEA 4OM0L 4PIRF 1FAKT 1NH6A 2G8ZA 3BUYB 5FL1A 4N0CD 2C1OB 5SWZB 1TA3A 3BISA 1KGWA 2ALWA 1I3GH 5BXSA 1H5VA 4MAZA 1NP2A 3LPGA 1H2JA 3JBG7 1FYTE 1G7JB 2G3IA 5F93C 3JWDL 2FH6A 1G7IB 1X5IA 4I18B 5KAQF 4GKSB 4YE4L 2IPUK 3D69B 2L0DA 4FQPA 4PJGF 5FOJA 2CDFA 3O6KL 3WUBA 2XNAA 3JUYA 4P9HH 3P73B 4N1HB 3DUUB 2KPNA 4JR9L 1A7NL 4X6FB 1G7HB 2XTJE 4FABL 1UWSA 1EH9A 3RTQC 4HTYA 4JG1L 4N0UE 3UMTA 2DQIL 5C0CD 5DHVA 3BPLB 4M43L 1T7YA 3QG7H 2ZUXA 3G08B 4XCFL 2ESCA 1PZ3A 2IFFL 3LS4L 4KI5C 1HP5A 1AGFA 3PZQA 1L0PA 3ZDZF 3OX8A 5HY9A 1EHLL 3EMCA 3VPLA 4Y7MA 2VZOA 3AM8A 4OGYH 4QP0A 3TT3H 4MGXA 1EFXA 2XIIA 3W0WB 2Z92B 5C08D 3CMOL 3EO9H 4G8GE 5E2UH 3CX5K 4OFDA 4ZS7L 3GI8L 2VYRE 3OKLB 5FCSH 3T4AB 4RRPA 3GBNL 4ZAKD 1TZIA 1QD0A 3ZL4L 3EJSA 4PJCF 5TJWK 3B2VL 4O2CA 3VFUB 1C5BL 1PKOA 4PYGA 1T4KA 2ZNWA 1AY1L 2XWBB 3GSRB 1WAAE 1CU4H 1FHGA 4X6CF 3OJDA 2VDRL 5AZ2H 2ZP0T 5EIIB 4UR9A 2VLKB 4HUVA 2OTPA 5DD6A 5TQ2H 2WM0A 3FTGA 5CIPB 4PPTA 3Q0HA 4P23B 3IDNA 4JFED 4LHUG 2R1XB 2DMKA 2BHYA 2WQ8A 5L7XH 4YHYB 5JTWA 2I60L 1OD8A 2E9IA 1MCPL 2RQ8A 4WW2B 5IBUB 2CHNA 4GKLA 1GAFL 1PX4A 1GQKA 5D9NA 5E8NB 5IHUH 2VX4A 3VH8A 3PWJA 5GGQL 2VISB 4PJBF 1M7XA 1VPOH 3O6FD 4JANA 1JGDB 2X89A 4GBXD 3CD4A 1KC5L 3ULSB 4FQXB 4IOSD 3G6JE 4KK9D 1KIPA 2AJYH 4GLRH 4JKPH 2BSTA 4G8IB 3IDJA 5I16B 1WISA 2E6QA 2LAAA 3PGDB 4I3RL 5EO0A 2IANA 3VXMB 4MDIA 4FLOA 4PREB 1NC4B 1G7MB 2HT4D 4QHNB 3WHXA 3AREB 5D93C 2DIEA 5L2KA 1FP8A 2ICEB 1E1FA 4QLKA 3L1OH 3QA3A 5LAXB 2CKSA 3PF2A 1WP6A 2HJFB 3H42L 2NXYB 1ISWA 5TQ0H 2FGLA 1A3LL 4KKBD 4H04A 1R3JA 2H32H 2R1WB 1U58B 4NKQB 2PXYB 4KHXH 2HISA 2FX8L 4JFDA 1XF3B 3BXWA 5D9SB 3VW3H 5I74C 4UT7H 3WFEL 2MHAA 4YHLL 4UBDC 4Q9QL 1JAEA 2Y6SC 4AEIH 2DH3A 3G5VA 2C3GA 1HYSC 3EDFA 1P6FA 3ALPA 1HSBB 1Z9MA 4CN4A 2ZXDA 1KJ2A 5DURD 2ED8A 1RSFA 4JQIH 1J5OH 2Z93B 5LXGL 4R0LB 5HPMB 1QBAA 5DUPL 3VFVA 4XMLH 3U6RB 4JFQA 4NZFA 4D1IA 1U91B 3MOBL 2CQVA 4OUUA 3OZPA 3S34L 4J6RH 1Q4NX 2UY3A 3TO4B 4DVBB 1WTGT 3UPRA 4NWTL 4KK6C 1FH9A 2DLFL 1RV6X 3JXAA 1DDHA 4RNRA 3LPWA 4Y19E 3GXTA 1UWTA 3IJSB 2W9EH 4LCYA 3WBEA 1WZMA 1P4IL 3HC0A 1C8YA 3H9ZA 1FFNA 1LEGA 1BGXH 3AIVA 3DSFH 2ZSVA 1WWCA 3ULVD 1BLNA 1MF2L 3HUJE 1XF4B 4OT1L 1JD9A 1EMTL 4PJXE 1CICB 1E71M 2ENYA 5F7NC 2E40A 1O5DT 5JORA 3DXAE 3RM9A 4LVOB 1T2XA 1QNRA 3LRHA 3H3PL 4M1DL 2EIBA 3BKJL 5F6HJ 4CAGA 1WBZB 5GS1C 2VLRE 1NCBL 3SDAC 1A6UL 3KLAA 1QW8A 4GI8A 3FFCA 4LLMA 4YHOL 3HG1A 3GSNH 3MA7A 2CIIB 2VLMD 1U6AL 3WN5A 3LRMA 2WBJB 4NKIL 1T0NA 2F19L 4GKNA 2CO7B 1N8ZA 5I8EA 3S96A 4OUOA 1I7TB 4LEXH 4KY1L 3SDCB 4PG2A 5CG0A 3DX2A 1NKRA 5EC2B 3CHFA 4KWUA 5JR1H 5F3HB 2XA3A 4YK4C 1A3RH 2HYMA 1CIUA 4U1MA 2PBOA 1QI2A 4UB0H 1N64H 5DHYA 2NY0D 4ZFGL 1MNUH 3VINA 3QUZD 1NGWB 3PP4H 4HWBH 3GB7A 4PJDF 3QEQA 3WN6A 3MBXL 2CBJA 2XM2A 2X0YA 2JIXD 3MODL 5KBNC 3IF1B 4ONGH 4LDEB 5DK2B 3HG2A 4TPRH 5EUOE 3TYGL 5JZ7D 5E5RB 3BHBA 4YHIA 1EO8L 3DBXA 2IBBA 3BMWA 1H3TA 3V0VA 3EKCA 4PJ5E 4UUJB 1RK0B 1ZVYA 2XUCA 4MA1B 1U0QA 3BZ4A 1L4IA 3MLRL 5E95B 5LGHH 4DQOH 4HWNA 5D96C 5L9DL 1VJSA 3UROR 1K4DA 1MFEH 3LB6C 2Q86A 3U7YL 1L7TL 1JUFB 3HE7B 5JW3L 4HA1A 1F4YH 3PDGA 2YHGA 4ZNEA 4KUZH 1C3FA 2ZWLT 4N90D 1QFHA 2WXDM 1JPTL 2BMKB 1BQHG 3SCRA 4F2MB 2X42A 2G2RA 1SBBA 1XAUA 4HFUH 2VL4A 5J12C 3WNKA 4YAQA 5IFAL 4WUKH 3KL3A 2V3DA 1KTBA 4XP4H 3I9GH 5HHQB 2F15A 2X2HA 2NY1B 4NCC2 1T1XA 1F11B 2DQUL 3WUZA 1DR9A 1KTKE 4Y4HD 2G3JA 5IB4A 3DECA 3EGSB 5T1LB 3WJLA 1H0IA 3EJJX 2ORBH 3RIFF 3B6SB 2J12B 4AMKH 3ZE1E 4S2SB 5IB1B 3FB5A 4WLCA 1I9IH 2O5YH 1QA9B 4OLVH 1BVLB 2YD6A 4K3HA 4ODWB 5C0DA 3X3FH 4XNZC 5A2CA 3UTSB 2BVOB 2UYLA 1R8LA 5FA4A 1WIOA 4ZO7A 2VDPL 4IM8A 1U8NB 4JRXB 3W9DA 5FYJE 1LEIA 2V7HA 4I13B 2VCBA 5IESH 1XH3B 5GGUA 2BNQB 3C6LC 2F74B 3QPXL 1FG9C 4XMPL 4FQIH 2HN7A 1J1PL 1W72H 5E6IA 1WZAA 4RGMC 4QGYA 4YUEH 1CFQA 4JFXB 2GK2A 3D3AA 1BZ9A 1WZKA 3CXDL 2CNCA 3AOFA 1XGPA 1SMDA 4PG9A 3H9HB 2X1PA 2V7NA 1AKJA 4LFHD 3NFNB 3QIWC 1XCXA 5IHSA 2D23A 2R56L 4G7YH 2Y36H 5FAAA 4LVNC 1B88A 1H8OA 1CLYL 1PVHA 3BO8A 1QLRB 2VAJA 3QUYA 4OCLC 2Y24A 2C1PA 3JZ7A 4GW5B 4PD4K 4JY5H 4ODXB 5A95A 5H2BB 1R0AH 1BF8A 1PSKL 3D2UD 4D0CB 2YPLE 4LRIA 3LIZH 2GSJA 5FB8B 3P0YL 1NEZB 3C6SB 3HZKA 4PLKD 5JOFB 3CAFA 2IALB 5FYKU 4JFZL 4QLJA 5ESQA 5JPMB 2XZQL 1I1WA 4L9LA 4ZG1A 3NFSL 4JQXA 5CMAA 5ICXB 3V4VH 3SCMA 1E4XH 4ONFH 3U57A 2AJXL 4D1JA 3HU7A 4Z0XB 1RZIA 3PV6B 1DE4B 1BGAA 1O7DC 4Z7QF 1E27A 1KJVA 2FL5B 3QDAA 4HAFA 1NBYB 4NXKA 2ARJB 4M1GL 4UDTA 2DPEA 2X41A 2F5BL 5FECB 2IAMD 5C6WH 3CFBA 2WSPA 4B3KA 4GRMA 1MLCB 5GISL 3TZVA 2VLJA 4P5MA 2P5WB 4JQVA 3RY6A 3IDGA 3PHQB 5J3HD 4TSCH 4OGAD 2YD9A 2A9NL 3MR9A 2CITA 4PV8B 4UT6L 5T5FH 3PWVA 1M4KA 2VXUL 2DRUA 1KR0A 5JHLL 3T2OA 4TNWK 3IGUA 4Z2HA 4OGXL 4Q0XL 5B38A 4GKOA 5EC1A 5F89B 2OP4H 3GJEA 4HX1B 1JHTA 3KPSA 1NC2D 1WT5C 4OJFH 4MNQB 4WFGD 1S9YA 3BJ91 3QUMA 2YA2A 2N4IA 5ILTH 2EICA 3JWNC 1FPTL 1U95B 4I2XE 4RE3A 3NJ3A 2BRQA 1I1FA 3BH8A 3WBAA 4OCRH 3F5KA 1S7UA 2AEPH 2QSCL 3QO1B 1UXWA 3RDKA 1RJLA 4J8RB 5CJOL 2MCG1 1TETL 2ZX6A 4CVUA 4HGKC 2IG2L 3BDXA 2Z0BA 3DRQA 3HR5A 1RUPL 2O26U 4JDTL 1U8KB 1BBJA 4DO4A 5GGRY 1TA3B 2DQGH 1YNTB 3QAZC 2BSRB 4KFZC 4P23D 3CZ8A 1J0HA 1T22A 5KS9E 4QRPE 5E1AB 4RDQF 1GGBL 4Q7NA 3FT2B 1QVOA 3GHBL 5LG1A 4ERSL 4ENEC 3UG4A 4JKMA 2YKKA 1DLHA 1IC4H 5DMIH 4Y5XC 2J75A 3VRLF 3MXWH 4HK0A 3UEZA 4UOZA 2XNAB 3TT1H 2H3NA 1GOMA 1TXKA 2WC3A 1IGIH 2OSLA 3SKMA 1HQRA 3OKYA 4KDWA 1XGRA 4FQXD 3N85L 4U0RC 4DWHA 5SWSA 3JTTA 2CIKA 4XTRC 2YK1L 4WKHA 2W62A 3HMWH 3HB3C 4KV5E 2FEDC 1LL7A 4IDJL 1SQ2N 1CF8H 2WIIA 4PLJC 3MUY1 3T2QA 1QKZH 3AXHA 3SUTA 1YDPA 2A6JB 1U2CA 1V3JA 3BP6B 3ROOB 4L5FL 3PJSA 2J8HA 5FM5O 6A3HA 3QXWA 1YHTA 3W29A 4J7RA 4Z18A 4Q6IA 1OQXA 1T3FA 1FSKC 1E56A 4NRYB 4GT7A 2PCPA 4M7LH 5FYJH 4JPKH 1W91A 1LQSR 1HK6A 1B3YA 3NA9H 3WFDH 2F7PA 4M4RA 1EHNA 4N8CL 4BYHA 2Z8SA 1RJYB 2JIWA 4UINH 3HR6A 5IVXF 4XP6L 4K7PL 1IL1A 4GSDH 4P46A 3PQYD 4UAOB 1P4LB 3WNNA 4BELD 4L8CB 4F8XA 4S1DC 1TDQA 3ARFC 3OJDB 4H8WC 4EUPA 3CH1A 1KGCD 5B8CA 1UWRA 2OR9H 5CSYA 3SGKA 3L4TA 1KPVB 2MSPA 1H5BA 4GG8A 4Z7WA 5E9DE 3CZFB 3DX8B 5E0QA 3RGHA 5ABGA 1T1YA 3IDNB 3EBVA 3CDFA 2MQ3A 3TO4D 4TUKL 4GPNA 5ITFA 2AJVH 5DD0H 3TFKD 3WS3B 1FVEA 4HIEB 4MQTB 4QCEA 4LYPA 8CGTA 2B20A 4AMXA 1GGIL 1TNNA 2OTUA 3VH8B 1CE6B 1EXUA 3NACH 4EN3B 2RCSL 1CICD 2BSTB 4MSWA 1CLCA 3FO0H 1FGVL 2UVFA 1NCCH 4GKZA 1RK1B 4U1IA 1OP3H 2QTEA 2JCCB 5F96L 1H4PA 2EDBA 3SIMA 1X1NA 1RH9A 4HCRL 2WPGA 1W0YT 4NO2A 3IFNH 5L2KB 3KWWA 3T65A 2B1HL 1S9XA 1U8HA 3AFLA 3QA3B 4ELMA 2ENSA 4NN6B 5I8CA 3UTTA 5J13B 3HC3H 4ODHH 5DVLA 3DARA 3G5YB 3AHYA 4EXPX 4ZO9A 2WBJD 4WHYH 4Y16C 1RZJC 1X5KA 3ZHDA 4B16A 1NCTA 4G6JL 4GAFB 5IFTA 4WWID 1JGVL 3O4OC 3MMDA 3SDCD 1YY8A 4NQEA 5C2UB 2VQUA 3OLEA 5F72S 5EOCH 3VGDA 5CD5D 3EJPA 4FMFA 1YEDB 4HF5H 4LLQB 2HJKA 3B43A 3GHEL 1A4KA 4MD5B 4U1NB 1YJDL 1KJ2B 3CBWA 1MJ8L 4HWZB 4IRJD 4AG4L 3RZCD 5E9AA 2XN0A 5C0ND 4LGRB 5JNYA 1EX0A 1MOEA 4L1DA 5IFJA 4LSVH 1XGUA 5E6YA 3QQ9D 3RTQA 1AO7A 3GSUB 3OJVC 3A4WA 3BIAX 4PFEA 3WUWA 4X4XA 1UZ4A 4MMXC 4PRHA 3D5OF 3EBAA 2NQCA 2NY5C 3WBDA 1FLRH 3OMZA 5KVDH 2WWKO 5DLMH 3V5DB 4QRQA 4LCYB 3P9MA 3DHPA 2E9LA 3VD9A 4TX6A 1LEGB 4YDLC 2B2XH 2ZSVB 1JJUA 2DT2A 4OIAA 1R5VA 1LD9B 1BLNB 1CGYA 2A9ML 4FQQB 4YHGA 1LDSA 5HDOA 4N0YL 3DJ9A 4D9RE 1LE9B 1PZ2A 3TA3B 1A9EA 3UO1L 4WGWB 4NPYB 1QFWH 4DW2L 1YYML 2NY1D 1DEEA 15C8L 3U0TA 1RUML 2FIKA 1CFBA 4Z95L 3LV3A 1MCWW 5T1LD 1KNOA 4KGLA 3W39A 3KPLB 1JPFB 3WJJC 3EDEA 1IGCL 1TR1A 4LCCC 1KWGA 3OXRA 2V17H 4LSQL 1LL4A 2W67A 5HGHB 3PDDA 1LL6A 1NWRA 2EXWD 1BG9A 1J1OH 4LLMB 5B3NA 3QCTH 4NT6A 4X0KA 4OM0H 3IXTB 5JUVA 4RIRA 2ATKA 2BVPA 3VFRA 4F3FB 3LKNA 3QOMA 3NPSC 4LAQL 1XMWA 1F3DJ 4JRXD 5D1QC 1E6SM 2WHMA 1T0MA 5I8EB 2IF7A 1NBVL 4O58L 5HVHC 3BAEH 4MADA 2F7QA 5AWNH 5TF1H 1MVYA 2L7UA 3KWXA 4OI8A 2IGTA 3FQNA 4U1MB 4C4KO 1RHHB 3D6GA 4YBLC 1FZJA 5FIEA 3AMKA 4IOFC 2H2PC 4PUDA 3QHZL 3GH4A 4LGXA 3EIFA 4YE4H 1AR2A 1QSVA 4ZFMA 1ZBCA 5IT2L 1I7RB 1KIRB 3BN3B 3O6KH 3QEQB 2RR3A 4KMTL 5JIKA 2PTTB 1T6WA 4PJEF 3DBXB 5I18L 1GCYA 2R1YB 4FABH 4K9EL 4AM0A 5J9PA 1A6AB 1MRFH 3JSSA 4JG1H 3CMGA 4BSWA 1HX0A 3PHAA 3HNSL 3BZ4B 1W2PA 4M43H 3CH8A 5C0RL 4DGYL 4ODVH 5GGRA 5DRZA 4F57L 4L3EB 2Q86B 3P0GB 3WD5H 3WNOA 3LS4H 5ADOL 1P1ZB 1EHLH 1JRHL 4EOWL 3UC0H 1N6QL 4MCZB 3MRKB 1BPVA 4QLLA 3FT4A 4YGVB 3CUPB 1QI5A 3MX0A 1NCNA 4W70A 1B31A 3T1FA 3GI8H 2XA8L 4Z5RB 4CW1A 1XR8B 4JFTA 2GJXA 1FZMB 2X4PA 5C0FB 3GRWA 3T4YB 3UCQA 5F9WC 3OKKA 2VUYA 4G6ML 4L4JA 3WFHA 1C5BH 4I5BA 3QXDA 3MUZ1 1AY1H 2X4TA 1KCRL 3ARGD 5D5ME 3VA2C 3B4NA 1XF5B 2UYLB 3FAXA 1N59A 4FP8L 1R33A 3IANA 2VZSA 4KQ3H 5F9DC 1HJXA 3WIHH 4E4PA 5D6CA 4MDJA 1AD0B 1F6AB 1Y6NR 2WLZA 4IEFB 5E4EC 4PCTA 4AD1A 2GIYA 3MRIB 4MNQD 3VDBA 4NZTL 5CZVL 1XGPB 1X6NA 4PG9B 5AC4A 2CK0H 5E8PA 4TVPE 1I3RB 3B5TA 5GGQH 3VVGA 5MEPA 2ITDA 3KDMA 2H2SC 1J0IA 3BO8B 4M03A 6FABL 1KC5H 3O3DB 3L4YA 2CEQA 4X80H 3WL9A 2C1PB 3KYMB 2XWJA 5A6MA 3W11C 5TH2A 3P4OA 3QZWB 3CX2A 4C7DA 4I3RH 1K3IA 2AK4B 3U82B 3V6FA 4EK7A 1VEOA 4GRWF 1DN2A 1HNFA 3ILQC 1LEKA 5GS1A 1LO3L 3QUXC 5ESQB 3KR3L 3SDAA 4NX0A 5HSFA 3WQ6A 4DCQA 3EJYC 3T3ME 4DN4L 4N5UA 5I15L 2GAZB 4MYWB 3H0TA 1RURL 2FX8H 2R23A 3R06B 3D39B 4BM7A 1E27B 1W1VA 3OA5A 4Q9QH 2PTUA 4PMDA 5GRZA 4KGJA 1HYRC 2DWEA 2DMBA 2P24A 1P7QB 3CFBB 1GHSA 5F8RC 3ZO9A 2X1OA 4QO1A 4PJEB 1S78C 2IMMA 3IDGB 5D2NB 2J74A 5DUPH 5IGXL 4P9MH 5KVGH 3PWVB 4Z2KA 5EZLA 5GRUH 3KHQA 3KPOA 3ULVE 2CBUA 3MOBH 1Q8MA 4OTXH 3S34H 1OLZA 5J1TC 1HILA 1LO4L 3N13A 5EC1B 4PJGA 3I75A 5B39A 4MZ3A 3CPUA 3GJEB 1YY9D 4NWTH 5I24A 3KPSB 2J8OA 4RBPH 3V0AC 1Q6FA 1S9YB 2YC1B 5GGSY 1IGMH 1KULA 4Q9CA 1MREH 1UENA 3MREA 2YA1A 3BH8B 2ARJQ 3C9NB 4RGOH 3CCHA 1S7UB 1MF2H 3QFDB 4ZFOB 4KK5C 1EMTH 1GC1L 2VOTA 2VLME 4X6DE 2GFBA 5I30H 5ECUA 5H94A 1RJLB 2UV3A 4UFHA 4XC1L 4ETQA 3QNYA 3MCLH 2G75A 1NAMH 1QBMH 2Y7QA 3DRQB 3HCVB 3H6JA 1S7RA 1IT9L 4M1DH 4PRNA 2UY4A 3TTOA 5I3DA 2WUCL 5DVOA 1OSPL 3THDA 4ZSOE 1A6UH 5DTFB 1XGQB 4FXLA 1JRHI 1U3HB 5CP7A 3O3BA 2XQBL 4HAGA 4PJCA 4JE4B 1E4JA 5GJTL 4XVTL 2W91A 1JPGA 1JMXA 3FOLA 3ETBF 3BEWA 2YZ1A 1B6DA 2YRLA 5A8NA 1YNKH 4KY1H 4RA0C 3GSXB 2FO1A 2XZZA 1GCFA 4X4YA 3IVKA 4NO0B 5IF0A 4PGEA 3QXUA 3QRGL 4TX8A 3K8KA 1IARB 2B0SL 1XGRB 2FBJH 4J3VA 1B0IA 3CIVA 3QIWA 2CIKB 1LMKA 4ZFGH 5CSBA 1CGXA 2IAND 2Q3ZA 4FNLL 4G5ZL 1ZBWA 1PLGH 3RNKA 4GRWB 3SHSA 2UUDH 2WIIB 5DD1H 5TE6L 3REVA 5EMYA 1IAKB 5L2KD 5D7LA 4PJBA 2J88L 3MLRH 5L9DH 1IM3A 3MXVL 2A6DA 5DA0B 2VRQA 1SVZA 4CADB 1L7TH 1RIUL 2FJFB 1T3FB 4LMQI 5SV3A 1NLBL 4A6YH 4JFDD 3WNLA 4FTVE 5D1ZA 1IE5A 3EDDA 1VESA 1IGFL 4J3OC 4WJ5A 2Z31B 2DQXA 1QG3A 4JVPA 4POZC 2ZUWA 3IFLH 5DD3L 5JW5A 2J6EL 4LRNH 4Q97A 2AGJL 1TQVA 1OTUC 1B6UA 3DTXA 4HKXA 3S35L 2J78A 1JZ6A 4XCNB 3UTPE 5KG9B 2BNRE 3BT2H 1C91A 5B8CB 2P42B 4TVPH 3LMYA 2N1KA 4R96A 1IC5H 3WKNA 3HPJA 3G6DL 4Z7WB 4BQCA 2ZG2A 1NBZA 3ARUA 1IEAA 2F53A 3RWEA 2X10A 2XY2A 2D7OA 2JB5L 5KN5A 3A4XA 2EDJA 2PW2A 5K9QG 2NTFB 4XMPH 4BA0A 1EXUB 1WT5A 1SM3L 5JOEA 2JJUA 3DX4A 3AFBA 1VERA 3JUGA 4LLWB 3A6CL 5BRPA 2HFTA 4PJ7B 3EOBA 4XVJH 3AY4C 3CXDH 1KFAH 2VXSL 3QG6B 1IAOA 3O8XA 5CGYC 4CNIA 2X8RA 5T1KB 3NCFB 2W4XA 2D4DA 4U1IB 5MHSE 3W82A 3FN3A 1E6JH 4OZ4A 1OP9A 5IQ9A 1KQZA 4PTWA 3ESUF 4M1CD 3KWWB 1DP0A 2ZXBA 4TUOA 1W3KA 1ACYH 4ELMB 3EYQD 4MVBC 1MFDH 4MLIA 4C56B 3VJ6B 3FFCD 2X4SA 3HG1D 1MWAL 3GDBA 4IOIB 2WW5A 5A6AA 4JFZH 1F13A 1SY6A 4ZPVB 1OT1A 5GHWL 3NFSH 4LLDB 5I17B 2YD3A 4M8QA 1DWFM 1ES0A 2AJXH 5CWSA 4ZTOL 3O11A 3RJQB 5I75B 4H0IA 2HJKB 4YXKL 3G04A 1A4KB 1GORA 5I66B 4Y5XA 2AV7A 1ZS2A 5CP3A 3EJUA 1M71A 1R6VA 2ZKHH 4M1GH 1HKIA 2P8LA 3QEQD 5IFJB 2R0WL 4XP1H 1UQZA 5EBGA 1XGUB 1Z5LA 4FZEL 4C4KT 3AVEA 3D9AL 4PB9L 4O4YL 2WANA 1W0WB 4X7DC 1JI1A 1OBAA 1R7AA 4PRHB 2VXUH 1DQLL 5BMFH 3T0EB 3CLFL 5JHLH 2XKSA 4OGXH 3TNNB 1JF6A 3TBTB 1CDGA 4UQ3A 2B5IC 1YUHB 5HHVH 1U8LB 1SBSL 2D3LA 3HG3A 2Q8BH 2JJTC 4MXWH 3M7SA 1CR9L 3MJ8B 4CN1A 1A7BA 4MNHA 1CD8A 4TYUA 5HJ3B 1FO0H 1PKQB 5DRNB 5DS8A 5BVPL 2D24A 5CILH 1T2JA 2P7TA 4F33B 4JG0L 1NFIB 3MRJA 1DEEB 4MA7L 5D2LF 3U0TB 2FIKB 3VIMA 5I6XB 1FE8H 2E6JA 1KNOB 3VG0H 4AZ7A 1Z6JT 5CSUA 3W39B 3GBLA 1NUFA 5A2BA 1CDIA 4KJWD 2WMHA 3VUPA 3WO4B 1GZQB 5CSGA 1ZLUH 1TETH 5BJTB 3ARFA 3QDMA 3U7AA 4D9QD 3P2TA 1TFHA 2CLVA 4NT6B 4PTUA 4YDVB 4M00A 1HHHA 1HZHH 2ATKB 4JDTH 4YDJA 4Z0BH 1DN0A 1C12A 4BKLA 5SWQA 4AH2A 5GGSA 2GI7A 4B50A 5E6ID 5FM8A 3MV8B 3FHAA 5DDHA 1RUQL 2EQDA 2NPLX 2OL3H 4ERSH 3C8KA 4QF1A 3PDOB 3AJ7A 1C5DA 1I8KA 1KG0B 1AKJD 2M8XA 1WCQA 3D87B 3MS8A 4Z9KB 3QWQB 2QHRH 1WUNT 4JHWH 1PIGA 3E8UH 3QUYD 5J9PB 4XHQA 5IHZA 3A67H 4HOXA 2C3XA 3D0LA 3VOCA 5T3ZL 4Z7VA 4OOUA 2AEIT 3LKSB 4PS4L 5E24E 1DWHM 4XT1C 4IDJH 3WF3A 4MWFB 3VIJA 2R2BB 1BZQK 2GSIA 3BRFA 4U1HA 4H8VA 3ZTNL 3OB0K 4L5FH 4PJ9A 4WK9A 4CDHA 1BFNA 2Q3AA 3HS0A 3SCMD 4LSTL 1SVCP 1EQCA 2GK1A 1LK3L 1KGCE 1F4AA 3WF4A 3C09C 2AI0H 2YD5A 4QOKA 1I9RH 4Y16A 1GHFH 4OJYA 5A2FA 1K5NA 3VRJA 2C3VA 4K71C 3D39D 4LPXA 4CW1B 1FFOB 2JE8A 1IC7H 5HDBE 1X5XA 4N8CH 2GJXB 1NFDA 2D0FA 3V7AG 1R3LB 2X4PB 3UG3A 4RZCA 1U41A 4OZIF 1B3JA 1D5IH 5E94A 2UWEE 3TZVD 2O9OA 1IQDA 3AXIA 2DGAA 4UIKL 3CFCH 1C93A 4DKFL 4KJPD 4FFYL 2YL5A 3G5XB 4OZFB 2B4CL 1JDAA 1DVFB 5DFVD 3WEXB 1MJJA 1NGXA 1ISZA 1GOFA 3ARDB 5D6CB 3OAUL 1E28A 4BQ3A 3HZMA 1RUAH 3CSYA 4TNVK 3U0WL 3BP5A 3E6FA 3O9WC 2DTMH 3KPSD 5ESAA 5E99L 2MKLC 3CC5B 3QJFB 4EDWL 3P4NA 5I76A 2AJUH 3HAEA 5IKCA 3N9GL 1FNSL 3SKNB 1GGIH 3AI0A 2O92A 2J5LB 1A7OH 4LCWE 4YHPB 2A74B 2PWEA 2ITDB 3KDMB 1NCWL 5D2LB 4OFVA 2A3HA 3LRLA 4WI8A 4Y4KC 1AGBB 1S7WA 1P7KB 3LKPA 3PL6C 1YEIH 4TSAL 2ZX5A 2ZCKH 2HT3C 2JALA 1FGVH 3P4OB 2G41A 3V6FB 3MTRA 1MIEL 5HHME 4WHDA 5E70A 3GK8L 5J57B 1U8OB 4HCRH 5GS1B 1BYAA 2AAVA 4LCCA 1JZ7A 3QNZB 4XB8A 4JFYB 2B1HH 4R97B 2ZE0A 1QR1A 3F7VA 3V4UL 1YNLL 4JAMA 4YEFA 4RAUA 3CLEH 5MENA 4PTTB 4I3SH 1AQHA 2AJSL 1W1TA 4ZFFB 5D1QA 3O4LB 3H0TB 1CXFA 4WIWA 5KTEL 4G6JH 1A0QH 5FYJU 1FNLA 4KKAD 3EHBD 1A5FH 1WDSA 4M29A 3LH2L 4JN2A 4YK4B 4K68A 3LQZB 5ALCH 4NO0D 4Z7UE 1MEXL 5GSRA 3GHEH 1S7QA 5GGVL 1YJDH 3V2AR 2FX9L 1MJ8H 1ZWIA 4D71A 3MCG1 3WXVH 2L7JA 4JO1L 5IIEA 2NLJA 2EYSA 3UEQA 3LOWA 5HHOA 4R3SB 3KPOB 4M3KB 3RL2A 4FG6D 3B5HA 1ADQH 4IBLT 1HILB 5L2JA 2AVGA 2OWCA 3BSGA 3U9UA 5HHNA 1U93B 4ALAH 5EO9A 1F2XK 3ZYIA 1FH7A 2JJSC 1VFUA 3L4VA 1IT0A 1A7PL 5A94A 1V7NL 3O2WL 2VABA 1N2RA 4NQVB 4RFOL 5B3JE 2JF1A 2XWTA 2A9MH 4HEME 4P3CH 5DK3A 1KBBA 3SUSA 4P2QE 1MQKL 1NDGA 5H94B 3SUVA 4R6UA 4RMRA 1AHWA 4P46D 1FGNH 5GNZA 5DJXA 2Y7QB 3VGAC 1RUMH 4NC1C 1CBVH 2WMPA 4HIIB 5KANI 1AGEB 4M5YL 4WTZG 1PAMA 5E2WH 4D6FA 1OAYH 3LPPA 3IS1X 5CZKA 4X0NA 1IGCH 4PJIE 3BAIA 4XHJD 3BPNB 4LSQH 3TBYA 1KIQA 1S9VA 3RVTD 1HWGB 3RWFB 4NC2B 5IVXA 4S0SD 4OZOA 4NQCA 1PQZB 1HHJA 2CDEA 2XWEA 1UM6L 3QEUA 1NBVH 5F1IA 3RBGA 4X4YB 4TOQA 4HS8L 3GIZH 3WNMA 2WMKA 1KCSL 2O61B 5JBEA 4AT6B 4XXCC 1V6WA 3DROA 1HSAA 1GPFA 2W0FA 1BMGA 4JRYA 1MI5B 3UJJH 5FEBA 3OGVA 4AZ5A 2GHWB 5HI5D 4KMTH 4JFFA 5IWLA 3X14A 4EKJA 2EADA 5E08H 2ZWZA 4K9EH 4CBPA 1JWMA 4LLYB 2AOSA 3MNZB 5I1DB 4EI5C 2IGFL 5AEAA 5DUBA 4XGZA 3VU2A 3KPPB 4C56D 3UTTD 3HPLB 1DZBA 3OG4B 3QUXA 4W5ZA 5DJ0B 2XQYG 4HMEA 5HGDA 5C6TH 5D1ZB 2DQJL 4MA3A 4EOWH 3DGGA 1HH6B 4YC2B 5LGJA 1LNUA 2MQ0A 4HKJA 3X11A 2OMBA 3MLUL 3NPZB 1BSIA 3IJ8A 4OZHB 5EG6C 1TVBA 4FF5A 3HI5H 5FA3A 4ORGA 2EBNA 1X7QB 2AW2A 4R4BA 3DUSB 3EJRA 4U3AA 3X17A 3RVWC 3FKUS 3HPJB 1CGUA 1NGYA 5FYLE 4HXBH 3RTQD 1AO7D 4OZGB 2C4XA 1NGPL 3UBXI 3GYCA 4FP8H 5KN5B 3RFZC 3AISA 2AK1H 2PW2B 4PRHD 4FMVA 3PZIA 3A21A 2CUIA 1U3YA 3L3OA 4YHML 1AGCB 4KRLB 2YZ8A 3NH7L 3EYPA 5CXPA 4YZFF 4NO5B 3U0PB 1FVDA 2VLLB 1CECA 3V6ZA 1MQRA 4N1EA 1KYOK 4OBSA 3OB8A 1YECL 1CVRA 4F37F 2VIRB 3QH3A 3LXCA 3UJTH 5CZVH 1W0VA 1IAOB 3O8XB 1AJ7L 3GM8A 2X0HA 3PZVA 2ZX9A 1T1ZB 4JLRA 5F97E 3OKNA 1GJIA 2APXA 3EAKA 4PGDB 4E42A 5CHNB 4EI6A 6FABH 5IV2B 2J7BA 5JHDA 4YDIH 2DIBA 4BQ9A 2DSKA 4V27A 4AZCB 1BAGA 2J7LA 1T89C 3W26A 5JUEH 2LQRA 1ORQB 1ZV5A 5I1EL 4HIHA 4F7PB 3LMJL 3GSNA 4MAYB 4N0UA 4KPHL 4CD5A 2APFA 4L4TA 3ZR5A 1FCGA 3QJHA 2RGSA 2W0PA 1D5XB 5DC0A 3S37H 25C8H 3L9RB 1D3CA 5CWSB 1VFMA 2YSSA 5F1OB 4DN4H 3BZEA 2PF6A 1AQMA 1VACB 3BX7C 1CK0L 4BZ1L 4Y5XB 1IAIH 4LNVA 4H26B 1DQDL 1A64A 4M61A 2EACA 5FIPA 1Z9OA 5EBWB 4G8GA 4GMTL 4ZXBC 1WLHA 4PRIB 2IPKB 2ADJA 3RDTC 2RGLA 3K81A 4P2RB 4WENB 2I07A 3I50H 3RPIA 4LARL 3BXNA 2LU7A 1QLFB 2HVJA 3BZFB 5A3IC 4NRRA 2D7NA 2VN4A 2F9BT 2EC9U 1WAAA 5BRZA 3IJ9A 4PGBA 1S9WB 4RCAA 5I1IL 1UR9A 3W5MA 3RHWF 4L8BB 3CFEA 3CZNA 3WD3A 5BYWA 4ML4A 5LA2A 2CKBL 1G6RB 4QXTB 1IM9A 3WIFB 3UAJD 2JEPA 1Q72L 4HEPG 4HJGA 3MRDA 3MLTA 4U1JB 4Z6AT 2W0KA 4UBDD 2Y6SD 1HKLL 4X5XB 3L3HB 5TPWH 1U3JA 4XNUL 3TTQA 4AYGA 1HYSD 4BSVB 4NP4L 1UA6L 3CDYA 3W27A 5DK0A 5EWIH 1UKSA 2WC4A 2ZG1A 3ARFB 3QFJB 4JO2L 4GG6F 2P48B 2IBGA 2AABH 2DJ4A 4L8DB 4OCSL 3RI5K 4AIZB 5J6GA 4EXKA 1LO5B 1NWTA 2WUCH 4BKLB 1V3MA 1TQBC 2Z8RA 5LGKA 4Y0GA 4MD0A 3O45B 4EUPG 5DDHB 2PYEB 5I1CH 1CFNB 2DL2A 4FS0A 1P84K 2CPCA 2FBOJ 2I27N 4QF1B 2IANE 2HP4A 1KXTB 4GFTB 4NN7C 4Q7DA 4NN5B 3ZE0E 2YD8A 4DFHA 2DBLH 5DA4A 1KGXA 1LJYA 1Q1JH 4MB5A 1ZLVK 5JXAL 4WJXA 4CCEA 1X6LA 4UNUA 4NBZB 4NOFA 5BOZG 2NW0A 2WVTA 2XPGA 3AY4A 3IDXH 4GAJH 4DUXA 3V7AE 3IDMB 1GOKA 3SOBL 3CVHL 1HF6A 3OJMB 1PYWB 3D0LB 3A0OA 4JFDE 5CEXB 2IBZY 4Z7VB 1IGTA 4XPBH 5IOPA 4FNLH 2NY6B 4G5ZH 5T1DH 3PZTA 4N0FB 1LP9E 1Q9WB 2GSIB 4NRZB 3SDAD 3CUHA 2X9YA 5FYLH 3GSWA 3MXVH 4PJ9B 3MRFA 2OSXA 2Q76B 3ZM8A 3ZKXC 2EEAA 2J8UE 3S36H 1T7ZA 3FB6B 4L1HA 5CUSL 2CKNA 1ERNA 1K5NB 4Y19A 2OWWA 3R8QA 1MCSA 4ELKA 5T1MB 5KSVA 1KB9K 4PY7A 1YYLL 4RZCB 4RX4A 4N9GB 3RNQA 5DD3H 5E94B 3D3VA 4UOJA 1A7QL 2J6EH 3TYFA 3GMMA 3IRPX 5EOQL 1IQDB 2XVKA 4P7RA 2HLFC 3CUGA 3WDRA 5D1XC 4B7LA 2BNJA 4PJXA 2WB5A 3TN0C 43C9B 1CGSH 3EFDL 1H0DA 2P45B 5EORH 2AJZB 1I85C 3PABA 3QDGB 3NABH 2FEEI 3VFSB 3LKQA 2L4OA 4P3DB 5FYKD 1E28B 1RU9L 3BKYL 2QKIB 3WKML 3TV3H 3A24A 2LVEA 2PW1A 3CSYB 1Y18A 3BP5B 3E6FB 3L4ZA 1ZA6B 5TE4L 2VLRA 2EYRA 2VVSA 4YJZL 5I76B 1F4HA 2QLYA 3HAEB 1ZJAA 3MGTA 1XF1A 1BGGA 1HI6A 5D7SH 4JM2C 4OQTL 2DQDL 3S3JA 2JJTA 1MCQA 1SM3H 3RM4A 4YXHH 1TVHA 3WUWG 3DO7A 4MS8C 1JHKL 3MRRA 3DSNA 2OW7A 1GOGA 3FFCE 1A1OA 5C0GA 5IQ7H 3HG1E 3GXPA 1YN6B 4ESKA 4E8CA 1S7WB 3LKPB 5DHVH 1W9VA 2VXSH 4KAQH 1NUNB 3HJEA 4FXKA 2FDBP 2DKMA 5HD8D 1M01A 1D2KA 3FXYA 3MRGB 4HPGA 3PG2A 4FXGB 3SN6N 1BD2A 4XH2A 3BAYA 1T04A 2WWCA 3QXAB 4ZNCD 4JAMB 4NM8H 4PJ5A 2XG4A 2X6MA 1XH1A 1MWAH 1OARL 2QSQA 3LDBC 4ISVA 4Y1AB 1CFTB 3KLHC 3CZLA 2LAGB 1VGKB 7TAAA 3LQAL 1F4WL 2QQQA 5IW3A 1HJWA 4UFIA 3VM7A 3WE6B 4W84A 4JN2B 4JM4H 3GSQB 1Q94A 5E1HB 1UFUA 3VFOA 4IPLA 4OM1L 4W8AA 1S7QB 3CMJA 1ZWIB 1MJ7L 4ZNEE 1YQVL 4TOYL 5IIEB 3GMOA 2NLJB 3MROA 3OXSB 3QIWD 4ZMAT 4CD7A 2R0WH 2ARWA 1F90H 2DWDB 1KB5H 4J3SA 5DJ6B 1XC6A 3MQIA 3A4AA 4NRSA 3KPNB 3D9AH 2CJUH 1QBLL 4O4YH 2O93L 4AC1X 2M26A 4P5TB 3U9UB 1IFHL 1X5AA 5EO9B 1QQDB 1QRNB 4H1LA 3CLFH 4FRWA 3T77B 2GJRA 4H5SA 4DZBB 4URIA 3KPQA 5AG9A 1FVCB 3PZMA 1TQWA 2IPUG 2YLLA 4MJIA 5D1ZD 1CR9H 4WFHE 1BQLH 5KVFL 1DWJM 5GZNC 1MJUL 3FW6A 2DOCA 4UZSA 1ZHKB 1E4LA 1ZB5A 4HZLB 3EUUA 1Q9OA 5IM7A 3CSBA 4JG0H 1AHWB 1KJ3H 1AP2A 1F8TH 5IUSA 4AZIA 3MSDA 4MA7H 2O5ZL 5H35A 2HH0L 1ZT1A 3TNMA 3UG5A 3E6HB 4P8WA 5GJSL 4TUJA 2OTWA 5D72L 1NGZA 3OKOA 1YC8A 3ZDYE 2GT9B 3GBDA 2NY2C 2IPTL 3TBYB 1G0CA 3CIQA 1B3WA 5DMKB 3S2CA 4M80A 1BOGA 3TM6A 4CMHB 4HZ6A 4X9HA 5IVZA 3UCRA 4D2NA 2P5EE 3I3BA 1FLTX 5D70L 3B3IA 4XC3H 5HVWA 3F7YA 5H8DA 5SX4I 4PJAF 3EYSL 3VFPA 1HCFX 1EV2E 2E0PA 4D6IA 1G1YA 3O9WA 3VFGH 1RUQH 1M05A 3E0GA 3Q2CA 3PGCA 3Q48A 4NDMA 4X6BA 1QNSA 3LEVL 4UOW1 1M7DB 1EEYB 5LYRA 1KN2H 4JRYB 4ZD3L 3O8XD 2ZG3A 1A22B 4HDIB 4NGHL 4YPGB 1FG2B 4JN1L 3QHNA 5CSZB 5AYUL 1NPUA 5KSBE 4Y4KA 1WGOA 3TIDA 1HOCA 1UR4A 3FZUC 5DJCA 5JDSA 2A3EA 1PGRB 1UXSA 1XZ0A 2YBRA 4OKVB 5HDQL 1Q6DA 4D6EA 4AD0A 2QQLL 5IMLA 4IMKC 4XGZB 5T3ZH 1CD1B 3QUKB 5HPCA 4PS4H 2EAEA 3T2PA 2H32B 2PUQT 5HGDB 4OF6A 4DAGL 2VLJE 4JO4H 4JZJC 1UD8A 3DX9A 3DGGB 3T2NH 3KYOA 4D0BB 4NM4L 5CS7A 4UV7L 1LNUB 4OCXH 4PBGA 3MLPA 4ENED 3BWUC 5ANMB 2D7PA 5IFHL 2APVA 2ZUYA 2A77L 3C8DA 3LZFL 1HE7A 5EBLA 4R4BB 1U92B 2Z91B 2EH7L 1FZOB 2BC4A 3MUGA 2W9DL 2OQJA 1X5HA 2VQ1B 3VG9C 3TA9A 1JTPA 3MO1B 3C87A 4IS6A 5DJYA 1BJMA 1W9UA 3IJHB 3HZYA 4XTRD 5DO2C 3HB3D 4RWYL 4D8PB 4OLYL 5E8EA 4M1RA 4UNVA 1CDBA 4PLJD 3OAUH 1BJ1J 1RZGB 5AD0B 3MRCA 3WLBA 1BZ7A 1MAJA 3U0WH 3V6ZB 2JJSA 4LNRB 1GNXA 1H8NA 3AIWA 4NJAH 5E99H 2WP3T 5KAQG 4YBQD 3BUIA 1QFWM 4XPAH 1FYTB 2CDGA 5KS9A 4QRPA 5IHLB 3U4BL 2FNBA 5B39G 1DFBL 1MY5A 3UERA 4AZ6A 2VDMH 1I1AB 4QY8A 3LSOB 1NCWH 1EEZA 3CFDA 4JLRB 4WV1B 2F1BA 3DV4A 2ZXAA 4U1GB 5FKPA 4CJ0A 1ZT4B 4QFUA 1HEZA 4HHAB 1A6TA 5C07A 4C57C 1Z3GL 1JG9A 2XTJB 4JZNB 3ARFD 1Z0MA 3QDMD 1XCWA 2BFVH 1MIEH 5BXFB 5C8BB 1NLDL 3GK8H 4ZUTA 2YPKB 3GSNB 4HPOH 3INUH 4KJYA 4M93B 3OZOA 2HVKA 5IBLC 1US3A 3IGAB 3FO9B 5GGTL 4HK3N 2WVSA 1B0GA 1R5IA 4XP9H 5SWSE 3PNWB 2YSSB 4Y8DC 4KZDL 2XN9E 3D25B 3TF7C 2PYED 1G0DA 3S3SA 4RMVA 4WDIB 5FGSA 3KYNB 4GIAA 3CUFA 4LHUA 5GIRA 1YJDC 5BZWA 2FR4A 1VBUA 4G42B 4G8GB 1E5JA 2IFGA 1B0WA 2R2EA 3G9AB 2RAMA 2D1ZA 2IBZX 4BSJA 3V5KB 2ZSWB 5EPMA 3C5SA 4HJ0D 5GGVH 4OV5A 1MCRA 2FX9H 5ERWB 1VADA 1SMOA 3ARRA 1EEUA 2X4OA 3OLIA 3OAZH 1A6WL 5A2IH 2Q20A 3WDJA 4EBQL 4NBYB 4LPUA 4XPFL 3ZKQD 3VFWA 4OFIA 1JK8B 4EI5A 2HTKD 4OLXH 5E9DA 5DJ8A 1QFUH 4PJ9D 4X8JA 1UVQA 3WDQA 5FCUL 1MCOL 4Y16D 5IG7A 2D2OA 4M7JL 4JJ5B 1MFBL 3O3EA 1EBPA 5CPSA 2KQMA 2WHLA 1MVUA 4HH9A 4EVNA 1MH5A 2V5RA 4RFEA 3MBEC 3QCVL 1GIGL 4IRSB 3G6JB 2AJ3B 3ULUE 4M5YH 1RIHL 5JO5A 3PTMA 3QCUL 5J6GB 2WMIB 4R90L 4XMKL 4X7TA 3VX0A 3P9LA 4HMCA 4ONHA 5A6JA 1W72B 1YEKL 2VCAA 2X4RA 3JV4A 4TTDC 5AAWA 2VR4A 4PRBA 4V1DA 1T21A 3SJVE 2V5MA 4YH6A 3MCKA 1J01A 3BESR 4K2UL 5DVNA 2VZUA 1OIMA 4L4PA 4MPKA 1OAQL 1UJ3C 4HS8H 5KZCB 4KZEH 1ZOXA 4K94L 2HRPH 3NAAL 1NMCB 4Z8FL 3BUQA 3CUIA 3WFLA 5IHBA 3NFPA 3UTTE 4NQDA 1AQDB 3EJZC 1GOWA 4X8XA 2FJHA 4Z7OF 4K9EC 2IQ9L 1JNEA 4KRPC 3AYRA 3O6MH 4Y5VC 3V79C 3BAWA 3DETC 2YL8A 4NQEE 3VXRB 3BEVA 4H41A 1BFOB 1JWSA 4RE2A 1T89A 1V0KA 5DR5L 4JFPA 1XEDA 1XCTB 4KVNL 3MRNA 2Q6WA 4HUKB 5MEND 4M6OL 1F97A 3B9VA 3HRZB 3HI1B 5D1QD 1AIFA 2G9HB 2V5YA 1NMAH 4Y19B 2W59A 3T3PE 3VGHA 1RY7B 3IKCB 4BJLA 3O2VH 4HKBA 4MXVE 4PYSA 4WKAA 4KTDL 4NQXA 3P0VL 3MLUH 5E56A 5EDXA 4F9PC 1X4YA 2H2PD 3KPRA 3L3KA 4WI6A 5CCKL 3DDGA 3HUJB 1TCRA 1TVPA 1NEUA 1OD7A 3BGMA 2ADFL 1K4CB 2FSEB 2Q87A 2EIEA 4KI5E 4PJXB 3VXUB 1F3JB 3K4ZA 3WIIH 4GQRA 2VKXA 3GNML 1UWUA 4ZXBA 1RZFL 3C08H 4X5LA 3RDTA 3DC0A 2CUMA 2VDQH 5HHOD 3EYOA 3IU3A 3DXAB 2AERT 2KQNA 1TMQA 2JB6A 4C58B 2WWMC 4QNPE 1QSEA 2FLBT 5FCZA 4AZGA 1Y18B 3FOMA 5FHAH 1FAIH 2VLRB 2R29L 3GNRA 3CO4A 2EYRB 5F88A 2EO1A 3VI3E 3OAYH 1QI4A 4ZFZB 1U9KA 1H0GA 1DLFL 2BVUA 5GS0H 1B9ZA 4OCMC 3MRRB 3RWIA 1RP9A 1IEBB 1FHDA 4Y4FC 2OI9B 1YEHL 4WFFD 3WH7A 4KTEL 1PIFA 3W28A 3LRGA 1AJ7H 3ECQA 2V3GA 3RWHA 1EPFA 4PJHE 1NAMA 2GTWA 3N06B 4LASL 4U1LA 5ADPL 3L95A 2VSDA 3FQRA 1VKXA 2WVVB 2QMJA 5K9KA 4XH2B 1T04B 4KC3B 2XTKA 2DKSA 5EUOB 5F1NB 2I9TB 1SYVA 1ZAGA 2FRGP 1QHOA 4PJ5B 3U1SH 5I1EH 4PMXA 2WKGA 4QWWC 4KPHH 3W0KA 2CRZA 1RIVL 4NZJA 4Y89A 4EQ2A 4UOW0 2C7UB 4QTHA 4I0KA 1JZ8A 4M48L 4B0MM 5FO7A 3CXHJ 1SEBA 1JBJA 3BP7B 1J8HA 4Z7NF 1HKMA 2EJ1A 3N04A 1Y0LA 1X5FA 1S46A 1ZSDB 3FFDB 4XWGL 3SE3C 1P6AB 5IJVA 4EUPH 1RZ8B 5L88L 4JRYD 2A3AA 3GMOB 1LE5B 3S88L 4NNXB 3DIFB 4LU5L 4LYRA 3BAKA 4GMTH 1Q9KA 4M7ZB 3TPUB 3VDHA 3VFMA 1AE6L 2I5YL 1YMHB 5ICYA 2CLZA 4HXAL 2J7HA 4GINA 4S1SH 1IKNC 2EPLX 4KXZH 1BX2B 1OAUL 4LARH 1T0PB 1IGJA 5HI3C 1G9MH 1W1YA 4RGNC 4ZS6C 4LKCA 4XPTH 2X7LB 3UTQA 1MCLA 5E7FA 3TGXA 3ILQD 3NIDF 3ULUH 4F9DA 3QUXD 5K9OA 4X9FA 4XB3A 4WF7A 1JD7A 3MV7B 5I1JL 3WLWD 1FN4B 4Z2JA 4A4AA 4X6EA 3EJYD 3EOAA 1R3HB 4JZOB 3GIVA 1GC1C 4X98A 5IM7B 1LWHA 2M2DA 1Q0YH 1BFVH 3K3QA 1DWIM 2EE9A 4V2BA 1A2YA 5D7JC 5DQ9A 4AZHA 3S4SA 1ZT1B 1INEH 1HKLH 4XNYL 3GXNA 5EOTB 3R4DA 4W6YB 1QRKA 4TUJB 2PO6B 2OTWB 1KPUA 4NP4H 7FABL 4UFLA 1X44A 4ZDHA 1PS3A 3LKOB 1S78D 5D1XA 3OHXB 1MFAL 3TN0A 4R2GB 5DRXA 4QRRA 2ZUMA 2BRRH 3RUGF 4HBCH 1I85A 5HI4C 2KL6A 4PJFF 3DYMA 5FXCH 1M7IB 2V3FA 1QI0A 1QR4A 2YPLB 1HHKA 3TC9A 2DD8H 4NIKB 1NAKL 3CSGA 4P7LA 1MW2A 1QVBA 3QQ4B 2DSWA 4LBEA 4QXWA 5BZDA 1N82A 2PNDA 1NCDL 3ECBA 4M02A 2F58H 2AQ3A 1FYTD 4JM2A 1JYWA 3GGWA 2HFFB 1NWSA 3IT8D 5KEZA 5ESVA 3DMMB 4LHJB 1U8PB 1TQTA 1PD6A 2ZXQA 2X1IA 4KK5D 1K2DA 1HOCB 2A2QT 4PUEA 2VXVH 5C71A 1NP0A 1C1EL 3CVHH 1OP3K 2NY3C 1B0RB 1TLKA 1KJ2L 3L2LA 2XTJD 3WXWL 2HKHL 3UTOA 3RGVC 3VFTA 1E6NA 1ZLWH 3F6IA 5MEOA 4L4TD 1ZTXH 3FN9A 3HLAA 3MLXH 2WBGA 1NJ9A 1S7VB 2D3NA 1HJQA 4AISA 2ZJSH 3ES6B 1RI8A 5LBSL 4BFIA 4PR5A 3TVMC 3CX5J 2J4WL 3ARVA 1KTCA 3DO3A 4NCC1 2XGIA 1FJ1A 1CL7L 5IB2B 1KSRA 4FFVD 1C12B 3MGOB 3QO0B 3RA7L 5CUSH 4ZUSA 2QR0A 5C09A 4UCFA 1KIUA 4PJGE 1V3HA 1IMHC 1PEWA 5CLWA 1OD0A 4R27A 3WL1A 1DSFL 4I2XB 3MUGB 5F71A 2FO4A 4G8GD 2OQJB 4DN3L 2R0ZH 4DZ8B 4NCDA 4RQQA 3BUDA 1HP4A 2PYFA 2WLYA 4MHHI 1A7QH 3QWOB 2AV1A 1FFPB 3U30B 5EOQH 3IETB 3IDYB 1UQYA 5DJYB 2DQTL 3AYSA 3PBGA 5CPTA 1ZA3A 4X6DA 1J0JA 3MLZL 3IFOB 1W9XA 4W87A 3EFDH 4GI6A 2J1KA 2JF6A 4UT9H 4PRAB 4APQC 5BRZD 4NKDA 5JW4R 3BKYH 4RDQG 4MX7B 1SJHA 4L8SB 3ZDZE 1J9CT 1B90A 3IJYB 3SCQA 3QHTC 1QACA 4EIZC 1MAMH 4XI5C 5KS9B 4UQBA 1GHRA 3L5HA 1JWUA 1WWBX 1MCJA 1UH2A 4OQTH 1Q9LA 1T2QH 2FGWL 2B1AL 1V6XA 3OGCB 3CFDB 2FECL 1QHZA 1JHLL 5TDNB 2YFNA 3DV4B 3L7EB 1UM4H 4WI9A 3BLKA 3LEXB 4PJCE 1C16A 2KZ1B 1N6VA 2E3VA 4HWUA 2A1WL 5DC9B 2JJVA 4YHZL 1ITCA 4UTBL 4QRUB 4X6CE 2BY1A 1GZJA 3RUGB 4OLUH 3BW9B 4PJFB 2WCAA 3HE6C 1RULL 4M82A 4RMWA 1B0GB 2DM2A 4XPHL 2FZ3A 3HN3A 4J1UB 2BVQB 2NX5E 2BCKB 1KEML 2E4TA 4F80A 3L3DA 5E2TL 1ONQA 1AR1D 3O3AA 1CGTA 4JY6A 3GH5A 4LHUB 1MHEA 1H15A 3I6KA 1VFAB 3NYDA 1F4WH 4S1RL 1JXJA 4WWKC 4W6XB 1RUKL 3OTTA 4X7SL 4F7EA 5BZWB 5D9PA 3JWOL 2K7QA 5D7LE 4PJBE 2ILLA 5KZCD 4FTVA 5I6SA 3NCBB 3BQUC 5EPMB 1J05A 3D85A 1MJ7H 5ITBL 4X9YA 1VADB 1NCAL 3MA9L 1YPZF 4BZ2L 3PWUA 2O9TA 1N7ML 4HIJB 3SCTA 1I1YA 4YFLI 2GEEA 1TNMA 1QBLH 2XZCL 2YPVL 3NBNA 2GTZB 4QHUB 5L8JB 4IMKA 3APGA 3QIBB 1SJEA 5E9DB 3IDIB 2Y25A 2AXFA 4AY1A 3LN5A 3TOPA 3QHFL 2DTSA 4PBVC 4UILH 4ZUVB 3AMCA 1UH3A 3AUVA 4UDUA 5CIPH 4NNPL 4BUGA 2WUBL 4A3YA 4S1QL 4JZJA 2WCGA 5EUKB 3P4MA 4Y19D 1V6UA 1N5AB 1Q38A 5ICZA 3O3EB 4AENA 1I8IB 2X40A 2F53E 5C0AA 3X13B 2PWDA 2VXQH 4PSPA 2AXHA 5B4MD 1MVUB 5J1AA 2Y9RT 4HH9B 5D8ZA 3UXFA 5ETUA 5HOSA 2HH0H 3EYVA 3SPVA 4GXVL 1WZ1L 4M6NL 4YFEA 2H1PH 3FMGH 3GI9H 3AROA 2J4GA 2IPTH 3DURA 3UTSE 4PCSA 1PZ5B 3MLYH 3TWCH 2AXGA 3FN0L 2OR7A 1KPRA 2VLRD 4PRBB 3NSNA 1G94A 1CLOL 3C5JB 4QYOA 3T09A 4FOMA 4HOWA 1WEJL 1DBAL 5KJRL 2E7LA 3GSVA 5KW9L 3O41A 5CKAA 1TTFA 4BQBA 4YWGL 3PHOA 2HTLD 3UBXB 1T03H 1PG7L 4ZD3H 1KUMA 3POCA 3L6FA 4RAVA 3VXSE 4JN1H 1KBGL 1QNZL 3MV01 1AQKL 3ARBC 3E2HC 1ZMYA 1JWSB 2CMRL 4HCRA 4JVUA 3SDXF 3GMLA 1PEZA 3QB7C 4JFPB 1Y6MR 3OKDA 4CMMA 3G5ZB 4RA3A 2CIPA 2IH1B 2NW3A 3B83A 1WDRA 4PJ5D 4ACPA 3A5VA 4PY8I 1UCBL 1T1WA 4DAGH 1S8DA 3UZEA 4TVCA 3BPOC 1M04A 2BSED 1XH2A 3RAJH 3TIEB 3GUTA 1J1XH 5DMGC 1XHGA 4QRTA 3V5HA 1VFFA 4BQ5A 3RJDA 2IQAA 3SGEH 5IFHH 3BGMB 2IADB 2A77H 1VBRA 4XBPB 4LVHC 4PJDE 4ODTL 3RDTB 5CJBA 1ZEAL 5E00A 3EYOB 2W9DH 1UWGL 3IU3B 2DMCA 4ZFOL 2P5WE 2O5XL 3AXLA 3QZWG 2B4CC 2JB6B 3MLSL 2W60A 4BCEA 2COQA 1P4BL 5IB3B 5LA1A 1MXGA 1YMMA 3TH2T 5J89A 3FQTB 3JVGA 2OJEB 1AMYA 1RZKL 2E9WA 2ICWA 4ZUWB 4WNQA 3FQWA 3K2UL 4RBPK 4AEFA 3GJFH 3TCLB 5FYJD 3FT3A 1GVIA 3LRSB 4MJID 4R26L 1T80A 3QDME 4HC1L 4L29A 1D5MB 4OLEA 1FH5L 1BQHB 3VRIB 4H2CA 3UR7A 3U4BH 1TQCC 5BROA 3JV6A 3SURA 5I9QB 1W9BM 2F7OA 1NAMB 2GTWB 4PD4J 2Y06H 4MQSB 4XCCL 2QLVB 3FQRB 5F9JA 3SQOL 4KI1A 1R5WA 3RWJB 5K9KB 4DK6A 1K9FA 4OD3H 4EKXA 1TJHL 5A8QA 1SYVB 1Z3GH 1I1RA 4KMLB 4BH7A 4WUUE 3PGFL 2ZWYA 2GITA 2MFNA 3B9KC 4FMKA 1D6VL 1URLA 1D5ZA 5EU5B 3UDWC 4GRLC 5FGBC 4Q9RL 4M7KL 5BV7B 1E4WH 1ZGLM 1SEBB 1GH7A 5IEKA 3O9WD 5LCVL 4CL7A 3ZQ9A 2E8ZA 3WFZA 3FQXA 2A6KB 4CVZA 4OIIL 4X83A 1UJ3A 1DBBL 5IR1A 4JO3H 4U6HB 2C4FT 2XI9A 3NN8A 5D7IF 3UZQA 2X9XA 3LXBA 2DQEL 1VB9A 5IK3A 3HZVA 4Y4KD 4JFEB 3BD5A 4PJAA 4Z78B 4QOKE 1R3KB 1B2YA 4O5LH 3PZOA 4XAWH 1L0QA 4LKCB 4Y5VA 2UUDK 3VXQB 4LQFH 3UTQB 5FOBB 3TTSA 1A1MA 4WCYH 1M03A 1CXLA 3S3PA 1WWWX 3VWKA 4F9JA 4XPFH 5D5MB 2I26N 1WZLA 1JV5A 4GMSL 1FL3A 1N5YL 3SKUD 1E6ZA 1V0NA 4A6YB 3AS0A 1QBBA 3HFMH 1QLEL 1M6OA 3DRTB 2WC7A 4GBXB 1AFVH 2H8PA 2YL9A 2YJQA 1REIA 1TPXC 5D9OA 2Y23A 3BWAA 2XVGA 2OZ4L 4ATLA 3X3GH 1I7ZB 4MB4A 3PWPA 3R1GL 2XVPA 1DQTA 4Z7QE 3VWJC 3U46B 4PJ8B 5ABFA 4M7JH 1MFBH 1NDMA 4K3DH 5C9JB 1OPGH 4LCWA 1KPUB 4F9PA 3BKCL 1S5IH 4F7CA 4BFEA 1TZGL 5A1AA 4O9HL 3QCVH 4KQ4H 3U7BA 3ZJ8A 3ZE2F 2IMNA 1HIML 3TBVB 2QV4A 1A9BB 1MUJA 1YEFH 1I8MA 3QCUH 3OKEA 4HGMA 1X5GA 1V03A 4R90H 3NSXA 1JCKA 4HGWB 3VDAA 1L9NA 4NKMA 4XCYA 4YBHA 3W2DL 4QXGL 3LPOA 5MP6L 1K6QL 4I4WB 4LBEB 3SDYH 3ME0A 1DWAM 3ECBB 5DURB 2VDKL 3MOAL 3I3EA 4QRPD 1EHAA 2H6PA 4KDTC 3MC0A 3BAXA 1KEGL 4QTIL 1TZHB 3CFJB 1R86A 1TG7A 4K94H 3MUHL 3ARXA 1ZHLB 1K2DB 3NIGF 4Y4FA 1GXEA 3ZZ1A 4ZAKC 1E73M 3QDJA 3RU8L 2H26B 2BOCB 1FNEA 4Z7UA 4R8WL 5GS2H 5FGCE 4KVCL 2WHKA 1S5HA 3A23A 4HS3B 1V05A 2BJMH 5C8JA 2V2TB 1WK0A 3RWGA 1BLIA 4IIQB 1ODZA 4NSKA 3FCTA 5DR5H 1ND0A 2IH3B 2XVNA 1HDMB 1UB5A 5CINH 2B39A 4IRZL 4KVNH 1OCQA 1XIWC 1OHQA 5E5MA 4BFIB 5T3XE 1C08B 4M6OH 2HAZA 4DEPC 4UFJA 2Q7YA 5I79A 4RISL 3GMNB 4HPHA 4ZUSB 5L0QC 5IBTH 4LHUD 3VRLE 5BQ7A 2A83A 4LSRL 4U6YB 1FDLL 4RQQB 2GJZA 3H9SA 3SE3A 4WRLA 3O6FC 3OKMA 3P0VH 5D4YA 4BQ6A 4JPIA 4CU6A 4KK9C 5EU3A 5EIQA 1KXQA 1T83A 3GNMH 1RZFH 1AC6A 5EZIH 3NZ8A 3HG4A 4W88A 3S7GA 1HCVA 1KCVL 4WFFE 4NKDB 2HT4C 3CSPA 4QXUH 2HFEA 3UJIL 5ID0A 3D4YA 1VIWA 1H3GA 1OP5H 1MRDL 3NCEB 2R9HD