1CXKA

Complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxkA01
4OIIH 3QO0B 4AEHH 1XGQA 2BJMH 3UYPA 5DMIL 3MRBB 5MP6L 2CKBL 2YHGA 3IDYB 3AHXA 2O5ZL 4X6EB 5CGYC 1MHEA 2R1WA 3QYCA 5FYJD 5EZOH 4Q0XL 4K9EL 4AD1A 1YNKL 1OT1A 5DJ0A 2EO7A 2AJVH 3ZKQD 2BNJA 2FO1A 2GK0B 1MFUA 5EORL 2AK1H 5C0RL 1A3HA 2L4OA 1JD7A 4HZLB 4OM0H 1N0LA 4NKDA 3U7WH 4XX6A 5EO1B 5DJ2B 1F2QA 2P4AB 4U1IA 5HHME 4P5KB 2JIEA 4EN3C 3NIDF 4NSKA 1UADC 1J0KA 3CNKA 4TQEL 2OI9B 4F37F 3LEXA 1DN0B 1U8NB 4J3TA 4PV8B 4LPVA 4Y5XA 5TPWH 5EU7E 3IAPA 1H1NA 4K3DH 1J12A 4GO6B 4PUDA 3O6ML 1VDGA 4G6JL 3H53A 5EZLA 3IDMB 4M1GL 4M6NL 4NM4L 4LFHD 3L5WA 3HE7C 2XN0A 2OSWA 4V1DA 4ZXOA 1IAOB 1BTCA 4Q74A 1YDPA 5HYEA 3SGKC 3PABA 3WNPA 1CLCA 1CFSB 2DQJH 2GIYA 4KH2A 4PRHE 5A16B 3WJLA 5E9DE 5CJQH 3N9GL 4GW1B 3IDIA 5C0ND 3VFSA 5HYJD 4JGUA 4O2CA 2IANE 4TUJB 2JF7A 1HJWA 1S9YA 4KMTL 4JQXC 1PYWA 2DKUA 4DFHA 5ABEA 3LHPH 5DO8A 4K8RH 3HUJB 4L4PA 3M46A 1CIDA 1A7NL 4KK6D 3U7BA 5FOBA 1NUDA 4JO1L 4NQUA 3UCRA 1HJXA 3QHMA 2AXFA 2PTTA 3F7RA 1HYRC 5IQ9B 2FRGP 4RX4A 2VX5A 3P9LB 1QKZL 5D6DA 5AZEL 1G7IB 2H26A 4NYLB 1GOQA 3C5SA 3CFJB 2WQ8A 2NXZB 3CFDA 1E4XI 3VGFA 3BN9C 5BO1H 3LH2H 3EJUA 1PG7H 3K4DA 3DMMC 4F9DA 3NAAL 1BD2D 4JZ5A 4R7NA 3OLDA 1XR9A 2H32H 2IADA 5BRZB 5MI0B 1A9BA 1QZ1A 3O3EB 4MJ2A 1NKOA 3TFKD 4DM2A 4HPYH 4PIRF 1TJIH 3EO1B 2ZOKA 3IAGC 4E9LA 4WK9A 5DSCB 3NN8B 3TYGL 2EBNA 3T0XA 2PO6C 3NIFE 3PHOA 3UXFA 3RJYA 3QEUA 3ARGA 4WGVB 3QUXA 4GLRI 3E3QE 5C0DA 3MLXH 4UZUA 4F80A 3TPUB 3NDYA 2K7QA 1JPFA 5EIIA 2EXWD 2YD4A 1I9JL 1J86A 4HFUH 4AEIL 3WN6A 2P5WE 4QXWA 4S2SA 4BZ2H 3VM7A 2EDBA 4X9YA 4W86A 2UYLB 3BP7B 2YMXH 3T77B 3BC9A 1TG7A 1LO2H 4PJ8A 4WTZG 2X7LA 3RWHB 3WUGA 1HEZA 1UZ8B 5DYOA 3L6FA 5T1KB 5B22A 5DC4B 1C8XA 2AXGA 3BSZL 5I8CA 1K9TA 3A4WA 4WNQA 1G7PA 3KXFB 3FO1A 1RMFH 3BP6B 1XGUA 2WNGA 5EFIA 3WHXA 4XPAL 3KWWB 1QRNB 3WLWD 1UWTA 3ZJ6A 1LK2A 1P4BH 3T8XB 7A3HA 3RGVA 2AS5M 5IVNA 5CLWA 5IK3A 4KTYA 3QIWB 3MV8A 2D7PA 2GJ6D 4S0SD 2XTKA 5I66A 3MR9A 5FGBA 5HGDA 3QR2A 4GAYA 4WW2A 3QIUC 1MHHA 4LSPH 4YNYA 3HLAB 5CD3B 4Y4KB 1G0YR 1Q38A 5SX5K 1QO3B 3IANA 2FEEI 4PRHA 2D23A 1R3IL 1WP6A 2OWWA 2DYPB 4Z0BL 3SKMB 1DN2A 5B38G 5H94B 1QSED 3T3PE 1UJ3C 4MXQD 5AZ2H 4CCDA 1LP9E 5KW9H 3SY0B 4EXKA 2OSLB 3MRDB 5FA4A 3ALFA 5GS0H 1QNPA 3QDGE 3LS4H 4C56E 4OJFL 4U6VH 2HFEB 2V9QA 2C1OB 4X6DA 1VFAA 1KR1A 3QHZH 1KWKA 2CBJA 4LGPB 3QO0A 3BPOC 3NIDE 3ZJ8A 2MKLC 4OCWH 4A6YL 2AW2A 5CZVH 4LRIA 5FDWA 5HI4C 4J4PA 1KULA 3SDDC 5BO1L 3MRPA 1T22A 4R97C 3WQ5A 5EG6C 2QV4A 4NC2B 5L7XL 2GJZB 4I1NB 2OMNA 1ZVYA 4KK9D 2V2XB 5C0BA 2NY4D 2VDNL 5KN5B 2BY0A 3PXHA 3GMLB 4NQSB 1QHOA 4LPCA 5TDOB 3TYGH 3OPZH 4PJ5A 1LO4L 3VOCA 1IEAA 5FUZL 3QWRA 1F90L 2YPLE 5HJ3B 2J7LA 3QFDA 4L8SA 5C6PB 5IB2A 4NZUH 1UEMA 3MR9B 4YE4H 4RGNE 1EBAA 4N5EC 5C0RH 2XA3A 4J12A 5DD5H 4LCCA 1MY5A 1PZ5A 1WEJH 4Z7UB 2Y23A 2CIKB 4J3WA 1PY4A 4LL9A 1LE9A 1ITCA 4PJGF 4AG4H 3CUGA 5T1MA 5KW9L 4PJXE 2NXYC 3ULUH 1XGRA 3MRCA 1JUFB 4PP1C 4R6UA 1TZ7A 3SCVA 5FK9B 5JW3H 5JW4M 1KTDB 4OCYH 2IXVA 2PR4L 1AO7D 3UJTL 3VFSB 5FHAH 3VFGL 4HUXB 1G9NC 1A7NH 1TCRA 1WBZB 4RRPG 4MB5A 5DUBA 5BS0D 5D71H 5J1AA 2HG5B 3HG1B 2AJXL 1R3JB 2IALA 3PP3H 2PWGA 3MFGB 5TF1L 3L4YA 3BH8A 3PZ9A 1U3HD 5AD0A 4RE4A 5CJQL 3BDYL 4TOYH 2M26A 4JGJA 2NY0C 3I6KA 1QBML 3BN3B 1YUHA 1FN4A 2VURA 5I0ZA 4FMFA 4OI9A 4AMXA 4R2GD 4D0BA 2F9BT 4XP4L 4Z9KB 5FYKL 2HH0L 2X1OA 5BRZE 1YN7A 1LDPL 2YPKA 1IMHC 2FD6L 3LXCA 5C0AE 1T3FB 4PJHE 4ETQB 4CVWA 1CFVH 3S35H 4FTVE 2F8QA 2BVQA 4O2CB 1HHJB 1MH5A 1AQDA 1U3HB 3UTSB 4G7YL 1FIGH 4FFVC 1NAKH 3P73A 4TNWF 3QIBD 4NX0A 1T21B 4N9GA 4HGMA 3HG1D 4EQ3A 4PJEA 3LPPA 1WNOA 2R2BA 4JZNA 4PJ8D 5F3BB 1A7PL 1PZ2A 4B15A 3GSOA 1XCQB 1WWCA 2X4RA 2NXYD 4I9WD 3VH8B 1QNQA 1JFQH 3FONA 1YPZE 1A6UH 4P59H 2FECL 2F54A 1X5ZA 2XRAL 3O3AA 3SDXB 1JNNH 3V4VL 4JFQA 3ZT5A 3I6LE 2YPLD 3S96B 4JPIB 3GIZH 5LGHH 5KSBF 3BZDA 1T1ZB 4BYHA 3LEXB 3BPOB 4XPFL 1RIUL 1FORH 2F53D 2HT3D 3O6FA 4G43B 2NT1A 1BAFH 1I8LA 3UTTB 5ETUA 5I19L 1RMFL 1E27A 2RB8A 3WIHL 2CK0L 5SWQB 3WSUA 3F65A 1XMWA 1BVLB 3NAAH 4RGOH 5ABFA 1QRNE 4ODVL 3LH2L 1BLNA 4UINL 4F9LA 5JORA 3EJZD 3V0WL 4WWKB 2X0HA 4WIQA 2DQHH 1GQIA 3KWWA 2KUTA 1AVAA 4PB9H 3HAEG 3BPNC 4FTVA 1EOKA 2B4CC 4JRXE 5CG0A 3NMEA 3DV4A 5CSUA 2WBWB 3I6KB 4PJHA 3MMEB 3LQZA 5EU7C 1FL5A 4J4PC 4LCWB 1GCFA 1AR2A 3PWNA 3F7QA 3G6MA 3MCKA 3VA2C 4CNIB 4HFWB 4P0DA 4ZUTB 5CJOL 1N2RA 1T2JA 1YPZA 2VDMH 4NZJA 4JRXA 4TTUA 3CSPA 4QHUB 1KCVH 4JZOA 1UR1A 3Q1SH 1KN2H 3DX9B 2AEQH 2VDRH 1KG0A 3L95A 2E6JA 1D3CA 4NC1C 1KT2A 1V02E 5JW5B 3QDGB 2GJXA 1KBGL 2R15A 3KLSA 2OQJB 2VRAA 4B9YA 4XHJC 4DKEL 4OGXL 4G7VH 3KYMA 4GKOA 1EEZB 4IMKC 5E8OA 2I07B 1E15A 1WBXA 4XGZB 3NH7H 3FQWA 2O9OA 4JFFB 5FB8B 4W8LA 5IOPB 4XCNB 1J8HA 4MYWB 4ZUUB 4NZFA 3O11A 3GZKA 2IBGA 4ZD3H 1DVFB 3JBG7 3A3HA 2AXHA 3LEVL 1E5NA 2AQ1A 3WXVH 3CFJA 4YHYB 3BP4A 1R34A 1FBIH 4GQ9L 1J88A 4PY7B 3ILPB 1SJEB 3BE1L 5C0JA 4ZENA 2CUMA 4KROD 4KPHH 4CMMA 4CU8A 5ISZB 1C16B 3QDJE 1ZT4A 1VAHA 5HGAA 1K4DA 3G5XA 1RFDL 2F61A 3B9VA 5AYUH 5JNYB 1MCWW 1AD0B 2F8OA 4NNXB 5DMIH 4ZPTB 3BZFA 2OS7A 3JUGA 1HKLL 1EGZA 4Y4HA 3BI9X 3VFPB 5DDHA 4J3VA 4M1RA 2QMJA 4XNUL 3IJSB 2QADD 1R3LA 2Y6SC 1GOWA 3RL2B 3HE7D 1DE4B 4S1DC 1BAGA 2EDEA 3WEZA 3WF0A 1I7RA 1B3JA 3IJ9A 4I5BA 2APTA 3OIHA 3W6LA 3U79A 2GUOB 5F9JA 4UNUA 3VDCA 5A2BA 1ZANH 1IGTA 3T09A 4WWKA 3CD4A 2DQUL 4O2EA 1F11B 2Z31B 4RDQG 5DD6A 3OGRA 1ZLSH 4HPHA 4J3SA 2B2XL 1ZLVK 2OK0H 3I3DA 2Q8AL 1IQDA 5FUCC 1H49A 1CDUA 5ANMB 4PJXF 5LG1A 3U36A 4BSVB 3VXSA 1HP5A 1RZFH 3WFDL 3WF2A 5EO0B 1CXIA 2VLRA 4QWWD 4RX4D 5F89A 3QR3A 4YDIL 5TGBB 1SHMA 4KVNL 1W9PA 1DUZA 1OAXH 1I1YA 3OJVC 3QNYA 1HKJA 5DD1H 1DLFH 1SY6L 2IUZA 3EKCA 4K94L 4XBPB 5C9JA 3QG7H 1ZT1A 1QHPA 4JFXA 2V5MA 5IHUL 1XZ0B 5C09B 4HIEB 3UTPE 3PZOA 1K2DB 3LEVH 4D71A 4GBXC 2XN9A 5DI8B 3HNVH 5T33L 3MACH 3BVTA 4ZAKD 2RFXA 4YBHA 1XCQA 3L3GA 2Q8AH 5JQ6H 2A74B 4KXZI 3A6CH 3SGJA 4OQTA 3CV5A 1X1NA 5J13C 3RL2A 5KS9A 5IVZB 1PX8A 4QP0A 1FFOB 1C5BH 1MAJA 2ATKA 3MOBH 4NWTL 3FN0H 3VA6A 2CLZB 2DH2A 4ACYA 1DBAL 3IGAA 4LLDA 4X9BA 3LRKA 3UC0L 2OW7A 4YXKH 3T0ED 2LVCA 3BZ4A 5IHSA 3W2DH 5JPNB 5D1ZA 2IPTH 4BZ1H 1K4DB 4E41A 1CS6A 3CDGA 3PHQA 2P43B 2ZXQA 4CAGA 4FOMA 1RK0B 1G6RH 1OF2A 4UQ9A 3O9WB 1TITA 3WFLA 2OTUA 2ZUYA 5SWZA 2NZ9D 4JRXB 4IMLA 4GG8A 4WUUD 3QRGH 4FFWD 3OX8B 4ONFH 2IANA 4PGEB 1ZSDA 5D72L 1A7QH 4JPKL 1JGDB 25C8L 2A3CA 4JM4H 3VIFA 2X4PA 3L5WB 3II1A 5FKAA 2D0HA 4LSVH 2A0LC 5JHDD 5FFLA 4LEOA 5I75C 1W3JA 3N1PC 5FGSA 3FAWA 1NGPL 3GHBH 4PTTA 4U6VL 1XCWA 4R90H 4HJJH 4UOW1 5CGMA 4XBPA 4M5YH 4S1QL 5JQ6L 3OZ9L 2WCAA 1OGTA 1U8QA 3MV11 1FO0B 3MA7A 1FORL 4E0RA 1MVUA 2JCCB 4KQ4H 1RIUH 4XH2A 2L7UA 1KT2B 4PJDF 1ZA3A 2VCBA 3LN4A 4UOQA 1KGWA 1RUQH 5BV7L 4ACZB 3TT1H 4E42B 1JFQL 1F42A 3B2UC 1MJJA 4FK9A 3V0WH 3X14B 3SE8L 1CN4A 3TV8A 4JZJB 3S34H 5ESQB 3AJ7A 4WW1B 2Q1EA 4FZ8L 3AC0A 1JF6A 4W4OC 3CVHH 3WN5B 4TSCL 4DWSB 3IF1B 4XPBH 2NTFA 5D70L 4AYSA 3UTQA 4ML4A 1CQKA 1HXJA 2EDOA 2HFEA 3GJFA 4KJPD 1HHKA 4QXGH 3MRJB 5J6GA 3VNYA 4QRQA 5BS0B 4TPRL 5AEAA 5BCAA 4UNIA 2VXQH 3HS0A 2D31B 3DIFB 3CBWA 4B7IA 3KYMB 1X4XA 3CC5B 3C5ZD 4LLVB 2NMSA 2NZIA 4F37K 1HK6A 5F9OL 4L5FH 2UWEB 5IHLB 3OBAA 4XBGB 5I76A 2ESVB 4R3SA 1TMCB 1U8MB 3S5LA 2VDPL 1BQHA 1EFXA 3IYLW 3AM8C 5C8JB 1BIIB 3WJJA 5JIIA 1YYLL 4OCRH 4HUVA 1LNUB 1KC5L 1A3LL 2XT1B 4KI1A 4LCCC 1T20A 2K3TA 4Q7DA 4GXPA 5HHVL 3JVGA 3MBED 1H11A 1OCQA 4E41E 2JEPA 5C1MB 1WC7A 2XPGB 9CGTA 4WUKH 5EFIB 5TE7H 4Y4FA 1QOKA 4U31A 3V6FA 5HHOB 4W70A 4I0PA 3AHZA 5FD0A 4AT6B 1IAII 2C0HA 1ZBVA 5ALCH 1JF1B 1U3ZA 2WWMD 1AGBA 2EH7H 2CIIB 1CBVL 5DJ6B 3PWUA 2XZZA 2Y72A 4PP1D 4Z7NF 1HJVA 1GZQA 1M7DB 1ZA6A 4OI7A 5HHNB 5DEZA 2BSED 5MENA 2XWJA 1Z9SA 2BOBA 2R0ZH 4XVSH 3BW9B 1T7VA 5DGRA 3U7YL 5I6XB 5C0GB 1IGYB 4JVPA 5T5FH 4L3AA 3VFUA 3B8SA 2AJ3A 1N59A 2PYEE 2MWCA 4YE4L 1K5NA 1U3HC 2JCCF 3V52H 3VXSD 2ZCKH 2IMNA 3RKDD 5FOBB 1A9BB 1BFVL 1UJ3A 4QOKE 2XYLA 5BXFB 5ILTL 4BH8B 1B6UA 1BZ7A 1MFBH 2Y5EA 5CD5D 5D5ME 1QW9A 1NMBL 5HYJA 5DFAA 1GZJA 3RM4A 1GGIL 1CGXA 4Z95L 3TC9A 5E4EB 1B2YA 4D6JA 3F4VA 3MRGA 3EZ8A 3KYOB 3S4SB 2R0WH 2QR0B 3DX7A 3EDKA 3RX7A 5CZVL 5KVFH 1FPTL 1OAYL 3VW3H 1PVHA 3BGMB 1A6AA 4HFUL 2DQCL 2OX5A 1GGBL 2NY5C 1FV1A 2VIRB 2ZSWB 5E8DL 3VFRB 5DVNA 2YIHA 3RHWK 4NT6B 2EXYC 1JDDA 3DX0A 1E6ZA 3UTTE 4HKJA 3LS4L 5GS2D 5I0DA 3WH5A 2ZWYA 4UTBL 5EWIL 4L3EA 2GJ6E 5KSAC 4H0HB 5KVGH 4GKZA 4P4RA 4DGVH 4G8EA 1LO4H 4N8VA 3UJJH 3FFDB 2A6JB 1SVCP 5HVGB 4PTMA 4MQSB 1W9DM 1QSFA 2DMCA 5E8EA 4ACZA 3CDYA 4ZYKA 3V5KA 4PG2A 1S7RB 2LTQB 1N64L 4L4TA 4OGAC 5BV7B 2DQTL 3RWJB 1QYGL 4K2UH 4DQOH 2PYFB 4GRWE 1IGCL 4OZFG 4C83B 5E8NB 5E2TH 3BH9B 3FTGB 4YO0A 4M61A 3BESR 4K7FB 2WHLA 3LPOA 4KI5D 4HXAH 3P11H 4LCWE 4P57B 3FO1B 2WM0A 1GC1L 3ARBB 2DT2A 1CK0H 5D7LE 3G6JE 1C08B 3TTYA 1IL1B 15C8L 3MNVB 4Y1AA 3TN0B 4YC2B 3NDZA 5ABHA 2Y9RT 3DYOA 2YBRA 4XVUC 3OGSA 4P5MB 4R97B 3X14A 4X0NA 2VL4A 4NQDE 1X5XA 2ZKHL 4OM1L 1IFHH 4UT7L 4JFUA 5DFVD 5FL1A 1C1EL 3CZGA 1C8QA 2CDEB 2M8XA 1OD0A 2FIRT 2P8PA 3HS0B 2WKLA 3KS0J 5EUOF 4NN7C 4H25A 3QUXB 2PBGA 4MNGA 4Q22A 2OI9C 4DJMA 4FQQA 3BKJH 1OGTB 5FB8A 5FIPA 5BS0A 5DJDB 1B6DA 3IS0X 1EERB 4M1DL 4ZFZA 4GZJA 3HB3D 1J0JA 4WI9A 3PIQB 2EDDA 5C0CE 3SURA 1YECH 3O2WH 1QKZH 4R7NB 3LQAH 3AZRA 2OM5A 3NZHH 4MXVE 3O3EA 3PJSB 1XC6A 2G75B 3T4YB 4BK4A 1TQSA 1CD0A 3L4WA 1AY1H 4OGAD 1PFCA 4FG6C 1U8OA 5FV2A 2J4GA 3U7AA 3DTXB 4KDVA 1ETZA 5IHZA 3WMBA 3QHOA 4AZBA 3B5GA 2WVTA 2FYVA 4O9HL 2HFFB 3FQXB 1BYAA 4V1DD 1EO5A 1FZJA 1Y18A 1XIWC 2F74A 3GFUA 5KVFL 1CR9H 1UWEL 1YEIL 3TF7C 4Y4KA 1TQTA 3MUIA 4QRPA 4Z7WB 4ODSH 1E4JA 2ZOKB 4XWOC 4UV4H 1RIVL 1K6QH 5MERA 3FFDA 4XH2B 1WAAF 1FZKB 4BFIA 1B0RA 2CBVA 4OOUA 2HJLA 4TRPH 3QZWG 3HR6A 3O6KL 3VRJA 4MTVA 4H04A 5I1JL 4WFGE 3UTOA 3VINA 4Z78B 3EYSH 4L4TB 1J11A 1EJOL 1DQLH 1HXMB 3QHTC 1J7VR 1MI5D 2Z92B 4FNLL 5EU4A 1M03A 4Y5XB 5IVXA 1HX0A 3OAZK 2NX5A 3DVGB 1BMGA 2Q8BL 3V4UH 4H8WH 1ND0B 4X7TB 4X9IA 2NY2C 2B20A 1X5LA 4LIQL 1DBML 1FZMA 3LEYL 4AIEA 2PWEA 4GRMA 5MP6H 2X2JA 2W0LA 5IROC 3AS2A 1NWSA 4TQEH 1ERNA 2OXGA 3GBLA 4MWFA 2FEDC 2P5EB 4BA8A 3P0YH 3WIIL 1NBZB 5EBGA 3L5IA 4I2XB 5KOVC 3MV7D 4H2CA 1ACYL 2BZDA 2H2PD 4U1SB 3RIAF 3NCOA 5EPMB 5IMLA 4XCEB 3IFNL 2I9LA 2EPOA 2CRIA 4HEPG 3FB5B 2D9CA 3B2VH 1YJDH 3QUXD 3O6LL 4CCEA 3QO1B 5LVEA 2HVJB 5HD8D 4JFZL 1XFPA 4OZHE 2XWEA 2AV7A 1AP2B 4GXUN 1OWRM 1K3IA 3D85D 2YRLA 5CHNA 3UTSA 1FA2A 4XZUA 4KKCC 5IB4B 3GSWB 2J2ZA 3E8UL 6A3HA 1QFUL 5DJZB 3L3KB 4QT5A 4UZSA 3EHBC 4W84A 3PDGA 2X1XR 2R4SH 3CUJA 2YD1A 5GGRY 1E28B 2HTLD 2HLFD 5FYLL 2UY6A 4PBVC 4ZUVA 4AIOA 4AW7A 4GKZB 4P4RB 3VW3L 1JDCA 2JIXD 3HI1B 3X11A 5J6HB 5EBAA 2C3WA 1H09A 4W4OA 4JPKH 4BK5A 1DBBH 2QTEA 3NACL 1Q9WB 3K2UH 5HTSA 3RPMA 4V2BA 5F9WC 4HBCH 1OM0A 4LAQL 3HG2A 3T1FA 4C58B 3OKOA 1NC4D 1CG9A 2CIIA 3T65B 4MLSA 5D1QC 3MA9H 3BWAA 4Y4FC 4W93A 2ED7A 2VZVA 2UWEF 4ZE4A 2YXFA 3A0OA 2X70A 2YKLH 4XP9H 2Z31A 3I50H 1OSEA 5HHOA 4KKAC 5IB5A 1J01A 2R1XA 1ZHNA 1ISXA 3N85L 1F3JA 5ACZB 3F7VB 3P4NB 3BYYA 4BH7B 1C5BL 4LLAA 2YL5A 2GSGA 1I1CA 4NO5B 1PG7L 4HUWA 2ZSVB 5BZDA 1EGJA 4BQBA 3L4ZA 3FT4B 4LEXL 3ZKXB 1V7ML 5B8CC 1G6RB 5I1LA 5BJTA 3NUKA 4MAUH 5DS8A 4BSWB 4BZ1L 2XA8L 3ZYOA 4L4VD 5HDBF 1FC2D 4QOKD 1PW3A 1V3LA 3HPLB 4P3WA 4FNPA 4X6BA 1TVBB 3PV6A 4NRRA 2DB8A 3BQUC 2EXWC 1K8IB 3TTOA 4X6EA 1Q0YH 3TN0C 3FRPG 3O4LB 1MCOL 4LVHB 1CVRA 5EDXA 5HGBB 3WD5L 4S3KA 2A9NH 4R4BB 4K94H 2HFGL 1J0ZA 3GMMB 4ODWA 1UWGL 5CMAA 3STBA 4BZYA 5DJ8B 1J1XL 1RJLB 5IKCA 4K3JH 4ODVH 2F5AH 5EIVA 1OVZA 5D2LA 2CMRH 1HZHH 4NF7A 1X44A 2K9UA 5LAXA 1FFRA 3D2UD 4IRSA 1F3RB 5F7NC 3WN5C 1DWGM 3MRQB 4LCYB 2WLZA 4OKVA 4P5KA 2BVPA 3C6SA 4AIZB 4OKDA 3PZGA 4JJ5B 5CGYD 1KGCD 2BNRB 4I77H 3WE6B 4P46B 3Q6FA 1JWMB 5JXED 4ODUA 4UQBA 3K1DA 1KC5H 1JNHB 4NRZB 1I9EA 4XPHL 3KJ4B 4D72A 4OF0A 3OR6B 4PMRA 2DQUH 4H88L 1NWTA 1OAKH 1RUPH 2ESVE 2A1WL 4PTVA 1E6QM 1A7PH 2ZUSA 3UPCA 5LGKA 1QLEL 1A14L 3ZKMC 1X7QA 3PL6D 4EI6A 1LNUA 2ZG2A 5CCKL 5L9DL 1IKFH 4LF3A 2W61A 3JWDC 2IAMB 2X4NB 1NL0H 1I85C 2DBLH 5A2IH 3VXOB 4MNLA 3WUEA 3QUYA 1ISVA 4X99B 5JQHC 4ATLA 4ODTL 5I8KL 3TVMB 3U83A 3L5HA 3MO1A 1DE4A 2HFTA 3BHBA 3SGEH 4H8VA 4NQXA 4KRPC 5I1GL 5IOPA 2UY3A 4HUUA 2WUBH 3ISWA 4PJHB 3CXHK 2EPNA 5I17A 4GQPH 1QEWB 2WMIB 3MCG1 3QHNA 4TVDA 2FBJL 4N5UA 3QUMA 4JB9L 1BFOA 3C5ZB 3WELA 5K93A 3SDDB 1C7TA 3L95B 1N6UA 1OGAE 1NANI 1PPIA 3TPKA 3MUJA 2NT0A 4F58H 3KLLA 4Z7UF 5I8KH 5FHBH 5JHDA 5E6ZA 1TFVA 1KOAA 1QBAA 2N56A 1BD2E 1T5XA 2X2YA 3DI3B 3PDOA 2XZQH 4AG4L 1QRND 5J1TC 4HWBL 1AXSA 3MV9D 2Q7YA 2QSTA 4J3XA 1WAAE 4U3AA 2DLEA 3CTTA 3BKCL 3FJTA 5IESL 4X6CF 1HIZA 2LFGA 1B4RA 4H0IA 4X9HA 4PMUA 2NNAB 4UAOC 5ADOH 4LHQB 3V5HB 4DN3H 5E9DA 1SQ2N 1H3PH 2XQYG 3SDAC 2FLRT 3IGAB 1I8MB 3EO9L 4HWZB 2A1WH 1CG9B 3P0VL 1EUTA 2P5WB 2IXUA 1WDRA 1BFTA 4OQTH 3MZTA 5KANI 5JZ7C 1YEHL 5B21A 3CZNA 1J10A 2BVQB 4JY4A 4JPVH 4TVCA 1BBJB 1RZ8B 1UM4L 4QLRA 4QTIH 5JHDE 5KJRL 2WUCH 4U1SA 3LQAC 3MRNB 2FL5A 3AQUA 1RUAL 4GZIA 3R1GL 2C3HA 5DQJB 1OIFA 4YDLB 4HDIA 4BELD 4ZFOA 1G7HA 4K68A 3V6OE 3D85A 3GSUA 2HJKA 2OCFD 1BOGA 4JN1H 1NCCL 4C57C 4JY5H 1IM9B 4UI2A 1EAJA 3AMCA 3C5ZC 3SDXA 4PN2A 3W9DA 4HQQL 4H5SA 5J9PA 3BIBX 2NY7L 3DJ9A 1GVIA 2YN3A 3CCHB 3RZWA 1D5MA 2ICCA 4XWGL 2GTZB 3KYNA 1EEUA 3QH3B 2Y06H 5FO9B 5L88L 3WBAA 1ZOXA 2X10A 4KGLA 3WLWC 4YHIA 1TZHB 1A7OL 2NX5B 4HBCL 2PYFA 4R26H 3SDXF 4X8JB 3AIQA 4NKQB 5F9JB 4MQTB 5DVKA 3C08L 4JFYB 2JEQA 2VTFA 5B8CA 3PDOB 1DWHM 1WAWA 1BJ8A 2OSLA 3IJYB 3BIKB 3EJJX 1ZBKA 1A7BA 1MCCA 2QLVB 4M43H 1OAXL 1NJ9B 1TXKA 2Z92A 2CK0H 5T5NG 2IEPA 3FQUB 1H3TA 2KZWA 3ULVC 1EVUA 2YUXA 5GRZA 1AJ7L 4X5XB 1TVHA 5HI4D 4M00A 3C6SB 2P42B 3HZMB 5E7FA 5SWZE 4X7TA 4UQCA 1JRHH 4GT7A 4UDTA 2G3JA 4PRPB 5HPCA 3BDXA 2LQRA 3DRTA 5FOOA 3GBML 1WIOA 3PG2A 2NXZC 4Y16D 4ZFFB 5DJ8A 4GSDH 5B38B 5DRWB 2QQQA 4MWFB 5EBLA 4HHAB 1KJ2H 5C0CB 2BNRE 4PJFA 2R4RL 3UTZA 2EIEA 4FNSA 1AXIB 5C3TA 3G5YA 2BRQA 3GXDA 3BVWA 3K74B 4LCYA 2WPGA 2OQJA 5I75B 2NTFB 2HP4A 4G6FB 2FB4L 5E2UH 3EFFB 3KAAA 3U0PB 3GJFH 3L7FB 3MJ9L 3HMCA 1D5IH 2VUYA 1JTOA 1TUXA 3TA9A 5H94A 4HCRL 4LEOB 3MGOB 5IDIA 3QCVL 2XY1A 5AG8A 1Q8MA 2VRJA 4RL3A 2ERJB 3DDFA 4HLZH 1W3LA 2VLMD 4DKAA 2F7OA 3F5LA 3DXAE 1WE5A 1BFVH 3ARDB 4IOIA 2YWYA 4BA0A 4Y2DC 1F02I 2FATL 3L3DB 2F7QA 2JCCA 4NZTH 3WF1A 1J1XH 3N0PB 1MWAB 5TF1H 4AY1A 1DQML 3RDTA 4PTXA 4I0PC 1Y7VA 2OYKA 3ULVD 5FM5M 3I84A 2F8XC 1GGYA 2KQMA 1E56A 1IAMA 1CFQB 1S7UB 1FG2A 1MCSA 4G3YL 2O5XL 2XACC 4NO5A 5K9QI 4ALAH 1T7ZA 4ORGB 1HP4A 2NZ9C 5IFAL 1DWAM 3BPNB 4A2LA 1NCWL 3K7UA 3AXIA 5I66B 1OCWH 1G0CA 4AISA 5E5RB 1KLUA 1ZMYA 4LIQH 4NN6C 5GGUA 1FDLH 4J3OC 5H35A 1KXTA 1WEJL 4DN4H 1S3KH 5GIRB 1AE6L 4X6BB 4P5MA 3GSNL 3VI3F 5IQ9A 3SIMA 5A2FA 3L3IA 4NN7B 2I9TA 1YEGL 5ENWA 1Y6MR 3VXME 2AXGB 1UT9A 4JANA 3V5DA 3JV0A 4O58H 3UG4A 4U1LB 1N6VA 1NJ9A 4KK5C 3RNQA 4ERSH 3KPRE 4M4PA 1EMTH 3WO3B 4HOXA 1E4NA 1HXKA 4IRZL 4X5WA 3UO1H 5CKAA 5MEQA 2JB6A 2DM4A 5BROA 2PR4H 5EC1A 5I18H 4QTHA 2CUHA 3OJDA 2GY7B 4HZAA 3ULVF 3HFML 3RY5A 1JWUB 3EYVA 2DS4A 5F1NB 2EDLA 4YAQB 1MRDH 5EU6A 3ZDXE 1ODAA 3RZCC 3MX0A 4YHIB 4WW2C 2M1KA 4JZNB 4GQQA 3VU2A 2L0DA 4CN4A 4L3EB 3AVEA 4JM2D 1MFEL 4YBLB 2X9YA 2XIBA 3ZR5A 5KVGL 1W9BM 2YK1H 3QIBA 4YPJA 1XH3A 1BGAA 1DWFM 5C0DB 5EU5B 2KZ1B 2FZ3A 3DSFH 1CPUA 4ZYKB 2WBGA 4OUUA 4GBXA 2IC2A 3OLIA 1N5AA 2XGBA 1KXTB 5J11C 4KRLB 1UQSB 2HTLC 1I8MA 4YR6B 3BSGA 3IETA 4P2OB 1V6VA 4X80L 2QLYA 3VPLA 1BQSA 4KKLC 3QEQE 4A6YH 1VF8A 4OI8A 1TA3B 4PREB 3RTQA 1NMCB 3HA0A 4NKMA 3FONB 1PEZA 5T1LD 3VXTB 5HDQL 3QUZC 2E9LA 2YD5A 5C6TH 4HXBH 1LG2A 4O2FB 1N4XL 3QJFA 2VL5B 1WTLA 3UO1L 1PGRB 4RFNC 4PJ5B 3FB8B 1LDPH 3L3OB 3CMOH 1A6VL 3EYOA 4OTXL 4RWYL 5HDRA 5SWSE 1FFPA 5D9SB 2FR4A 4G8FA 5BZWA 4RAHA 2KBGA 3Q5OA 4KRMB 1H3UA 1EIBA 4W89A 2WLYA 1EJOH 3O45A 4Z7NE 1QPPA 1MHCA 5C07E 1P69B 2BDNH 2YPKB 4MS8C 4MNGE 1NLBL 2CR3A 3BOVA 2RBLA 3GBNL 4FQQB 2WC7A 3K0WA 4XRCB 5TQ2L 3U46A 4EUPB 3RGVC 1KIQB 4QKXB 3UDWC 4PJBE 3QNZA 4Z0XB 1BSIA 1LL7A 1UR8A 3N50A 4M1CC 2XVKA 5TJWK 5A8MA 1MFDH 4QXUL 3UJTH 1FAKT 2DEPA 3GI8H 3HE6B 4GLRH 1JV5B 1HXYB 1CR9L 4YZFE 5DTFB 4GINA 5H2BA 1EVTC 4XXDA 5BQ7A 5T3XH 2NLJB 3ZZ1A 1A6ZA 2YZ1A 4MPKA 4APQA 1VFAB 4E8CA 1L6XA 1KIRB 4RMTA 1IGIH 2DQGH 1KJ3H 2KQNA 1RZKH 2DI9A 4PRHB 3GIVA 5CZXD 3GSRA 4YHNB 5GQBA 4XX1G 4U6YB 4C83A 5DJAB 2QPSA 3W9DB 2VLJE 5JIWA 4LCCB 4Y19D 1U91A 2YBTA 3TLRA 2J5LC 3CLFH 2XFRA 5LA0A 1MFCH 2JJVA 3ZE0E 4MAZA 3DUSA 1OB0A 2GHWB 4IHOA 1IAIH 4R0LB 5ID0B 4JDTL 2DDQH 2XFFA 1FVDA 4R96A 1IGMH 3FN9A 1R86A 3VGBA 5EOTA 3FQTA 4HGKC 5HNNA 3WKZA 4Y1AE 4BQ8A 1R87A 4Y2DA 3UX9B 3L5XH 4QWWC 2WUBL 3LQZB 4D9QD 1CGYA 1UCTA 1IC5H 5D8JL 4P3DA 2XFXA 1A9EA 4ELKA 4H8WC 4FLQA 3WY1A 1QFWH 3O9WD 2EEBA 3CFKA 1SYSB 1A6AB 3ZYJA 1ZT4B 2X1IA 1SVZA 3V6OC 4PMYA 4XVTH 1QLFA 2CQVA 3VFNA 2O9PA 3QHFL 3VFMA 4XB8A 4NKIH 3P9WB 1KCRH 2ILLA 4IDJL 4MB1A 4M7ZB 3VD4A 5I1CH 3ZQ9A 4NBXB 1ODUA 5HHQA 2JIXA 4LQ1A 1NCWH 5FHBL 4HX1B 5IW6B 4LCIH 5IJKA 1H3PL 2DJUA 5FYKD 2R0KH 2FX8H 4I3GA 4WFFD 4NO0A 3IJYA 3SCNA 3BLPX 4HXAL 1WBXB 4XGZA 5A8NA 3NCMA 1SEBA 2CJUL 4TUOB 2Z31C 4X4ME 2FGWL 3ARBC 4QRUA 1UXWB 3QBTB 3DVGA 4LSPL 4X5WB 3RZCA 2AJYH 1GL4B 1C8PA 2CKRA 4LYQA 3BAJA 1G9MC 4N0UA 4MDJA 1KJ2A 5IMMB 1P6FA 4PJ7E 1PBGA 3GMRA 3RDTC 4H20L 4PJ7A 2ALWA 4XNZC 1XD1A 4MA3A 3BZEB 4JL1A 1P4IL 3FAXA 3RAJL 2LVEA 3KXFE 3MBEC 3NCJL 3KHOA 2IPKB 3LRHA 4MJ6A 4LKCA 2NX5D 5F7MC 4FQIL 2XN9B 2XZAL 5DI8A 3QULA 1FZOA 3MREA 5D7KD 2IGFL 4QRSB 1OIMA 1R3HB 4LOUD 4XAWL 1LO2L 1JPSH 4HK3N 3OX8A 3A4AA 3QJHA 3BO8A 3P3YA 3LB6D 4PP2A 1JNDA 3RDTB 4BQ2A 1N5YL 1OWQA 4OM0L 3GZAA 5HY9A 4M7ZC 5HGHA 3WKML 1FAIH 4M7KH 2XI9A 4PJCB 4XV0A 1CE6B 3UMTA 2J7BA 2VWEC 1MCBA 4AYGA 1FNGB 1BGGA 1UQSA 5FYJH 3VXMD 5T1DH 4YHKH 1J1OH 1RJCA 3MLYH 3SCMD 4FQJL 1ZV5A 1NM9A 3EJYD 3O41A 1S9WA 4GO9A 2O93L 5I8EA 12E8H 2W07A 4RIRA 4RISL 5IROA 1GAFL 2FE0A 2UY4A 3PWNB 4FQXD 4CW1B 1EQCA 4IHOB 2ZUQC 2ID5A 3WKNA 1CGUA 2XWTA 3BRGC 1IZJA 4OFIA 1UB5B 3HE7B 3KYKH 2UVFA 5CEYA 1JUFA 1KIPA 5T1KD 1YPZF 4IRJD 4Q2ZB 3ET9F 1IQDB 2CSPA 3GSOB 3TM6A 1WIUA 1J5OH 1LD9A 4OLVH 3JV5A 1W8NA 1JTPA 3MV9B 2F19H 3X3GL 3C8DA 4N0UB 3VILA 3U36B 4BSVA 5CINL 2FO4B 2WKGA 1MCNA 1VENA 3QCTH 4KJPC 3NTCL 2XA8H 1TETH 4N0YL 1WIPA 3DX8B 3DMMD 2CHNA 4RGMB 4WI2A 3GGWA 2GAZA 3B9EA 4JM2F 4NDMB 3ZHDA 2VCAA 3FQRA 2JTDA 1FYTA 1SYTA 4R0LC 3OG4B 4P2RB 3UJIL 4F7MA 3TZVA 1BFSA 4W68A 1A5FL 1T89C 4JREC 4OZIB 4S0TD 1KGCE 4AZGA 3KYKL 4UIMA 1LWRA 5DS8B 4BSWA 4IJ3B 3F6LA 3P40A 4NO3A 4Y4KC 1BREA 3BUTA 3QIUB 4NWUL 1B0GA 5HDBE 4ODTH 1KB5B 2ZXDA 5T1LB 5CINH 1C8YA 1QW8A 3CZSA 3GI9H 4PJAF 3KS0H 3RIFF 4QF1A 2UWEE 1QBBA 3QI9C 3SHSA 1D9KC 4MAYB 5L9DH 3HJEA 2HWZL 3WKMH 1ACYH 5DA0B 3NSXA 3W24A 4DN3L 5DD3H 4JKMA 1HKFA 5EBMB 3CFEB 1RZFL 3FO9A 1NAKL 5DURB 3WFDH 5HD8C 4DGIL 2AK1L 2J47A 1QSVA 2QJDA 4GXVL 1HQ4A 1OTUD 4WW1A 2ICES 5E5MA 1JWSB 3VRLF 4CN1A 4S1RL 4FQJH 4RGOL 5J06A 1ZLSL 2BRRL 1VEPA 4M5ZL 4GRLB 5K9KB 2DBLL 2VISA 5F7EL 1OQOA 4GJTB 5D2NE 5F9DC 3IXAA 4LAQH 5D70H 4PGBB 1I9IH 3CZJA 2WW8A 3P4LA 3VIMA 2EE2A 2FZ3B 3PDDA 3GHEL 3UR7A 3H7LA 5DD3L 4HKZA 1L7TH 1MNUH 4DK3A 4MD4A 3CDFA 2VXTL 4PY7A 3U6RB 4FTVB 1U8QB 3H6JA 1OM3H 2A9NL 3UTSE 3UTTD 3F5KA 3QQ4B 1YQVH 2E3ZA 1CL7L 1MHCB 4XCFH 5HGAB 4Z2HA 4YGVA 3CLFL 3QXWA 1P1ZB 1RJZB 1RJLA 1Q9WA 1LD9B 3L2MA 3EMZA 2PYED 2ORBH 2OLDA 4M5YL 4S1QH 5J11B 3VIGA 1UA6H 4KRNA 3S2CA 5L8JB 3EUUA 4QOKB 5FM5O 3G5VA 1MRDL 3WLBB 3NFNB 1QUNA 4NNPH 2PXYD 3EOAA 2GJPA 5D5MB 2PTTB 2H41A 1Q0YL 4PP2B 3MO4A 4APQC 4MNQD 4KQ3L 2CK2A 4HZ7A 1A7QL 4AQOA 5FO7A 2BHYA 2WVVB 3AHYA 4DAGL 2H9GB 5KZ6A 3FO0H 4NQCD 1FRGH 2VWEE 3OL2A 4J4PD 5C09A 3PBGA 2DDQL 3ROOA 5D1ZD 3G08B 4TTDD 1MXDA 3TV3H 4HA4A 4F66A 5CEZD 5IG7B 1ZS8B 4MQ7A 4DKEH 2CEQA 5HXMA 2X4RB 4WKHA 5SWZD 3JTSA 4P8UA 4NRSA 1G1CA 5FM8A 1DLHA 1GIGL 1W2PA 4FQPA 5IGXH 2LAGB 5EU3A 1QI4A 2YN5A 3OGCA 4JRWA 2YFOA 1UCBH 1Z5LB 4TUKL 5IMOA 4P2QD 2X9WA 3AZTA 4EANA 5ECUA 1MW3A 4QRRE 1FVCB 3FOMA 3GKZA 3QHZL 4CD6A 3GEWB 3AHVA 3FB5A 1AC0A 1E55A 2I26N 3W0KA 3NFSL 3S4SG 1HI6A 5DLMH 1MPAL 5F3HA 2MCG1 4GIAA 1ZBCA 2BS9A 5A6KA 1V05A 3AREB 4DVBA 4N9OB 1QHZA 5I1EL 2XN9D 3M17B 4FHBD 4LP4A 1EJ6A 1L0QA 3O3BA 3DYPA 3L9RB 3O8XA 5FCUH 2DRUA 4FQCL 2Y36L 2CO7B 5J4MA 3VXMA 2OR9L 2MOVA 4JKKA 2EDKA 4XAWH 1UKSA 1D6EB 1N0XH 4I0CC 3NPZB 1DEEB 1UR2A 1T89A 3CK0H 1KLUB 4KUZH 1NOUA 1JGIA 3QUMH 4P3DB 3WIIH 4EZMA 4L8BA 4M6OH 2B4CL 2VLKD 3H55A 3O0RL 4MNHA 4M6ML 5DMKA 8CGTA 5FO7B 3S35L 5ISZE 1KB5L 4GRWH 3QDJB 2P47B 3MLYL 4D0BB 4FNQA 4MD0A 3CMOL 4GUPB 3CU7A 1I3VA 4UTBH 1B3VA 4LBEA 4XI5C 2AEWA 3AAZA 4A6YA 4NI3A 2X4OA 2WBKA 1MLCB 2C7FA 1SJHA 1K8DA 4KKCD 2DKSA 4JY6A 3LPGA 4Z76B 15C8H 2MMXA 3D69B 5GS1A 3MI6A 3WL0A 4NNYA 4GAJL 4LU5L 4GFTB 4JAWA 4HUMB 1DVFA 3ECBB 3OA5A 4YDKH 4RBPK 5F7KC 4AC1X 5T3ZD 2IFFH 2XWJB 2YPLB 4KC3B 2QBWA 1I8LC 1H5BB 3MRHB 3FRPA 1E6PA 2VJXA 3CFEA 2GTWB 4JHAH 2DMBA 5DJCB 1LO5B 1RV6X 2AV1A 1G7IA 5EBWB 4P3CL 4DW2H 5LGHL 3IFLL 3NCEB 2XOTA 2EEXA 2VC9A 1F4WL 1U58B 1XGTA 3WS3A 4TULL 3AHTA 5JUVA 3G04A 3DECA 4J1UB 3IFNH 5D2NB 1OINA 2EACA 3HFMH 4G8EB 3EFFA 5T5FL 1QNOA 3BZ4B 2VDLL 4P4KA 5TDOA 1QFWM 5TFSH 2CDFB 1Q1JL 4PYGA 4JKWA 4R2GB 3F5JA 1A3RL 1HJUA 3PZUA 3V5KB 1TPXC 2YUWA 1A7OH 4FFZL 1NCNA 3LEYH 2Y1VA 3ZTJH 4G43A 5I1CL 1CU4H 3KPSA 4QRTA 3DHUA 4QRQB 3QHFH 3VWJB 4OFYA 4M61B 2YD6A 5F9AC 5JORB 3O2LA 4HWUA 3GH4A 4UDTB 4XNMA 2F54E 4CU6A 3VWKA 5GGVY 3GMLA 4NQSA 4FQXB 5L0QC 3TN0A 2MHAA 1IL1A 4KROC 3I6LD 1XHGA 3RNKB 1IV8A 5J3HC 2SEBA 1P2CA 4QRRD 5I18L 1V02A 1NBZA 5CJOH 3PWPD 3V5DB 2OJZH 1GZPA 1EEYB 1O5DT 4H1LH 1NGYA 1MJUH 3RIAK 1YECL 2OWXA 1W9VA 2YFNA 2Q76B 3DNKA 3WFEH 4H25B 1UFUA 3HR5A 3RWCA 3QIWA 3WSQL 1NOWA 2FIKA 1HT6A 5EU3B 3NBNA 1YPZB 3SDXE 3KWXA 4GAJH 4LU5H 4Q58C 2W0FB 3S88H 5CBEA 3HLAA 1RH9A 2R4RH 1DSFH 2XWDA 2VAAA 2GSIA 2ZG3A 2VSCA 5E2TL 4UQ2B 1FNLA 2PXYA 1S3KL 4P2OD 4YHLL 4X5LA 3BH8B 3TWCL 3OKLA 4FLOA 3FCTB 4J8RA 3MRLA 1PG7X 1XRVA 3WDQA 1Q4NX 5BRPA 4EEEA 4D6CA 2JALA 4MCYB 4W6WB 3MRFB 4DGVL 1Q9LB 1CFNA 3KPQA 4XCCL 1QSEA 1JHLH 4DZBB 2RGMA 2VC2L 1SBBA 1XR9B 2IADB 5BRZA 3LZFL 5K59F 1CD9B 1XF5B 2XVLA 1WK0A 5E8DH 2DJ4A 2E9BA 3GSVA 3IU3A 1QOXA 1DQMH 4XNQA 3MGOA 3BP5B 2EADA 3CUIA 3JTTA 4WV1B 3UYRL 4WLCA 1AD0A 2A9MH 4QHMB 3P4MB 4JFVA 1CFTA 1W0VA 4QCIA 1HQ4B 3QEUB 3O2DH 2AEIT 4M56A 2ZX7A 4KHXL 3ZTNH 3C8HA 1JGUL 5I1HH 1OGSA 4ZO6A 5F3BA 2ZWZA 4XP5L 2ADFL 2FX7L 4I18B 3ZDYF 1X4ZA 4UT7H 3TBTB 1XGYH 1NCBH 5EO9B 1LHZA 2YJQA 4S2SB 1I7ZA 1HINH 5DQDH 1N4XH 2RIKA 5LCVH 4PTWA 3CSGA 3OKNB 1RD6A 4PLKC 3DHPA 4FLRA 4LSQL 5DHVB 5GS1C 2JJWA 3HMWL 4YK4B 4HV8B 2C4XA 1NC2D 4AEHL 1H15A 3DMMB 2R1YA 2EC9U 1WGOA 3RUGA 2XKNB 1IAOA 3CK0L 4HJGA 2HVMA 2CHOA 5DJ2A 3WH8A 3HNTL 3QNYB 5E1AB 5GGVL 3TV3L 4F7PA 4PRIB 2CDGA 4NO2B 3TBVB 2WCGA 4JO4L 1TTUA 3U1SL 2W60A 4C56A 1KIQA 4KJYA 3WUWG 1S7UA 5DWUH 3PZVA 4PG9B 3EO9H 4QLLA 2ZWLT 4H1LG 1P6AB 5DZNA 4ONHA 5ITBL 1WTGT 1Q9OA 5HI5D 4F9JA 2ICWA 5CSYA 1KEML 3MOBL 4NWTH 3WEMA 3D39B 4LPXA 3KJ6H 4DZBA 4HS8L 4YHZH 2YLAA 3V7AG 2OZ4A 4N0RA 1PZUB 3V7MA 2B39A 3LRGA 1KXVC 1QNZL 5C70A 2F58H 3FB6B 4NN5B 1L4IA 1AD9A 2ADJA 2DQJL 3HRZA 3LMYA 3SKNB 2VR4A 3V8OA 3N06B 3FT4A 3AU1B 2IBZX 3IVKA 1EDQA 1M05A 2PXYB 3G04B 2PKDA 2WWKO 1NGWA 5B39B 1HILA 2VXVL 1JYVA 3U9PL 2GK0A 2JK5A 3MLSL 2IAMA 2VABA 4N5ED 2VQ1B 2YA0A 5L7XH 4K8RL 2WWCA 2AJUH 4RMSA 2Y8VA 1A6ZB 1RQ5A 5E6IB 5E2WL 3MLWL 4AZ6A 1ZVSB 1R6VA 1D5ZA 2EZ0C 2J6EH 4U1HB 1AHWA 4XHJD 4ZPTA 3VWKD 4OF7A 4IDLA 4WENB 5JNYA 2O9RA 3OXSB 3N18A 4Y5VC 1ES0A 1OARL 1BWWA 5DJAA 1F97A 3H2WA 1DBJH 5FKAB 4G42A 5GZOD 1WFUA 4MGXA 1MHEB 3QRGL 1L6ZA 1Y18B 4RAUA 3VGAB 1E5JA 2W67A 2G9HA 2HVKA 1NUNB 1QO3A 3FOLB 4PMZA 1VFBB 2HAZA 4IMLB 4L8CB 3LKOB 3KLKA 3BCDA 1YY8A 4RGMC 4G6KL 4AD0A 4PR5B 5A3ID 2R1XB 5DJZA 4OLXL 3ARDC 3EJRA 5CCKH 3ZE1F 2X4PB 4CKVX 2CLRA 5C07A 1JGVH 4ONHB 1HHHB 3UESA 1A4JA 3GBDA 3MV7A 2R4SL 5K59E 1YMMD 2AABH 1N82A 4GI6A 2XZAH 4FQIH 5AC5A 5FYJE 5F9WB 1FO0A 3MA7B 3NCJH 3BD4A 4L3ED 4E0RB 1EHLL 3LSOA 3VX0A 1OAUH 4XCEA 3CZKA 1T6WA 1I1YB 1ZVHA 1FG9C 2HT2D 5I73B 1RHHB 4WSKA 3UCQA 2ZZUT 2BNQE 3C60B 4HCRH 4E42A 2B2XH 2R23A 2CYGA 4HJJL 3SGDH 4MS8D 2IPKA 4MJ6B 2GEEA 4NFDA 4S11A 1PJ9A 5DEFB 5DZOA 5IK3B 3AIWA 2IJ0C 5CHNB 5J12B 2EXYD 1T0NB 3VIPA 1XF1A 1IC4L 3HNSL 1PYWB 3I3EA 2YD3A 3RTQC 2DYPD 3Q3GB 1INEL 1K3ZA 4PYHA 1WPCA 2BVOA 3GK8H 2FX8L 4HZ8A 2N4IA 1KJ2B 5IMMA 1G7JB 1RZ7H 3MLTB 4XPGH 2A6DA 5BVPL 2AI0H 4FG6D 3RU8H 4JFDE 2Y06L 4GMTL 4LASH 5EBMA 2YA1A 4PJ9C 3WO4B 2H1PL 4OZGB 4JG1H 2V38A 5BMFL 4PRHD 4QRRB 3CFDB 1MEXH 2WVUA 3P30H 3QIBC 4P9MH 1T20B 4KZDL 3VIOA 1DBJL 3K3QA 3O0RH 3QQ9C 4JN1L 5HBFA 3GNMH 3M8OL 2Z4QA 5HHQB 5A2AA 1UQYA 1PLGH 3VWJD 4PGBA 4UTAH 3GJEA 4Z7WA 1BZ9B 4ZXBD 2HFGH 3WNOA 4ZAKC 1M6OB 3V8CA 5KS9E 4MA7H 2JJSA 1NCDL 2IPTL 1RSFA 5BVPH 2YUVA 1V6XA 4ZFGL 3MACL 4YXKL 4L4VA 1U95B 3A67L 3RZCB 1RU9L 3AUVA 1DEEA 2AK4D 2QSVA 4Y89A 4XNXH 1U8JB 1R75A 4M4RA 4PRIE 4DOHE 1QRKA 1KACB 4PJBB 2JKXA 2O9TA 1DTUA 2GDUA 4RCAA 3RWCB 1RJZA 5FF6B 4R0LA 1B88A 3AYSA 2XTLA 5EZJB 5L2KD 1R24B 4UTAL 5D96B 2IG2L 4ZFFA 2CERA 4LF3B 1TTGA 3GUTB 2WV3A 2ZOLB 3TH3T 3W0WD 5M03A 2JIXB 4YH6A 1U8IB 4PJ5D 2A6IB 3Q5YA 4TNVF 1OD7A 3N1QC 2DF3A 4UAOB 1JZ2A 3HG4A 4P9ML 4KZDH 2ARJB 1IGJB 4XWOD 4Z7UE 5JHLH 2W62A 4WW2F 4IM8A 4NRXA 1QQDB 3DX9A 4AM0B 5TDPA 5IVXE 3QDGD 2IBBA 1ADQA 4EKJA 4D3CH 1SBSH 2CJUH 1FLRH 2DAVA 1T1XB 3WBEA 1FNSH 2G3IA 4LARH 4YEFA 4WI3A 1J9YA 3D3VE 4OZFH 2YD9A 5IR1B 3WH7A 1E6JH 2CRMA 2VLRD 1EXUA 4K7PL 4KKLD 1P9MA 3EGSA 3FO9B 4EIGB 1NBYB 5DMJB 3EDEA 5IM7B 3F12B 3QUZD 5I1LB 1WFNA 3Q48A 5E6IC 4QNPE 3I75A 4XNXL 3HE6A 5DTFA 4GO8A 4F7CA 1RJYA 5C6TL 3C2SA 2C8NA 5HYQB 3UERA 1PX3A 5B39G 4WWKD 4Z5RB 1BM3H 2Q3ZA 1S9KC 5DRWA 3ECQA 1QSFB 3HI6H 1KJMB 1CXKA 4FA8A 3MLWH 4WO4B 1HHGA 1G01A 3VD7A 4K2UL 4X9GA 4DQOL 2P49B 1JVKA 1E0XA 2WINA 3M45A 1MAMH 1GGTA 2V2XA 2M2DA 2NW3B 5C0BB 4CGTA 2E8ZA 2NY1B 1CDHA 3SKJL 4B3KA 3DC0A 5INDA 5T3ZL 3QXUA 1PQZB 1YEKH 4MSWA 2X42A 1SYVB 4L4VB 2DTML 3F7VA 35C8H 3HMXA 4JIEA 4P59L 2XWBA 1YZZA 3BHBB 5KBNC 1UZ4A 4HV8A 5DK2A 3LRSA 3QGVA 4U1JA 3VXRD 4DWHA 4P46C 2UWFA 2P8PB 1HSAA 3RWFA 3MC0A 2VN4A 3GH5A 4U7SA 1B31A 2CO6B 3T0EC 5TDNA 3ARBA 3FOLA 5FUZH 5HYIA 1XF2A 3CUFA 1HWWA 3VIKA 3O3UN 4G7YH 4GQRA 4QCFA 3WQVA 1UASA 1C12B 1H0DB 1PKQA 4PJ9B 3SDYH 1A47A 4P2OC 1XSJA 4YK4C 2BY1A 2AKRA 1WUNT 4KGJA 3LD8C 3X13B 1AQDB 2VZSA 3DV4B 4I3RH 4KDWA 2R0LL 2E7HA 2MPAL 4P2RA 1MFCL 2WC4A 3C87A 1NMBH 4LEXH 3LXAA 2F18A 1DUZB 4X8XA 4JHWL 4LCWD 1OARH 1YEIH 1WT5C 3WEOA 5HHOD 2HVJA 1DL7H 1Z2KA 1QR4A 1BBJA 1RZ8A 1T4KA 3ALPA 3I50L 4PJCF 5AAWA 5GNZA 2EPMX 4GAYB 4WW2B 5EU5A 1I7TA 3N15A 1G9ML 2DQGL 1KTKE 3C60C 4LSUH 1EO8H 4OKVB 3HRZB 4F7TA 1FDLL 1E0VA 1F4XL 1Q72L 1XSIA 4OIFA 1YN7B 3AISA 1JRHI 1NBVH 1JP5A 2DWEB 3WYRA 3IDGA 1QVOA 3CSYB 4R4FH 2QR0A 3DX7B 5FHAL 5EUOB 3BSHA 2ESVD 3MCLH 1EQPA 3NOIA 1Z5LA 5EOCJ 4EVNB 2NPLX 3VFRA 1GJUA 3U4BL 4UT6H 4MAYC 3A22A 3ZIZA 1QNRA 4KK6C 3ESUF 2F15A 4JQIL 4NP4H 4G7VL 5DD5L 3P0GB 2FDMA 5C08E 1MIEL 1CGWA 2FLBT 2WZPD 3WDPP 1JGEA 4PS4H 1FZJB 3REWB 3MOAL 2BDNL 3S36L 1N64H 3CPLB 3S96A 1FNFA 5JPNA 4GAGH 5DT1L 3ARBD 3SJVB 4ZNEE 1FIGL 1TQVA 3MV7B 1KN4L 2MCPL 1KCVL 5TDNB 4PRDA 2MSPA 2DKMA 1LMKA 2FD6H 2YRPA 1LE5B 1XGYL 4J23A 4FMVA 2E7LA 3A47A 2SEBB 1XF4B 4M48H 2E9IA 5LQBH 4GI9A 5E0QA 2FX7H 3H9SB 5FM4A 3AIUA 5DURD 2ARJQ 4Y5VB 2CESA 4WTZA 1FHLA 3GBNH 4YDKL 1UXSB 2A73B 4EQ2A 5A8OA 3OKDA 5CP7B 2A83B 4UT9L 3LS5L 5C7XL 2IPUG 1N6QL 4YHOH 3UETA 3HC0B 1P9MC 2GT9B 2CGRL 3I6GA 1JF1A 3VFOA 3DSNA 1YJDC 1J8HB 1KNOB 3E6HA 1TJHH 4OBSA 1TA3A 2BNRD 5SV4A 3D52A 3LY6A 5LYRA 5C71A 3D3VB 4D1JA 3QUZA 4ZNCD 4PB0H 3MRCB 3T3PF 4YHNA 4CCCA 4HFWA 5GSVB 3G5ZB 1LL6A 2G2RA 4OV6F 1OP3H 4JEGB 4Z5RA 4M6MH 4KRPD 3WCYA 2FJGA 2V6HA 1ESWA 1ZHLA 3ULUL 4TOYL 3U57A 3OKEB 3LRMA 4EVNA 1ED3A 1TCRB 1GW1A 4Z7WE 5EA0L 5K9OB 2ITCA 3MRFA 2KH2B 4E5XB 3MYJA 3SOBL 3IJHB 4C54A 5JW4R 4UFJA 1IRAY 4WUUB 2WIIA 5ADPL 1HHIB 5LJYH 3QIWD 3HUJF 2ARJA 4H26A 3EIFA 5C8BB 1E4XH 5GHWL 2PW1A 4G8IB 4LVNB 5CGTA 4C7GA 1R0AH 1ZTXL 4F8QA 1KJVB 3DUUA 3STLB 1HWHB 1P4LB 4JO2H 3T0EB 4LLUB 1WWAX 4ELKB 4LYPA 3WSQH 2HN7B 3HHRB 5DK0A 3T2OA 1UM6L 1A22B 2Y5TB 3VIHA 5C09E 2EH7L 1G7HB 1AR1C 3IETB 4P2OA 1AQ0A 4M81A 1IGFL 5C0BE 2NY4B 2WYSA 3I9GH 2HLAA 1H5BC 3VWKC 2CUIA 1IC5L 5D8JH 1UACL 3O3BB 3VXPA 2XV6B 1RK0A 3WDRA 3FQNB 4BM7A 4ZAKA 2J7EA 1YEEH 4A6YB 1YEGH 2NY4C 3BZFB 2X41A 3O6KH 2XUCA 5A94A 5GRYA 3ARFC 3WFBL 3LOWA 1MJJB 5DVMA 3BUDA 4ELMB 4X6DE 3O2WL 4LDOB 1A3LH 3QFJD 3WEXB 4IRZH 5BZWB 4J7RA 4BQ4A 4I2XE 5AZ2L 1FFPB 4UOJA 1HQRB 3HZ3A 3LRSB 4XNMB 5IWLC 1E73M 4FQXA 2KPNA 4PSRA 4Z7VA 1MFBL 3W6MA 1UD2A 1OSPH 5D8ZA 5I1IH 1NFDB 3W29A 1FVDB 4HZ6A 4LHUB 3PV6B 3MRHA 5E56A 3O6FC 1HOCB 3INUL 3LHPL 3O11B 3VXUE 3I85A 1CBGA 4Q6IB 4O9HH 4LVHC 5FUOH 3RTQB 4DKFL 1OQXA 3PZQA 2BSTB 5HYFA 1TE1A 2BMKB 5BJTB 1CDIA 3T3ME 2X4SA 5T3ZE 2VMFA 3ZKNC 2XN9E 1A3QA 4KK8C 5E0FA 4CADA 5ITBH 2GCYB 3QJHB 4WHYH 2Z93A 1CI5A 2BJML 4YPGB 1MCEA 3P9LA 5DUPH 1O6IA 1AJ7H 3B43A 1Q9LA 2A38A 2IPUK 4UIKH 3S36X 1K5NB 5I77A 1MQKH 1YC7A 3T0WA 3VGDA 1PDKA 4M9OA 1X4YA 1MOEA 3RKDC 4UILH 5BXFA 1B3ZA 1H5BA 3ZYZA 4ZO7A 1F4WH 4LKXA 4TUJA 3QNZB 1NBYA 3LN5A 2YSSA 4NKOB 3M07A 1MFAH 1HDMB 3CH8A 2UZYB 5GGSY 1NCAH 2J7FA 2DTMH 2L7JA 2ZX9A 4PLOB 4ZPVB 4M5ZH 2WSPA 4M7LH 2NY0D 3MLPA 2G8ZA 4M29A 4QGYA 2D73A 4AD3A 3OKDB 3W9EB 1H2JA 3OHXA 3QQ9D 4FQXC 4WEBL 4PV8A 4JJHA 3X12B 1BYBA 1JHKL 3CX5K 4OCSL 1LE5A 2MQ3A 5D72H 1BBDH 4FZEL 4BQCA 3RQ3A 3V9FA 4NUGH 2W0KA 2P8MA 3ZDZF 4LDLB 3CC5A 1U3JA 5JOPD 3MRRA 1QEWA 5BRZD 3EYQD 3IDMA 4DOHB 4PJGE 3RX5A 2R2HA 2VXSH 3D18A 3WS6A 3ORJA 3V6FB 2BSTA 4AXNA 4ZUWB 4ISVA 1IGTB 1V5JA 4OOZA 1G7MB 3C5ZA 5H35B 3MO1B 2CKBH 4Z2JA 4NO0B 4OZIE 2IBZY 2GVYA 2MKWA 5E8NA 1RFDH 1JBJA 4GPNA 5TE6H 1L9NA 5J3HD 4QYOA 1N3NA 1MWAL 3IJSA 4PS4L 4R4NC 5J8OA 5DEGA 5FIEA 1NDGA 2IG2H 4APQD 1UYQA 1U0QA 5EO0A 3QPQC 4RA3A 4JZJC 4PPTA 5LXGL 2P48B 3RVXC 3PWJA 3ME0A 2IAMC 1XF2B 2V5CA 5ICXA 2ZNXA 2EIDA 3VXUA 4D0CA 1QR1B 3ZE2F 5CIPA 4WJ5B 2ADJB 1O7SA 3SDAA 3WIJA 2X6MA 4EBQL 4FXGA 4WUUE 1HCFX 1BGXH 2R29H 1W2KT 3CXHJ 3KL3A 1MVFA 2VAAB 4LNRA 1JN6A 4BQ9A 1PX4A 1JZ4A 3GNPA 4ERSL 1VADA 2BVTA 2WIIB 4LLVA 3MJ6A 1CD1A 3MMWA 5A6JA 3SDDD 3WY2A 4KQ3H 5DK0B 1IQWH 4Q9RL 4QF1B 5D9PA 3T0EA 4J2XA 3MJ8A 5I24A 3QUML 3R1GH 4TSAL 3Q1SL 3BEVA 1MQ8A 3TBYB 4X6CB 5CPQA 3TESA 1INQB 4KMQA 3GSRB 35C8L 4IRSC 2FX9L 1KYOK 4K9EH 4G6JH 1FL6B 1X5KA 3A6CL 1XGQB 2H1PH 1X5AA 3PP4H 3JV6B 3FB7A 3VM5A 4ODXA 2VIRA 2ZSWA 4EN3D 4WF7A 2J3SA 3DVNB 3RDKA 4TTGA 4PJ8B 2D3LA 3A67H 3CDGB 2RHEA 1KCSL 4WO4A 5F6HI 4K23H 3RX8A 1KXVA 1DBAH 4EI5A 2NQCA 3CVIL 4CVZB 5C2BH 2NR6C 5D7SL 4PG2C 5DXWA 1BVZA 2PF0A 2IAMD 4IS6A 4PMNA 2H2SD 3IDXL 3TPUA 1RURL 4YFLF 1UD3A 4HIIB 3VXRA 2WNWA 1E3ZA 1BQHG 2D4DA 5J13B 1AGDB 4JAMB 3PL6B 1NLDH 2XNAA 3GHEH 3O81A 1I85A 3MNZA 4NQDA 4G8GE 3VD9A 2VERN 2GKIA 4QHMA 1XV8A 4WI7A 1E6SM 4HWBA 3ZLQC 4FABH 4ZTPH 3CJJA 4NQCB 3TT3H 2IF7A 3A23A 4MB3A 3DRQB 3VXNB 3GMNA 4AIXA 4ZXBB 3BWAB 2Z1SA 3G6JA 4LPTA 1MQPA 2BRRH 1YJDL 1S9VA 4Y4FB 5IHRA 4LNRB 3MJ9H 4LASL 1DQJA 2FGWH 4GOSA 2CBUA 5JOEA 4JG0H 1HWGB 5I1DA 1VGKA 3QUXC 4PRID 1CLOL 2B0SH 1B0GB 3V0VA 5DMYA 3OXRA 5JXEC 3D2UB 2V2TA 2EYRA 3P0YL 2RCSH 3H3BC 5SWSA 5E8PA 3HZMA 1FNHA 4RWHA 2DQDH 5JHDB 2EQDA 3S6CA 1A2YA 2BY3A 43C9A 5ISZD 4Z7VF 1H0IA 4Y8AA 2R2CA 1ONQA 4Y19E 5EORH 4WEUD 2DI8A 4H88H 1NQ6A 2J4WL 3SN6N 1Z9LA 4MDIA 1NEUA 4K3EH 1AI1L 4ODBD 3H9HA 3MRIB 4CDGC 4JRXD 4HSQA 1J5OL 1YEKL 1HKKA 1HKLH 3LN9A 5C0CA 4K3HA 3MLZH 5HVFB 1AIFA 1QLRA 2C4FT 4I3SH 2A77H 4OLUL 5B3NA 4JR9L 4MZ2A 1BF8A 1QFOA 4OIIL 4P7OA 4PY8I 3O8XB 2JELL 4NC0B 2H2SC 5DUML 1RZJC 1GAFH 2R2EA 3S34L 3OMZA 4KUZL 4LLMA 5K9QG 3CH1B 1NFIB 4B0MM 3BVXA 1AGEA 4IRSB 1AP2A 5F88A 5C0AA 3W25A 1V08A 1J9CT 4JO3L 4N0FA 4POUB 2V9RA 4J6RL 3SCRA 4MDJB 2BSSB 5EOCL 5DJ0B 4DCQB 3AS1A 2IAND 1M04A 3SUTA 3X3GH 4M62H 3B4NA 3QFDB 4ETQA 3EHBD 1RY7B 3D25A 4ZS7L 3SJVE 3HCVB 4NKDB 2QKIB 4QDMA 2FO4A 3RFZC 3O9WC 2N1KA 4JY4B 2EH8L 3MLUL 1P7KA 3P73B 3QRFM 3AXXA 4XX1E 4GW4A 1F6AA 3KYAA 3DX2A 2WMJA 3ZDZE 2W9EL 4NZRL 3RA7L 4Y5XC 1UCBL 1KTDA 2V17L 2W9LA 2W1NA 4XUYA 3H9SE 5MEND 3BUBA 4Q2ZA 3FFCE 1SR0A 2FSEA 1HI6B 4JKPL 4EAMA 4JANB 5D7IF 5EOCH 1SBSL 4X7CC 3K4ZA 2P46B 5EOQH 1GOFA 1NGQH 4EUPG 4J6RH 1WISA 2XNAB 3D5OF 1BQUA 1I3UA 3RVTC 1ZGLM 1FOBA 3GTNA 1G7JA 3TVMA 5GIRA 3MANA 1S5IH 5CEXA 5L6YL 3RWEA 4YPGA 4GKLA 2LAAA 3U6RA 4Y4KD 4YHGA 1F4YL 4OCSH 5HI3C 4D2NA 4QHKJ 4QRRA 4ZDHB 5HGGS 2EJ1A 4C7FA 1D9KB 2J8UB 4RA0C 1JNLL 4GXUM 1WV7T 3ROOB 1CQYA 3D3VA 3SEPA 2A3BA 4YGVB 2UY5A 2YEZA 5MEOB 3HAEH 1BJMA 2CDGB 4NO2A 4RQQA 4Y1AB 2VDML 5ABDE 1XGPB 1ZEAL 1RIHL 2OZ4L 4HP5A 2WSKA 1PIFA 1U6AL 1WB0A 5DR5H 2VQUA 4PGDA 5GS0L 3KXFD 4MJIA 1HH9B 1FO0L 1IAKB 3TO4B 1I3RB 2V9TA 3G5XB 3OKKA 4M62L 4XCYA 5E99H 5TDPB 5A6LA 1BGXL 2HRPL 4YDLC 4OQ1A 3SUSA 4JRYB 3T2PA 4UOW0 4WFFE 2FEDD 1AQKL 1NP0A 1WWBX 4JO3H 2DM3A 2R23B 1IC4H 3HNSH 4KKBD 4QHUA 2H2PC 2VAJA 2AV7B 2FWOA 3W38A 4LSRL 2J8GA 1T1ZA 4EOWH 2VXTH 3IFPA 1JJUA 3HI6L 3QPXH 3QDGA 2GJXB 1DP0A 4OZIA 4U2YA 3PJSA 4GAFB 1LP9A 3A4XA 3RPKA 4YHEA 2I9LB 5J0BA 4JL2A 1I4FB 2R2BB 3A6OA 3EO0A 3MTRA 4P57A 3DX4A 3FO2A 1EZVX 3IT8D 3W5NA 3HI1A 2AK4E 4JREB 3X11B 5J6HA 1D6EA 4K7PX 5I78A 4M93B 2Q8BH 3VWJC 3C6LC 3H0TB 4TVPE 1E1FA 2ZUUA 4PMVA 4NQCE 4OT1L 3GM0A 2I27N 2YUZA 2O5YL 3Q6GL 3U5YA 5ETUB 3MNWB 2BXZA 2XVPA 1W9UA 4EI5D 3TTSA 2X0YA 3MROA 2JJSC 2EDFA 3BP6A 5DHVH 4DGYL 5D1ZC 4QXUH 4H0GA 2VL5A 4LMQI 2UUDK 2QSCL 1MW2A 3PP4L 3VI4F 3RNKA 3PGDA 5L2JA 1V0MA 5C0FA 4MD5A 4AY0A 1K9EA 1KB3A 1A64A 5EZJA 1LEIB 1OWWA 5KZCD 3TO2A 2RGLA 1JPTL 2F5BL 4UFKA 5BXTA 3G6LA 2X44D 1RK1B 2P8LB 4XC1L 5JW3L 1EPFA 1W3KA 4D6IA 5TGBA 4BS0A 1CICA 5I8OL 3K4AA 3QUZB 3RWDB 1ZS8A 2J1KA 3AGVA 3LKPB 3RWJA 3WD4A 1W72A 4KVCH 4KWUA 1L7IH 1GOHA 3MBEB 4F79A 1ZK9A 4G6AC 5FO8A 3GRWL 5AG9A 3BRDA 4JDTH 5ACLA 3T0DA 4FFVD 3NFPB 5BXRA 1U8PB 1MCHA 2W65A 4XPTL 5BZDB 3GIVB 1S9YB 4JPWH 3TH2T 4MX7B 1AY1L 5IKCB 4JO2L 1T04A 1RPQA 1U58A 1JWUA 1CK0L 5I1AA 1LJYA 4WFEE 1MREH 2IFGA 5KSUA 3UPRB 1IEBB 3K46A 1MJUL 1WFOA 4O00A 4O5LH 3ALWA 4AZ5A 1V7MH 3LKNA 1OF2B 2Y7QB 5HDOA 4NKOA 3QUYD 4IEFB 4WTWA 2EIZA 4MCZB 4QRPD 3T1FB 1EOMA 1S7XB 2C7UA 3CPLA 4FNUA 3L7FA 1S7QA 2H6PA 3OPZL 3L5XL 4XPFH 4LLDB 3RY6A 1C5DA 1T66C 1FH5L 4RMWA 2F74B 1US3A 4QLKA 5IEHB 4AJ0A 4M7LL 4PRAA 2D9QB 2K7PA 3DVNA 3IRZA 3WS3B 3ULUF 1FYHB 5TPWL 4WEMB 1CFNB 5JOFA 2NSXA 4WV1C 1GHFL 2A74A 1I9RH 3WEXA 1U2CA 1T2XA 4CVZA 5IB3A 3W53A 1CDJA 2Z8VC 3PWUB 3HMXH 3QCUL 5JUEH 4Y5YB 4NJ9H 5IMKA 4Z7VB 5DZLA 2CKSA 1CFVL 1AGDA 3MGTB 2GJRA 4OJYA 3LZFH 1P7QA 2GFTA 1A6WL 4D9LH 2Q3AA 4QCIB 4CN6A 2PETA 5E95B 4JZJA 2Z91A 3VXUD 5CBEB 1YYML 2ZOXA 1DANU 3I02A 2W65B 1UM5L 3U9UA 1JRHL 4I9WE 3WDJA 3VFTA 4L4JA 5EO1A 1XIWD 4AENB 4Z6AT 4NCDA 5F89B 1MFDL 4BFEA 1Y0LB 3Q2CA 1HVXA 1TFHA 4PB0L 3EOTH 4U6HA 2D0GA 2MQ0A 1HILB 1LEIA 3LN4B 4ZODA 1MXGA 1YMMA 2CXGA 1NAMB 3KPOB 3HNTH 5GGVH 4D0CB 5AWNL 4WWID 3WENA 4LRNH 4NP4L 1GGBH 1BBDL 2JB5L 3ILQC 2QQLH 4FZEH 4NPYB 4OF3A 3S97C 3EMQA 5A8PA 3MRDA 2X4UB 4R7DB 1F8TH 3EZJB 1XSKA 2OL3H 2R39A 4UCFA 4MA1C 3ZM8A 5A43C 1VEMA 1UHVA 3MSDA 1JG9A 1RZJL 2BFGA 1MYRA 3OKYA 3STLA 2ADIB 1XCTA 2Z8SA 1VCAA 4U1MA 1UWUA 1JI1A 4YX2L 5D1XB 3QA3A 5DRNB 5K9JL 4LSSL 4UFMA 5J6GB 2I5YL 5DJCA 4UQDA 2ZCHL 3SUVA 3WFBH 4WUUA 1M7IA 3GMOA 1M53A 4RGND 3PQYE 1G9MH 4D9RE 3MPCA 1I75A 3HE6C 1ZJAA 3TBWA 5CJXA 4XXDB 4NSBA 1MQQA 2H45A 1BQLH 3S36H 1N6QH 4AEIH 4N8CH 3AIBA 4Y5YA 1NSNH 1SJVA 4YUEL 4B41A 4UFLA 2HN7A 5C09D 4GKNA 1CLYL 2G5BA 1JFHA 1BD2A 3IF1A 2J12B 3S9DB 3OKNA 1NMCC 2AP2A 1W91A 4W7UA 1ZWIB 3GDBA 1CDBA 3QXDB 3VI4E 1JGDA 2HLAB 4HF5L 1RZIB 4XTRC 4F2MA 5I1EH 3VWJA 4OFDA 1KJ3L 3T0AA 1IZKA 1WKYA 2FDBP 4X4MA 1QFPA 2D1ZA 1LILA 1OAZL 1AE6H 1VESA 5DYOB 3CHCA 5D9MA 4KI5E 2PTUA 1AGBB 4X9FA 3G6JF 2BP3A 2X4UA 3G5YB 4NGHH 1XGUB 3CZFA 1KYOJ 5JBDA 1CICC 3U0WL 5IT2L 1R5WB 3EOYG 3HZYA 5ALBH 4AL8H 3BUIA 4K71C 1SJHB 1T03L 5I1AB 4HUUB 3VGGA 3U1SH 5DHVA 4W5UA 4XPTH 4DUVA 1A6WH 2X7LB 4D9LL 1I8KB 3HC4L 4MCYA 3DX6B 4M43L 1WC7B 4U1NA 4NNYB 2AJ3B 4LQFL 5CILL 1RI8A 4FQHA 2DIAA 2VSDA 5GSVA 1BECA 1V03A 1UXSA 2A73A 1HNFA 4O4YH 3F7YB 3LV3B 3EYPA 1YN6A 3EOTL 3GMRB 1OTUC 5L2JB 1UD6A 5TE7L 1V7NL 2UVEA 1FL3A 4GI8A 2DT1A 1S5HA 2YPVL 3M1BA 2GJZA 4JN2B 2GCYA 3B9DA 1ZT7A 5C08B 4N90D 4NXSA 3EAKA 5DMGD 3FCTA 1VBUA 1RULH 4OCNC 2XG9A 1MQRA 1UM6H 1I1FA 3MXVL 3SCMB 3SO3B 3GXPA 4HLJA 3VG9C 1MSPA 1U92B 1FGNL 5GZNC 1FFQA 2CRYA 5IFHH 4S1SL 3RIKA 1S9XB 3UYRH 4JM4L 3BAEH 2W0FA 4XCFL 2ZPKH 1H41A 1A14H 1RUAH 2H26B 2E0PA 2EPKX 4N1EA 1DVFD 2VXQL 3WL1A 5TH2B 1YEJL 3CMGA 5KSAD 2XM1A 1UZ6F 4Q9QL 1W0VB 4XPHH 3MBXH 5GS0D 2NXZD 4Y16C 2W9DL 4UV7L 4D6FA 2Q8XA 5I16B 4TVPL 5LBSH 4HU8A 1FHGA 5I30H 2LABA 2HLFC 4LVEA 3JWOC 2YBUA 4I0PB 1PSKL 4W81A 1K4CA 3QEQA 3VJ6A 1U6AH 1IKNA 3CUPB 4Y4HD 4ZQKB 2ICWI 4W85A 5D7JD 4P8VA 3MV8B 1KENH 3DXAB 4NUJB 3KYNB 2BFVL 2PO6B 3ZE0F 1DL7L 5A6BA 1JNLH 5HHOE 1MCWM 5F1IB 2ADGB 2DQFA 2FH6A 2GTZA 3CHEA 3EJYC 1AMYA 1S7WA 1OTSC 4O02L 4YQXH 1KTLB 5E9AA 1S5HB 3PGDB 3FT2A 4B9ZA 1TZGH 5AUMB 1HH6A 1EXUB 3QDMB 3CSBA 2OR7A 5T1KA 4HMEA 1U41A 2X4NA 4HH8A 3R8BB 4F7MB 1XYZA 3DROB 3GB7B 4OQTL 3ARVA 2YOCA 2AJZA 2XKSA 4MA7L 1ZLWH 4X4XB 4X7SH 4RE2A 4L9LC 3NFSH 4L29B 5L2KA 5BV7C 1O7VA 4L9DA 2GITA 4HIHA 4QO1A 1VRXA 3EOAB 4Q6YA 1SMOA 1NOFA 3HZVA 5E9DD 3MRMB 1A0QH 4ZUUA 1FC1A 4RNRA 3WD1A 4ZOAA 1LO5A 2EKSA 2PUQT 3QUKB 1A1OA 1MIEH 3S5ZA 2WAGA 3I02B 3OKKB 4XCYB 3PQYB 2EXOA 3PWPA 3Q5TA 4CJ0A 2A6IA 4JFSA 1E40A 3ARED 4I3RL 3RCNA 1CGSL 2DQXA 4EDXA 3NIGE 4LHUD 5E6ID 4A2MA 4L8SC 2DSKA 4UMGA 1TETL 4N0YH 5EBLB 3F8UB 3WNLA 2J8FA 4UDUB 5JLZA 1W0WA 4CJ1A 3OKEA 5FYLD 1HNYA 4LKCB 1CD1B 1OTTC 1TVDA 4XCNA 1X5GA 4YDVA 3STZA 3SDAD 4P2QB 3VMPA 4XMKL 2OYPA 3QEQD 4AQ1B 5IESH 1T1XA 2APFA 3EFDL 2VLKE 4UFHA 4GW5A 4XVJH 1AQHA 1UWIA 3OKOB 2G5BB 3IB4A 5E0CA 2FATH 2AK4B 1NFDE 1UB6A 2XZQL 4PJAA 1W72H 5D1ZB 1F58L 4L4VE 3NCBB 3BIKA 5CBAB 1BX2A 3C09B 4I3SL 5I30L 1NWUA 1BHGA 4M24A 2BCKB 3HNVL 5GGSB 4MNHB 5T33H 1FO0H 2XVGA 4OUEA 1OAUL 1GHRA 5JTWA 2H8PA 2VB5A 1UG6A 1BJ1J 3FTGA 4YO0B 4MD4B 3L3DA 1TQCC 4MNQB 2Z35A 4CUCA 3SCTA 4ATWA 1DEDA 1D5IL 1IC1A 2VQ1A 2D20A 4CMHC 4X98A 5SWQA 2J4WH 3WD2A 4KPHL 5F6HJ 4LBEB 6TAAA 4YDJA 4L9LA 5JR1H 1C93A 1FAIL 2GK2A 1S7SA 3IXAB 3N1GC 4M7KL 1U3YA 5FGCB 1MCOH 3WD5H 4JM2A 1P53A 1L7TL 2ESCA 3DBXB 1BM3L 2QEJA 3S3SA 2WMPA 4P49A 3QI9B 3D1MC 2WC3A 2GYSA 2AXFB 3GH7A 1CLOH 2A77L 1ZT7B 2B0SL 4OLUH 4XT1C 4ZD3L 5C08A 1T4KB 3DXAA 1AO7B 1EAPB 4NUJA 1E43A 4UQEA 5DC0A 2XSBA 3J7HA 4TVUA 1U8LA 3DX3A 5DEGB 4MADA 2GUOA 5JW4N 5KVEL 3B9KD 4HIJB 3Q3GA 4HWBH 4QYOB 1UOKA 1KSRA 1D5MB 4F7TB 3AS3A 3G6DL 1HYSD 3U4EA 2OW6A 4Z18A 3OJDB 3V4UL 5I1DB 1XR8B 3MRIA 1HCVA 1CDCA 3LQMA 1JF5A 3RTQD 4WIWA 2QQNH 3LMJL 3BVUA 3CVHL 3B8YA 3L3JA 5AYUL 3RVXD 2OYMA 3OJMB 5E09A 3RI5K 5F7HA 1FYTB 5SX4H 2H32B 1Q6EA 3P77A 1QLEH 5A6AA 2DBJA 5SWSB 1FLRL 2XN1A 1ZKAA 2BNRA 4PJFE 1JZ8A 3TVMD 4LSRH 2E27L 4MQ7B 1MHPH 3CH1A 4K94C 1R47A 3UZEA 4XNUH 5D71L 4XXCC 4RAVA 3QEGH 1I7TB 5GJSH 5JDJA 4G9FD 3QO1A 2QV2A 3NZ8A 4JDZA 2EE6A 4KXZH 4F15B 3APGA 4KQ4L 3F7PC 4BQ3A 4JQXA 1ZHBB 5IMOB 1H8NA 4HS6B 2EZ0D 4QTHB 4YWGL 3DTXA 3ARSA 3GMPB 4NZRH 1W72L 2J8HA 3MV7E 3NABL 3RILA 2NY7H 2DIEA 1RIHH 2OZ4H 1PKQE 5DFTA 5FKPA 2G75A 5DEFA 3TGXA 1GUVA 4JFEA 4TSAH 4IRSD 5ECJE 1PSKH 5C2BL 2G9HB 2HVKB 4N0FB 3MJ7B 8FABA 3FRUA 4KJWD 5CEZL 1CLZH 1O0VA 2Z1KA 3WS6C 3MV8E 1BP3B 4A3YA 4DUWA 2V2WB 4D9RD 3TTQA 2CLZA 1XYFA 5EB9A 2ZSVA 4HUWB 4OLZH 4PUBH 4YXHL 1JXKA 3ARFB 3MBXL 3MFFA 2MTPA 5T1DL 3LQAL 1AQMA 4OLVL 4HG4K 4C56D 3BJLA 5DHYA 3FB7B 1TZGL 4D94A 4DK6A 1VFOA 1UR0A 5MEPA 4P7LA 4DAGH 3B9KB 5CKGA 3MCKB 2ZPKL 4Y19A 5HVHC 3O4LD 3H9HB 3CFBA 1UZ1A 1T7WA 1B4JH 3QG6B 2APBA 4URIA 4JR9H 3BKCH 1ZLWK 2AEQL 3SGEI 5AUMA 3VCLB 4Z0XA 4WCYL 2NXYB 3THMH 3MXWL 4NKMB 1GRWA 4ZXBA 3BXNB 4IS6B 4L4TE 2CKBA 3NPSC 4K55A 4EDXB 4XNZB 2C26A 3RGHA 2BNQD 4DTGL 4NQVA 1TR1A 1NCAL 4QHNA 4MLIA 1C7SA 2PTVA 1KR0A 4IRJB 4LK4A 3B5TA 3PZIA 1J0IA 3GK8L 3HI5L 1HL8A 3GXMA 3PZNA 4TSBH 2XSAA 3WE6A 1VPOL 1KELH 1T0PB 2HRLA 3UEQA 2MQCA 4OZGF 4TXEA 4TRPL 1GOIA 2C1PA 1T22B 3KJ4C 1R3KA 5I71C 43CAA 5GJTL 1WAAA 4KVNH 2A3EA 5JLZB 5T5NF 5IQ7H 2YLLA 5DUMH 1FLTX 4OZ4B 5KN5A 4YIQB 4JLRA 4RBPH 4X4ZA 4UU9B 3TO4D 3V6ZA 5HHPA 4WRLA 1KWGA 3P9MB 3HC3H 1WCQA 2UY7A 5JMOC 3OG6B 1M7IB 2CCRA 5EPMA 5IMLB 5EOTB 2VX7A 1VADB 1HXYA 4HZLA 5T3XE 1Q94A 2ZXBA 1OGAD 5JXAL 3UPAA 4TOQA 1J87A 1E0WA 5FYKH 4XP5H 4JCLA 5DJXA 3MV9A 5E6YA 3WXWL 1ACZA 5MEQB 1IKFL 3S7GA 1ZHLB 1DDHA 4KHXH 5GGQH 1NC2B 2Q87A 3AMDA