1CXKA

Complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxkA01
5CPQA 2VOTA 4MXQC 4EI5A 5IGXH 3AS0A 3FO0H 3CZGA 2EDRA 4D0BA 2JB5L 7A3HA 3DX6A 4OM1L 3L9RB 2F53B 2UYLA 3QWOA 4KDWA 2MPAL 1KJMA 1MIEH 1TCRA 3T2NH 3OGCA 4H1LH 4M1GH 2CJUH 5GGTA 4MD5A 4TTGA 3JV4B 5A16B 2X6MA 2X4UB 3CD4A 2WZPD 1YJDC 1IM9B 3H3BC 4HAFA 1QR1B 2WQRA 4WHYH 2Z93B 3DGCR 4FQLH 4XGZB 4ZDHB 3HNVL 3UJTH 5T1DH 2EICA 4QRPA 2GW5A 5IK3A 4GW1B 5LKNA 5J0BA 1IAMA 1IGTA 2ZUQC 3NTCH 4EI5D 3BVWA 1NQBA 1OHQA 1X4XA 2OXHA 5KSBE 4C56E 3TZVC 3ZYOA 3MRQB 1FCGA 1M7IA 2EE9A 3A21A 1MCEA 2ED9A 4HA4A 2AKRB 2VZSA 4ELMF 1TQBB 1MJUL 4XVSH 4G80B 5M17A 3TZVA 2PNDA 1QNSA 1U9KA 4E0RB 3KPQA 1HXMB 5D2LF 3WY3A 1OLLA 2JCCA 4FMKA 4NQVA 3V5HB 3NCMA 2D3LA 2VCAA 1MHPH 3HI5H 5HVFB 4JFEA 3ZDZF 3GBEA 3LVEA 2NX5B 2RR3A 5IW6B 3DX0A 4OLUL 1CICB 2P47B 1LEIB 4NO2B 2NT0A 4V28A 1QUNA 5IW1B 5LAXB 5CSBA 1C16B 4IEFB 2A73B 2OLDA 4AMWA 1KR1A 1KYOJ 4AIEA 1P9MC 1V7NL 1S9YA 2NY6C 1M05A 2I60H 4H8WL 1T2XA 1IGYA 2BOBB 3REVB 5B38B 1SYSB 5D93B 1W9XA 2PR4H 3QWRA 3VFMB 4I0CC 3TZVD 1P9MA 1D5XA 1CXIA 5BV7B 1T04A 3HAEG 3OKNB 3TGXA 5DD0H 1Q9WB 4Y1AA 3G04B 4YC2B 3BESR 4JFED 2X70A 1FNHA 4N0UA 1I8IB 5JO5B 1NUDA 2DTMH 2Y1VA 1UYWL 2W0PA 3WD1A 1D3CA 1NL0L 5I17A 1TVNA 3MRIA 4HPYH 5ICYB 5DJCA 3ULUL 1AY1L 1FFOB 3KHOA 1MOEA 4QRSB 3V6ZA 3VUPA 1I1FB 5D70L 5H35B 3FFCA 5AEAA 3GFUA 2IG2L 4R97B 1F3DJ 3VXRE 1GZPA 2GUOB 1QVOB 4RGNB 4K2UL 3QWRD 1KJ2B 5HOSA 2NY6D 3D69A 3NVQA 4DO4A 2DQUH 5I5RA 1INQB 4PJ7E 4TPRL 4F57H 1WWBX 4Y1AD 5JHLH 5EZLA 2IGTA 1S7SB 2F5BH 3L95A 5I1EH 3QXWA 1U91A 4EOWL 4GRMB 4YHML 1JDAA 2YC1A 3NFPB 1PYWA 2EH7H 2XTJB 4JPIB 3MRFB 3VJ6B 4YUEL 3BAWA 3S7GA 3WKMH 3BW9B 3LKNA 5SWQB 5ESVA 3QHFH 4LGPB 1LGVA 1UR8A 3FFCD 3ALFA 1GOGA 2ZOKA 4M4PA 3BE1L 5ADPL 5BV7L 5IFJB 2P7TB 2AEPL 1UACL 1CFBA 2MHAA 1FZJA 4FQXC 4YNYB 3VD4A 2FJHA 3GJFK 1GGIH 1UB5A 1OL0A 1XCQA 2VDLH 2VLJA 4GLRI 3P9LB 5J12B 5DRWA 3D25A 3DWTA 4KH2A 1L7IL 2CRMA 4WENB 1EO7A 2YMXH 4GH7B 4XPTH 1MCJA 1I1AB 1W3LA 1EHAA 5I1KL 2NY5L 1G6VK 3DX3A 4MWFA 3MJ9L 4KXZH 5DD6B 1RZ7L 5CZVL 1U33A 2D22A 3CUJA 5JXEC 5FA4A 1FORL 2K1MA 1KUMA 4JKLA 3W25A 4JM4L 3KYNA 5DJXB 2NZIA 1QVBA 5HHXL 1M53A 1VIWA 1Q4NX 1PAMA 1T1YB 3TVMB 3EGSA 3NCFB 4AIZB 3NCEB 3DUUA 4YHKH 2VLJD 1Q9KB 2V2WA 4FNLH 5JXEA 1U58B 3NFSL 2G2RA 1IC5L 4AEIH 5ITBL 4CW1B 1DDHA 4W7VA 4FQXD 3WDJA 4DQOL 3G6JB 4DFIA 1E6XM 1N59A 3WIHH 1KIPB 2VQUA 1YN7A 3IGUA 4N5UA 2O61A 3O11A 3QIWB 1MH5B 5E8EA 1YYLL 5E6ZA 2IALB 5IB3B 3W82A 1T03H 3F7VB 4TNWF 2ZJSL 3C6LC 3QDJE 1YEDB 5K59E 3DV4B 3IU4L 3BPLC 4FQ1L 2PBGA 2HH0H 4K3EL 3D85D 1N2RA 2F8OA 4ZPVA 4FA8A 1ZWIA 5F1OB 4KHXH 3U36B 4UOQA 1FZOB 2PO6B 3C6LA 5JXED 2XG5A 3QHZL 4R7DA 1AGEA 3C2AH 4X7DC 3DURB 5LA2A 4KGJA 2VMFA 3O0RL 4GMSL 4XVTH 1A47A 3ZDYF 2ZSVA 4HFUL 5D7KE 3I9GL 1LE5A 1HH6A 4U1GC 1T22A 4WW1B 3KPLA 4UIKH 5TGBA 4FNTA 1YN6A 5EB9A 2EH8L 3AS2A 3EOYG 5EFIB 5T3ZL 3EMCA 3WJLA 5BZDB 4OLYL 2BVDA 1PDKA 4XB8A 4PGEB 3QCVL 4DN4L 2J4WL 2RGLA 4DOHB 4WDIA 1FH7A 3ZDXF 1U8NA 3C9NB 5E8OA 4HF5H 3UTQA 1ZB5A 1D5IL 1XGRA 5HYQB 5IB5B 4MMXC 3QAZB 2AABL 1QOXA 2R4RH 5DRXB 1HOCA 3U79A 3F58L 4GAJH 3C6LD 1C7TA 3O3BA 5LWYL 4K3DL 3N11A 4NJAL 3VXPB 2WYSA 3GSOB 3K4AA 2DWEA 4H88L 4JDVA 5MP6H 3BRFA 1UR0A 2ESVD 3M6DA 2RHEA 1I7RA 4HMEA 4S2SA 3KXFE 2NXZB 2HTKC 2IANB 4F3FB 1YEFL 5EPMB 4HKZA 3GRWL 1U8LA 1EGJA 2YPVL 2OXGA 4FQPA 4YO0B 4PS4L 3RTQC 4HC1L 4Y16C 2APFA 3BEVB 1ND0A 5GXBB 3LHPH 4WV1C 2GCYA 2BFGA 4Y5YB 1TVBB 4NRSA 3PP4H 5FOBA 1K3IA 2P5WE 3A23A 3TLRA 3IS1X 1A9EA 1E72M 3RTQA 3S35L 1HHJB 4Y16A 3SKMB 4I0PB 3W9DB 3HPJA 3C09B 4WV1A 5FYKE 2X9WA 3WUWB 3ILPB 3IGAA 2FX8H 5HVHB 1R5WA 1HKJA 1WE5A 3GMMA 2D20A 2NX5E 1PY9A 5A6AA 4Z7VF 5TE4H 1CGVA 2AQ2A 1YEGL 5D7IA 3HC0B 5F3HA 2MQ3A 1A3RL 5A69A 4KAQH 3EHBC 2OL3H 3HZKA 1QRKA 4LEXH 4L29A 1A1MA 1OAYL 2V5RA 2XY2A 4FN0A 2HTKD 4U7KA 5E2VL 3C87A 5HHPA 1HJSA 1N6QL 4JDZA 3RQ3A 4BQBA 1QNOA 4JB9L 3P11H 4KDTC 3RTQD 3K8MA 4Y16D 3MNZB 2ITCA 3GSUA 4XCEA 4D9QD 3KYKL 3U30C 3GI9L 1S7WA 3KPOA 2ZPKH 3W39A 1ZJAA 3BKYL 4KDTA 2YRLA 3BUYB 5K33A 3QUKB 1TPXB 4XZUA 1MSPA 5LYRA 3S37X 4KZEL 5L9DL 5FCSH 4KJWC 1CPUA 1H11A 2W65B 2RFXB 4FFWC 4P4RA 1NLBH 1GOHA 5E6IB 1F42A 2GDUA 2LTQB 3K3QA 4TVCA 5JBDA 1ZT4A 3EHBD 3EIFA 2CKRA 4OAWA 4JHBA 3NIGF 5I19L 3WD2A 4RGNE 3MRHB 4U1JB 4W8LA 3OAZH 4H8UA 2R39A 3ARXA 3UAJC 3FY1A 3HE6C 3QUZC 2VDQH 4NNXB 3WH7A 4KTDL 5E4EC 1G6RA 1UJTA 5ICXB 5CCKH 4LSQL 4XNUL 4JY6A 2XHYA 1MWAB 3QDHA 1PW3A 3SCVA 3HE6A 3QUZA 4GKLA 1FLRH 4NN5B 5B38G 2ORBL 5CJXA 5TQ2H 1UKTA 5FCUL 1S3KL 2XTJE 3HZVB 2BJMH 2C0HA 3GKWH 3R4DA 3FCTB 4OLZL 5CS7A 3TCXA 4FFWD 3CUHA 1NCUA 2W1NA 1FG9C 2R15A 1NAMB 2CIIB 5DR5H 4X7FC 4LGRB 1S5HB 3EYSL 3ARBB 5EIQA 3PZQA 4GPNA 3VWJC 3D85B 2WPGA 3N1GC 4KHTH 5E8PA 1E4KC 2DQEL 2VR5A 5EULV 2B8OT 1U8MA 4WKAA 3RA7L 3FFDA 3K0WA 2LU7A 4HUNB 5MENB 3O45A 1FBIL 3VWJA 4P99A 1K4DA 3UAJD 5F93C 4HG4K 1E4KA 3HE6D 3EAKA 3QIUC 3QUZD 4TQEL 3VH8B 4UZSA 5ABHA 3GSXA 4G6AD 1MXDA 4W93A 2X1IA 3ZL4H 3BQUC 4YJZL 5T3ZE 2GJXA 1UH2A 4LCCC 5IHSA 3RO8A 5GS2H 3GM8A 3QIUA 2YDSA 2IGFH 4YGAB 4F7MA 2VVSA 4ONGL 4KJPC 3BQUA 3PL6B 1ZHKB 5AUMA 1XGYH 4IPNB 2ZX8A 2CMRH 4LCCA 2VISA 1NDGA 4UOW1 1OGTB 3MBXL 4MB3A 5I74C 5C0AA 2F61A 3BUQA 1DQLH 1W8NA 4FZEL 3N1AA 3WHXB 2XFFA 3G6JE 2GJ6B 1I3RA 3VWJD 4ODSH 1JYXA 1Z5LA 3QXUA 4OGXL 5KZ6A 4BFEA 3CX5J 5DHVH 2FCBA 2V7HA 1A7RH 3JV6B 2CLVB 1AGDB 2R1XA 1J0HA 4U6YA 1CDUA 1J88A 1KCRH 2ZWYA 2GDVA 2VLME 2RGSA 4JPKL 1PKOA 1GPOH 1GVIA 3O4OB 3QIUD 1BFVH 2SEBB 3MO1A 4P3CH 5CBEA 1RZGB 3T2QA 4LRNH 5MEPA 3BQUD 2AJ3A 4LIQL 5GRJL 2IQAA 3JTTA 3ZDZE 3WIIL 4KPHL 4AC1X 4Z7VB 1T3FB 3BKJH 5DEGA 3AM8C 3GBNH 3JZ7A 2IPKA 5C0AD 1Q0XH 3PDOA 2HFTA 1NGXA 5I8CA 5HI4C 1KXTB 2BSED 2BC4B 5J8OA 4FQHA 4XH2A 4DVBB 1R0AL 1A6WH 3BRDA 4KKNA 3V6OE 3S97C 1OIFA 3BP4A 3O4LA 5JW4N 1FNSH 1JGUH 4XMKH 3ECBA 4OQ1A 5FCZA 3H3PH 3M8OL 4DOHE 1CLOL 5E95B 3OTTA 1BVZA 4RFOL 1N64H 4XPHH 3OZPA 5SWZB 2B0SL 3QZWB 4YHPA 3C5JA 1BX2B 1VGEL 3T1FB 3RIFK 2YUWA 4KWUA 3RWHB 4CMMB 2Q87A 1A1OA 4JFHE 4M7KH 2V17L 3N85L 4TSCL 4NHCH 4Z7QF 4YR6B 3LRSA 3TBYB 3RVTC 4MDIB 3GJFA 1FP8A 1F4XL 3VFRA 1JPST 2J7EA 2IANE 5HHQB 4S0TD 5EIIA 4P9MH 3O4LD 3VD3A 3AYSA 4JFOB 4FNUA 3X13A 3RGHA 3VI4F 5HI4D 1VBUA 3UEZA 1UQZA 4M82A 4CD8A 4OOZA 1A2YB 1OLZA 5I30H 2Q86A 5EIVA 3B43A 1EEYB 3BZ4A 1RK1B 2PYEA 3HFML 4XAWL 5ABFB 3Q0HA 1VBRA 1TDQA 1H8SA 5D9OA 2QQLL 1H15A 4LHQB 3VDCA 4PFEA 4AIXA 2J8UF 3I3DA 3BX7C 3W0WB 1BEYH 5GS0L 1BPLB 5EU6A 1MCOH 2EJ1A 4K8RH 5E94B 4PMQA 2JF6A 4LSUH 2F15A 4WEUD 1GOQA 2B4CH 1U8KA 3EJYC 1MQKL 4MJID 1EV2E 1K2DB 2Q76A 3RVTD 1PZ5A 2R56H 3WLWC 3UYPA 1ZLSL 2PYED 1C8XA 3U6RB 1VADB 4HHAA 1SY6L 5KEZA 4L5FH 3SKJH 5FO7B 4NF7A 4R0LC 1FNEA 3EYUH 4K9EC 4IRZL 2EE3A 3IDUA 4HZLA 3SDAA 5HPMB 3QJHA 1IZKA 1XSIA 2UWFA 1YPZA 1S8DA 5EU6D 5J1AB 3WD0A 5FL1A 4JFPB 5I9QB 1PVHA 4H8HA 4R0LA 3GSQA 1IQDA 4A6YA 2X0YA 1Z9LA 4XNZB 5J11B 3BH8B 5LJYH 3ROLB 4XCFH 1KB5B 4ZOCA 1WFOA 5EOQL 4WFGE 4W87A 2CNCA 1U8PB 1G9NL 1EJOL 1UZ4A 4NGHL 3N1FC 4CDHA 3WUWG 4O58L 1H0DA 3EJYD 1LO3L 4ZD3L 1UA6H 1LL7A 1BVLA 1IKNC 4MX7A 3VIGA 5M7QA 4JHWH 2Q7YB 3CHCA 4JZ5A 2ZX9A 1GC1L 3CU7A 4YIQA 3HZMB 5IV2B 3VIFA 3WLWD 4C56A 1CF8L 2GFBA 1IEBA 4AM0A 3C8KA 1ZHLB 1DBMH 1IKNA 1RUQH 2WZEA 4WKFA 1VEPA 4C7FA 4BH8B 3VIJA 1WWAX 4GKSA 5E09A 1FV1B 2G3IA 5EOCH 4ZE4A 3S34L 5CIPH 3TT3H 4QRQB 1V8HA 5D6CB 2DLGA 4NQXB 4WFFE 3CX2A 1J0JA 4TNVK 1ZLWK 1NCTA 4N90D 3MR9B 4XBPA 1HJVA 3KZSA 1EVTC 3IJHA 3LQMA 3PWNA 3DX9A 3ZDYE 1CFVH 5FYLL 5KVFL 2BCKB 1O7VA 2HWZL 3D3VE 5EBWA 1I7UA 4M1RA 4MMZC 4IRJB 5GSRB 1XR8A 2YUZA 5TE7H 2TAAA 3BD4A 4QHUA 5GRYA 1A4KB 4LIQE 1FZMB 1I9IL 1QBML 4P9HC 4R4NC 4XP9H 2ALWA 4RNRA 3LQAH 4YAQA 1B2WH 5MENE 3ZDXE 4Z0BH 4M1CC 1J1PH 1U8QB 3FB8B 1CDGA 5AWNH 3WENA 3AJ7A 3RUGF 3CMOH 4PGDB 5IHUL 1UG6A 3U9UB 1MF2L 4J8RA 4PRNB 1RZKC 4PG9A 1IT0A 5CD3A 2AJVL 2XA8L 5IVXF 3VXNA 2VN7A 5FM4A 3RL1B 3CDGB 4HJGB 3CK0L 4OLXL 4PTVA 3QQ4B 1ACZA 2DQGH 5IOPA 4M61A 4XP6H 1T7YA 2ZOXA 4GXPA 1T20B 5CJQL 3BAIA 3O6MH 1MVYA 3VXRA 3KDMA 5I1JL 2CHOA 2GJ6E 1D5ZB 1DANT 1HHKB 4UFLA 4M6NL 3NAAL 3F5KA 4HUVA 4O2EB 4XC3H 4UTAH 4R4ND 4LFHG 4PJ7A 2QJDA 4XXDB 1OOAA 4XMLL 4FNQA 4M1CD 1P4IH 3NACL 2BNQA 2PW1B 2X4TA 4GAGH 5CSZA 5IFHH 3N17A 1DQDL 3TJHC 1RHHB 3QEHA 5MERA 4DKFL 4P2QA 5JXAH 3VX1A 4GOSA 4DTGL 1TA3B 4NQDA 1LEKB 1EFXB 4GUPA 2EDWA 2B1HL 2ICEB 4JHAH 3FQTB 1ZHBA 4NBYB 3VRIB 4QRRB 5T1MA 2UWEF 3VXRD 4PPTA 1S5IL 2O5XL 3MRJB 1LDPH 4M7ZB 1ZAGA 2DM7A 2X1PA 3ARYA 4GKNA 3TYFB 1R3JB 3IU3B 4JQXC 2CQVA 1IM3B 4G6JL 1HKIA 1TR1A 1NDMA 2ADJA 5I1HH 1E1EA 3C5SB 1JK8B 3EDJA 5CEZD 1FN4B 5F1NA 2GSGB 4PREA 3DX1A 3QDGB 4KQ4L 3VIHA 2BNQD 1HJWA 2DS4A 4M8QA 4JQXA 5FOJA 5SWZE 1HWWA 1RIUH 1MCDA 4P2QD 4GT7A 4R2GC 4YHLL 1ODAA 3H9SB 3QNXA 4NQDD 5BCAA 1AI1H 5J6GA 2XVGA 1BQLH 4FQQB 3IDXH 3TJHD 1UZ8A 5E2WH 4DJMA 1UWXH 1CXHA 3ESVF 3OSKA 2XVLA 1V7MH 2IAMB 5MEQB 1FSKB 1NUNB 1LK3H 4GI9A 1FHGA 1C5CL 3HI1A 3P30H 3UO1H 2VZ3A 4ENEC 3NIGE 3LIZH 3KPMA 1EUTA 4Z7UF 5I1DB 5I66B 5IEKB 3RHWF 3ELAT 3BKMH 4BJLA 2ERJB 3S4SB 4CVZB 8FABA 1E55A 1ZSDA 4UR9A 3ZOAA 4Z95L 4X6DF 1RH9A 2CKBB 2DAVA 4FNRA 4KY1L 1H3VA 3HC3H 1I8LC 1WAAA 4F15B 2D3VA 3BH9A 3JWNC 1P2CA 1IEHA 3LRHA 1HINH 2DWDB 3QDJA 4B41A 4PP2A 3W0WE 1MFEL 1ZLVK 3VFSA 4PLOB 4R2GD 3HUJA 2ED7A 4HW6A 4JO3L 3V6BR 1I8LA 4RE2A 3VSTA 1UQSA 5ETUA 3RM9A 3BAEH 4OV5B 3AFBA 3QZWG 4XHJC 5C0BA 3UPRA 4L4TA 1MHEB 4LU5H 1OB1A 5HVWA 4ZUWB 4OSUH 4AIOA 1NOWA 4YXHL 1EOKA 3CVHL 3HG2A 1UADC 4I77H 2OQJA 2VDML 5EWIH 1JNHB 3L6FA 4ENED 5K9KB 4YN5A 2OWWA 3PXJA 3IFLH 4OIIL 3WF1A 3MRMB 2LVCA 4ZTOL 2AV1B 4H8WC 4X4ME 2WNGA 2AI0H 3QDJD 4F7PB 3E3QE 3L9RA 2EYSB 1ED3A 3SE4A 3V52L 1YY8B 3ZKNC 3RUGB 1G0DA 4EDXA 2YN5A 4I2XA 4W4NA 3RCNA 4GAYB 2XWJB 2AXFB 3MREA 3W29A 2CIKA 5IVXB 5C0BD 4L4TD 1C8PA 4FLRA 1LJYA 4PJ5A 3BLKA 1HH9A 1ETZB 3SCMC 1G7IA 1P7QB 4X6CB 3UZEA 3KXFA 2Z35B 3QO0A 2DM3A 3P0VH 1KCSH 4OZIF 1SJHA 4XHJD 5E5RB 4Z78A 3ULUC 2X09A 1SMDA 2XZAH 2AJYL 3NBNA 2CETA 1UWRA 4JPWH 1WBXA 3L7EB 3EFFB 4U31A 3SDDC 3D5HA 2P5WA 1BM3L 3OKOB 3P4OA 3ET9F 2VX4A 2YJQA 1FIGH 2C4FT 4QTHB 5DFWH 5EC1A 1C1EL 3ZKND 3SDDA 2J7DA 4PJ5D 3HCVB 4LSSL 1OD9A 2XSBA 4RFNB 4PSRA 4N0FA 1MFVA 3KXFD 1X5JA 1QTYT 2CUMA 3OAUH 3NPSC 1JUFA 1NC4A 5EC2A 2YA2A 3F12A 1VJZA 4X0KB 4M93B 2UWEB 1E6JH 3FOLB 4UV7H 3SCMD 4IUGA 4OKDA 2OZ4L 4W5UA 3FQUA 3MMEA 2A74B 4UNVA 1GZQB 2X8RA 3ULUD 1Q0YH 3HHRB 3H8NA 2JIXB 1NFIA 4FLOA 1BYCA 1RMFL 1ZE3C 4MNHB 5DRZB 7FABL 5J6HB 2CKNA 1NANI 5EUKB 1A64A 1FVCB 2XWTB 2V5DA 3FN3A 3VFMA 2YD4A 4PMNA 1JWUA 1HHIA 2IPTH 5EORH 3SDDD 4F7TB 4G6ML 2J79A 2GTZA 1OWRM 1OT1A 1JMZA 3MRGB 3AUVA 3IVKB 1JF6A 1FVDA 5HHMB 3TEUA 1NC4D 4K7FB 5H8DA 5JO5A 1UXWB 2NY5C 1PQZB 4Z7QE 5FGBC 4WIWA 3GH7A 2F54D 4ERSH 3O2DL 4OQTH 1EEUA 5BJTB 3SGEH 1DE4B 1U3HB 5A6JA 2H32H 3S2CA 5GNXA 4S1QL 1I1FA 5EU5A 5IHLB 4Z7UB 5FGBA 2VWEC 3MJ9A 5DMKA 3VI4E 1PX4A 3MUGB 3MBEB 4JQIH 4U1MB 1FYTB 2LFGA 2R2CA 3F5WB 5EOTB 3PWPA 1W72H 2WC7A 4X6DB 1EXPA 3IXTA 4YFDB 4YHZH 4GI6A 4KK6C 4UNTA 3WN5B 1UWIA 1KR0A 2EO9A 3EDEA 1X7QB 3NFPA 5FUOL 3ZTNL 4L4PA 2WHJA 1VFMA 2Q3ZA 3WUGA 2VLLB 5SWQA 5TH2B 1E27A 4YDJA 3BIAX 1EDQA 2YD8A 4HG4J 1KCUL 1KENH 4QRRE 1CLZL 2J7HA 5FHBL 3ZKXB 4YNYA 1TZHB 3PWPD 2F18A 4NZUL 1IEAB 4QXUH 4X7SL 2X4PB 4P2OD 3OL2A 1OM3L 1ZHNA 1DANU 1NAKH 6FABL 3BRGC 1QI4A 4GBXC 2A9MH 2CDEA 2Y36L 5F7EL 5ILTH 4JFUA 4RRPA 3DV6B 2XJ7A 4ZUUB 4KK6D 4P5MA 4JKWA 1MCCA 4B7LA 1MPAL 1NFDA 5HY9A 4NWUL 3H9SE 2AJSL 1JD9A 3RGVB 2PWHA 3FQNB 4GBXA 1QQDA 2R2EB 3BWAA 2D1ZA 1A7QL 4XPAL 5IHBA 4ORGA 4RL3A 1QOKA 1ZV5A 2APTA 3BWUC 2H26B 4KI5E 4NKMB 1T1XA 3VXUA 2J5LC 4B16A 3VI3E 4OZIB 2YKLL 4AIZA 1MHHB 3RRQA 1ZGLM 4F66A 3V0AC 5I75C 2J75A 4JM2F 1E71M 2GK0A 1UR9A 2BY2A 4LSTH 2VDPH 3G6JA 4Y4KC 3ZE2F 1J1OL 4XPBH 3WH8A 4H1LB 5GGSA 2WKLA 1Z9OA 3B83A 3P9MB 4H25A 3MGOB 1I1CA 4IS6B 3U0PA 2EC9T 2Q8BL 1OCWH 2IALA 3LKRB 1UB6A 4D71A 5C0DA 3PG2A 4HEME 2ZUYA 3FMGH 2DJSA 5FA3A 4JIEA 4Y4KA 5EU3B 4GBXD 4XWGL 1A7PL 1ZK9A 2DQDL 3GRWA 4JHZA 4LVHC 4D9LH 3MSPA 5I16B 4N8VB 3D2UB 4WHTB 4HC1A 4JZJB 5C9KA 4AIUA 3VXUD 2GQHA 3GBLA 4MADA 4ZYKB 1GQJA 1NFDF 2XZCL 3V6OC 2D4DA 4LCUA 5FEBA 2X4RA 4O2FB 4UB0L 3HR5B 5FB8A 1C3FA 5FYJL 3MACL 3V6OA 3LZFH 4XZWA 1T0NB 4JFFA 2R0KL 3TTQA 4UT7L 1IC7L 4D8PB 2VLMD 4Y4KD 3SE8H 2OTWB 2K7QA 4W7WA 5IMOB 3UR8A 4MDJA 1MUJA 5HJ3B 3QNYA 4PV8B 2OR7A 3RUGE 3L4TA 5BO1L 5C6WH 1O6IA 3UBXA 3U7VA 2PW2A 2HLFC 1HVXA 5IVXE 3VXPA 1LO2H 3GSOA 5HGAB 3L3OB 4R8WL 3ZYZA 2OP4H 1H5BC 2ATPA 5FHAL 1RZIB 1H0IA 1HP4A 3OXSB 4NRXA 4X6CE 2VSCA 5C0CA 4G9FE 4NNYA 4OGYL 3QXAB 2ICWB 4WEBH 1H5BA 4JFFD 2VC2H 2XWDA 3TYGH 3AHZA 1MYRA 3PTMA 5AZEL 4P2RA 3RPKA 2WW5A 1D6EB 3D3AA 2P48B 3VFTB 4F7EA 3HNTH 4BQCA 3TPKA 1BAGA 5DMIH 1NCBH 4LASH 1P1ZB 2DPEA 4KK9D 1FL5B 3L3DA 1YZZA 4HIXL 1TZ7A 4I3RH 1ROWA 4IISA 4YBQD 1PFCA 1F02I 1ZT7B 3RAJL 4HA3A 1KF9B 4XNQA 1KEML 1UKSA 5IW3A 5C0CD 1B3ZA 1UWQA 4PJGA 2HLFD 2KPNA 4C7DA 1QLRA 1UVQB 3PWLB 4NDMA 2UWEE 3HZYB 2L7JA 4RIRB 5ALBL 1GPFA 1G94A 4IHOA 5CEYB 4P2RD 2ARJB 4OD2B 4P59L 1KC5L 3VMNA 3HMXL 2F5AH 5EO1A 1UEMA 1YYML 2OJZL 2X4NB 4NP4H 4RAVA 3OIHA 2PTTB 3JTSA 3VFUB 3G5VA 2M1KA 3O6FC 2PR4L 1JZ3A 3SUSA 4OFIA 4F9LC 3BGFC 3V8CA 2C4FU 3D6GA 4P5KB 3BUYA 3Q6FB 2V7NB 3QUKA 4ETQB 3KGRA 5HHME 1BYAA 5F89B 1MEXH 1X6NA 4RWYH 2W65A 3MRRA 3VFNA 4NQUA 1D5BA 4JKMA 3O6FA 4UILH 4F9LA 4HX1B 3SCSA 1ADQH 2DTML 2W91A 4UT6L 2HG5A 3M1BB 2V5CA 1CLYH 1KB9K 5IB1A 1AIFA 25C8H 5CKGA 4NO5A 3HJEA 1NMCB 3UTTD 1L7TH 4JM2B 4YFLF 5IEHB 5JW3H 4Z7UE 5KSVB 1QBBA 3GMOB 2NXYC 4PJGF 1FYTE 3MRHA 1J9YA 1TZGH 4XBGA 5D1XC 4X6DE 5JR1L 4LOUC 4HBCL 2ZUTA 3O41A 2DQFB 4AT6B 4HWBH 2MANA 2AV7B 3R8BB 3GXDA 1M01A 4YDKL 4GRWH 2PTVA 3AREC 3QUMB 2XNAB 2W63A 4TULL 4PJEF 3RWFA 4Y89A 2Q8AL 3O3EB 1Q1JL 1R3HA 1BOGB 4WFGD 3V6FB 5E03A 2NY0C 4LSRH 2F5BL 4XB7A 2NLJB 32C2B 4P46B 4PR5B 3FCTA 4WUKH 4M6ML 3SGDI 1E1FA 3S5YA 3AREA 3AY4C 5KVGL 1YNKL 3CZJA 3VG9B 3GI8H 4GJTB 3D3VA 4RMQA 4FTVA 3RWDB 1LL4A 1T2QL 3CC5A 3TA3C 2Q6WA 1IC1A 1CFNB 1UWUA 1INDL 2R29H 3AY4A 4NCC2 43C9B 2W92A 5F7DA 2UUDK 2NXYD 2GJRA 2JLLA 4NQTA 4JL1A 3N12A 5EZOH 3LS5H 3IDMA 1U8IB 3TTSA 2WUCH 1QRNA 5D1XD 3KYOA 1DBKL 3TA3A 3LPFA 2VZOA 2W0LA 3HE7C 1UJ3B 3GJEA 1XCWA 1WZAA 2XKUA 3W28A 4KROB 5I71B 1AP2B 5SV3A 4XXCC 1IGIH 4FMFA 2A38A 4WSJA 2QSCL 4PBGA 4JFYA 5EZIH 2QV2A 1QKZH 1GIGL 4HGMA 1TJIL 2XACC 3O3DB 1CTOA 3ARED 3T3PF 1CE1H 3MZGB 3LXBA 4E5XB 3VFVA 3B5TA 4XXCA 3D3VD 2NY0D 4FTVD 5ESAA 2NTFB 2RCSL 2Q8XA 1A14H 3IAPA 2UY5A 4OZIE 4X4XA 5BXFB 2W60B 4G5ZH 4QGYA 1AQMA 1E6PA 1DWIM 1FGNL 4KTEH 4LLWB 3WH5A 4R96B 1N8ZA 2L0DA 1QRND 3OXRB 4LCYA 3TA3D 4JKPH 4W8BA 4AEIL 1UXSB 2DI9A 4PJBF 5KOVC 4U0RC 3NIYA 5KW9L 2YPLA 3E0GA 3DSFH 4C83B 1JRHL 4HT1L 3GIVB 1JFQH 1KLGB 2ZNWA 4Y5XB 4OT1L 1V08A 4S1RL 3EFDH 3HE7D 5IM7B 3MCKB 2BSTB 3PZTA 5LGHL 3VW3H 3UR7A 4GFTB 1FFPB 4JN1H 4J3SA 2FO1A 1FRGL 4ZS6C 1TETL 1XF4B 1CK0L 5DQJB 5DVMA 1I8KA 5GS0C 3VU2A 1V6WA 2AJXH 2CLRB 3AXLA 2CO7B 5IFPA 3S5LB 1MY7A 3BGMB 2FWOB 4EVNB 4HS3B 1K6QL 1RJZA 3IETB 4FQCL 5T5FH 1CFTB 5L2JA 1KJ3H 4Q9QH 5C70A 3EJUA 1MJ8H 3QUXC 4CD7A 4Y4FB 3F6LA 2KQMA 1CGYA 4MAZA 2R69L 1MFAH 2PXYB 5DJDA 4M6OH 2YPLD 2E5EA 4OIBA 4M03A 1T5WB 3QUXA 3K74B 3RX7A 2EC9U 1NJ9B 1R8LA 1KTBA 1HHHA 4L3AA 3PQYB 3SDXA 4O51A 3TJEH 2XZQL 1G7MA 1GOOA 4QCEA 4G8GB 3E6HA 1BX2A 3UPCA 1LQ0A 4JKKA 3LKQB 3T1FA 5C08D 3ZHKA 1LHZA 3VKKA 2VYRE 2OL3B 1XCTB 4H1LG 3TNNB 1IC4L 5DEFA 3RWHA 4LCIL 4WO4C 1SY6A 2DQIH 5EN2B 1HIMH 4YDVA 1CD8A 1T0MA 1PIFA 3WFBL 3MA9L 4ISVB 3SUTA 3PN8A 2DSVA 5HPCA 2GSIB 4XB3A 1WZ1L 2XN2A 5GGUB 1EZVX 5GS0D 1TQVA 1T7VA 4N8VG 2OW7A 1HI6A 3LEXB 4HUXB 2CK0L 4D6GA 2EPKX 1Y18B 1A2YA 3QUXD 4I18B 5L6YH 4F8XA 3Q2CA 4HK0A 5TF0A 1XMWA 3UBXI 1YEEH 3BDXA 1GC1C 1UC6A 1TFVA 5CUSH 2WCSA 3AHTA 3WN6A 5SV4A 2FATH 4IMLA 2C3VB 1B2YA 1B0RB 3PP4L 3TIEA 1WJ3A 3W0WA 3VDHA 1K8DA 1UENA 1J5OL 4ODTH 4WUUB 3EYFA 2EEDA 5GJTL 4R4FL 3GXTA 3IDYC 4PGBA 2PTUA 4F2MB 4WO4D 4YX2L 4U4BA 4L4VD 2DT3A 3MCLH 3RY4A 1UD8A 1KCLA 1JWSB 3VFGL 1FYHB 4CD6A 1K2DA 2OJEA 1RIHL 2C5DC 3KJ6H 1ZVSB 2XY1A 2Y06H 5I6SA 3IS0X 4QRTB 1E6ZA 3WNLA 1S7UA 1F90L 2R4SH 1QBAA 5I1GL 5ICZB 3E3QC 1Q6CA 2ZUSA 3N50A 4LEXL 4ZMAT 4DZBA 4MPKA 4HUWA 3OKEA 4MAYC 5T3XD 5HBBA 5E1HB 4AZGA 3W11C 2ZCLL 5IF0A 2XIDA 1H9VA 4ZODA 2HKHH 1JE6A 2C9AA 4X4MA 4RMVA 4ZO9A 5SX4H 1TXKA 1DQMH 5HPMA 5J1SC 1XH1A 1E4LA 5I1CH 3QEQA 5CILH 4MAYA 2FJGB 1A8JH 2EIEA 1N0XH 5IBTL 5IT2L 2J8GA 3O9WB 3FO9A 3EKCA 3EJPA 3HAEH 2HVKB 3FNDA 3TOPA 4OF7A 2QL1A 2ZICA 4HJJH 4L8SB 4UT9H 3GNPA 2YDQA 2BHZA 3KPPA 5F9JB 4H26B 4DFHA 4KMTL 4N8CH 5L8JB 4LVEA 3PDDA 4KRMB 1O7SA 4G6KL 2I9TA 3MI6A 2HJFA 4LP4A 1IAKB 5DSCA 3ZE2E 3SKNB 4AZ8A 3HG1B 5LQBL 2Y2WA 3P2TA 5FYLD 1CZ1A 3QXVA 3U0WL 3CFDA 2OLHA 1DLFH 2FX7L 3QEQD 1H3TA 4MAYD 1GZJA 4KKLC 3W11D 4U05A 3CJJA 4NKOA 1YUHB 2C4XA 1DLHB 3BHBA 1ZLUK 5C2UB 4PSPA 3K1DA 4S11A 4AZCB 1A6AA 4IPLA 3FQWB 4DUXA 1JXKA 4MNMA 4QRQA 1S9VB 2GJZA 4YDIH 2Z91B 1OAUL 2O5ZL 5I2IB 2DQJH 1Y0LA 1C90A 5TQ2L 5HYEA 3VD5A 5DD1L 5GS1C 5DHVB 3UYRH 4NYLA 1RZFL 2ADGA 5D7LB 1GYAA 4DN3H 1VEMA 3DXAA 1UA7A 3VXMA 2UY4A 4QTIL 2ZSWA 1JGVH 1PJ9A 4EUPG 2FL5A 2VUOA 1H09A 4EQ3A 4PV9B 5GS1A 4L3CA 4X8JB 2DDQH 5L2KB 2EQDA 1VHPA 5ANMA 3MJ6A 3VCLB 3UZQA 3FB8A 5SWSA 3RWIA 5I77A 4ZFFB 4KKLD 1NGWA 2Z4QA 9CGTA 2BHYA 2RGMA 1BQUA 3VINA 4Y2DB 3BMVA 2BERA 5CMAB 4JVWA 2YLLA 2A3CA 3ULSB 4OCXL 2KDGA 5I8KH 1AC6A 2MNUA 1CIDA 1GOIA 3GMQA 1BGGA 3DXAD 4LPVA 1EAPA 3VXMD 4XPFL 1JN6A 4AZ6A 5F7WC 3GSRB 4JFTA 2CBJA 4BQ9A 3A6CH 1XGYL 4RAUA 4RRPG 4BFGA 2FDBP 4M7JL 4JG0L 5SWSD 4OF0A 3A47A 1CE6A 4NPYB 4ZNEA 2BRQA 3SHSA 5C07B 3FAXA 3V0WH 3SDCB 5CZXC 4U1KA 3LSOB 1WCBA 1VKXB 2WMIB 3NPZB 1GOWA 1HCVA 4PRAA 1U3JA 1E43A 2WIIB 1CG9A 2A3AA 4OZFA 1SYVB 4NRRA 1LG2A 5ERWA 4PJHA 3AIWA 2DM2A 3BJ91 5D5MA 1TA3A 1T7WA 2PF6A 2ZCHL 2GITB 3UCRA 1XHGA 3KJ4C 4K7PX 1EFXA 4UFMA 3QR3A 2I07B 4TX6A 2X4SB 3KEHA 4M7LH 3B5GA 5DK0B 1G7PB 3BKJL 3X3FH 2R2HA 3SOBH 3FB5A 3U4BH 5M3WA 1UR1A 3A6BH 2H45A 2R8SL 1RAMA 3EOTH 1IM3A 1HJQA 3T0EB 1A4JB 1A6WL 1WZKA 4HXAL 1CYGA 3LEYH 3S96A 3EJQA 1FNSL 1OGSA 1K4CB 3KWWB 1M71B 5AD0A 2EDLA 2G60H 3CVHA 3H3PL 4G8GE 5FDYA 4BH7B 5CZXD 3B6SB 4D3CH 5JA8B 2VX5A 3UESA 4UDUB 5IHZB 1U8JB 5HPOA 4FQIL 1JMXA 3IFNH 4G7VH 3BO8B 1NEZG 1TLKA 2BRRH 3P4NA 3S36H 3QP3A 5I76B 1F4WL 3SQOL 4BQ4A 4NHCL 1IMHC 3TV3H 3DO3A 2XYLA 5I1DA 1TQCC 1GHFL 4I13B 4AH2B 5IEKA 1YNLL 4CVZA 4PJ9B 3MV9B 4AW7A 1V05A 2EKSB 4NCDA 5IG7A 1R3IH 3H42H 2CPCA 1XT5A 1B3XA 1BFNA 1OTSC 1MFDH 4PJFB 4TSBH 3APGA 4RE4A 5L8LB 1VPOH 4JPVH 1QNZL 1W0VA 4QDMA 5IKCB 3MRKA 2LVEA 3MA7A 3ZJKA 4WUUE 2IFFH 3RWJB 3FO1B 2I9LA 1EX0A 3DBXB 3VXTB 3L2LA 3UDWC 1QX1A 4OV5A 3QCUH 5K9QG 2O9RA 3PNWB 4PRDB 4F7CA 5IMMB 5LA1A 5D72H 1PEWA 4U2ZA 2YIHA 4ACPA 3L5WA 2PKDA 3MGTB 3VXSB 3UDWA 3WFEH 3GHBL 1JNHA 2CO6B 4RGOH 4NT6A 1JNEA 1XF2B 5JDSA 4JZNA 4QY8A 3X11B 3MLSL 2VKXA 5CIPB 1GJUA 4TX8A 35C8L 1ZS2A 5JA9A 2N56A 1BFOB 1W1TA 4Q6YA 4GSDL 4JRYB 1OTSD 2OZ4A 3BJLA 4XCCH 1YHTA 4HTYA 3TF7C 3OGSA 5DYOA 5ISZB 1FDLL 3QT2A 3T3PE 4UZUA 4XCNB 5F70A 2XV6B 1NGYB 5IQ9B 3BYYA 3CHEA 5CKAA 1IGJA 1OWWA 4X6CA 2YL6A 1OAXH 2C3XA 5GGVY 4G9FA 2WVVB 5C0EB 4ZUTA 1AFVH 5DZLA 2X1QA 2WVSA 3ECQA 3GNML 3NIFE 4J1UA 4X4ZA 2FR4A 2YBUA 1H0GA 3ROOA 4MCYA 4C54A 4Z7WF 3VXOA 2OR9H 3TBWA 5K93A 5DS8A 3O2DA 4YQXL 4IDJH 1MAMH 1AXTL 4J23A 5CP7A 2DD8H 1KBGH 1RZJH 3CLFH 1ZT1A 4HQQH 3U7AA 4W84A 4HKBB 1NSNL 4LF3A 3DVGA 3DIFB 4YHOL 1KACB 5GZOC 5KTEH 3U1SL 3MXWH 1SEQH 4BQ5A 2J78A 3G6MA 2VH5L 4LRIC 1WVZA 1QSEB 2EXYC 4PJAA 1DEEB 4YXKH 3WDIA 4HGWB 5D7LE 2WNWA 2XWBB 3GXFA 5C0RH 3REWA 1MCFA 5I8OH 4ZS7L 5IJVB 1GZQA 1JWMB 2JF1A 4LRIA 2KL6A 4MA7H 4CBPA 5A2JH 1BQHA 5J6HA 1HEZB 2QMJA 4NN7B 3OKLA 4UCFA 1KB9J 5K9JL 1GQIA 1EFQA 1I7ZA 4XP9L 4CJ1A 2VLRB 1UA3A 4OLVH 5EA0H 1AO7A 5B39B 4Z0BL 2UY7A 4QF1A 3MRGA 5FKAA 4HIJB 3IVKA 3SN6N 1GJWA 2Y8VA 2B2XL 1JNJA 2FJFA 4HUUA 3RI5K 1VACA 2YDRA 1H2JA 1RUPL 4E41D 1JFXA 3Q6GL 4KK5C 1L6XA 4OF5A 3TN0C 5GZOD 4QHMB 2YWYA 3IRZA 2ARJQ 2B1AL 1GHRA 4W7UA 2EXYD 2H6PB 3S9DB 5BOZG 5CBAA 2Z31C 1ACYH 2R1YA 3TN0A 1FYTA 2VURA 3F5WA 3QEGH 1C91A 1ZMYA 4AD2A 3O6ML 1A7OH 1AGBB 1IAOA 4FOMA 1GOMA 4MA8H 2EDBA 1AO7D 1ZTXL 3L3HA 5FO9A 1UR4A 1W3HA 4PB9H 4ODXA 2Z31A 5C07E 4LSPH 4HKJB 3ARUA 5D8ZA 4Z7NF 1M04A 3NCYS 4K94L 4JGMA 3KLHC 1CEOA 1J18A 3I2CL 4NNPH 4U1SB 3ULVH 5KZCB 5BRQA 3MLZH 4D6DA 1J8HE 3CV5A 1SEBA 3QI9B 2AGJH 2H2SC 4HGKC 4S0SD 3RPIB 1DWJM 4P4KB 4KK5D 4L8CB 3NZHH 2IFGA 4UU9B 4W86A 2WQ8A 3RVVC 3GBMH 4PGCB 4WJ5A 4GS7C 1FL6B 2MFNA 4PLKC 2G5BA 1CGTA 1JPTH 2Y5TA 4PUBL 1IEAA 3MLXL 2Z31D 3T0EE 1VFUA 4P3DA 1B88A 3LMJH 4EI6A 1E6SM 2G75B 1E4MM 5I78A 4QT5A 1AKJA 3GO1H 1R87A 1KTLA 3S3PA 3THML 4AL8L 5IMKB 4PJ8C 3FQNA 3KLHD 4G9DB 2P8MA 1I3GL 3UJJH 2G9HB 2EXWC 4Z2LA 3JWOH 3PHOB 1CT8B 3PGFL 4L9LB 5TQ0L 4JJ5A 3IDXL 1QNPA 4PLJC 4PJ8A 3V4PH 2H2SD 3QYCA 1V7ML 2CXGA 3R06B 5JOEA 2P8LB 1ONQB 3DMMC 1HYSC 1QHPA 4P7QA 3WD4A 3MV9E 3N18A 2P49B 1Q6FA 5IMLB 2R1WB 4Z7WB 1YDPB 4PLKD 1Q94B 5C09A 4GXUM 4X9HA 3MXVL 1NOUA 4FNSA 5D9SB 1D5MB 4NC1E 5C0JA 3HNSH 2FB4H 4PJFE 4PB0H 1AKJD 3DMMA 1X6LA 1T7ZA 4JRXA 4KRPC 5FYJD 3LRMA 2QQNH 3MFFA 3U5YA 1JTPA 3DX8B 3WSQH 1R3KB 3QFJB 5GGTH 4N1CA 4TTUA 3WL0A 4JFDE 3WFCL 4XP5L 4P3WA 4JFZL 3WIFA 4CL7A 4NRYB 3RDTB 2AJZA 1NLDL 3MLRL 5D2NC 4PJ8D 4ZYKA 2WZIA 3VXQB 1TZIA 4L4JA 5E08H 4HV8B 4UQ9A 1E4NA 4QHLB 2EXWD 5F3BB 1YJDH 5I1AB 3U0TB 1F3JB 3LKPB 4I4WB 4LU5L 5GRZA 4OTXH 5D2NA 4YWGL 1AJ7H 4MD4B 5C09D 3W2DL 4RQQB 1G7JB 4H0GA 2YLAA 1MRFL 3HRZB 3DMMD 1LNUA 4AJ0A 4JRXD 1HYSD 4TVDA 3CHFA 5L7XH 4H41A 4YDLC 1C8YA 2HFFA 3M17A 5GGVH 5IMOA 1P69B 2D3NA 3SO3C 3R0MA 3DJ9A 4WTZG 1G84A 2YSSB 4E42B 1JGLL 3EO1B 4LLUA 2NZ9C 4PV8A 4KRPD 5GRWA 1T1WA 3MNVB 3OAYK 4Y4HC 1VFAB 2GI7A 1E6QM 2CBIA 3L3GB 4NQSA 4F58L 4PRWA 3IDJB 5ISZE 1VCAA 1W0WB 1C5DB 1A6UH 3HMXA 1FNFA 1SJEB 4X80L 5HGAA 3BUDA 1X4YA 3EMZA 4Y4HA 1KSRA 3OXSA 1AHWB 2BZDA 1F4YH 4O02L 3RX5A 2UZXB 4M5YL 1MNUH 1X5YA 2H41A 3BSZH 3TFKD 5EZJB 3T4YA 1E6NA 3SUUA 3CFBA 2DQXA 3PABB 2APWA 1DJSA 3P0VL 4MA1C 2WBGA 3I85A 3HC4H 1GQLA 3AIEA 5C9JA 4LQFL 5F6IB 2BV9A 3BD3A 2XZAL 1GCYA 3UTPE 4NM8L 4OUUA 2QR0A 5DA0B 3VFTA 4Z5RA 1F6FB 1QSVA 4MSWA 3P4MB 2BMKA 4LAQL 1XGPA 2H1PH 4BZ2L 2XFRA 3OR7B 2NY2B 4ZO7A 2YBTA 4P5TC 3B2UC 4J3OC 3TCLB 2H32B 5E2UH 4Y4HD 3V79C 3FB7A 5GRUL 3QNZB 3FT4B 4MJ6B 2OI9B 4NO3A 4MDOA 4S1SH 5HYJA 5LVEA 5I1LB 1IGCL 4G3YH 4RFEA 3AMGA 4P5TA 1RJLA 4WW2C 4W68A 3C60C 1YY9C 3L7FB 4RIRA 1MRCL 2HFEB 3T3ME 3D9AL 2OSWA 1FL3B 4UV7L 4OCRH 1FO0L 4OCSL 4URIA 2APVA 1KJVA 2E7BA 4WW2A 1WFUA 2E40A 3C60A 2FH6A 5TDOA 1A02N 2DGAA 1AMYA 3FB6B 3O9NA 3V0VB 2BNUB 2VLRE 3U4EA 5D7JD 2BOCB 4X0NA 1V3IA 5B8CB 5EORL 5JLZB 1ISWA 3GEWB 1FC1A 4ETQA 5HYJD 1E9LA 1XR9B 2V9TA 3B2UD 1UM6H 4NO0B 1S7VB 5M95B 3WFHA 3VD7A 5A3IC 4R3SA 1XGUA 2IBZY 3NABL 3H9HA 1HQ4A 1A5FH 1E3XA 4NKDA 4JY5L 3TNMB 1KGCD 3UC0L 1KIUA 3H9ZA 5INCA 3C60D 1PKQE 1YY9D 1RUKL 3WBAA 1LP9E 3KS0J 1HXYA 3SPVB 5CEXB 4IBLT 1TJGH 3VWKB 5T5NF 1ZA3B 5ECUA 4JQIL 3F5LA 5DT1L 4DW2L 3QRGH 2FZ3B 3TIDB 3H2WA 3L3KB 1W72L 1XC6A 1E4JA 3N9GL 4WW2F 2CESA 1UM5L 4G43A 2JALA 4O00A 4M3JA 5DWUL 1EZVY 2XYCA 5F7FA 1OP5H 4K71B 3V6FA 4XMPL 5D4YA 4P46A 5E1AB 3DGGB 5DFVC 1US3A 5B39G 4WGWB 4HDIA 5A3ID 1FZKA 1FJ1B 4LHUD 4UIMB 1ZU8A 4H20L 4LPWA 4AENA 2YWZA 4FF5A 4H0HB 5CJBA 2DBLL 2WINB 1NWTA 1QLFB 1KQYA 5JQHC 1IGFH 4OZ4B 5I15L 3DRQA 3GMPB 4BK5A 2A0LC 1F58H 5I23A 2FEEL 5F6HJ 3ARSA 2PCPA 5DJYA 2EE6A 2CITA 1NCWL 5H37H 3GXNA 3PIQA 2VLKD 3PGCA 3OKDA 2DSKA 4ZAKB 1KT2A 1Y6MR 2OSLA 1QLEL 4P8XA 1H3PH 4LKCA 2OWXA 1G1CA 3WE6B 3BPCB 1UYQA 2WC3A 1ZXQA 2JKXA 3WXVH 2AS5M 4X5WB 4MQ7A 2VQTA 2RB8A 5DFVD 3SUVA 3O8XC 1P6AB 1NP0A 3AMCA 1WCQA 3LB6C 1IAIL 3DTXB 1Z9SA 1WTGT 1B3VA 4Z7WE 3DO7A 2WUBH 2X4QA 1CFSB 4JO4L 2EIZA 4AMKH 5LA0A 3O8XA 2OSYA 3E6FA 3WELA 4LNRB 2QMKA 4ZPTA 1W9PA 2VDPL 3DVNB 1HSBA 2A0LD 3T0AA 4XPBL 1G0XA 1CZ8L 1S7RA 4EBQH 2CGRL 4U1HB 4HWZB 5DD3H 4Y5XA 3O2WH 4X6BA 3VE0A 2B5IC 4PJIB 2FIKA 12E8L 3TESA 4IRSB 3JV0A 4I3SL 3FMGL 3VPLA 3BT2H 2BK8A 5HDLA 5C6TL 1XF4A 2YS4A 1V6UA 5JOFA 1WWCA 2ARWA 4DAGH 1AD9B 3S5LA 4WY7H 3BGMA 3QXDA 2E7HA 2HA1A 2UY6A 1EGJH 3MROB 5GNZA 1FVEB 3UJIL 3IKCB 4XVJL 4NX0A 3EZ8A 1AXSB 3TWCL 3AFLA 1RK0B 4ODWB 5DQ9A 5HDQL 4Y4FA 3IXAB 4EXPX 3O8XD 1VJSA 5JBFA 3LB6D 1J87A 4YPGA 1RU9H 5D7SL 1H3XA 3ARTA 1H3UA 2HJKA 3ARGC 4DEPC 1E15A 4PD4J 4QCIB 1E28B 2W59A 4UINL 4A3HA 4PYSA 3RDKA 1S9XA 5F6HI 1JNLH 1AGFA 3TTOA 5DO2C 2NNAA 3ARGA 3MJ8A 5KJRH 3LKQA 1F45A 5DT7A 1HL9A 2XFXA 4MCZA 5TPWH 4LEOB 3QDMB 4RGMC 3WNPA 1LG1A 2WMFA 3QDAA 4XP4H 1QG3A 5C0FB 1HN1A 5E99H 2I27N 4LNVA 3CLEL 5D7JB 3RIAF 1NMBL 3I50H 2W9EH 3CZFA 1I9RL 3MV7A 3O81A 4Z0XB 3E2HB 2E27L 4TOYH 5FF6B 4I5BB 2W0KA 3UEQA 3FO2B 2I25N 4RA0C 4UTFA 2BS9A 2HVJB 2NW2A 1J0ZA 2D31B 3BMWA 4AY1A 1CWYA 4WGVB 5GJSL 1RJYA 2VC2L 4BUGA 2COQA 2A83B 2AXJA 3G5ZB 3R1GL 3ARGD 5JDJA 2PWFA 4OCNC 3SDYH 2YHGA 4Z7NE 4OCYH 2NY4B 5L88L 2HT3C 2VDNL 3CFKA 3HNTL 4KV5F 1TUXA 2DKMA 1NCBL 5GSVB 5DO2D 1YMMB 4ALAH 4PRHA 5HBFA 4ODHH 3AU1B 3RNKA 3S88H 4QNPF 1KIQB 5ESQA 3MV7D 4I3RL 3DOSA 3EO9L 5IUSA 3ZKMC 2N7BA 2G3MA 4PTTB 3N1MC 2W61A 3EJTA 3V2AR 1JYNA 3MODL 5I73B 4A4AA 3RJQB 1BAFH 4F9PC 1KGWA 2C1OA 3TONA 5BVPH 4KKBC 3RY6C 5JNYA 2PC8A 3AROA 1JDCA 3BOVA 3C5ZB 3VDAA 1RHFA 3FOMA 5C8JA 4XNMB 3GXPA 4F9PA 1RUMH 3LOWA 4HCRL 1GGTA 1FE8H 1EDGA 3RY6A 2WBJC 2F5AL 1CENA 5TE6L 1N7ML 4PBXA 4PRHD 1MIML 4K7PY 4KUCD 4R26L 4XAKE 1BYBA 5C8BB 4FRWA 1UT9A 1FFQA 2HT3D 2WBJA 3DDFA 1C5BH 4R9HA 4U6XA 1R7OA 2X1OA 3AAZA 4MZ2A 4QGTA 2BY0A 3LEVL 3O6KL 5EO9B 5BVJA 2CRZA 2CR6A 5DZOA 4Y8DC 3ZKMD 4UAOB 1UM4L 3WDPP 2O5YH 4I3GA 1ADQL 5DC9B 1TVHA 5T1KA 2YXMA 1SHMA 2V2XB 1CD1B 3SKNA 1NGQH 4KKBD 3BXNA 5HYSB 3NDZA 4GW4B 3BIKB 5F7UA 1U6AL 2QSVA 2HKFH 4EANA 1TZGL 2NYYC 2X7LA 2WHMA 2EACA 5A8NA 1WDPA 3GB7B 2WBJD 4NZTL 4ELKA 5LXGL 4HH9B 5F9DC 3OG6B 3DRTA 3HA0A 1OPGL 2WP3T 2E8YA 2AEWA 2Z91A 4XCYA 3RNQB 3U7YH 1A6VH 2CR3A 5BS0B 3AMLA 2HP4A 4YK4B 1WBYB 2GKIA 5BRZB 3AS3A 3U2SB 3DUSB 1ZJBA 5T1KD 5DHVA 1AVAA 4V1DE 5D7LA 1V0MA 4KXZI 2B7DT 5C7XL 1E0OB 4HWEH 1LE9A 1BGAA 4PJDA 3M7SA 2VRAA 4XV0A 1OAQL 4HUMB 1VFBA 1ERNA 1BZ9A 4PV9A 4XNYH 2DN7A 2F2HA 1DWFM 5HGGS 1IL1B 1JZ7A 3RWEA 4RZCA 3KE0A 4X8JA 3KYMB 1WEJL 1A1NB 4ZFGH 1P5UA 5J3HC 3H0TB 2BY3A 2QQKL 5A6LA 2FX9H 4OZGF 4CMHC 1P4BL 3MLWL 1QI3A 3T0BA 2VITA 2NYYD 3BZFA 1QW8A 1F8TH 4W4OC 1IGML 1U95B 1JRHI 3WLBB 1E4WL 5C92A 5A8PA 3ZSSA 1I8MB 5IQ7L 1R3LB 1FAIL 1QKZL 1PLGH 1OAZH 4W4OA 4Y5VC 5DJ8A 3OMZA 2BXZA 3MV8E 3GXMA 1IE5A 5B22A 3CZEA 4MLIA 1EA9C 4G5ZL 4Y5VA 4PRPD 4B53A 2VAAA 2Y7QA 2IQ9L 4M48H 2D03H 3PJSB 1Y6NR 1DUYA 3SDCA 3Q1SH 3UCQA 4PJIE 5IB4B 1MVUB 2MTPA 1EIBA 5FECB 4P8VA 3EBAA 4B50A 3MRBB 1H1NA 3VFOA 2IADB 2FE0A 3GJFH 3IDIB 4UV4H 1AGCB 1ZA6A 4YXLL 1B6UA 3JV5A 4OOUA 1J8HA 1Z9MA 1DBJL 3GIZH 2Z0BA 4RISH 4PJXA 1O5DT 2Y25A 2DIAA 2Q1EA 3L3JB 2A9NH 2DIBA 3F7YB 4BFIB 4ZFOL 2VABB 4TUOB 2RBLA 2BY1A 4CADA 3VMPA 4QHNA 4OZHF 2BDNL 3LV3B 5FV1L 5F96L 2VAJA 1AQDB 3L5XL 1C08A 4BZ1H 5B3JE 1KG0B 2DOCA 2R0LH 4YBLB 1RULL 1EBPA 2F74B 4ETYA 3BISA 5JHDB 5K9OB 4BA8A 4K55A 3QDME 4UDUA 4HS6B 5BQ7B 2QADC 2ITDB 3UTSB 1JV5A 3WL9B 4K23H 5I18H 5JW5A 4UQ2A 1XGTB 3QH3A 4PBWD 4P0DA 1T89C 3U7WL 3CH9A 3TO2A 2QBWA 3B3IB 4BKLA 5DGRA 1ZGLB 4JY4A 5HYFA 3DROB 3ZT5A 2XWEA 3LY6A 1JTTA 3IJYB 1UWGL 1P4LA 4KUZL 1T89A 3WEOA 2JB6B 2VXVH 2XQBH 4NSKA 2EKSA 4U1IB 3D18A 3QIBC 2ZWLT 5J06A 4M62L 1UR2A 2C7UA 3GGWB 3HAEB 1IFHL 4ZXBB 3O2VH 4HIIB 1YEIH 3FJTA 5GISH 5KVDH 4PJCE 3KL0A 1UCBH 2P24B 4K9EH 3KLAA 3D0LB 4YGVB 5LGKA 1HKLH 4DGIH 1XZ0A 1FPTH 1QBLL 3DARA 4JFDA 1YMME 4QEGA 4M43H 1OSZA 4TVPL 4U6VL 1EERB 5E5UB 4EZMA 2ADIA 1GOKA 3RKDC 1MJ7L 1ORSA 4XP1L 2QADD 5ACZB 4PRBA 2HRPL 4CVUA 2G8ZA 4Q2ZB 2X9XA 1HL8A 4I9WD 3HMWL 15C8H 1J12A 3OJDB 3PHQB 3P0YH 3WFDH 2WMKA 1CLVA 1QFWL 1XGZA 1S7TB 5C3LD 4EJ1C 4GRWE 3KJ6L 3CFJB 3I6KA 3TO4C 3SKOB 2P5EE 4EKXA 2XG9A 2JJVA 3S6TA 1RUAH 3EOAB 1JZ8A 3GM0A 5A2FA 4ZTPH 1NC2B 5BW7C 4MLSA 4PY8J 3QIBD 2PF0A 2EPOA 4JFDD 1NANH 3QPXL 3LKSA 5DTFB 4WFEE 3TO4A 1Q8MA 1HX0A 5T5NG 1DQQA 2FBJH 2HKHL 1SJVA 1IQWL 2YBRB 1AC0A 1M7XA 3ZYJA 5BW7A 3W6LA 3UTOA 1BD2B 2VE6A 3FN0L 2VXQL 1NGYA 1DL7H 1JNNH 2C26A 2CLZA 2Z92B 1ZEAH 4JO1L 4WWKB 5IQ9A 4Q9RH 4APQB 5JW4M 3BUIA 4K7PL 1MCRA 2ATKA 4X99B 5D96B 3B9VA 3KPSD 3RKDD 2J88H 2DYPB 5A94A 2R2BB 5E00B 3WS3B 4FABH 1RIVH 3E8UL 4Y7MA 3GSNL 5FO8A 4U33A 5GIRA 3MLUH 5AYUH 1W2VA 1O0VA 4OUEA 3I02B 4ZSOB 4Z8FL 2WVTA 3P73B 2VIRB 4TN9A 4D6HA 2BVQB 1UZ1A 3AZTA 1UKQA 3N06B 4O4YL 2ZX7A 4W88A 3D0VB 3MRNB 1MY5A 4P9HH 1V3LA 1MRDL 4X6FB 1DSFH 4HIHA 1BFTA 4AQOA 4B9YA 2I5YH 5A6SA 2DL2A 1B4RA 4BK4A 4DGVH 1E5JA 3FT3A 3GYCA 4HKBA 1D9KB 2YK1H 3OKMB 4PRPB 4DVRH 4LHUG 3QHOA 5DVLA 2XM1A 2V5MA 4PTUB 5BS0E 4K94C 2MMXA 4CCDA 2EDOA 1RZKH 2EDYA 1C12B 5BRZE 3MMWA 4PIRF 3K2UL 4ODUA 1W9BM 4HGWA 3SJVB 1UUQA 3FQXB 2M2DA 5A40E 1DN0A 4LLQB 1FAKT 1NMAH 2GTWA 5IJVA 3QEUA 3CX5K 2YEZA 4AYSA 2WMGA 3UERA 1BIIA 4X5XA 1G9HA 3OKKA 1FH9A 3MLTA 4N9GB 2GJPA 1CTNA 4GKOA 1Q9OA 2AAVA 4OZHB 4Q7DA 5CZKA 5CEZH 1DTUA 5D1ZD 2NT1A 5TF1L 1E4XL 3NCJL 1UZ6E 1UASA 1CNVA 2J1KA 1K8IB 5DJ0B 3QG6B 3O6LH 2DDQL 1JDDA 1A0QH 3TBVB 4NXKA 1EHXA 5GGRB 3STLB 5DI8B 5KVEH 3MLVL 4KQ3H 4G6FB 1ZANH 3PWUB 3SE9L 2JIEA 2J8HA 2OYKA 3LKOA 3V4UL 2B31A 3VFWA 5FK9A 3D39B 1NCDL 2W0FA 3X14B 4FXKA 2ZG3A 3CVIL 2VXSH 3UPAA 3U9PL 4I48B 1EO5A 3W24A 4QHMA 5JUEH 2ZUUA 2VB5A 3FRUA 5I8KL 3AXHA 4CN4A 2VI0A 3NH7H 3AXXA 1OARL 1PKQA 1LP9A 5IESL 5TDNB 3L3IA 2FD6H 4ZXOA 2AJUH 1AXIB 3VGAC 2F9BT 1KXVC 1AGBA 1LO5B 2VT0A 3B9DA 1JAEA 1TE1A 2DQCH 2X4OB 1JGDB 4GMTH 4X98B 4K68A 4Y2OA 1E6OH 4KV5E 1NWUA 1W8OA 4LXFA 3QI9C 2O9TA 4PY7A 3UTZB 1OP3K 2WCAA 4WI5A 1OINA 2H8PA 1MCWM 1T4KB 4QNPE 5GZNC 5IHRA 4IOIB 1HQRA 2JB5H 2WHLA 3EYPA 4ACZB 4W89A 5BZWA 5A43C 3QI9A 4Y8AA 2GFTA 4P7NA 1ISXA 2MPAH 1J1XL 1M6OA 2QPSA 4UU9A 3JVGC 5DURD 4HIEB 3MO4A 3H53A 5C2BL 4WNQA 5EBGA 1S7QA 2K7PA 4P2CG 5FIPA 4M7LL 3CXDL 4HMDA 3X3FL 2GT9A 3JVGA 1R75A 1PG7X 4X6EB 3HNVH 4LYQA 4A2MA 1HKKA 3PWJB 3DNKA 3EOTL 3ULVF 3QISA 4D6JA 1VGKB 5J13B 4P23C 4KVNL 4RWHA 3CZLA 1MI5B 3LEYL 1OF2B 3HPLB 4NWTL 5JHDE 1UHVA 3VIKA 5C0GB 4YLQT 3SY0A 4ZFZA 2VJXA 1MHCB 1KN2L 3MRLB 3QQ3B 2EDEA 2KUTA 5DHYA 5GGSY 1M7DB 3RZCD 2XN0A 4P23A 1NOFA 1HDMB 5DUBB 2VX6A 5GZND 4YHNA 5J56B 3WD5L 1MJUH 3PHOA 4J2XA 3KL3A 4CDGC 5EOCJ 3IFPB 4GO9A 2D73A 2IMMA 2BRRL 3VMOA 2CUIA 3MC0A 3R06A 4I8DA 3S6CA 1ONQA 5EUOE 1I1YA 4KZDL 4Z2IA 2VZUA 1EHNA 4Y19D 3MJ7A 5DRNB 4K3GA 4OLUH 2FSEA 4PGJA 3HB3C 5D9SA 4JFQA 3KPSB 4BSVB 4OD3H 2EDJA 3EYQC 4EDWL 3VRJB 4RDQF 1R3IL 1V7NH 3H42L 3QCTL 4H8WH 4Z77B 1KV3A 1MFDL 5AG8A 4G8EA 1JCKA 5CG0A 1WC7B 5E5MB 3MRDB 4JPVL 4UDTB 4MXQD 3VA6A 1YC7A 1GGCH 3GDBA 3U83A 2EECA 4EN3C 4H2CA 6CGTA 4O5LL 3QULA 1HSAA 1ODUA 1ESWA 3V5KB 4QHLA 3U0TA 1F3JA 1ECEA 4J6RH 1B9ZA 4QRPD 5KANI 1UYWH 4NZFA 1NARA 2XPGA 4I4WA 5CSUA 2NY1B 2GAZB 4EN3A 1NL0H 2C3WA 3KAAA 1GAFL 4ONFL 3T65B 3RWCB 3ULUH 1RURH 1AY1H 3HRZA 1KIRA 4FQJH 1X5IA 1XD0A 5D70H 2NCMA 3HB3D 2YSSA 2IG2H 2NY3B 4JDTH 3K80A 3EYQD 1VESA 4K2UH 4UNIA 4J4PA 3AIBA 4MD0A 5DDHB 1FO0A 5HSFA 1U8HA 4OF8A 1S7XA 4TPRH 1SJEA 3T4AB 5A6MA 2HAZA 1KCKA 5D1ZB 1AD0B 3LN4B 3DX2A 4ORZC 2HFGL 4EN3D 3MUJA 2AEQL 4WU7B 4EOWH 1RY7B 4YHMH 4NQEA 5DVKA 4B7IA 5ID1A 4YHYC 1U0QA 4YUEH 3U82B 4UFIA 4ZSOE 3F4VA 1BLNB 4HSQA 2JCCF 3OX8B 3BE1H 5ADPH 4B3LA 5FYKL 2AEPH 1UACH 5HGBA 5JZ7C 1FC2D 1L0QA 3CZKA 4QHKJ 4GKZA 1WIUA 2DLIA 4M1DL 4XX1G 5F72S 4DGYH 3BSGA 1T5XA 3D4ZA 4OB5L 3ARDB 2DD8L 1KBGL 1KN4H 1HYRC 2CDGB 3CFEB 4HQQL 4FFVC 4NQED 5I1KH 1R5IA 2NY5H 3W9EB 4FXGB 1SBBA 1W72A 3LQZA 3MNWB 3MJ9H 4OBSA 3SJVE 5KTEL 3L7FA 1RZ7H 5CZVH 2IUZA 4JZOA 3SGDH 1XRVA 1XIWB 1FORH 1FL3A 3S98A 2L4OA 4JM4H 4L3EA 3LXAA 5JORA 5HHXH 3WFZA 3OB8A 4AZBA 4JHOA 4OZHE 4EUPH 3NFSH 1MELA 3V0VA 4LMQE 1JFHA 1G5AA 2BNUA 1KTDB 3QR2A 5ITBH 4JANB 5JZ7D 4DQOH 1NCAL 1MVFA 3WQ6A 4Z76A 2W5FA 4ZOAA 5DJAA 1HNYA 2E9WA 5M03A 3KNBB 2FH8A 1YYLH 3BP5A 2PYFB 3MS8A 1WIOA 3LDBB 3KPNB 1HNFA 3QUYC 1URLA 3RILA 1DP0A 4FFVD 3MUAA 5CSGA 3NIDE 4D1IA 4L3ED 2MCG1 3G6AA 1KJ2L 4FQ1H 4K3EH 5A6BA 2D0HA 1KB3A 3LPOA 3CIVA 2A6JA 3X3GL 3CH1B 2XN9A 1F6AB 2NR6C 4KJYB 5HHOA 1U93B 3QUYA 3STBA 1JBJA 3QHZH 3QUMH 5MHSD 3MOBL 3LRKA 1ZA3A 3I6GA 3O0RH 2E8ZA 1JF1B 3EO0B 1B4JL 2QKIA 4TUJA 1DBAL 1F11B 2H9GA 1XSJA 1U2HA 4RE3A 4NXSA 4HFUH 3VIIA 3I9GH 1ZLWH 3KPRA 4XAKD 5DQDL 1I9JL 3OJ2C 4LLYB 1JPFA 2EH8H 2XTLA 1P5VA 3CPLB 4LYPA 4PB9L 4DWSC 4QHKI 3IDNB 5DJ6B 4LSPL 1PX3A 4OLYH 4Y19B 4K07A 4ELMB 5BXRA 2YD3A 3QCVH 2J4WH 3BEWB 4DN4H 5FUCE 1LK2B 3P0GB 1FFNA 4DWSA 5A6BD 4R90H 1D5IH 5D2LB 1OVZA 4EI5B 2AABH 2O93L 2XN9D 4D0BB 3DX6B 5HHOD 3QUYD 3F58H 2UYLB 4V1DA 3EYVA 4K3DH 5F9OL 4NJAH 5B3NA 5LWYH 3RWGB 3ES6A 1KJMB 1G1YA 1TCRB 1X9QA 4H88H 4MGXA 3I3BA 3NZ8A 3OGCB 5CQ1A 3F8UB 3WJLC 1QLFA 4MD5B 4NM4L 2NR6D 3KPRD 3ISWA 1MQRA 5I6XC 1RVFH 4J28A 4JGUA 1YEFH 5E9DA 1BJ1J 4F33A 2YPVH 8CGTA 4PS4H 1K5NA 5IK3B 3WFLA 1G7LA 1K9FA 4L8DA 1IGTB 4DWSD 1DVFC 4X9BA 2F53E 5F1IA 4KJQC 3AS1A 3GO1L 3RVXC 4FK9A 3S35H 4V1DD 5L0QC 1M7IB 4MXVF 2UZIL 1Z0MA 2R9HC 2Z8RA 1DVFA 2ZUQB 5EBMA 3MV8A 3VFPA 2J7CA 4NI3A 2D7PA 5JQ6L 2ED8A 3TZVB 1R24A 1KGUA 4P7LA 3GZKA 5HGHA 1T6WA 3KPQB 4NQCA 3V4PL 2F7OA 2JCCB 5E9DD 4NQVB 1CDBA 1YEGH 1UKOA 5M94B 3QA3A 1A3RH 4JFEB 3F7RA 3MLPA 2CXKA 3WKNA 1OAYH 2VQ1A 4IDLA 3BFOA 5E2VH 4QXTB 1MFCL 1G9ML 4PJIA 4AG4L 1N6QH 3BDYL 1NBVL 2PN5A 4JB9H 4WCYL 2QQNL 1S9YB 1M05B 4UQ3A 3W6MA 3FZUC 5F97E 3WCYA 3HG5A 1IGYB 3K8KA 3NGBC 3KYKH 1DVFD 3GI9H 4PLNC 1BJMA 1Q9LA 3GNRA 3ZJ6A 3MV8D 4KJQD 4TVSa 3FT2A 3RVXD 3BKYH 5JOPE 5FUZL 2NY6B 5DJZA 1AD9A 5KANG 1T04B 2H3NA 4NQCD 4KZEH 1I3VA 5L9DH 2R9HD 1QP1A 2IH3A 4WI2A 5KN5A 4Y1AB 3BVXA 1SBSL 4M4RA 4EXKA 2X70B 4N0UB 4YHIA 1WQVT 3I84A 1BBJA 1KGXA 4OTXL 3TT1L 3IAGC 5I17B 1XF5A 1B0GA 1KTRL 5IR1A 5DJCB 5DUML 5I0DA 1CI5A 4JQVC 4UNUA 1MLBA 4AK1A 4GW5A 2GYSA 4LLVB 2GK1A 1CVSC 4P57B 4WFHD 1KCVL 2V9RA 4HOWA 1LD9A 3FFCB 3QG7L 2ZCKL 3DX7A 1QACA 2F19L 1VFFA 1GZPB 1XH3A 5H94A 3E1F1 4JCMA 1NBZA 4JQVA 4KTDH 1BBDH 3D69B 1GXEA 4HCRA 3EW3B 1CU4H 3P4LA 3FZUD 3ARPA 3DSNA 4UUJA 4LSQH 4HLZH 4XNUH 5ENWB 5FL0A 1WGOA 4JREC 2PWDA 1BGXL 3PP3K 2ORBH 2UVFA 2G41A 1F4YL 5FCUH 5IROC 4LCWA 5EU4B 2CUHA 1ORQA 3BH4A 1Y6KR 3GBDA 1U91B 4GQ9L 2P44B 4BCEA 2YC1B 4GG6A 1PYWB 3WXWL 3K46A 3HC4L 3LKNB 5IROA 5D8JL 5ESVB 1OM0A 3X12A 2CRIA 3EYSH 5D7IF 2JELL 2ZOKB 2DQEH 1ADQA 4PJCA 2MHAB 1FZJB 1UWTA 1HHGA 1OGAA 2FJHB 5CJXC 2V2TA 1UB5B 2EYRB 1FNGA 1XCQB 1FNLA 2VLJB 1MCPL 4NBZB 4QXGH 3RA7H 3UXFA 4GQQA 1V0NA 4G8FA 4ATLA 3ARZA 1L8NA 1IKFL 1CFQA 4TQEH 4MNQA 4QOKA 5DRWB 4Q9CA 4FQXB 3D25B 2MCPL 3FQRA 2UVEA 1GGUA 4LCWD 1HKMA 3BP7A 2VDRL 3ZE1F 5INDA 4KJWD 1IVLA 1LMKA 3BVNA 4LBEB 4MAUH 4MWFB 2J7FA 2EIDA 2WSKA 2P1YA 5KBNC 1N5YL 1LO0L 5D1QC 2P5EA 5HYIA 3SGEI 3KYNB 4NUJA 1Q38A 1FHLA 4Z2HA 3IDGA 1F2QA 3MCG1 1DR9A 3IRPX 2HVMA 3A5VA 1PD6A 3MBXH 3VGEA 1OGAD 3EGSB 1KNOA 5IVZB 3DUUB 4FZEH 2V2WB 5D1QA 5CGYC 1EAJA 4AZHA 3U46A 4IMKA 5ALCL 4OGXH 2G2RB 4JN2A 1DWHM 5ECJE 4MNQD 4QOKD 1A6ZA 1DDHB 5FYJU 1YN7B 1YMHB 2O61B 2MQ0A 5F9WC 3P3YA 3O11B 3GUTA 3CUPB 5E8EB 3GH4A 4HK3J 4JPKH 43CAA 4NHUA 3K1KC 5FFLA 3JWDL 2VKWA 2P5ED 5M5DA 5GRJH 2A3BA 4TUKH 3WIIH 4KPHH 2W67A 4CGTA 1YNTA 4ZPVB 1ZWIB 5HYSA 2BNRA 4AEEA 3RBGA 3FTGA 3C6LB 1MWAL 4OKVA 5D1QD 4R7DB 1AGEB 5DLML 3BPLB 3BZEA 1RFDL 1RPQA 4UOJA 4CNIA 1R0AH 4UOZA 1YEHL 4LKXA 5GGQL 2ESVB 4F37K 2FEEI 2R23A 1HH6B 1LE5B 1X5ZA 1T22B 3KPLB 2YOCA 1V02E 4ELME 5CGYD 1MREH 1NAML 4U3XA 2HMIC 3QFDA 1PS3A 1CLOH 1QSFA 3P9WB 5BS0A 2VDOL 4YBHA 2E9JA 5D2LE 2B0SH 4U1GB 4ZUVA 4UBDC 5TFSL 3DUSA 4WDIB 7TAAA 1VGEH 1U8NB 5E8OB 2VO5A 3UTQB 1XGRB 3THDA 2BNRD 3MRPA 5DZNA 2AK4A 4MJ4A 1HOCB 4NC2B 4WJXA 1X5XA 3N85H 5HI3C 4TSCH 3O3BB 4KJPD 4O2CB 1OIMA 4ZQKA 3L4UA 4JDVB 1F4XH 2DWEB 4KRUA 1JIBA 3C6SB 1IAII 3ARWA 4LARL 2CPUA 5JPNA 4UZGA 1I7RB 4S2SB 1WO2A 3DHUA 5ACMA 1CGSL 2D4FA 4HKZB 5CHNA 1QSFD 2DQHL 1U8LB 1MCQA 1BVKA 1Z0NA 3BPNC 4ZFOA 1NGZA 2ZUWA 3HFMH 4XAWH 1QPPA 1MJJA 1U8OA 4RDQG 1ND0B 2MOVA 2QQLH 5C0IA 1PX8A 2GCYB 1R5VA 2QLYA 3CO4A 3M46A 1A7NH 1H3PL 2HMID 5CWSA 5FOBB 1SVZA 3PV6A 5I8EA 1WBZA 5A2IH 4CU8A 4BSWA 2AK4D 2ESCA 1A9EB 3RTQB 4UBDD 5GS0H 3CSYA 4Y16B 4DZ8A 4ZUSA 1FHDA 3HPJB 4WV1B 5TDPA 1GL4B 3IGAB 1FOBA 2JCCE 3K81A 3OHXA 1SM3L 1R5WB 1BZQK 1UEYA 4KVCL 1EOMA 1MQKH 5HI3D 4LVOC 1VDGA 3ZTJH 4JFEE 5KS9A 3PJSA 4R7NA 1T1ZA 2WUBL 5D7IB 4M8VA 4WI3A 5F3HB 4AMKL 3CCHB 1OAKL 3QO1A 3HZKB 1ZLSH 4L29B 1SY6H 3RU8L 3KWXA 4EBQL 1CGXA 4GRLC 1ULVA 5HHPB 1CVRA 4MZ3A 4JDZB 4IRZH 1AGCA 1OP9A 1U2YA 2UZYB 1OQOA 5J9PA 1S9KC 1ZKAA 1YQ2A 3F7PC 1IARB 3S3JA 3GK8L 1DQJA 4AYGA 2DKUA 3UROR 2ITCB 4V2XA 2YR3A 3GSUB 4GRLA 4XCEB 5CLTA 4WVRA 5A1AA 2HN7A 3BAXA 3OZOA 1S7WB 4HEPG 3L4XA 4TRPL 1IILE 1QEWB 2CCRA 3I6LE 4DK3A 4XZUB 1LO4L 4N0UE 3OLDA 4LVNC 4Q6IC 3U30B 5T3XH 4NGHH 4P4RB 4AZ7A 1BF2A 1K85A 4H5SA 4NZRL 3INUH 3SDAC 1CR9L 3ALPA 1LO3H 4ZD3H 1MCIA 3PZUA 4M29A 4MVBC 4Q6IA 3BIBX 4PRIA 4IJ3C 4UMGA 1A3LH 3BKCL 4DCQA 1GC1H 2C1PB 3FFCE 5IIEA 3PE9A 1ZT4B 2F74A 4OAWB 5CINL 1KBKA 3MFGB 1CF8H 1P53A 4RA3A 2VXUL 4GRLD 3V5DA 2F8VA 2Y07L 5E8DL 4HJ0C 5TPWL 3LCYA 4OGZA 1BG4A 3EYOB 4HPOH 3W38A 3II1A 5A2LH 3S34H 4TVPD 4D0CB 3TPUA 1OD0A 3ZKSD 5EUOA 2W9EL 3HE6B 3QUZB 3IFOB 2JB6A 5E4EB 4OCLC 2F58L 1V03A 1T0OA 5FYLH 5KVFH 4GO8A 3SIMA 4PRID 2HWZH 2VXTL 3NYDA 1S9WB 4B0MM 3EOBA 5KSBA 3PGDA 1G7HA 2NW3A 3SDAD 3GSNA 2P24A 1N5AA 1I9IH 2J6EL 5HGDA 2QHRL 5E8PB 2EPNA 1ZL1A 1WZMA 2DLHA 4XC1L 3UG4A 4OD1L 3G08A 1QYGL 5HDRA 2NSXA 1J0KA 1U8MB 5DJ2A 1CD0A 4CVXB 1FG2A 3O45B 4GG8A 1LDSA 3VWJB 1K4DB 4HJ0D 5IHUH 2CK2A 1MF2H 3WUBA 2WIMA 4N0CC 4OI8A 3AHYA 3GSXB 1YPZF 2AJVH 2XA8H 1TJHL 1ZBCA 1BAFL 2CYGA 1KLUA 1NCCL 2GJXB 3CK0H 3WO4C 1MCHA 3QIUB 1A9BA 3D87B 5GQBA 4D0DA 5A2CA 2YPKA 4C56D 1N3NA 5EBAA 4AY0A 3OR6A 3BQUB 3I3EA 2EYTA 5CJQH 5AUMB 5DK2A 4DKDC 3GSVA 4WWKC 4LCCB 2BSSA 4U1NA 5I1JH 1KB5L 1NDGB 4JVUA 3B9KC 2YBRA 5C0AB 4M6NH 3NAAH 1IBGL 1EJ6A 2EDTA 3CIQA 2ZKHL 3IF1B 4YZFF 4KGLA 1I3RB 4AMCA 3OGRA 1Z5LB 4WWKA 2Z92A 5KSAC 4XMLH 4HZ7A 4MXVE 2IH1A 2V7HB 4J3TA 2I26N 3B9KA 2YXFA 3NACH 3FONA 5I74B 1MFBL 2R1XB 3ARFC 4U6YB 1DUZA 1CDYA 1Q72L 5T1LA 4EK7A 1DQDH 1EHLL 4CU6A 3HTLX 1Z3GL 5ABDE 5KSAA 4DTGH 1G0YR 4N0CD 1A3QA 4DKEL 3MO1B 5CBEB 5MI0C 3ARFA 3RIKA 5MEPB 1E5NA 3WQWA 2AJ3B 5F88A 1RJCA 2IQAB 1NGQL 2O5XH 3A0OA 1TQWA 1MLCA 1CGWA 4MXWL 2IPKB 5GHWL 1NBYA 3ZR6A 2A77L 1CCZA 3PDOB 1OTUC 3TH3T 5ITFA 2ESVE 2HKFL 3W4RA 1NGXB 4UQEA 5I8CB 4G6JH 3EZJB 5FD0A 3P77A 4FQHB 4XH2B 2FIRT 5AYIA 4LLDA 2J8UB 4ODVL 3WBDA 3T1WA 2JE8A 3B9KD 3BP4B 3O4LB 1QFUL 4KQ4H 2XKNA 3BP6B 3ECBB 4YE4L 5T1LD 1BOYA 3NUKA 5IB2A 2BVPA 4GINA 3BPOC 3IJSA 3BCDA 5I3DA 4C58B 5KSAD 4N1HB 1F4AA 4YHLH 4UFKA 4PMVA 2XRAL 4NN6C 3VNYA 4XNXH 4Z7VE 3ARFD 1W9DM 4YHPB 3C5JB 4FFZH 3L5HA 5D4QA 5ELIA 2W62A 4X4YA 5H2BA 5EBLA 3VNZA 3PZMA 1JGEA 1A1OB 2Q3AA 4DM1A 4BFBD 1C5CH 1VA9A 3LRSB 2EEBA 3GJFB 1VSCA 3VFRB 5H37G 1K8IA 3NFNA 4OZFH 5DD5H 4D6IA 5EIIB 4Q9BA 2HLAA 3CGTA 4MJIB 2WWCA 1N6UA 1OTUD 4LLMA 3X13B 3MYJB 4Z95H 4ODBD 2OSXA 1JPGB 4KY1H 2Y6SC 2Q86B 1QFHA 3KVQA 1F13A 3BZ4B 1HK6A 4X9FA 2PYEB 4KI1A 5SX5K 4ONHB 4I48A 3MSDA 4PJ7F 1H15B 1MFEH 1Z6JT 4G7YL 4JO3H 3F6IA 3L4ZA 4G42A 3SE3C 5EU6B 1YEJL 3WY2A 4WU5A 4M5ZH 4M24A 4YXHH 4U49A 3CVHH 2XTKA 2JK5A 3AB0C 5D7IE 1XD1A 1RZ8A 3SE3A 2X4OA 2VDMH 2Q76B 4JLRA 1PZ5B 1JHTB 5LGJA 2JJSC 1KPRA 4OIIH 4LAJH 3Q1SL 3ZO0A 5EH1A 3TBTA 1WICA 4HHAB 2CSPA 1UWSA 4ACZA 3STZA 2JJSA 2WWKO 3V52H 3C8HA 4NZDA 2UUDH 3AOFA 3CUFA 2Y6SD 3NN8A 1FNEB 3OZ9L 4UV4L 4HZLB 3ZE1E 3QJHB 3T8XA 1YPZB 2FRGP 1IJ9A 1S8DB 4K3JH 3KG5A 1KPVA 3NSMA 3WJJC 4CD4A 4R0LB 4N0RA 1A6TA 4JFWA 3LPGA 2F7RA 3CZ8A 1HJXA 4FG6C 4U3AA 3PWJA 1UGNA 3WJJA 4Z2GA 3SE4C 2OW6A 2XXCB 1NUGA 2KQNA 4G8IB 2Y24A 1A21A 1H0DB 3OG2A 1I7TA 5DEZA 1BVLB 3NA9H 1X5GA 1SZNA 1D7FA 2F53A 2IPUG 1RSFA 1BM3H 2ZZUT 4YIQB 3SKUD 4FMVA 1JHKL 1KFAL 2GFBB 1IEBB 3WMBA 3C8KB 4TNWK 3JV4A 5D6DC 1WAAF 4HS8L 4JAMB 4LSSH 3RL2B 5A16A 2X4UA 3C08H 1IM9A 1QR1A 2CKBL 4GKSB 5D7KD 5B4MC 2Z93A 5K59F 2CEQA 4XGZA 4ZDHA 3CDYA 5J1TC 3HUJF 5D6DA 4GW1A 1QFWI 4XBPB 1EPFA 4FFYL 2OZ4H 2VXVL 3EDFA 3IJHB 3PWNB 3DX9B 4QYOB 1TQBC 3DHMA 4YPJA 4FG6D 2WP3O 3FXYA 2IMNA 5CGTA 2F53D 3MRQA 5EBWB 5FIEA 2BVOB 1I7UB 7FABH 1WDRA 2AKRA 1XR8B 4CAGA 4QHUB 4P2YA 4G80A 4RNRB 4G6MH 3TH2T 4WIQA 4JGJA 4YAQB 4E0RA 1CICC 1E4IA 1HXMA 4U7MA 2R0ZL 1IM9D 4CRPA 3RBSA 1TTUA 3V5HA 4LYRA 5T33H 2A1WL 2NX5A 4OCWL 3EJZC 1CWVA 1JAKA 5IW6A 3F62A 1CICA 15C8L 4J8RB 1LEIA 4NO2A 4PG9B 3O2DH 5LAXA 5IW1A 5CD3B 1BVNP 5D93C 1EVUA