1CXKA

Complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxkA01
3W37A 1V3KA 4LAQL 3O3DB 4EI5C 3UO1H 1V0MA 2BZDA 2JLLA 1J7VR 4HHAA 3MLRL 3CFCH 4E9LA 2WC3A 2FYYB 2XIIA 1GC1C 2IANA 2I07B 5IQ9A 4X4YA 5IEHB 4PTTB 4F8TA 3QXUA 3AIRA 1LO0H 4OZ4B 1DWJM 5GIRA 3HI5L 3E2HB 4LCYB 3ZJ7A 3QIWC 4IOIA 2ENSA 4P5TD 1YYML 3OG4B 3QHFH 1N3NA 4GQRA 2QV2A 1C90A 1WDPA 3HNTL 3BN9C 2OTPA 4AH2A 4KZDH 2AJ3A 5FD0A 3WYRA 2HLAA 3PHOA 4JAMB 4UZSA 5CIPA 4K7PL 1L0YA 1WBYA 1NSNH 4JZOB 3T0BA 1RUKL 4OLEA 3VXOB 2VZOA 4BSVA 1HF6A 4NPYB 1G7MA 4PUBH 3TYGL 3A21A 6CGTA 1UR4A 4D9RE 4HUVB 3RVTD 3MLUH 3MRQB 4I0KA 1LE5B 2ARJQ 4NQXB 4GXUM 4F15C 1DWIM 4ONGH 4OZHE 5ACZB 3DURA 5DD5L 5F7WC 3KPNB 1QNSA 5IHLB 5D7JB 3QHFL 2CESA 4WHYG 2R23A 4TOYH 3IXTB 4YHZH 5DMGC 1T20B 1I9IL 2GY7B 4PGCA 4NT6B 4UZUA 1GOWA 3S5YA 2NPLX 2KQNA 1MH5B 2YFOA 1FL5B 1TJIH 2FNBA 1S46A 3BYTA 4ZO9A 1CGWA 4BELD 4DZ8B 3ULUD 3O6FB 3SCPA 3WE6A 5AY7A 4YGVB 8CGTA 4UOZA 2A77L 3U0WL 5HI4D 5DJAA 4Z7NF 1CPUA 1E4XL 2V6HA 4JKLA 5DJCA 4D71A 2BCKB 2XTJD 3C87A 1MELA 1O7SA 3TV3H 4YDLB 2YSSB 1C5CH 2PC8A 2EPMX 2J5LB 3MSPA 4JY5H 4Q6IB 2F8OA 1AVAA 1FNSH 2E6QA 3JWOC 4AYSA 4OCNC 3TJHD 4YC2B 3G6LA 1QEWA 2FE0A 1T1WA 3QISA 5I8KH 3QEHA 3GSOA 1AGEA 3T1WA 1YN7A 4DUXA 1AQKH 1WE5A 1X5HA 4U0RC 3CPUA 2ZUXA 3KYKL 2BRRL 1CL7L 5EO1B 4UB0L 1MCPH 4HMDA 4JFDD 5EWIH 1VF8A 2L0DA 4R96A 3IDMA 2FEDC 5M03A 1KJVA 1FO0L 5HYIA 1ZTXH 2V5SA 4FQXA 3HR6A 2FL5A 3LQAC 5ILTL 4NZDA 1XGTB 2DQFA 2XYCA 1ZLUH 4JR9H 3CUIA 2R56H 3OGCA 1SZNA 2F54E 3BPOC 3SY0B 3RWHA 1XC6A 4YWGL 3UR8A 4OOUA 4OLWL 5IVXE 1BF2A 4XNYH 1MW2A 5CD3A 3DROA 1SVCP 4NUGL 1MFAL 2WWMC 2NY4D 1AIFB 1FH5L 2Z92A 3SDDC 3DIFB 5T5NG 3D39A 1MQKL 1QFWI 2AJUH 3H0TA 2PYFA 3VRIB 5DURB 3U4EB 1KB9J 4P57A 3HUJF 3ZDZE 3SDXF 1LE9B 5I0ZA 2J88L 5EOTB 1J0HA 5DJZA 3VIKA 1RUPL 2X4NB 2LU3A 1LEGA 3TTQA 1AXTH 5KW9H 3GB7A 1D5XA 2CR3A 3WQ8A 3DX8A 2DLTA 5C0EB 4ERSL 4R6UA 2CYGA 2EE3A 2VXQL 1Z3GL 3LPGA 4UFKA 3H9ZA 3DX9A 1MRFL 3JUGA 2ZSWB 5GZOD 1DWFM 5INCA 3EJJX 3GJFB 3WDQA 4NM8L 3BXNB 4HF5L 5IBTL 3NCOA 4ZS7H 2BHZA 4M80A 2QQNH 3QUKB 5E4EC 4X7TB 43CAA 1FLRH 4WU5B 2X89A 2V2XB 4OQTA 3N85H 4Y4KA 3V5KA 1WZKA 2Q3AA 5C0IA 2DT2A 2R69H 3QHTC 4JJ5A 1R5VA 4KKCC 4QRTA 5I30L 2OX5A 4CU8A 3J8F7 1Q9WB 1QVBA 3B9KB 1DBKH 3TH2T 1ED3B 5CJBA 4OLVH 3UDWA 3KEHA 5FL1A 3UCRA 2ERJB 2XWJA 1M71A 1KYOK 3G6JB 3GNML 1IZKA 3JTTA 1I1YA 3MO1A 3VTRA 5IFTA 3GSRB 3CSPA 4PJEE 4L4VD 1DVFA 1OSPH 1R3HB 3MV9E 1I9IH 1UXWA 1W9UA 1UA6L 5IW6A 4XCEB 4HFUH 4FQJL 5I1GL 2FSEA 3QDMD 3VD7A 2WHLA 2X40A 1FORH 4YPJA 1A3LH 2QHRH 4ZFFA 2FX9L 3BUYA 5GGRB 5MENA 1YJDL 2KZ1B 4ZXBC 2FEEL 3NCBB 4OV6F 1AY1H 1W9VA 5BQ7B 1QRNA 1AKJB 2PTUA 1FL3B 4RNRB 3BAEH 2V2WB 3T2NH 3WEMA 4HH9B 4NWTL 3BPLC 3LX9A 4UNUA 1DDHB 3DNKA 3M17B 4R4BA 4JG0H 3GO1H 4QOKD 4PJFA 3FQUA 2Q3ZA 1PQZA 3HA0A 4K7PH 4NQED 3MRPB 1J0ZA 2B2XH 5C09E 3TONA 3NDYA 2NTFB 4PJ7A 1FVEA 1HH9B 3C6LC 3UYRH 2EIZB 3U7BA 1IQWH 5MEQA 1C3FA 3THDA 3UBXA 5D5MF 1KFAL 1OGAE 3SQOH 5C6WH 1FRGL 3CMGA 4KI1A 1N59A 3LCYA 3F7PC 4ELKA 3KLHC 4PRWA 2FCBA 3TEUA 4PJAA 1HJVA 3HE6B 3G08A 2VR9A 5FUZL 1K9DA 5JQ6L 1Q1JH 3HB3D 4P2QA 3WELA 4R2GC 3OIHA 5CHNB 3UO1L 4C56E 2ZSVA 5F1NA 3QUZD 4GAGL 4G9FB 2IF7A 4O2CB 5CAYB 1WZMA 4OCYH 3FONA 4DAGL 4QOKA 2W9DH 2DT3A 4WIWA 2FGWL 5C92A 4P23B 3MNVB 5TE7L 1EUUA 3QULB 2BXYA 3MUHL 4JO2H 3OR7B 5FK9B 1RUML 3IFOA 2JCCA 2NY4C 2GK1B 4CRPA 3TM6A 4X4ZA 3HMXH 2AI0L 3SDDD 5ISZD 4JZJB 3T0EA 2HLFC 5TFSH 1CD1A 4UI2A 4O02L 4L8SA 3OKKB 2NXYC 3BC9A 4H1LB 3WNPA 3WIHA 5LGHL 4M62L 5AUMA 3II1A 3MNZB 4O02H 1W1VA 1DR9A 2VDLH 4P8XA 1AMYA 1QNPA 4S2SA 1ITXA 4DWSB 5E56A 3TPUA 3UERA 1N64H 1RVFH 4HBCH 4JRXA 1WAAE 5D1XA 3P9LA 1M05B 4E42B 4KMTL 1W32A 2YDRA 3KXFD 3ZYZA 3D85A 5F7DB 3ZSSA 4J28A 3FAXA 3UTZB 3BEWB 3GSUB 1BIIA 4P4KC 1NGWA 4FQ2H 4YQXL 2ESVD 1MJUL 1HILA 3C6LB 4U1SA 1KULA 1P4IH 2AJSH 1UWXK 1JPGA 1KCUL 4LLWB 43C9A 3ZTNH 1H8NA 3WUGA 1U8HA 5GS0L 2P44B 4X98B 4PJ7E 2R0KH 3CLEL 2ID5A 3MJ9L 3OX8A 4OLZL 4PTUB 4Y1AA 5DRXA 4WI5A 1CXIA 4U1KA 2UY3A 5D1ZD 3L9RB 4M7JH 5IIEA 3AHYA 2AEQL 4F7PA 1RJLB 5KVEL 4JFFA 3QHMA 3QPQC 3F7VA 4R4ND 4APQB 4PGEA 5FYLD 1IC1A 3MCLL 3TO4C 1W9DM 4LOUC 4OUOA 1TVPA 4NNYA 3A4XA 1KEML 2CO6B 4WJXA 3A23A 1AGFA 2AW2A 1V6XA 3T09A 2VZVA 4NKMB 5A3IC 5T1DL 3PG2A 2PCPB 1DJSA 4LCWD 2EDYA 3MNWA 3ZKMD 2ARWA 3O6ML 4ODHH 2C7UA 3ZDYE 5A6SA 4LFHD 4L9LB 5C0FA 2VXTH 2NY2B 2NZIA 5JOPE 3AS3A 1XF2B 3FQXB 4ZUSA 1NGYB 5CFHA 1QX1A 2QSTA 1BG9A 4P48A 5H37H 1V03A 1DL7H 3L5IA 5K93A 1GOGA 1UZ4A 3SDAA 3HLAB 2ATKB 3PGCA 2QHRL 5DT7A 4Z76B 4PJHB 1VFAA 4U7SA 5CINL 5F3HB 2LU4A 4W88A 2Z35A 2AK4E 1QSFA 3HTLX 1QLEL 3OGRA 4FFWD 4M7LL 2HRPL 1US3A 5DJ2B 4N9GB 1UM5L 2PYED 2QSQA 1VKXA 5I23A 2NQCA 4JDVB 4YHNB 4DN3L 4QRPA 1K4DB 3AREC 1ZB5A 1J0IA 4Q74A 2UWFA 3QQ4B 1F42A 4OGYH 1V3LA 5J11B 3O3UN 5IBUG 1B4JH 1FN4A 1E1EA 1GOKA 3PIQA 2QKIB 4QEGA 3HC3L 4FQ1H 5IDIA 2YD7A 2J75A 4ODXA 4F57L 4PJFF 4MDJA 5FDWB 1N6UA 4WCYL 2VXUL 3IDUA 3QUML 5T33L 5EUKA 3TZVA 2FYYA 2CERA 4ZS6D 4I2XE 2W65A 4X4YB 4AQOA 4AENA 4PD4J 4Q97A 4Z7OE 4L8CA 3W2DH 2FDBP 1CVSC 2C3VA 3HZMB 4HF5H 3LD8B 4JRYE 1IAII 4JFYA 2WP3O 5JXAL 3CC5B 3L6FB 5K9QI 3GNMH 1MCWW 4LVOB 4ORGB 3ZO9A 2VXVL 2YD6A 2ZCKL 1JZ4A 3LEXA 2GT9A 1O7AA 4OLVL 4WGWB 1CICA 3C8HA 5HYJD 2DIEA 2DQXA 4U2YA 4P7RA 1MVYA 3MUGA 1DBKL 4K94C 3PQYA 4CVZA 4HKZA 3T8XB 5CD5D 3QDME 5AD0B 4YHIA 4MA3B 1G5AA 3Q48A 5DMYA 1QKZL 2BNJA 4NZUL 4LQFH 3W28A 3DDFA 1RUPH 3O4LA 4KK8C 3ZHDA 4AYGA 2HISA 2RGSA 3MUY1 1BQLL 3MUJA 2VZ3A 4HK3N 5IT2L 3NABL 3WF1A 1LD9B 5HVWA 4UV7H 4I4WA 2VLJE 1I7UA 4GI8A 4XBEH 5AEAA 5JBFA 1ZXQA 4OZHF 3S37L 1CXLA 2MSPA 4JRWA 2AABH 4KUZL 1C5BL 2B1HH 3C5ZA 4JG0L 4WI4A 2BOCB 4V1DB 4NT6A 3ULSB 3RDKA 5CZVL 2FATL 4ZD3H 1P9MA 5D1QA 2BFVL 1M6OB 5A2BA 2AV7A 4I2XB 5HDBF 1IL1B 1G01A 5IFAL 4YGVA 3RZCD 4NI3A 1DQMH 4NQTA 3ZHKA 2A83B 5IJKA 1S8DA 4G8FA 5JIKA 3HI1A 4PMYA 5EU6E 2AOSA 3WFBL 1GSMA 2VCAA 1J1XH 1DQTA 3G6DL 2X4UA 1IGYA 2I9LB 5A6BA 3AY4C 3UTPE 4RGMB 5KZ6A 1BFOA 1OGAB 2WZPD 1XSKA 5DGRA 3BISA 3ARBA 3T4AB 3BIKA 5FL0A 1P1ZA 4KJYA 3QEHB 1DBJH 5IW1B 2A3CA 3SCVA 4NQCE 4RAVB 1YN7B 1UACL 3D3VE 1TFVA 1WBXA 3SOBL 4WWID 1RUAL 3UTTD 1NCUA 1JHLH 2VR4A 4NXKA 4B5EA 3P30H 5CUSL 1A4KB 1XCQA 1RK0A 3VRLE 3ES6B 4QO1A 3NIGE 3E6HA 4U6HA 2VLRD 4A2LA 1EFQA 1RPKA 4R26L 4ZUWB 2L7UA 4PG2C 3SKNB 4DM2A 1X4ZA 3WQ6A 5DC4B 3RIKA 4KK8D 3UZQA 1NEUA 3QI9B 2Y36H 3B2UC 1F4YL 1BSIA 4JQXC 3BPLB 4AIEA 2J7BA 1BYCA 5GZOC 4QHNB 3NGBB 1CE6A 3KHOA 3SY0A 5B4MC 3RAJH 1FYTB 3T65B 1T1XB 1CFSB 3IJ8A 3DROB 2IFFH 3NUKA 4XPBL 5DDHB 4IRSA 2EEDA 5BRPA 3UMTA 4RE2A 5HXMA 1QR4A 4Y4HB 2WLYA 2NW2B 2NXZD 3BZFB 2OS7A 1AHWC 2PYFB 3BW9A 3KPOB 4RZCA 4S0TD 3EYSH 1G0XA 2Q76B 2VWEE 3GGWA 3U7WH 2VC2L 3O9WA 4P57B 2DQIH 1LE9A 2W91A 3H3BC 3VKKA 2Y1VA 4NYLB 1BGAA 3VXTA 3U9PL 4A6YB 3OLIA 4W4NA 2JIWA 3WFZA 3D3AA 3MV7D 5F70A 3CSBA 4MJIE 1GORA 3L4UA 2ZUVA 2J8UB 1MFUA 1UWSA 1IKNA 3ECQA 3I6LD 1RZIA 3BJLA 5IB1A 3GSNH 3O6AA 5A69A 4JEGB 4UTAL 3BMVA 5TF1H 3BGMB 2HYMA 3H53A 4KDTA 4UBDD 1X4YA 1ZEAH 4FLSA 1B2WH 5FM5M 3ZL4H 1WIOA 4JFHE 5CJXC 5DFTA 2MPAH 5BZDA 2BERA 3SCMD 4EOWH 4WO4B 5BRZE 4HA3A 1TQWA 4MPKA 1SEBB 1X5XA 1KXHA 4GW4B 5I1JL 1XRVA 3DHUA 3GMQA 5DURD 3VXUE 2X0YA 2X4SA 3HFML 1QSEB 3PGDB 4FQXC 2F18A 3CFCL 2BNUA 1IC4L 1IGML 1IEAB 3T0VA 2IMMA 1G0CA 3QI9C 1IM3B 2GUOA 2IG2H 3S7GA 4YNYA 4C56D 5HSFA 4JB9H 3WY4A 4Z7VF 3WS6C 2E6JA 5J13C 3SPVA 1F3DJ 4ZFGL 3VIPA 2A6JB 2BVPA 3G6JA 3LN4B 3HE6D 2JIXA 3AHTA 1QHZA 4P4KB 1BJ1H 2YC1B 3QRGH 5BXSA 1F3RB 4IM8A 1ES0B 4ZFOA 3MJGX 2W0KA 5FKPB 4BZ2H 3ZE2E 2W0LA 4PP1C 3WNMA 1TR1A 3U0WH 3BUYB 1CLZH 4Z0XB 5MENB 2AEIT 2CLRA 5DZNA 1J05A 3A47A 1YQVH 2G5BB 1QRNB 4XPAH 1P6AB 5JW3L 1A6ZA 3K4ZA 4J3TA 5C0CA 5IB2B 5HHOA 4ETQA 2VN7A 2DQHL 5E9AA 1F8TH 1V7NH 2X42A 1X5AA 2A9MH 1C91A 4P2RB 5DUPL 3OGSA 4DK6A 1ZV5A 2NYYC 4GBXD 2Y4SA 3CSYA 5BXFA 3K1KC 1YMME 3WH6A 3MRPA 3FO9A 1FSKB 1ZHBA 4A4AA 4CN1A 2XVLA 1UWEH 2YK1H 2ARJB 5C0AB 3ARUA 3RVWC 1DQDL 1HHGB 1QOKA 3CFKB 3BRFA 4UCFA 1PJ9A 3TYGH 4XPGL 3VSVA 1C08A 1NGPH 3GSNA 1T1YA 4OSUL 4BZ1L 4H7VA 1CZ8H 3LB6D 3VSTA 4NM4L 5FV2A 2XA3A 1CD0A 1O7VA 3QP3A 5BRZA 1BVKA 1YMHA 4YDKL 2JF7A 3C8KA 4GXUN 1QSED 4PRPB 1FBIL 3CMOL 3VWJD 5KTEH 2J8UF 3MRFB 2EYSA 1UWUA 1EXPA 1U3JA 2VZUA 4WRLA 5CHNA 3DVFA 1OM3L 1CLYL 5FGBC 1U8OB 4MA8L 4ODSL 5FGRA 3GM8A 2VCBA 4Y5XC 3I9GH 3FONB 3ZKNC 5KN5A 4PJXA 3CLEH 3MJ9H 4OLZH 3MNVA 3QULA 4IJ3C 1RIUH 4KUCF 4PREA 4EIGB 2LV4A 3IFOB 3M8OH 5DFAA 4J1UA 2JJVA 3NABH 3QXAB 1EVUA 4FFVD 1N7MH 2RGLA 2DKUA 3DRQA 4K3EL 3SKUD 3S36L 2QPUA 4PBGA 2XZZA 4HWBL 3I50H 3RZWA 3T0WA 2VR5A 1UZ6F 1UG6A 4X6BB 3ARGD 4HGMA 4BH7B 2HTKC 2D4DA 3HCVA 3U7VA 4AZCA 3TPUB 1J8HB 5B38G 5KJRL 1NCWH 2A1WH 1TVHA 5T3XE 1HP5A 4EQ3A 1MJ7L 1UQYA 5F1IB 5B3JE 2VDLL 3JV0A 1HHHA 4AZBA 4MQXC 4PJGA 3GSUA 4WNQB 5I18H 5FO7A 3BEVA 4LYPA 4P9MH 2BVYA 2FZ3B 3RVWD 3C5JA 3VG0L 2J7DA 3MLXH 5JA8B 2E27H 2QBWA 4WWKC 4XMPL 4KUCD 1U8HB 3FW6A 5KSBA 3ZTJH 3RU8H 2XGIA 1GQKA 2DT1A 4PTUA 5CJ5A 1ZKAA 1W91A 2IXUA 3FNDA 3DV4A 4GZIA 1RZGB 3D2UB 5C7XL 3K2MC 1YNKH 4QHLB 3MQIA 4F7PB 4FF5A 4NJ9L 2BFGA 4HPYL 1IGFH 3SO5A 2GFTA 4ZXBD 4PGEB 1EGJH 4YJZL 4X9GA 5L9DL 2E8ZA 3ZE0F 4NNYB 4NQVA 4DOHE 2NMSA 4WLCA 2JK5B 4R0LA 2E0PA 2DSVA 4NKMA 4ACZA 1UR9A 5L7XL 2HKFL 3DMMC 2J4WL 4CN4A 1UJTA 3NCJH 2XWDA 3VFRB 3OKMA 3UTSB 2AJZA 4LSRH 4UFJA 3HE7D 3CVIL 3TN0B 1YEJL 4NO0D 3DBXA 1HCVA 2P48B 4EDWH 5K59E 2UY5A 1XIWA 4J3WA 1JFHA 1NGYA 2VE6B 1T0NB 2NXZB 3BESR 4G3YH 2GIYA 2EEBA 3WD3A 4KHXL 4XPHL 1N4XL 3IDGA 4IRZL 4RGMC 3GZKA 1Q0XH 1PX3A 2ZX6A 4FNTA 3WLBA 4P2OD 4Z76A 3G5XB 4MSWA 1A6UH 1ZT1B 5F97E 1LO2H 5DJXB 4LSUL 3VFMA 2NY6C 1HHKA 4KHTL 1YECL 4GQPH 1LO2L 4WHCA 1GPFA 1ZBKA 1MIEH 3NSNA 1MPAH 4XP4L 2YMXH 1OTTC 3B5HA 2GK0A 3LZFL 2LQRA 2I9TB 4BFIB 4MD5A 1QSVA 5IOPB 1U3HD 3O0RL 1K6AA 3W53A 2QKIA 3C60A 1UOKA 4HCRH 3RVUD 5BMFH 4QTHB 1MCQA 2E7BA 4Z5RB 4KK6C 4PBWD 4H04A 3FQTB 5HYSA 5DMGD 4N0UB 4W8BA 3L3KA 4Z7UA 2VDPL 4E41B 1XF4A 5J9PB 5ESVB 3EYQD 3VSUA 3JSSA 1UYWL 4JM2D 2DLIA 3Q6FA 3H9HA 4IDLA 1JDDA 2V7HB 3I6KA 2G9HB 3SHSA 5K9JH 3RM8A 3AI0A 1KCUH 2V7NA 1OSZA 4Z7WB 3BI9X 4I3RH 1QBAA 4YGAB 3S37X 3JUZA 2C1PA 3GYCA 4PMXA 3NYDA 2PI6A 1H0GA 4LLYB 1U6AL 4RMTA 4P5TB 4EE9A 2A2QT 2MNUA 4UNTA 1HDMA 4PY8J 2D23A 1KXQA 5DHVH 1FLRL 4LRIA 1E6NA 3QUXB 2FBJL 3RBGA 3V6FA 5IVOA 2CDFA 3BLKA 3AOFA 1WISA 4HKZB 1S7QB 1UQSB 3T8XA 4KGLA 3F6LA 3WO4C 4HZAA 3L3JB 2PYEB 2CITA 1A6TB 2BVUA 2EDJA 4M62H 4JO1L 4RQQA 5CGYD 2AXFA 2F8XC 4W93A 1S7RB 3WH7A 3WO4B 4CVXB 1ZLSL 4FQIH 5I1IL 2J78A 1Z3GH 1TQCC 5AZ2H 4M6NL 1E6PA 4I18C 5JHLL 1Z2KA 3ROOA 4GO9A 4JDZB 3WQVA 4CGTA 1BZ7A 3CU7A 4OI7A 1M7XA 1EEYB 3H9SD 5IVNA 3OLDA 3D25B 3HMWL 4G42A 4P2RD 3ARFD 3NSMA 3RQ3A 4JHOA 1HYRC 2AV7B 4I2XA 3HZKB 2HJFB 1S7WB 4MS8D 4YLQT 4X7FC 2EIEA 1JF6A 3VWKA 2VQTA 4LKCA 5CEZE 3IGUA 4GS7B 4X7SH 3AJ7A 4GFTB 3VH8B 2Q8BL 4WWKD 3R4DA 2B4CC 1IE5A 4FS0A 4P46D 4OLYH 3VFUB 1RHHA 1GOIA 3MRGA 5C3TA 2OP4H 1FHLA 3ARBB 3T4AA 3ME0A 4JM2B 1NBYB 5DSCB 5IK3B 4FRWA 4WI2A 5I16A 3BLBA 2X1WL 5IW1A 1X5YA 5T3ZL 1SY6L 2V2TB 2G75A 4X5XB 4KRNA 2VX6A 4CCEA 1MHEB 4MJ6B 4PJEB 5FFLA 1N5YL 3UDWC 1DBBH 1WBXB 3GRWL 3QO1B 4LPTA 4TVPD 1PY9A 2ADFL 3KPSE 4KMLB 2FO4A 3PZMA 1DQQB 3CZFB 1XCQB 3ARED 4PJBE 3PP4L 3E6HB 3IJSA 5GHWH 5FM5O 5C08D 3B4NA 3AFLA 4Y2DD 3L1OH 2Z0BA 2Q6WA 1LP9E 1M1SA 3SDCA 1MWAH 3N9GL 1E4WL 1F4XH 4QXUH 1SJEB 4JFVA 2P8LA 4JM4L 1A7QL 4HIJB 5C2BL 5C2UB 2YR3A 2XXMB 5FCSH 3FQNB 1E3XA 5D96B 3QQ3B 1DSFH 4MNQA 3O2DH 3LY6A 4XH2A 5D7IE 2VC9A 1JTOA 3C6SB 4O2FA 3BW9B 3ZM8A 4CW1B 5GGSY 2XWTB 5LWYL 1VEPA 4JFQB 4RA3A 1XR9B 3BUDA 3AXXA 4XWOC 1TZ7A 1OD9A 1HJQA 1CD9B 1BBJB 3U46B 2P5ED 4NWUH 3KJ4C 3WS3A 1U3HC 2OJZH 1UWQA 4JFZL 3GI8L 1LWRA 2IGTA 3N85L 4PMZA 4JO4H 4WEBH 4UT7H 3T1FA 3U5UA 4PJEF 3GMPB 5D7IF 5T1LA 4ONGL 2XSBA 3W6MA 4UQ9A 4M43H 4AM0B 2Q8XA 2NT0A 2D1ZA 1JZ6A 1OM0A 4JM2F 1B0RA 1ESWA 5M3WA 4NSBA 4Z2KA 4B3LA 4D6GA 5I1HH 1BPVA 4Y7MA 1B30A 1R86A 3ZT5A 2HFEB 1CBGA 4DGVL 2AAAA 1IFHL 3A6OA 4POUB 1VRXA 3TLRA 3AU1A 1R85A 2ADGB 3MA9H 1HYSD 3C9NB 2EO1A 4DUVA 2UV3A 1T2XA 2V5CA 2AKRA 3WN5A 1RP8A 4KAQL 3QIBA 3VFOB 3PGDA 1U8IA 4DO4A 1DN2A 2BNUB 1CZ1A 1MAKA 2F74A 4WKHA 3REVA 5FOOA 3F58L 1H0DB 5LQBL 1E4WH 3BAJA 3N1AA 1ZEAL 3GK8L 3WH9A 4HFWA 5IB3B 4A3HA 4KRPB 4LCWE 4GI6A 3FQWA 2J88H 3EYUH 3NIYA 1SMDA 3VX0A 2WSPA 1IT0A 4MDPA 3QCTL 2BJMH 3STLB 4Q9RH 4AYFA 5L8KB 4PRHD 1ZT7A 4I0PB 4TVDA 1KCRH 5SWZA 3ORJA 1OTUD 3AC0A 2GSIB 1FFNA 3DUUA 1W3LA 4XNYL 4HDIB 1NP2A 2GY5A 1KCSL 1MHPL 3MLTA 3X14B 4JPWL 3RVVD 1MRDL 4F3FA 5T3ZH 3MFGB 3U7WL 5DVLA 4XTRD 4OD2B 4ELMB 2ZNWA 1G9HA 1WJ3A 1A1MB 2VDOL 3ELAT 2AMGA 1S3KH 1U58A 5FGCE 5JMRA 1ERNA 4I5BB 2CPUA 5EFIA 2YPLD 2CRMA 5DMKB 2UUDK 2P5WE 2Q8BH 2AVGA 1ORSB 4ETQB 1EEZB 4X7SL 1PBYA 2BSSB 1N0XL 2OSXA 1RIHH 2EKJA 3NTCL 1OGTB 1KF9B 3HZVA 4F7EB 1OP5H 3BZEA 3I2CH 5IROC 3ZR6A 4K2UL 2QQLL 4HJGB 4HUMB 5JOFB 2ICCA 4Z77A 3LH2H 3HMXA 5C0AA 2HT2C 3GMRB 5FYKH 4GSDH 1BMGA 5F6IB 2YA0A 4FZEL 5I71B 4DK3A 1ACZA 4M1RA 4M6ML 3PWPE 4KKBC 5JHDA 5KSVA 5IMKA 2FJFB 2H8PA 1T21B 3T04D 2VLMD 4BSJA 3GSNB 1T1YB 1U8NA 4I3SL 1W1PA 5A6LA 3G5ZA 1V7MH 1I8MA 3K8KA 3EJZC 5E9DD 1A64A 4X8JB 5CIPH 4PRPA 3RVXD 4KVNH 4EN3A 1NCBH 1QFWM 2R1YB 4YN5A 3TA3D 4WI3A 2HG5B 3QDMA 4MXWH 3AM8C 2D4FA 3QA3B 1RY7B 2CRYA 3OPZH 1UVQA 2WC7A 3PZNA 1DQLH 4YXLH 4NNXA 4KXZH 5MEND 4L5FL 1H3XA 2D7MA 5IKCA 5KVMC 2CK0L 4L4TB 4ELME 3B9AA 1PG7H 3MCKA 2DSZA 4U1MB 1OAKL 5E2UL 1ZSDA 3BP5A 3CTTA 1G1CA 2XUCA 3O6FC 2DH2A 1QPXA 3R06A 2X7LA 2YPKB 3DRQB 1CI5A 2ZIDA 3W0KA 1FZJB 1XAUA 4ZO6A 5TD4A 2VLKD 1MRCL 5ALBH 4GG8B 5E2TH 2C9AA 5DA4A 1TVBA 1MLBA 3ESVF 4HLJA 2VITA 3IGAB 1LO4L 1I3GH 2K3TA 1A47A 5E00B 3HCVB 4HP5A 3UETA 1I1FB 1XFPA 2QR0A 4XBEL 5IFJB 1H15A 4OKVB 5IFHH 1E0OB 1TQBB 2BXZA 3H7LA 5DXWA 4PRPD 1N0LA 1OB1B 5F1IA 2FB4H 1HHHB 4FOMA 3CZSA 2J62A 4NZFA 3AHVA 4S11A 3WKNA 1MCOL 1KLUB 2A74B 3VGAC 1HHJB 3VXUD 1GC1H 3PV6A 5CBAB 5LGJB 3U6RB 4G5ZH 4XI5D 2DQDH 4EIZC 1J0KA 1T7YA 2UZIL 5GQBA 2WUCH 1S9VA 1W9XA 2EDKA 5F9OH 5J0BA 3P4OB 2D7TL 5EZIH 2C4FT 4E5XA 5C0AE 2X4PA 4PTVA 5CBEA 1U8LA 1KENL 1FZMB 4N0FA 3GHEL 4LAQH 4WI7A 3X12A 3C8DA 1WKYA 4YDJB 3E0GA 1I8LA 3STZA 1QRNE 1IGIH 5DZLA 4D9RD 2XQYK 3S3SA 4UDTB 3PL6B 2EABA 4QCEA 5J6HA 3TH4T 2ICWA 1X9QA 2VXSH 4NOBA 4OZGE 4HS3B 4U31A 5GGTA 5TH2B 2W63A 3WJJC 2PXYA 2NX5D 1K5NB 1M01A 1NBQA 1PKQB 1YY9D 1C1EH 4ZFOL 2VT0A 5I3DA 2J79A 5D4QA 3O6FD 1MAJA 4M1CD 1Q38A 1EFXB 3FO0H 5L7XH 4YEFA 4XMLH 4Y16C 2ICWI 1OTSC 3EJYD 1WT5C 1QFPA 1QFUL 5D1QC 3RHWF 2CETA 3HPLA 1BGXH 2XZCL 4PRBB 1HT6A 2W60B 3WXVH 5BZWB 1AGDB 2R4SL 3QI9D 4BJLA 5I1DB 2J8UE 3UJTL 2J5LC 2FDMA 4OFYA 3MPCA 3MBEC 1ACYL 3CNKA 3MXWH 3RNQA 1E4KC 1LNUB 2B0SH 2KKQA 4NRZA 4Y19E 1VJSA 4GRWB 3LV3A 1WITA 4LGPB 3D18B 2XRAL 2XTJE 5DJXA 4ALAL 3WFHA 1C92A 4K7PX 3D3VB 5I1KL 1CLOL 3H9SE 3TPKA 3JTSB 3HRPA 4N9OB 4NO2B 3EYFB 2GK0B 4JANA 3DSFL 3F6IA 3SE8H 3ARTA 5L2JA 1CGUA 1LHZA 1JP5A 1NDMB 1BVLB 4MQ7A 4XNMA 2CIIB 2BSRB 4TSCL 3KPQA 2PW2A 5DJ8A 2Q87A 1J1PL 3AIVA 1FA2A 4QRRA 5DHVA 3QEUA 1Q94B 1MJ7H 2IADB 4R3SA 4N1EA 5F9OL 1XHGA 3LEYH 4MAZA 1WTLA 1DFBL 4EQ2A 4ZXBA 1UM4H 1KFWA 4Z7UB 2HT4D 3ETBF 5EBMB 1Z6JT 3GH4A 3WLWC 5ICZA 1FFOA 5ESVA 3CC1A 2WMJA 3RGVD 2KBGA 3JVGC 1AR1C 1D9KB 5D6CA 3F65A 1JNEA 1NFDF 2V7NB 4RMRA 3ILQD 5H94B 3FO2B 4YHOH 5L2KE 1KPRA 3MJ7A 1P4BL 1FL6B 4YDIH 3BRGC 2C1PB 4LLVB 5DLML 2AS5M 4NKOA 2CIPA 3D52A 3TCLA 4M7JL 1NGQL 2F5BL 4LLYA 2IFGA 1YY9C 4OIFA 4TX6A 4CNIA 4H41A 2IAMB 3N0PB 1X5JA 4R97B 1OWQA 2O9PA 3X13B 4Z6AT 2VDQH 5EO0B 4IRSC 1UH4A 3NH7L 2NY2D 3AISA 3ZTNL 4OCXL 1UD2A 1DEDA 3Q5OA 4L4VB 2G60H 4JFUA 4UFLA 1KGXA 1CLYH 4G80B 1A6TA 2J4GA 1H09A 4LSQL 5T5FH 5H2BA 1S7RA 5DK3A 4G8EB 3S96A 2FLBT 4WY7L 2N56A 2Q7YB 4PS4H 1JK8B 4PPTA 3RL2B 4XRCA 4E8DA 3DHPA 1BJ8A 1XCTA 2IGFH 1K85A 4RMSA 3IJYA 1H3VA 1BX2B 5IB4B 4JQVC 3SO3B 5C07D 3WV0A 4U1GB 4YHLH 3TYFB 4NZJA 3F5JA 5A8QA 1HQRB 1JMXA 1A4JB 2H6PA 1DANT 2SEBA 4Z7UE 5GRXG 1DN0B 4IPNB 1I4FB 2OL3L 3MXVH 4JVPA 3HZKA 4TVPL 1S7WA 3T0EC 2DOCA 1J01A 3C60C 3HE7C 4WDIB 2WHKA 5J89A 1RUMH 5E7FA 1GC1L 4MLSA 5E4EB 5GS2D 1XCXA 2R8SL 2DT0A 4WHDA 2CSPA 1YMMD 3S4SG 4M4PA 1MEXL 4UT6L 2OMBA 1MWAA 2M8XA 2R4SH 1FFRA 3GMNA 1U95A 1E43A 1HKLH 4PRID 3DGGB 2NY6D 2JJSC 3NN8A 1T1ZB 5J1AA 2IH3B 2F54A 3PE9A 5LA2A 4QRQA 5D2LB 3NVQA 3MV9A 4UDUA 4O00A 4ISVA 2D2OA 1OTTD 5C07A 2XG5A 2VX4A 3BVNA 1MRCH 3SJVD 4POZD 5HHQA 4JY4A 2ZKHL 4OZIA 4NHUA 3L3IB 5I1LB 1H3PH 2XA8H 3RWGB 1KV3A 4F33A 1JDCA 1N5AA 2Q86B 3VGGA 1CN4A 4OF3A 1IGIL 3MR9B 3NPSC 3SDCB 4CMHB 1UUQA 1IBGH 1V3IA 5E99L 4RGOL 3LQMA 1NCNA 1HSAB 1X1NA 4PD4K 4MNHB 3ESUF 3WIHH 4W68A 4P46B 3FQNA 1II4E 5BROA 4J3UA 5C09A 3QJHB 4M6OL 1IAOA 4EUPH 4TSCH 2DQDL 1RJZB 3PP3H 4KKNA 4ONFH 2IQ9L 4KVNL 1GONA 1IM9B 1ZAGA 3D4YA 1JN6B 4LEOB 3SDDA 4O2FB 3TJHC 2NNAA 4J23A 4JGJA 1EHLL 2EACA 2MPAL 1I9EA 3UROR 5LQBH 4OTXL 2H2PC 2XWTA 1YC8A 4JFQA 1QI4A 3ARBD 1XR9A 4FTVE 4JFDB 1OAUH 4M4RA 5HGBA 1P2CB 1QR1A 2DDXA 4KVCL 2C1OB 3FHAA 5EU4B 3QNZB 4LPCA 3CLWA 1F8TL 2NCMA 3WHXB 3VXME 3QWOA 2D31A 5C0BE 5E2WH 4O2EA 3V9FA 1FH9A 1UH2A 4Q0XL 3MA9L 3P73B 3HG1D 3JWOL 2DMBA 2WCAA 2P5WD 2VN4A 1CGTA 1W2PA 5BV7B 1UCBL 1X6NA 2I24N 4DEPB 3KPSA 5T1LB 5JTWA 4X4XB 3AS2A 3SDAD 5DHXB 3AS0A 3HI6L 4XXDA 4D8PA 3TVMD 4P2OB 3REWA 1JHKH 4XCCL 3DO7A 5IVZB 3GBNL 1IEBA 2NY4B 3N1FC 4QYOB 4Z78B 2VDNH 3VXNA 1RJYA 3ZE0E 4AL8L 3PNWB 3V7AE 1XH3A 1S7UB 2Z8SA 1QFHA 5TE6L 2BV9A 2VDMH 4JFZH 4OZGB 2QSVA 2YD3A 3P9WB 4Y2DA 1MCJA 3RIFF 3WN5B 4WI6A 5HY9B 4WHYH 5IV2B 2KZWA 5BXPA 1YNTB 4FABL 1GGTA 5A16B 1BZ9A 5BVJA 3FMGL 5BWFA 3AAZA 3BP4B 4PR5B 4IOFC 1NJ9B 1GXEA 1MJ8H 2B5IC 1BYDA 1TQBC 4QTIL 2EDRA 3FQWB 5ESAA 2OWCA 4Q58C 2JELL 3HG1A 2Z93A 5FAAA 1FNFA 4XWGL 3STLA 2E9WA 4LU5L 4X0KB 5E9DB 2P5EB 4KJQC 4W81A 4X0VA 2X4OA 4EOWL 4NQCA 1CICC 3SE3A 2O9OA 3VWJC 4OBSA 2ED8A 3BQUA 1LL4A 2GSIA 1I1AA 1RUAH 4Z18A 4U1LB 3U9UB 4OLUH 3SGEH 1QNRA 1SR0A 2VLLB 4XP1H 3EYPA 2QF8A 5EUOE 2PB1A 4F3FB 3P77B 2CR6A 3F7QA 3PGFH 2WANA 1KTLB 2H2SD 1OAQL 2ZOKA 4U1IA 5C0RH 4JO3H 3ABZA 3MGAA 3IDNB 5ALCL 4EUPA 1FP9A 1NWRA 5AC4A 1I9JL 2X2HA 4JPIA 1QNZL 2Y6SD 3N18A 2IALA 3GH5A 3PTQA 3BRDA 5LA0A 2HFFA 3PL6C 1YEGH 3MROB 1EEZA 1WFNA 4M5ZL 3BWAA 2M26A 5FUOL 2AK1H 5JLZA 5LGKA 3BT2H 1KT2A 4ESKA 1S3KL 4AEIL 2FH8A 2NY0B 1K4CB 4P3DA 1EERB 1OGTA 3HZVB 3K3QA 4O9HH 3ULUL 2EH8L 1TQSA 3KYMA 3W38A 3WNKA 1CU4H 3C5ZC 2ZNXA 2RHEA 5IHBA 4GRLB 5F3BB 3FZUC 1UXSB 2VZTA 5CKAA 2N7AA 4HG4J 1MCNA 4JFEB 1WWCA 1QFOA 1KCRL 3SE4C 3MFFB 4AIXA 2EC9U 3LQZA 3V7AG 1HWHB 3DJ9A 1VFFA 1FIEA 3K4DA 5IHSA 2YPVH 3LN9A 1KLGB 4TNVF 5C8JB 2X89D 3B5GA 2XKUA 1ZLUK 1NFDB 3WN5C 1B9ZA 3SBWC 4XP1L 2D20A 3GXDA 1GH7A 4HUXB 2OI9C 1NCTA 2ICEA 4I9WE 4M7KH 4KY1L 1FVCA 3V6ZA 1FNSL 2OI9B 3F4VA 1TPXB 1XCWA 1JF5A 3EOBB 2LVEA 4W70A 1F3JB 3BPCB 4GMTL 5EUOB 5HI5C 5IKCB 1PZ2A 1YY8A 1GIGH 1A2YA 4HIXH 5HYQA 4FNRA 4N8VG 2O61B 4M6NH 4EI6B 5KVFH 1FPTL 3QFJA 1T04A 3ZKXB 1TQUA 1HSBA 4EBQH 2OCFD 1BOGB 3O45B 3VNYA 1RU9L 3ZKXC 1MHHA 1R75A 1RPQA 4L4JA 3RDTC 3MRKA 5T1KA 3KJ6L 4GG8A 2OLHA 4YHZL 3HKFA 1FG9C 1KN2H 2NY5H 2PO6C 4G9FD 4ZNEA 2EDQA 2IANB 4F2MB 3O9NA 2VLRA 2UYLA 4ZAKD 5IFJA 1K3IA 3BPNC 4S1RH 2EH8H 4JGUA 5GIRB 2DS4A 4KC3B 4X5WA 2PTVA 4LNVA 1W8OA 3P3YA 2ZX5A 1D5ZB 4LGXA 4FQCL 1JNNH 4GW5A 2CKBH 4G8GD 4D0DB 4B50A 1ZVHA 1IKFL 5CPTA 4NRYA 4JO3L 2PR4H 3DXAA 3M45A 5E2JA 2HLAB 3PHOB 3BKML 4CADA 4LCIH 4UOJA 1CFBA 1DBMH 4H88H 5TE4L 5E2VL 2KPNA 1WBYB 2P42B 3ARSA 3VXOA 1KJMB 4BSVB 1I9RL 4GRWH 4NPYA 4BKLB 3JV4B 2CMRH 3O6LL 4EDXA 1PSKL 2IWGA 1U8PB 4XC1L 3VXMD 3AIBA 5MP6L 4XX1E 4LQFL 5EPMB 4KTDL 1KGUA 1AFVL 3L3OA 3WEOA 2J7FA 3PUCA 5I74B 4PMNA 1VFUA 4BQ2A 3P4NA 4PGBB 3DURB 1CF8L 4XBPA 3WMSA 2H9GB 3WXWH 1ZVSA 4IOFD 4ORZC 4QTIH 4OD1H 2EXYC 3ZJ8A 2WW8A 2AXGA 1K5NA 2YBRB 3EYQC 4LNRB 5CJXA 4GQ9H 3KLLA 1AHWB 2K7PA 4X99B 2EDOA 3RGVC 2DKSA 3AREB 1BGGA 4I13B 2YD9A 4FZ8H 1IGJA 3U57A 4KHXH 3HE7B 2WNWA 4HEME 1N8ZB 5LXGH 4TNVK 4M7LT 1AGDA 4U6YB 5I1DA 3QFJE 2YBUA 3FB6B 1IGCL 1MFCH 1IAKB 2ZUMA 3VWKC 4KRMB 4LGRB 1LNUA 1ETZA 4NRZB 3RNQB 5E8PA 2PN5A 3PWUA 1C16B 3VXSE 1XSJA 2PBOA 3NCJL 2FX7H 1N6VA 3O41A 4DFHA 1JPST 1S9XB 3K81A 4EXKA 1CWYA 2HTLC 5K59F 3WN6A 3CUFA 4N0UE 4R8WL 3VFNA 2FBOJ 3D3VA 4WO4D 3QIUA 3JTSA 4UTBL 5L9DH 4BSWA 1P4IL 3ZT7A 2D24A 3JWOH 2X1OA 2VDRH 4YFLF 4P7LA 1DUYA 4NJ9H 4GINA 2VJXA 4FG6D 3FB7B 5ID1B 1CFTA 1HNFA 1DSFL 5K9KB 3SCNA 5DJ8B 3IXAB 1KXTA 1S9YA 3TBVA 4PYGA 2R8SH 5DRNA 1KPVB 1WAAF 4HC1A 5CJQH 1FP8A 12E8L 1OAUL 1CK0H 5A2LH 4FMFA 2FL5B 2APWA 3N06B 3HAEA 1I3RB 2EE6A 1KWGA 4PJ9B 3OGCB 1J8KA 3MODH 2W67A 1U91B 4JFXB 4DQOH 1DBAH 1DL7L 5A40E 5FECB 1B3JA 1FL6A 2YPLB 2JKXA 5ETUA 1J12A 3KS0H 3R0NA 4NKOB 1QRKA 3HMXL 5IB5B 3OJDB 2FBJH 3WJJA 3P2TA 2WMIB 3OKOB 1ONQA 3CFDA 3PHQA 2X4TB 3H0TB 3OKLA 4RFOH 5CKGA 5EO0A 4CU7A 4C83A 1SY6H 4QNPE 1H3PL 1EZVY 2XA8L 4PRHA 5FO9A 2F1BA 1WNOA 3G9VA 5EB8A 1PZ5A 1UWGL 5IBUB 3NCEB 4FFYH 4XVUC 4AG4H 1V3JA 2DDQH 4DKEL 5ADOL 5HYSG 1LILA 4GLRI 4XI5C 4G80A 3CVIH 3LDBB 4M3JA 4MAYA 2C0HA 4OCXH 5A8OA 3B2VL 2VB5A 4XBGA 2BNQB 4TUJA 1N6QL 2CDGA 5DJ0A 3TTSA 5TPWL 5I66B 3VIFA 3C2SA 1FO0B 3IDXH 3AZTA 1MWOA 2R0KL 3RKPA 3QCUH 4AMWA 1W0YT 4I9WD 2OR8A 1NBZB 1DTUA 2CH8A 2HH0L 1U0QA 4OM1H 5INDA 3MA7A 4I0PD 3MJ6A 3VXQB 1QYGL 2X05A 2PW1A 3DX4A 2QHAA 3Q6GL 1PG7W 5CG0A 1T0PB 1WQVT 1U92A 4JFHD 3ILPB 5E5RB 4L8BA 4HKJA 5E94B 2YMXL 2DD8H 3MGTA 1IM9D 4UAOC 2XQBL 4XNZC 3RM4A 1WFUA 1GGBL 3KR3H 4P5KA 4ZUUA 2MANA 2H32H 1T5WA 1V6YA 1YN6B 4JFWA 1JD9A 3DMMD 4X6CB 3IAGC 5DUBB 1A22B 2R1WB 4HPHA 2JALA 5EB9A 4M1GL 3W9DA 2J8GA 1A3LL 1RH9A 1UZ8A 3OJ2C 1LP9B 3MLSL 2CJUL 5J1AB 3MO1B 4LLUB 3KDMB 2V5DA 3W0WB 5C07B 1A5FL 3ARWA 3BZ4A 5C6PB 4IUGA 5IW6B 3FFCA 1PYWA 4Z7OF 3P0YH 2HKHL 3BAKA 5DD0H 3MJ9A 3WXVL 2VAAA 2ZXQA 4H2CA 5LBSH 5D1ZB 1MLCB 2A6DA 4X9HA 2VRJA 2CLVB 1BJMA 1AO7E 4TTDC 1RZJL 2XHYA 1JFQH 1AQHA 5BS0A 5FIPA 4OD3H 1SQ2N 1XGRA 2LABA 1KEGH 4R4BB 4ZO8A 1FSKC 1TIUA 1IGCH 1HXYB 5MEOA 4PJFB 1OM3H 1SY6A 1QA9B 4KU1A 2EZ0D 5EN2B 4GRLC 1U93A 1Q0YL 3VXRD 4YFDB 3UYRL 4DTGL 1U8QA 2IPKA 3H3PL 5A43C 2EIZA 1EA9C 2XN9E 1OD7A 4RFEA 5E6IC 4HWEH 3SQBA 4UT9L 1OT2A 5F7YC 1K2DA 4QF1A 4BQ9A 1QI0A 3IDIB 3OV6A 4W84A 1J5OL 1I7ZB 2K1MA 2UY2A 3B6SB 4WHTA 2YBTA 1OWWA 4KJQD 1D6VH 3RPIB 2WZIA 1Y18B 4D3CH 2LAGB 2R4RH 2DI7A 1UH3A 1NGXA 2Q1EA 4AZ5A 2ITCB 4P2QB 5DD3H 1DLHA 3TESA 1F6AA 3OJVC 4XTRC 1G9EA 3GIZL 3MV8D 1I9RH 5C08A 5IVZA 1X7QB 5TDOB 1FAIH 5ENWA 2P8MB 5D7KD 4D6EA 3BSHA 3UTSE 3PNWA 5EOQH 4HXBL 5IGXH 5ERWB 4JY6A 2GK1A 2E7LC 4OZGA 3U0PB 1B3XA 3GEWB 4BZ2L 4JL1A 1SYVA 2NXZC 3MLWL 5HY9A 2J7HA 2F8VA 2UWEB 2VKXA 5GPRA 4MNLA 1JZ7A 2BY0A 1OP9A 5D7LD 4M7ZC 3IF1A 4KZEH 1EXUB 1T0MA 3MRBA 5KSUA 1FNGA 3MNZA 3KG5A 5BVJB 4QRUB 4OZFG 3BGFB 2X2YA 3NCFB 3RWEA 3BP4A 2RIKA 4PR5A 2BSTB 4PYSA 1ZT4B 5B8CA 3VE0A 5ESAB 1S5IL 1QPKA 5ILTH 3UEQA 3D85B 2X4RB 2W5FA 1IQDA 1RHFA 1QSZA 2VZSA 1MFDL 4NM8H 2F53E 2HFGL 4IRSD 3T2QA 1M4KA 2DWDB 5HGDA 2J6EA 4NCC1 2IH1B 3HC4H 2BVEA 1EX0A 1HILB 3MV8A 4Q9QL 3CZEA 4ZPTA 4UBDC 4U5IA 5E6IB 5EZIL 3NSXA 4LLWA 2XWBA 2WUCL 3O3AA 4EKXA 4PMOA 1YNLH 5IHUH 2VISB 4LSPL 5E8NA 4PJHE 4MB4A 1NANI 4YHML 3IS1X 3H55A 5ANMB 5C8BB 5FCUH 5DD6B 4I18A 5I2IB 2HFFB 3RWDA 4UIKH 2YA1A 3RWCA 3W24A 1FDLH 1B6DA 4C56B 1LWHA 3FN9A 3NZHL 2ZE0A 5E1AB 1WTGT 2VVNA 4NP4H 1MCWM 1OAXH 4RIRB 3LPWA 2GJ6B 3QXTA 3ZKND 1YEFH 5F3BA 1T2QL 1Z0NA 4WTXA 4L1DA 4XB3A 2NY5C 1MF2H 5IVXA 3BKJL 4M8QB 5HBFA 1LO5B 1MFAH 3WH5A 5TQ2L 2R2HA 4QGYA 2CBVA 4V2XA 1WAAA 1KLGA 1NCAH 3TN0C 1JWMA 4PJXE 4HGKC 4JPWH 2F19L 3R1GH 4Q9BA 4JR9L 3FQRA 2ATKA 5FA4A 5DS8A 2ICEB 5TDNA 3VFTA 4BA8A 5DD1L 2WIIA 3N1QC 1ZGLM 1QNZH 3VGDA 2IJ0C 4OCMC 5F7EH 3BWUC 3EOBA 3EFFA 3VI3F 4AEFA 5F88A 3HB3C 5FGBA 5DJ2A 1TJHL 4N90D 3INUH 2DJ4A 1A2YB 4MADA 3APGA 4MQSB 4PV9B 3PGFL 4LHUB 4GKLA 1UWEL 2YK1L 4OBRA 2KDGA 3HNTH 1FDLL 5D7LE 2XN1A 3VINA 3ZIZA 5MEPA 3OF6A 3TJEH 3KE0A 3ZQ9A 1KB3A 3QXDA 3MACH 1CT8B 2EDHA 1T5XB 4N5EC 1ZGLA 2LE9A 1CFQA 1MHHB 2I60L 2J77A 4OF8A 1ZWIA 4JE4B 5GRJH 2A38A 3OQ3B 1LO0L 1F4AA 2EXYD 5EUKB 3NGBC 2W65B 1P7QB 4PRDA 3A6CL 3S5LB 5EOCH 3GSWA 1R8LA 3OLEA 1T66C 1MJJB 3V52H 5EIIA 2A3EA 2YRZA 2C3VB 3HZMA 5HGGS 4KROC 1O5DT 1F00I 3RGHA 1KJ2B 5HNNA 1DCLA 3Q3GA 5GSRA 1F2QA 4BUHA 4D0DA 3CFBB 5EU3B 1QO3A 1F45A 4P59H 1JCKA 3DXAB 3VRJB 5A2KH 5C9JB 3CH1B 4CADB 3BH8B 2DBLH 5EBLA 4Z95L 1NM9A 4R7DB 3S6CA 2RCSH 4OZFB 2XVGA 4WU7A 1MRDH 4LBEA 1VGKA 1KJMA 3EO0B 5F1SA 5CEZL 5DEFB 3TT1L 1TQCB 2EKSB 5E0QA 1BM3H 5M95B 1QBMH 2FATH 1TTGA 4MB5A 4QY8A 4XVSH 1HL8A 4U7KA 3MZGB 5C0ND 4H5SB 2N4IA 2DYPB 5IMMA 3O4OC 3GMMB 3KYOB 4XBPB 1ZS8A 4N8CL 3L5HA 4WTZG 1L7TL 4YDVB 3D0VA 2ITDB 5F9JA 5HGAB 4NC1E 3EOAB 5IT2H 3IT8D 4KZDL 2FJGA 4M6AA 2AXGB 4LNRA 1MNUH 4PGDA 1ODUA 4AJ0A 3HHRB 3ULSA 5A3ID 5AG9A 3MV7A 4HMEA 5H37G 4MQTB 1C5DA 1M6OA 1EHLH 1IL1A 7TAAA 2OTUA 4ZYKB 1G7PB 4MTVA 3HI5H 3MUIA 3UXFA 2WWMD 4M02A 4KK6D 5JHDE 2I26N 3KJ4B 4KTEH 3EJQA 2HVKB 1GGCH 1Z9LA 5D2NE 2H26A 1HHIB 4BYHA 1AQDA 3S98A 4JM2C 2X4UB 2NLJB 1ETZB 5FYJL 5IG7A 5F1OB 2FGLA 1Y0LB 1OGAA 5HTSA 4XCFL 1U33A 1NUGA 3V5DA 3PN8A 1TA3A 3VFNB 5C0BA 5BV7H 3WHE1 4GW1B 4XVUD 1B3WA 2CEQA 4QLLA 3Q5TA 4K71B 4U6VH 5EFFA 5FO8A 5DR5H 1G7HB 3P9MA 4L8DB 3QB7C 1H8OA 3VDBA 4OLYL 3MOAH 5ADPH 4MXVF 4NBYB 4PY7A 1KEGL 1OWRM 4OIAA 1KXTB 3VM7A 3TBVB 4NO3B 4TVCA 1KPVA 1R3JA 2X9YA 4JG1H 2VLJA 2GW5A 2DSWA 1B4JL 5IXEA 5I78A 3RDTD 4PJ9A 3MOBH 3O3BA 3DVIA 2AK4A 2VRQA 1FYTA 2YN3A 3UC0H 5I8CA 1E27A 1G9MC 3OXRA 1NWSA 1CFSA 4MXQC 4ZFZA 1R0AL 4PFEA 4ZPVA 5ETUB 3SCSA 1OT1A 4BQ3A 1H5VA 1PKOA 3UYPA 1YEHH 2B1AH 5DDHA 3BSZL 4NFDA 5BVPL 3A4WA 4Y5VB 2AJXL 4Y4HA 1MWAL 1YNLL 3SOBH 4IIQA 1N64L 1RVFL 3VI4F 3KPOA 5EG6C 3ZE1E 5F8QC 4FP8H 3K1DA 2Q76A 2V5YA 1S9WA 4M48H 3O9WB 3BN3B 1G7IB 4NO0A 3ULVH 3LS5H 4YR6B 4GO8A 3NDZA 2MQ3A 3VXTB 5I79A 1S7TA 3CZJA 5A1AA 1PBGA 5F44A 4N0CD 4U0QB 4LDLB 2VXTL 2Y7QA 5HHOD 3CHFA 4MAYB 1E0WA 3W2DL 1VFBB 3B83A 1SJHB 1VEMA 1NCCL 4ODUA 5I66A 1EUTA 4GBXA 5DJYA 3D3VD 2XOTA 2VL5B 2WW5A 4M1DL 3LKRA 5KS9B 2DWEA 4OCYL 1NBZA 2VQUA 5SWZD 3PWPA 2VX5A 1A9EB 4ZTOH 3KPTA 2AK4D 1KQYA 5ABDE 2C3XA 1S7SA 1UR2A 5JNYA 3I6LE 4G7YL 2AEQH 4M61A 3WHE0 4F58L 1C7TA 4TSAL 3DVNA 3PABB 4ONHB 3RTQB 3V6OE 4AZ6A 2ZG1A 2J47A 4OCWL 4HXBH 1R7OA 3AMDA 3GJEA 5IR1A 4D6FA 1UJ3C 3WEXA 5KS9F 3KZSA 4JFOA 1BQLH 1F13A 2QADC 4GG6F 4Y2DC 5GGVL 1PX4A 2EYTB 1T80A 2R9HC 3IKKA 4IHOB 1ZLVK 5C0DB 1JWUA 3RX7A 1JPFA 2E7CA 3GXIA 2X9XA 3G6AA 1Q9OB 4NJAH 3C5SB 4PRHE 5C0AD 5I24A 2WINB 4OZ4A 1M7IB 2A3HA 2JIXB 1FH8A 3SGJA 3U0TA 1YEDB 3MLZL 3W0WA 3QUYC 4HWUA 1YHTA 5CD5C 1HK6A 4IRZH 1Q4NX 4CVUA 4FNUA 3ARFB 2MCPH 1FNEB 4KPHH 4W6YB 3DETC 4AH2B 5FKPA 4B3KA 4WW1A 1Q0YH 1EO8H 5CIPB 4B15A 4EAMA 3ARFC 3UP1A 2CLVA 4PJ5A 1WC7B 2CLRB 5JZ7D 1Q6CA 2WP3T 1NCCH 4MAYC 2G5BA 5CJQL 4HIIA 5KVEH 1P7KB 1JXKA 4AT6B 4KQ3H 3NZ8A 4P3WA 2WWCA 1OF2B 1NCDH 1JNHA 2FX8L 1W9PA 1GUVA 1BQHA 1B0GB 2CHOA 5ACMA 5GNZA 1B3VA 2Y2WA 1LL7A 1QI5A 1RZJH 2UWEF 1DLFL 1QA9A 4HIEB 4G6JH 5B4MD 3CU1A 5ACZA 3TP4A 2YL5A 5I71C 5AC5A 3GBML 4XHJD 4KI5D 4FQQA 3U82B 1ZJAA 2UY4A 1WLHA 4K7FB 4PJCE 1XR8A 1J18A 3MRRB 4XNQA 5E8DL 1T20A 3K7UA 4D2NA 2VH5L 1K2DB 2BVQB 4PB9H 1MCIA 1H5BA 3VJ6A 4P3CL 4POYA 1R0AH 3CPLA 5C9KA 2CKBB 1WEJL 1US2A 1DE4B 1TZHA 4LK4A 2FH6A 3VWKD 5EO9A 5L8JB 2QLYA 4ZUVB 3VW3L 3B6SA 2VLME 1A7NL 5AAWA 1TITA 3HPJA 5HHPA 2QQNL 2GTWA 4HU8A 3K8MA 1GGUA 2R9HD 4OF7A 2IQAA 3GIVB 3VDHA 5BV7C 5LGHH 3FT4B 1E6ZA 5DK0B 4BQ5A 2DPEA 1A9BA 1U8OA 1EHAA 3DUSB 5I9QB 1T4KB 4YFLI 2X09A 2APXA 4LKXB 4F7TB 2UZIH 3JWDL 1NAMH 4UQEA 4I0PC 3LHPH 1XH0A 4U1JB 3WEZA 4LCUA 3QXVA 4N1CA 1MW3A 2EDNA 1F97A 4KI5F 4HUWA 4J1UB 5BS0E 1KCKA 4LLDA 2AAVA 4HWBH 4XC1H 4HFUL 5I1GH 5E8OB 4H8WC 1AXSB 3P0VL 1T83A 2ZOLA 3CLFH 4PJIB 3KYNA 3WIIH 5TE4H 3TH3T 2A6IA 4BH7A 4J27A 2J4WH 2YEZA 1XGTA 4W85A 5EBGA 1R5WB 3VE0B 4ZDHB 1XH1A 3AIQA 1YDPA 2O9RA 2GYSA 2Y24A 2MKLC 4C7DA 4V1DE 5GJSL 2X4RA 3FRUB 4MA8H 4ODSH 5ALBL 1EGJL 4D9QE 1JIBA 1Z9SA 2EE9A 5FOBB 4O58L 1INEL 4FFZL 3WUFA 2DWDA 5C7XH 3ZO0A 3SCWA 2IH1A 2NZ9D 3JV6B 2J2ZA 5IJVB 2R0WL 3D9AL 3BOVA 5E6IA 1L7TH 1NGZA 2A73B 2Z8RA 3BUQA 4EJ1C 3O3AB 8FABA 1E40A 2W4XA 2VISA 5E8NB 3TBWB 2W9EH 4PLKC 3PZQA 5EOTA 3KPRD 3LIZH 3MGOA 4X6CF 32C2A 1QVOB 3RIAK 1ISZA 3BX7C 4D1IA 1KN4H 1C12B 4QHLA 1KNOA 4MNGA 1RU9H 3BAEL 4U1NB 3CUJA 4S3KA 3S4SA 4G7VL 5E8EA 2R29H 4P4RA 4DW2L 3GB7B 4QHUB 1BFSA 1AP2A 1LGVA 5KVDL 4CMMB 5E1AA 3LXAA 3LQAH 2JK5A 4R0LB 4ACZB 2GJ6A 2IAMC 4GMTH 2NYYD 3IETB 1QBLL 2IPUG 1MCKA 2PYEE 3OKMB 4GUPB 1Z9MA 2Z1SA 4M6MH 5JA9A 2JIEA 1OW0A 1KYOJ 4CVWA 1LO5A 2IBZY 1UD4A 4IISA 4DVBA 3A3HA 3FFDB 3RGVA 3MRCB 3QUKA 4EI5D 3H6JA 43CAB 4DCQA 3MLVH 5CPSA 3QDJD 3GBLA 4WFFD 2GK2A 4Q6IC 1RIUL 4Y4KB 3NFNA 3FQRB 4JGMA 4ZE5A 2AQ2A 3PZIA 4JKPL 1V02E 4UQCA 1L0PA 5I30H 1U36A 1IGTA 1TXKA 5EZLA 4DGYL 3B9KA 4NUGH 4MJIA 4P2QE 3EFFB 4W86A 3VILA 3AM8A 1IQWL 3U30C 5ID0B 1CGSL 1OAZH 4Y1AD 3TBTA 4PV9A 5BV7L 2XWJB 1MIML 3QPXH 1G9NL 3HNVH 4R90L 3O11A 4XGZA 2YDQA 1ORQB 1I3VA 3U30B 1HIML 1YEGL 5FUOH 1JGVH 5D72H 1CT8A 2V38A 1QI2A 1ZGLB 4QTHA 2FSEB 5MI0B 2F61A 2PF6A 4CCCA 4OQ1A 2WYSA 5EWIL 3V79C 1KELH 4PN2A 5EIVA 1GOHA 2F19H 4D94A 3Q6FB 1ZLWK 1E6RA 4E8CA 4GKNB 1GJIA 2YLLA 5D1XD 1OSZB 2ZG3A 4OIIH 1CDBA 1Q9LB 5CILH 5D93C 4Z7WA 1BLIA 4F15B 3VGFA 1TETL 4JPKL 2BNQD 2IAMD 1MF2L 5DVNA 3BLPX 4RWYL 5ICYB 3CHDA 5D2LE 3TA3C 3ZT6A 4JHAH 5DUMH 3PBGA 2F53B 3BXWA 1WWBX 1OAXL 1HH9A 4UNIA 4DWSD 1FG2A 2F5AH 5CP3H 5C9JA 5KOVC 3QUXA 3RUGA 3V6FB 3NZHH 5IMLA 2XXCB 2Z4QB 4WU7B 3UBXB 3W9EA 4NQSB 3L3JA 2PYEA 1UA7A 4MAUH 4RQQB 3ZE2F 2YRPA 4RWYH 1JVKA 4GG6A 2DQTH 2VLKB 2XTJC 3OAYK 4NUJB 2V3DA 1MSPA 3EAKA 4NQEE 4Z95H 5GS1C 4AY0A 1UB6A 3KPMA 3G08B 3RI5F 2BHUA 2NY3D 5DD5H 3TJEL 2VDNL 1PZUB 1C8QA 1VACA 3VA2C 2XFYA 3EOAA 2FJGB 2ZZUT 3OBAA 3UESA 1V02A 3TBYB 1FLTX 4G9FA 4LLQA 1PG7X 1GCYA 2FD6H 3OKDA 4HS8H 4QOKB 4L3EA 1FZKA 4ZAKA 3DX6B 2HJLB 2ZXBA 1PX8A 4PRNA 3WL1A 3LKQB 1HZHL 3OR7A 4ZYKA 5BOZG 2AEPH 4F9PA 4FXGA 4OGAC 4R4NC 2R0LH 2E7HA 1HHIA 4I3GA 1BEYH 2Q7NA 1KBGH 1HOCB 2I60H 4GOSA 3P11H 1NCAL 3OZ9H 3HUJE 1JNLH 1VJZA 2XYLA 2UZXB 4P2OC 1TA3B 2L7JA 5I16B 4JDTH 2JB5H 4E42A 5DRWB 5D7JD 4X5XA 1T2QH 1MHEA 4MJ6A 4PJEA 4UU9A 2A0LC 4OGXH 5SX5H 3P0VH 1LK3L 1SEQL 2BOBA 1KBKA 3CZFA 3U48A 5CJOH 1IBGL 3C6LA 4TOYL 2A3BA 2WB5A 4U1SB 4V28A 5LKNA 1DBBL 2GEEA 3CFJA 1RURH 3IJSB 3QJFB 4YHMH 5D5MA 5JW4M 2H45A 1BYBA 2Q6WB 4AEIH 1P69B 2VABB 3AXHA 1SJEA 3RILA 2LAAA 2PWFA 3H54A 2F1AA 5HOSA 4H20L 3UTSD 1E27B 3NPSB 4RWHA 2P24B 3FO1A 1FO0H 1JYVA 4ODWA 1TJGH 2WHMA 2R29L 1J88A 2UVFA 3CUPB 1A3HA 3FTGA 2MMXA 1HKLL 1AGFB 3H3PH 4KROD 3GNPA 3P4LA 1Q6GA 3LIZL 3F5WB 5FXCH 1A0QL 5A6BD 4DKDC 3ALXA 5HHNA 3SE4A 3GKZA 4Y5YA 4CAGA 5E0CA 4Q2ZB 2PO6D 1MFBH 2ADJA 1GGIH 4PJGE 3HE6C 3QDGE 4OD3L 2WWKT 3KNBA 2CXGA 1IC5L 4ACYA 4DJMA 3MI6A 5HDOA 5C0BD 3H42H 3L4ZA 5GGSA 3MLVL 5CWSB 3SDAB 3QUYD 5D7KE 1OINA 5MHSE 4HKBB 2OL3H 4M93C 4U7MA 1R47A 4RBPK 4PJHA 3DVGB 5GGRY 3WLWD 5C0NC 3PWPB 3M6DA 5DQ9B 1B0RB 2DM7A 4KQ4L 3PDGA 2YS4A 3OSKA 2WMFA 3V5HB 3HUJA 1KXQE 1QSFD 4S1QL 1TETH 1XGPA 4JPKH 4YHNA 5BXRA 3MLSH 4FLRA 4QRPB 3NCCB 4G6ML 4NC1C 2ADGA 1FIGL 3C9NA 4POZC 4AL8H 3QQ4A 3QUMH 1Z9OA 3RDTA 5KVDH 2GCYB 3VUPA 3BVWA 1F3DH 4RX4D 1E4XI 2DKMA 1CFVH 2XGBA 4DWSC 2B5IB 4X7DC 3VH8G 4GPNA 5H35A 1CE1L 5BJTA 2EYTA 5HDBE 4OGYL 3TWCL 1C5BH 5GGUA 1RJCA 4TUFA 3BAXA 4TUOB 2X2IA 2AABL 5A8PA 4OUEA 1JPFB 5L88L 2QHLA 4NJAL 1DEEA 2XPGA 4FLQA 1UKSA 3G6AB 1Q9OA 4BUGA 4GO6B 5F6HI 3U2SB 4Y4KD 4WFFE 4LRNL 1WWAX 4FXKA 1R24A 4XVJL 3PWLB 2XKNA 1A7NH 5HPMB 1GOFA 5DGQA 5E1HB 5DD3L 4BA0A 4ZNEE 1YYMH 1KC5H 2R1XB 4UZGA 3DX7B 1DUZB 2H1PL 1RV6X 2XZAH 4NRRA 2CCRA 4OUUA 4WW1B 3D5HA 5E8DH 3V6BR 5M7QA 4CVZB 4ZOEA 1U58B 2J8OA 3MRDA 1WC7A 5E09A 5ABFB 5E4IA 3PQYD 2BDNL 4HIIB 5EFIB 4S10A 1Q9KA 1F2XK 1BQHB 1ORSA 4DKEH 5ADOH 5JXED 2CUIA 3WCYA 1S5HB 2XWEA 2YD2A 2BSSA 2N1KA 1NDGB 4WIQA 5HJ3A 1UWIA 5FHBL 2YKKA 2C7FA 2C26A 2GAZA 1JJUA 4GKSA 1JMZA 1MCDA 4WUUE 4KTYA 4MXQD 3SKMB 2DLFH 3W5NA 4RFOL 3WFCH 5ABEA 4D6CA 1INQA 2DL2A 1R5IA 1UKOA 1G0YR 3GMRA 1RZ8A 5ITBL 4NKIH 5GRYA 3C5ZB 2BVQA 1CG9A 4PSPA 2FJFA 1HINH 2H8PB 3QRFM 1CXEA 5EOCJ 2OK0H 5D9OA 3CXHJ 4QXTA 2JEPA 5J06A 3GSVB 2VMFA 4HWZB 3IFNH 1KN4L 3H3KA 1EOKA 3G5ZB 4EN3C 2YOCA 3HRZB 1S8DB 4X8JA 5JOEA 3HI1B 4RFNC 3E2HC 4MJ2A 4N0RA 3BP7B 3VW3H 4HK0B 1UM5H 2OW7A 4EN3B 2HG5A 3QDMB 3PZ9A 2HVJA 3D9AH 1G7LA 1OD8A 1BFOB 2WNGA 2O92A 1C1EL 4PJ7F 4MCZA 3UX9B 1E4MM 4G8GA 4ATDA 3DUSA 1UWRA 2O5ZH 4PRIA 5KZCD 3LMJL 4NQEB 4FNLH 4AD4A 4F7TA 5EFDA 3NIDE 1BQCA 4FTVB 4K8RL 4RDQG 3TBSA 3PXJA 4BH8A 4AZ7A 4HUWB 3UTPD 1NEZA 4LLDB 4P9ML 4ENED 3QFDB 4L3CA 3TNMA 2OK0L 1UD6A 3UTTA 3ES6A 5IMOA 4GAJH 2FX8H 5A6KA 1Q6EA 4PLOB 4HS6B 3K2UL 1UWTA 3I3EA 5KAQG 2DJUA 3VVGA 1CFNA 3EYVA 1GNXA 5D6DC 3TCXA 1YDPB 1S7XA 1TE1A 4IMKA 2EXOA 1XGYL 1PKQE 4M1DH 5FYJE 4FA8A 1X5ZA 1B3YA 1V3HA 3VFGH 1E28A 2MCPL 3S2CA 4RMVA 3MMEB 3SKJL 4H26A 2XZQL 4HAGA 3FZUD 1TNNA 3G6JE 3FY1A 1WUNT 4OV5A 1KLUA 3MRNA 2A74A 3EDJA 3K0WA 4FQXD 2F15A 4PRPE 2QMKA 4KTEL 3U6RA 5LGJA 5DEGA 3IYLW 4P9HH 1G6RH 1N6QH 2MHAA 4NYLA 4NNPL 5AYUL 2AJSL 1KIPB 4A6YA 4HD9A 5SV4A 2XG9A 2X4PB 2VURA 1EQPA 4YBLC 4YDIL 5FV1L 5A2CA 4FQ2L 4YHOL 1WV7T 1UWGH 3X12B 1U8KB 5HPCA 1E0VA 1QFWL 1L8NA 1MCLA 3DV6A 4ZXOA 1FBIH 3CMOH 3HG3A 4MDIB 3VXSB 3SO3C 3Q0HA 1W72B 2V5RA 1UENA 3U1SL 2QMJA 1CWVA 3AYSA 3CFIC 2EDBA 3LEYL 3BMWA 2ORBH 4UTBH 3IETA 4F58H 4PMRA 4K7PY 5FB8B 4NWTH 2EXWC 4LSSH 4AD5A 1JNNL 2DLGA 5JPNA 4XHJC 1OIFA 3OL2A 1VENA 1F11A 3BFOA 3IJHA 2HT2D 2HWZL 3H8NA 3FFDA 2AI0H 1HI6B 5GRVK 1T89A 1L7IH 3RGVB 3H9SB 2XQYG 3LDBC 4LARH 4G6MH 4D9LL 3VX1A 2XPKA 1R7AA 3BPOB 5B38B 4NQDE 5D7LB 4D1JA 1S9KC 4P59L 4PTTA 4ODTL 2X4SB 3NFNB 1J0JA 1RSFA 4X80H 5CPQA 4JZ5A 4M29A 2D0GA 2GUOB 4IOIB 1E1FA 2JJTA 4KI5E 4MA7H 5GJTH 4X7CC 3U7YH 5ID0A 3W27A 4FP8L 3PZOA 1CDHA 2BVPB 5HYFA 4MGXA 3WXWL 1TZGH 1BVLA 1L0QA 4MQ7B 4G6KH 4GLRH 4XMLL 3NFPB 2FX7L 3D39E 3L4YA 2BSRA 1YZZA 1BAGA 1PD6A 2VX7A 1NLBL 4H0HB 1U9KA 5DHVB 2W0FB 5I77A 4ZFOB 5KVGH 3DECA 5JPMA 2R15A 3JVGA 2XN9D 1RZKL 3LKSB 4CMHC 4Z0XA 2O5XH 4NQXA 2OMNA 1A7PL 4EXPX 2GUYA 4IEFB 4KK9D 4LSTH 2VO5A 2FR4B 2DICA 5L88H 1Q9LA 4LMQE 5C0CB 1URLA 2PR4L 4UIMA 4ZNCD 1XF3B 3IXTA 1PAMA 4GQ9L 1HJSA 4OD1L 4HX1B 1G6RA 3QDJB 5B21A 1HXJA 1X5IA 5I8OL 4LCWA 1YEKH 4NGHH 4NZTL 2F53A 5A6JA 4NQDB 4ZTOL 4HQQH 1FG2B 2Y5TA 4JJHA 1AFVH 1OW0C 1W72L 2JB6A 3VD3A 1FGNH 1WVZA 3RZCC 2AGJH 4QLKA 4WW2A 5IMLB 1TQTA 4JKWA 1Q6FA 2GJZB 1EPFA 5JW5B 3RHWK 3EO9L 1KSRA 2BMKB 1ZA3B 3K74B 3KLHD 2D3LA 1QQDB 3AXIA 4PLKD 2G3MA 4FK9A 4RRPG 5BRZB 3RL2A 3BKMH 2XN9A 5IESL 2J8FA 3GSOB 1I3GL 2X0HA 3F12B 1U8JB 1BX2A 5KVFL 1KB5A 2YN5A 3TYFA 5TDPA 3OZ9L 3VA6A 4WKFA 4O4YL 5GRJL 1I1RA 2D03L 4WVRA 5KN5B 3IDMB 3AUVA 3QEQE 4IRJB 3TA9A 4LU5H 4PRNB 4PREB 3MACL 4XNZB 3OMZA 2YXFA 4WUUB 4OI8A 4YHPA 1ISWA 4BS0A 4ZS7L 5T1KD 3SDXA 1HWGB 1UJ3A 1R3LA 3CX5K 2VZ1A 2GQHA 4X6FA 5GISL 4Q7DA 3PZVA 4X6BA 3VOCA 4UQ2B 5GRUL 4OZHA 3BVTA 5I75C 3MBED 4LLMB 2GJXB 3UG4A 3ZZ1A 3C08H 1A6WL 3DIFA 4I8DA 1YA5A 4GRMB 4UU9B 3MRMA 1A6AA 2PNDA 4QXGH 4TRPH 4ISVB 4QRSA 2QQQA 2OZ4L 3DXAD 4OLXH 1D3CA 1ZHLA 4XCFH 1WBZB 2IBGA 3VFWA 3IKCB 3CFJB 1NAMB 2YZ1A 2X4NA 2QSCL 3WSQH 1LEGB 3WD2A 5ELIA 3IFLH 3QJFA 2OL3B 4DEPC 2P5EE 3V8CA 2YPVL 4YO0B 2Y8KA 1DHKA 3VNZA 4NP4L 4OF5A 1KIQB 4J4PD 3DRTB 1A6VH 2LTQB 3L7EB 2D7PA 4U05A 1JNLL 4WJ5A 3DX9B 4KJPD 2GITB 3B8YA 2OR7A 1WDSA 2VDOH 1JWSB 4ZSOB 1FGNL 1JXJA 3RBSA 4Q9CA 1VSCA 2RGMA 3BXNA 4Y16D 5L0QB 2Y5EA 4OFKA 4N8CH 4JZJC 5JR1H 4X7TA 5D1QD 2IUZA 4BQBA 1YUHA 4AD0A 1UEMA 2JELH 2AJZB 5F8RC 3MREB 5DF0A 3V5KB 4Z2JA 3TN0A 1TENA 2ADJB 3DBXB 3QNZA 1F02I 5C0IB 4JJ5B 2B4CH 4FG6C 1H5BC 1QBML 2VE6A 1TTFA 3A67H 3BH4A 4RRPA 1KGWA 3W81A 4Z7QE 3KXFB 3KPSB 4FMKA 5EDXA 1FC1A 4X6CE 1P4LA 1S5IH 1ZT1A 3SKOA 7CGTA 2P7TB 4JRXE 4D8PB 1KOAA 4P2OA 3GM0A 2VLJD 2GJRA 3F62A 1C5CL 4NNPH 5AYUH 3DO7B 1XYZA 2EH7H 5DK2A 1D5MB 3CCHA 3HUJB 5I6XB 1RJYB 4TPRH 1XGPB 1LG2A 1E4XH 2BNRB 3HI6H 5F72S 2EDTA 5FDYA 1DANU 3V52L 4MMXC 5LBSL 5CGMA 1D9KD 3WH8A 4Z2HA 3RDTB 2EICA 2VXVH 2E9LA 3RWJA 1AR1D 1FAIL 1LEIB 1AO7B 3LEVH 3T0AA 5FYLE 5K9QG 1T7ZA 4EI5A 5D2LF 5IFPA 1GZPA 3AXLA 1T83C 4RGND 5CILL 3IJ7A 2Z93B 3LD8C 3MU7A 5DI8B 2OSYA 3I6KB 3TIDA 1T6WA 25C8H 4YHKL 2P5EA 4NWUL 4OCRL 1F6LL 1IAMA 4CD6A 3S6TA 1TUXA 3RFZC 1NL0L 1CDGA 5EBWB 5KBNC 5MEQB 3BKYH 2X10A 1XV8A 3QUYB 1HDMB 1N59B 2YDSA 3MRJA 2EYRA 5D72L 5DD1H 4ELKB 4R7NA 5ABHA 3VXMB 2O5ZL 4YBLB 3HE6A 1S7QA 1UQSA 4RAUA 3MRDB 2HRPH 3BIBX 3VG9B 4EUPB 5BMFL 3GDBA 3RL1A 1LG1A 1HN1A 3LRLA 4KK5C 4PB0L 3TIEA 1QTYT 3MROA 4LVHB 5T3XH 3W25A 2FHBA 3IRPX 1O0VA 1HH6B 4O2CA 1LEKB 3ZDZF 1FYTE 1G7JB 3LRMA 4GKSB 3ROOB 3UPRB 2ADIB 4MNQD 5ECUA 3SKMA 5J11C 5EOQL 1BZ7B 1CNVA 3GXNA 1J1OL 4BZYA 4HWBA 4X6EA 3RVTC 4MDOA 4OT1H 4Z2GA 1W1YA 4QT5A 3MFFA 4HOXA 1YPZA 4YXHH 1BLNB 3P0YL 3O6MH 1P4BH 3CDGA 4NKDB 2D9QB 4UT6H 1W1TA 2IBBA 3QIWD 4HTYA 1UFUA 4QFUA 3VFGL 2UWEE 2PTTA 4K8RC 3O6KL 2NY7H 1E6QM 2H3NB 5GS0C 2DH3A 3VWKB 1A1NB 5B39B 3LPPA 4ZXLA 1JUFB 3B5TA 2NY6B 4RSVA 3R8QA 5AZEH 4U5KA 1EAPA 1M05A 5T5NF 5ICXB 4M1GH 4PJCF 4OT1L 4PJFE 3PP3K 2HP4A 3E6FB 5HBBA 1KJ2H 3T0XA 4DVRH 3OAUH 1NKRA 4HJ0D 4G8GB 3CUGA 1OLZA 1BIIB 5EUOA 4LHUD 1VGEL 5IK3A 1YY8B 4UV4L 4XAWH 4NN5C 1F58H 2V2TA 2F7OA 2JF6A 3ARQA 3QFJB 1JPGB 4B7IA 1QACA 3L95A 3QO1A 2DD8L 4PCTA 1GQIA 4BH8B 1NPUA 4AXNA 2FO4B 2XM2A 3QEQD 3UTTB 3EJTA 4JIEA 2VH5H 4EVNA 5HVFB 1YEEL 3J7HA 5DT5A 3MV8E 1AE6L 4ODVL 4XPFH 1QZ1A 4LASL 4APQA 4F2MA 4PLJC 4MNJA 3O4LE 1JRHH 2VLRB 5EC2B 2NY3B 4DGIL 5DT1L 1M7DA 3TWCH 5A2FA 1I8KA 4TVUA 1QLRB 1CE1H 5LA1A 5IGXL 2YUVA 4YX2L 2PCPA 3X17A 3MANA 3MNWB 5TPWH 1HINL 1OPGH 4IIQC 3MRHA 3T4YB 3TC9A 3QH3B 5J6GA 2IXVA 1ADQL 4OV5B 5TQ0H 5DMJB 1XF2A 2DQUL 5E24E 4X4ME 4JPVL 1MQ8A 1A1OA 2DLFL 5F9DC 3TA3A 3SUSA 3LRGA 4X5LA 3EMZA 3O6KH 4PJ8B 4D0CA 1BD2E 4FTVD 2HRLA 1OPGL 5FHBH 3JUYA 4LVNB 4YUEL 4XP6H 3PXHA 4BKLA 4EDXB 3EOTL 4G8GE 3VMPA 2X44D 2J3SA 3IRZA 1JPTH 5DZOA 5HI3D 1N7ML 2ZWYA 2Z35B 3HG1E 1QW8A 3NH7H 2BDNH 3QWRD 3PF2A 1J8HD 3DV6B 4PJAF 3S88L 4OZOA 3M1BA 3OKEA 3RKDD 3P4NB 4PGBA 1OTUC 1JV5A 1LDPL 4X6DF 4JDVA 1E9LA 3AIUA 4XUYA 5D5ME 3I9GL 1ZK9A 2AEWA 3ROLB 4AZ8A 3O4OB 4KRTA 2YBRA 4UQ3A 4EEEA 1CGVA 1WFOA 5HDQL 3U36B 4ZODA 4X99A 3DX1A 3PWPD 1JHTB 4PB0H 1QYGH 3GXTA 5MERA 4ODXB 2HFEA 3T3ME 1IGJB 2ICWJ 1F11B 5FDWA 1S7VB 2VLRE 4PB9L 4C54A 3AU1B 3WDPP 3F8UB 5IF0B 4PGJA 2OZ4A 2B0SL 1N8ZA 1LDPH 4YDKH 1OGGA 2G3JA 4ATLA 1TZIB 3IDJB 3OAZH 3TZVB 4B9YA 5LYRA 4U6YA 1HJUA 2IPTL 1GHFH 5D7LA 4LHJB 4AENB 4WKAA 3VFOA 4L8CB 1U8IB 1IAKA 5E2TL 4G6JL 3VRLF 5I75B 3RJYA 4JZNA 4H1LG 5D6DA 3WBAA 4K71C 3BSGA 2BK8A 2P43B 4KROB 5JUEH 2HMID 5J56B 4TQEL 3SGDH 4FNQA 5I2UA 5ITFB 1PG7L 5FF6B 3VGBA 4LPUA 4Z8FH 3RTQC 2V17L 4PJBA 2J7GA 3JXAA 3V0VA 2XICA 1A7BA 3OXSB 4GAFB 4HT1L 3RY6A 2BNQE 2RR3A 1TVDA 2FJHA 5ESQB 2DSKA 4PGZA 3LRKA 4Z7VE 4KQ4H 2W0FA 5T3ZD 3BDYH 3MJ8B 2AJVL 2JB5L 4TYUA 1JNJA 3N13A 1A1MA 2D7TH 3NACL 4YXKL 2XFXB 1MUJA 2AJXH 2F58H 3FB5A 1NAKH 4OI9A 4BFEA 4I4WB 2DAVA 4O5LH 4TPRL 3CMJA 4HPYH 4XAKD 4LP4A 5HHMD 4MD0B 3T77A 4UIMB 1QLFB 2YPLA 4YFEA 1GAFH 4TRPL 2XVKA 3E8UL 2F8QA 3HZYB 5FUCC 2BOCA 4OKDA 4V1DA 4FZEH 3ARXA 5MP6H 5IB5A 2WQRA 3OJDA 5ISZE 4X6DE 1E6JL 3FFCD 4UFMA 4I48B 2VXSL 3BZEB 3AMCA 3EFDH 3OKLB 3K4AA 3TFKD 4HJGA 4PJIF 1WF5A 3N9KA 4HA4A 2J25A 1DWGM 1NQBA 3VO0A 3QBTB 5GRUH 4NN7C 4UV4H 3NTCH 4OCWH 3H9YA 3NCYP 1W0VB 1NLDH 1IKFH 5IMKB 1JGDB 1T21A 2BMKA 1IGYB 1WK0A 2YFNA 2X4QA 4LCCA 1U8NB 3KVQA 1BFTA 3QSKB 1I8MB 2XJ7A 3RNKA 5GS1B 1P1ZB 1TG7A 4NZRH 4F9JA 3D0LB 1C7SA 1JAKA 1GRWA 1A7OH 5CSZB 2WAHA 3OJMB 1U8JA 3W0WD 5E2UH 3NA9H 4XPTH 1KB5B 2XACC 3WD1A 1OP3K 1PW3A 1T66D 3QZWA 1UVQB 4L5FH 5KSAA 2GI7A 3KJ6H 3C2AH 3V6OA 2WKLA 2X9WA 1KJ3L 3AS1A 5SWQA 4JFTA 1PS3A 1H0IA 1A7RH 1HKJA 1BZQK 1OCQA 4PJ5D 2ZUWA 3IFLL 3WL9B 4WUUA 3MGTB 4YHPB 4FN0A 1B0WA 3R06B 1HIZA 1AC0A 4G43A 5EA0H 3SDXB 3FXYA 3WSUA 1UHVA 4I0CC 2GVYA 1R3LB 2EBNA 5HVHB 5DMIL 4OM0H 1E72M 1YN6A 2HTKD 2CMRL 1EFXD 5EU7C 4NKQB 2VC2H 3VGHA 1KUMA 2E7MA 2PETA 2XTLA 3EYSL 4XWGH 4A2MA 4XZWA 4KY1H 1SM3L 5HYEA 4QHKI 4J7RA 4OZIF 1RULL 2CK0H 3CFEB 2B4CL 5SWZE 3I84A 1LP9A 3MRMB 1MHCB 5FGCB 4XVSL 3GGWB 4OQTH 5JDSB 3KAAA 4BF7A 1EVTC 3TF7C 1JGVL 6TAAA 1FYHB 1T6VN 1PYWB 4H8VA 1I8IB 2AJ3B 1F4YH 3IKCA 5KANI 1LF1A 1NAMA 3UBXI 1SMOA 1NQ6A 1J87A 1OL0A 2OYLA 3A24A 3WD0A 3O3EB 5I8KL 1S9VB 4Y4FC 4WUUD 4E5XB 4DGYH 1U8LB 3BGMA 4LPVA 4URIA 1XGRB 4O4YH 1FNAA 3L7EA 5GZNC 1Z5LB 4MAUL 5JO5A 2WCSA 3MRQA 5EH1A 1LLOA 4WJ5B 3STZB 5A2AA 4QNPF 3VIGA 4UDTA 1H49A 1KCVL 4Q22A