1CXKA

Complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxkA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxkA01
1F97A 2XGBA 5BV7H 3T0WA 4FFWD 5EC2A 2C8NA 1FCGA 4JQVA 3ULVL 3NIGF 2EH7H 3LEVH 2R1WA 2ZWLT 4X7DC 2NY3C 1EEQA 4J23A 3QEQA 2EO7A 3WIJA 4GBXA 1A2YB 3OKMB 4PJEB 3WIHH 5KG9A 1VFBA 1T21B 3CSBA 3FAWA 1CGVA 4YDIL 3H42L 4OM1H 4PGEA 1JGVH 4NX0A 5CGTA 5CILH 1PFCA 4PTTA 1T0OA 4P46D 1RUKH 3P0YH 2FGZA 4OB5H 5T33L 1TJGL 3QQ3B 3EYOB 3T8XA 1KIRA 1RJLA 4OLWH 1NGXB 4QHUB 1KBGH 4LPCA 3O45A 4GMTH 3DNKA 4X5XA 1GGCH 1BD2B 1EGJH 1WDRA 1FVEA 4K68A 1Q9LB 4BSJA 5C0IB 2VZSA 1BZ9A 4HLJA 32C2B 3SDCB 3QG6A 1KXQE 1DQDH 5E1AA 3U0TB 4GG6A 5GGUB 3NIDE 3MMWA 5GS0H 1HXMB 1E3XA 4RNRA 5IQ7H 4EDXB 1D5ZB 4NWTH 5C0AA 3CFJA 3NCEB 4M8UA 3BN3B 4O4YL 4OD3L 5FM5M 4Q58C 3VD7A 3O2DL 1E4KC 3LKOA 1XIWB 1IGMH 3L3KB 4CVZB 1BBJA 4FZ8L 2HFGL 2WWKO 4D3CL 1A9BB 3R06A 5EN2A 2R9HC 3H9SA 4ZYKA 5D9SA 2Z8WC 4YQXL 3DETC 3NCBB 1A6VH 4Z78A 4H41A 3HZ3A 1OB0A 2VL5B 2GAZB 5D2LB 2F54A 1P7QD 1PG7L 1VFFA 3U57A 1NBZA 1R33A 4NC2B 4YXLH 2XUCA 1D5BB 2EYRB 1DVFD 1JNLL 5IMMB 1PEZA 4A6YB 1KXTA 4U0RC 1XT5A 4JQIL 4PV9A 4ONFH 5E94A 4JDVA 3QULA 3HR6A 5C0FA 4Z7OE 5I1AA 2UYLB 4U1HB 3V6FA 1HYRC 3KPSB 4RMUA 5CJQL 4V1DD 1XSIA 4JZJA 4ELMB 1LK3H 3JVGA 4B5EA 4Y4HD 2ZP0T 1QWNA 3WN6A 2OZ4H 4IEFB 3EO9H 3FB8A 5EPMA 1EDGA 4P2QD 2V17H 4Y16B 4KROB 3SKMB 1NWRA 4OAWA 4NKIL 4HUVA 1L7IL 3ZTJG 2GJZB 5J6GA 2FO1A 1BQLH 3MNWB 1E5JA 1U8MB 3VA6A 3UESA 4UQBA 1KPRB 4KFZC 2R1XB 5C09E 3SOBH 2YZ8A 3VFWA 2F7OA 1JPSL 1XCWA 4D9LH 4Y4KD 3IFOB 1EQCA 4LLVA 4O2FA 1ZHLB 5EC1B 1OTTD 1UG6A 4M8QA 4Y5VC 2HT2C 5C8JB 5IFAL 1JF1A 4Z76A 2P8PA 4L8DA 2JIWA 3V52H 2PF6A 1MFAL 5F1SA 1LLOA 4QTIL 3VIMA 1X5XA 3CXHK 1VPOH 3FRUB 3HG1B 3WNPA 3Q1SH 3HPLB 1JF5A 2GK0B 1OSZB 2YC1A 3BQUD 3HA0A 1OPGL 1DEEA 1ADQH 3F5LA 2JFEX 3PZMA 4A2LA 4M4RA 2X89A 4LCCA 2VOTA 4HIJB 4YDJB 3WELA 3JUGA 5EU5B 2YK1H 3KPPB 5AZEL 3B5GA 1LNUA 2FIKA 5LAXB 4JQXC 1GGUA 4FXKA 2O5YH 2A83B 4R2GC 2HT4C 3GSVA 3WSQH 4Y1AB 1E4LA 3PQYE 1N5YL 2J88H 3UTQA 1YC7A 4FQJH 4JFYA 2H2SD 4D8PB 3QNZA 4I3RH 4DKFL 5EBLB 1D5MB 1KTLB 3KXFD 1R8LA 1LO0L 3NOIA 4KVCL 4I0KA 4FQ2L 4IRZL 5CJ8A 3VFVB 1VEOA 4W8BA 5EA0H 1G5AA 3ALXA 4YFLI 4UAOC 1MCFA 4NCC1 2Z8VC 5C70A 2EEAA 5ABHA 4Z7UE 5LA2A 2CLRB 4NQXA 3QIBD 1WFTA 5C8BB 5C0BA 1ZXQA 4PPTA 3TFKD 4AZIA 4KI5D 1KB9J 1C8PA 3RNKA 2D7MA 3HG3A 1QBML 2R0WH 2FLBT 3SY0A 3RPIB 4EUPB 4QOKD 1T7XA 5CSGA 1UACL 5KW9L 3L9RA 3U82B 2BMKB 1XGYL 1IRAY 4MDIA 7FABL 4MAYB 3WS3B 3B3IB 4D72A 4PTMA 2OJEA 3TT3H 2AEPH 2VXVL 2XN9E 4LKCB 1GOIA 2M2DA 3IETA 4NBYB 4EUPG 1UWQA 3F6LA 2YUVA 4XP5H 1RUML 1RIVH 3ZDZF 5J06A 2R69H 4JHBA 3TP4A 3HZYA 4D3CH 1AXTL 3CHCA 5C07D 1I75A 2DB8A 2XWTB 1V5JA 4J12A 5CCKL 5CINH 1N7MH 1C92A 1MH5B 3VSUA 3AREB 3WUGA 4J4PA 1DUYA 2EQDA 3RNQB 2B0SL 3UP1A 4NM4L 1H49A 1F11B 1JGUH 3H3PH 4AD4A 1WB0A 3TNMA 3SPVA 2X4QA 3WF2A 4IS6A 1KT2A 4YJZL 4GAYA 2X42A 4NQED 1RAMA 1VGEH 2Y23A 5I66B 1GZJA 1RZIB 2VAAB 3GMOA 1UWXH 5LWYL 1M53A 2F74B 5ADOL 4JHWL 3CPLB 2QV2A 4PJ5D 3VH8A 5IVNA 2ESVE 1WUNT 5IF0A 2JB5H 3DBXB 4TSCL 2I5YH 4P57B 1HNGA 2EYTB 4C4KO 5DJDB 1RFDL 1NUGA 2B5IC 4MD0B 3WNLA 1MCWW 2BNQE 1UM4H 3PWLB 3GXTA 1D5IH 4JFPB 2Y1VA 1PKQE 2VWEE 2AK1H 3LD8C 1JMXA 4A2MA 1C16B 1JPGA 3NYDA 5KSBF 2O9OA 1FHLA 4GRWF 5KANG 5C08D 4M56A 3WO3B 3C08L 4NO3A 1GC1L 3WQ4A 1A6AB 3C60D 5F8QC 2NY3D 4D6CA 1L6ZA 2NW2B 1CQYA 3EJRA 3O9NA 4AWEA 4JFEE 3THDA 3T1FB 4PYSA 5BMFH 1HYSC 5JW4Q 4WI2A 3RJYA 4WHCA 4POYA 3ZYOA 4CVXA 1M7IA 2H32H 5DJAB 1IGFH 1C8XA 4P2RB 5GGSB 3T04D 4X8XA 2VSDA 1HK6A 2X9WA 1EEZA 4KQ3H 1J10A 2VDOH 2C3WA 3BD4A 2YFNA 3MTRA 3VGEA 4WO4A 3UERA 2VLKE 2E7LC 4PRNA 1HJWA 2V3FA 1LD9B 3VXQA 2GIYA 4LSQH 3NZ8B 1ISWA 4K94L 4XNUH 1NBYB 4EI5C 2R29H 2MSPA 4HTYA 4GAGH 43C9A 2J8UF 1DQQB 4AQOA 1NUDA 4HEME 3UG5A 2ICWJ 4XCFH 3FNDA 4IOIB 3OGVA 5LGHH 5JHDD 4R96B 3OAYK 4R4BA 5I15H 4WUUA 5D7SH 3QXDA 3LIZL 2ICEB 4R4FH 2PYED 3UDWA 1ZLWK 3SGDH 3ARDA 2YPVL 1VAHA 2CUHA 3LKSB 5FK9A 5B38A 1TXKA 3EDEA 1NCWH 1HHIA 1U8PA 1YMHB 2VXSL 4WHTB 5F7KC 4HIXH 4N0RA 3PZVA 2B7DT 3PDGA 3ZE2F 6FABL 1N82A 3AS1A 2R9HD 2AI0H 3NCFB 2CBJA 1T0NB 3MBXL 3BT2H 4X7FC 5HGAA 3HR5B 1HVXA 3DRQB 4I77H 3DETD 2D31B 3P4OA 4NRYB 3V6OA 3L5XH 3BVNB 4HS3B 1HXYB 5TGBA 1UCTA 5DO2C 4H2CA 1HWHB 4RGNB 3K8KA 4L4TE 1B0WA 3A67L 3WHXA 2IJ0C 3RU8H 4EI6A 1JIBA 1FAIL 4BF7A 4F58H 1HN1A 1MQKL 4PTVA 3QIWC 2ZCLH 4PJ8A 4XV0A 2Q8BL 3QDJA 2IFGA 4JVPA 2PWGA 1FORL 2EKSB 1WAWA 1HZHL 1A3RH 2ATKB 1JHKL 3MGTB 4ODSL 5C1MB 3RI5K 5IESL 4ZO7A 4YBHA 2VDKH 5BQ7B 3ZIZA 5H37H 4IISA 1WJ3A 2L7UA 4R3SB 4L4VB 5B3NA 4AD3A 1I1RA 1S7XA 1QOXA 1EOMA 2R0LL 2GITA 4PJAF 4OM0H 4OZOA 4P8XA 1K3IA 4OBSA 3HLAB 3VXUD 5JO5A 1BX2B 3MODH 4QRQA 1PZ2A 2DQHL 1NARA 4DWSC 3L4ZA 4M7ZC 3G6JF 5ANMA 5FKAB 4NQSA 1A2YA 3W26A 4G6MH 1BPVA 3DV4B 1A6PA 4JHWH 3NN8B 4HIIA 4ZEPA 2YUXA 3GZAA 1W1VA 2A6IB 5I16B 4NKMB 1G7QB 3BUBA 3CX5J 1D9KD 2HJKB 4WLCA 5DEGB 1B0RB 1AI1L 1TQCC 3GBNL 2EBNA 8FABA 4GPNA 2WP3O 3PP4H 2AK4D 4H5SA 3VFNB 5T5FL 4DZ8A 1WLHA 3BSZH 4UOW1 4C7FA 4L8SC 4QHUA 4YO0A 1OWWA 4O9HH 2LQRA 1NC4D 4LGRB 4P5MB 1N8ZB 5KSBA 1KTDA 2OCFD 4MQTB 5I74C 4DGVH 5K9KA 1B3WA 1J86A 2HVKB 9CGTA 2DTSA 5HY9A 4OZ4A 4YZFF 3QEQE 3BD5A 1Q9LA 2BVYA 3TYGH 2YD3A 1Y18A 3QPXL 4LMQE 5IIEB 3DGCR 2EIBA 4W6WB 5GRJL 4S1DD 5FUCC 3H3BC 1S9KC 3SGJA 5A95A 1ZT4B 2ZKHL 3KHQA 2B8OT 4HZLB 5DFWH 1B88A 2HT4D 1RUQL 4APQC 2VL4A 1BWWA 1Q9KB 3S5YA 3DTXA 4KY1L 3EGSB 4KTDH 1T83A 2HVJA 4KTEL 3MO1A 1CGSL 2DQFA 1SJHA 1IKFH 2YL5A 3MOAL 3BKYH 1ZAGA 4K94H 1RUPL 4NN7B 2FH8A 5EBWB 5L9DL 3AY4A 1GQLA 1F58L 4MHHG 3VGFA 3T0VA 2VL5A 2OK0L 1OIFA 3HC0B 5DWUH 5EZLB 2ZCKH 4GG6E 3OJMB 1ZVSB 2D0GA 2QSTA 3BXNB 2ZG3A 4M1GH 5T3XD 1GORA 1SM3L 2EYRA 4XCCH 3HZMB 4HS6B 1BLIA 1W1YA 4A6YA 3MMUA 5C0AE 5FB8A 2OI9B 2B2XH 2CXKA 5IVZB 4E41D 4LASL 2CDFB 3VINA 1CXLA 2UYLA 2DKSA 5IB1A 3O6FC 3F4VA 3ZKMC 1QWUA 5E1HB 4WFEE 1ZKAA 5DRXB 4XX1G 5DJZA 4CNIB 4ZFFB 3H9SE 2EDHA 4W7VA 4P8UA 5FF6A 4AY0A 3QHMA 3LCYA 1UEMA 4GXVH 2F54E 3B6SB 4KRTA 4JL2A 4LHUB 4NBXB 3AB0B 3AS3A 5IB5B 1G6RH 5IEHB 1TFHA 1U8MA 3IAGC 4QP0A 3WD4A 2B20A 5FYKL 1ZHBB 3KLAB 1J8KA 5MHSE 1PX8A 5KVGL 2GJJA 2WUBL 3IFOA 3BPCB 4P7RA 3JV5A 4LHUG 1S3KL 3VFPA 5IFHL 4OIIL 5EC1A 1A6UH 1MRDH 2W65B 1JHKH 1RPQA 3LN5A 4JKLA 3TV3L 3V5KB 4BYHA 5GSRA 4EEEA 1CL7I 5GS1C 4Z2JA 3U9UB 4HWEH 1BBDL 4MNHB 2VB5A 3UYRL 3NTCH 3HZKA 3CV5A 2WHMA 4QLJA 4JDZB 2O93L 4ZUUA 2ZUVA 4PRPB 5TDPB 2E40A 2ATPB 1QSEA 1TZHB 2E5EA 3NFNA 3RWCB 4Q9RH 4LBEB 4ISVB 5IEKA 5HXMA 2ICWB 2C3HA 2Q6WA 3OJDB 1VB9A 5C0RL 4WFFD 4ZD3H 3DV6A 4D0CB 5CGYD 3G6JA 1BQCA 3OLDA 4XAWL 4CGTA 3S3JA 2UZIL 4HIJA 1BSIA 3FOMB 2Z93B 4CMMB 1NOUA 3ALFA 3JV6B 1H11A 4QXTB 1YEDB 3GMMA 2FBOJ 2G60L 1F6FB 2QHRL 4LCYA 3MJ9H 5INDB 2ORBL 3AROA 4HD9A 1CNVA 1DBAH 2BY1A 3SGKA 1OWQA 5J12C 4WJ5A 4OCWL 5A69A 1FP5A 3ROLA 1D5MA 1GPOH 4PJ7A 5ALBH 2Y6SC 4P23B 3ES6A 1ZHKB 5DK0A 3UTSB 5JOEA 2XKNB 5CEXA 5C0GA 3MV7D 4EI5D 1YMMB 3FOLA 1IEHA 3MOBH 1F6AB 3BP5A 3L3JB 1KFAL 2VVNA 3ZR6A 1YEFH 4HPYL 2CJUL 2E8YA 4D9QD 3RKDC 4N8CL 3RPIA 3MU7A 3EYSH 5M95B 1RUQH 4NPYA 4DO4A 4ODWA 3B3IA 1FC2D 1X5FA 1R47A 3MXWH 1WNOA 4KKAC 4NNXA 2GJ6D 1OP5K 1E3ZA 2VCCA 1WISA 3L4UA 3MOAH 1A6ZA 3UTOA 1I9IL 4YWGH 4ZG1A 3KPQA 4LRIA 5TE7L 3SQOH 4MMXC 3PGDA 2NNAA 2OWXA 5D9OA 3AREA 2VZ3A 2Z31A 4AG4H 2UWFA 2ARWA 5C0BE 3EOAA 1DUZB 5DO2D 3QO0B 4HG4K 4R2GB 3CCHA 3N06B 1B3ZA 3DDGA 4RDQG 3MNVA 2E9IA 4HAGA 1CGXA 4G80B 2QLVB 4OBRA 1DJSA 1XGPB 4X5LA 5ID1A 3HI1B 5CHNA 1KB5B 3VDAA 3QIWD 4A6YL 2VAAA 1CFTB 1D2KA 2L7JA 1IQDA 4RAVB 4YN5A 4UAOB 3SJVA 3LY6A 5IW6B 4MJ6A 4GQRA 3VG9B 5CSUA 4P57A 2RJMA 1DQLH 4PJCF 3N15A 1FG2A 3BGFC 3RUGA 1QPXA 1HHHB 3EJPA 1MJ8H 1RMFL 1GJUA 3FT2B 4KKBC 2ERJC 1C16A 1RZGB 3BYYA 4R7DA 4JRYD 5FO9A 2BNRD 3IXTB 3QHFL 1KWGA 3RBSA 3L6FA 4TVPD 1GGBH 5F6IC 2IPTL 4KGLA 4JPKL 3NZHH 3KJ6L 1A6AA 3RO8A 4Z9KB 5GIRA 4MNQD 1QR1A 1LEKA 3SGDI 1WTLA 5D1XA 3U5UA 2OP4L 4Q7DA 4UQ3B 1UR8A 2XIBA 3Q3GB 3LH2H 1IZJA 2C4FU 2XN2A 2J77A 4HXAH 5B21A 2H3NA 1KTKE 1RULH 1U8HA 4ORGB 1Q9OA 5DJCA 3QCTL 1GH7A 2CLZA 2D7TL 5I1HL 2A3EA 4JY4B 5E9DD 3CSPA 5EOCH 3RL1A 3A5VA 1QFWM 1I8LC 3O41B 3GH7A 2X10A 1Q9WA 1PD6A 1X7QA 1X5GA 3IU3A 5EU7C 1P84K 3WUFA 1MCRA 4NRRA 1JVKA 1NJ9B 1Q1JL 3MRJA 5IJKA 3ZYZA 3D4ZA 1CGWA 2OR8A 3RTQC 5I6XC 1QOKA 2ZSWB 2V3GA 3TZVB 2Q3ZA 2FJGB 4RGOL 3O3EB 5D7JA 1TVNA 5I18H 4MXVF 3MNZB 4P3CL 1F42A 2OYPA 2PBGA 2UUDH 2FZ3A 2O26U 4BQ6A 4AT6B 3TTSA 3LD8B 4R6UA 2F2HA 4FFYH 1JK8B 3PNWB 2J2ZA 1KJ3H 3BZFB 3HRZA 4TVUA 2XJ7A 5IROC 4ZUVB 2FX8H 4WHTA 1YMHA 3M1BB 4ODVL 3OKLB 1DLFL 4GRWH 2YBRB 5IB3B 3ULUL 3WD3A 1EFXB 1WCQA 3SKOB 25C8L 1FA2A 1MRFH 2EDKA 3L3DA 4PJDF 5E00A 3I6LD 3TBTB 5KVDH 4WU5B 4NRYA 3TIEB 2CK0L 4NQUA 2K1MA 4HUUA 2NT1A 4NC0B 3IAPA 4JDTH 3IS0X 5J11C 4OLVH 1N0XL 5J57B 3B9EA 4RX4A 5GS0D 4WUUE 4NO0D 4S0SD 2R39A 3SDAA 2AQ3A 1JE6A 1JRHH 3WFHB 4NFBA 4GG8A 5INCA 5JXAL 2EDDA 2DMKA 1NLDH 1KCUH 1AC6A 4JFQB 4XCEB 4KKLC 1BAFH 2W60B 1U36A 4YLQT 3A4AA 2FHBA 3NH7L 3APGA 2I60H 1Z5LB 5I8EB 4HS8H 4U1IA 1TQTA 2LAAA 3MRBB 3O6FD 3VTRA 4EI5B 4UT6H 4ATWA 3ZKMD 1O5DT 4GI8A 4FS0A 1GL4B 5DS8A 3VIKA 4WKAA 4QNPF 4TUKH 2EXOA 1V6XA 5FKYA 1K2DB 2GI7A 4UQ2B 2JJWA 4QRUB 1OINA 1OD7A 4L9LA 3OKEB 5HHXH 1PLGL 3PZGA 1JGLH 1KPVA 1MCOL 2XN1A 5C0CB 5AAWA 4XP4H 4RE3A 3ARGA 4P3DB 4YEFA 1S5HA 4X7CC 4KHXL 2AJYH 4GOSA 3V4PL 4MXQD 3BAWA 2IH1A 2D20A 1C12A 4HC1A 4OF6A 4XPAL 5FYKE 3A6BH 1KG0B 3TTYA 4LPWA 1UD2A 2DWEB 5ABFA 3ZE0E 3QDJE 4WTXA 1UJTA 3B4NA 3UEZA 1MY7A 3BGMB 3R4DA 3PJSB 2P8MA 3ZDZE 1AJ7H 5A1AA 5BRZB 1A64A 1FH5L 2LVCA 4L5FL 2BSRA 1NFIB 3HI6L 3ARSA 3EDKA 2QPUA 3PV6A 1RVFL 2NSXA 4MYWB 4P5MA 1X5YA 5HSFA 1JI2A 3BH9A 2FYYA 4JRXA 1IM9A 1MFEH 3W28A 4LGXA 3LKNB 1FH8A 1E0OB 5ANME 3QR3A 5HHQA 5CWSA 2DQJH 4XRCB 3W9DA 5IHUH 5HGBA 2GJXA 3GNOA 2I27N 4M7LT 3QIUC 3SQBA 1T4KB 2I9TA 3VFOB 1BEYH 5T1DH 1L0PA 4X4YA 3LRMA 2VX7A 1XF5B 3DSFL 2WMKA 4F9DA 1ZTXL 1YPZB 4PG9B 1T0MA 2Z9TA 1T03H 3TONA 3P0GB 4NNYA 1V08A 2NW3A 5CQ1A 3NSMA 2ZOLB 4I3SL 1SJVA 2C1OB 3EGSA 4DGYH 2J7CA 4DWSB 3V6ZB 1KLGB 2CK2A 5FGRA 3QYCA 3UTPD 3LB6C 5KSBE 3HKFA 5C0JA 5HDQH 1OM3H 2YLLA 3G04B 5IKCB 4C59B 4NRZA 3CMOH 3GSRB 4FLRA 2FJFB 3GB7B 3IXAA 1F2XK 3QHOA 1TQCB 4QLLA 1EK3A 4PTXA 4ALAL 4PJ9A 1CQKA 4GQ9L 1OGSA 4OLYL 2V7HA 3ROOA 4Y19A 1P4BL 2XVGA 2E0PA 4LRNH 4KKAD 1A1NA 1MREL 5I74B 3KJ4B 1OAKL 5D7LB 5IV2A 2E9LA 1A21A 1FL5B 1WK0A 5BS0B 4AYSA 2X7LA 2VXUH 2WLYA 4WW2A 1OF2B 2BXZA 3WHE0 3HNSL 3BAEH 4PJDA 5AWNH 5L6YH 3O2WL 3AM8A 4JFTA 2KZWA 5BROA 5EBAA 1IEAA 4AMXA 4HOZA 3O8XA 2AJ3B 1SBBA 2XTJE 1BIHA 1MAMH 4GXUN 4APQB 4HLZH 1L0XA 4G6FD 1CIUA 4XZBA 3WF1A 1UB6A 3BP6A 2XG9A 3T09A 4OQTA 3CFEB 1QKZL 4U1SB 3UZEA 4PJHF 3P9MA 4HHAA 4LF3A 4MS8C 1RSFA 2YPLA 1WFUA 4C56D 1HDMB 2EH8L 3LPPA 1UQSA 4CADB 4WGWB 2VKWA 4M6AA 3ZE2E 1WT5A 4P9HL 3R8BB 4UZGA 3GSOB 2A38A 1BYAA 4X99A 4MNHA 1QSFD 2BHYA 3UCRA 4JDZA 1W72B 4AEFA 3UR7A 1MFBH 3P4NA 3BVVA 1ISZA 5HHNB 2IANA 4PGBB 1IGIH 5I8OL 5KSUB 2DT1A 3AJ7A 3K1KC 4YXHL 2VERN 1I7ZB 3L7EA 1AHWA 4HC1L 4D0CA 4URIA 4ZO8A 1Q6DA 3T08A 4TUOB 1V6VA 3FQXB 3VD9A 3X3FH 1OWRM 1RZ7H 3P73B 4YHZL 4CMMA 4WU7A 3FL7A 3JV6A 5BW7A 3MUAA 5CEZH 4HUWB 5IB4A 1H0DA 1BFNA 1H3VA 4C58B 5E5MB 4MGXA 3K8MA 2C3XA 4MD5B 4PRAB 4U5IA 3D3VD 1HE7A 1IFHL 5JPMB 3HI6H 1K4DB 1VERA 3GKWL 1EQPA 4M80A 2J78A 5DZOA 4BM7A 4W89A 2Z92A 2FBJL 3W11C 5CD5C 1M6OB 2ZNWA 2Q86A 5F9DC 1KGCD 1QSEE 4UZUA 3VFGL 4IRSC 2XKNA 3LRHA 3W81A 4HJJH 5E8NA 2P42B 3ARZA 3GRWH 2WSPA 4NZJA 4P4KD 1D5XB 3L3JA 3RTQD 5B4MC 2UVEA 3N11A 1NLBL 3KPOB 3G6JE 1RURH 4Y2DC 5E6IB 4J28A 1NH6A 2HWZH 4YHNB 2FEEL 5GS1B 2V2WB 4UIMA 5DK2A 1RHHB 3GHEL 3WJLA 4FQCL 2C1PB 1Q0YL 3SE8L 2W4XA 2JF1A 5FYLL 1E0XA 2VLME 3MRMA 3G5ZB 2JJSA 4OD1L 3KGRA 3DDFA 4PJ7E 3BZEA 1ZVHA 4TVDA 4E5XA 5T5NG 3ULUE 1W3HA 3U7AA 1HHGB 3BJ91 3LMJH 1H4PA 2V5MA 5JDSA 4IJ3C 4M9PA 1OAXL 4GAJL 1FYTA 5JW4N 1NMAH 4EIGB 4HGWA 4N8VA 3V4VH 4OTXH 3QO0A 3OKNB 3U46B 1H1NA 5J12B 1L8NA 3D0LA 3OAUH 4LPTA 5DMJB 3O6LH 4X7EC 3KL5A 1CE1L 2YDRA 4KKLD 3WF0A 1KB5A 3HG5A 1OW0A 4M82A 3P4MB 3WSUA 1BG9A 1AKJD 3QUYC 3S3SA 4AD2A 4PD4K 1FGVL 3MRNB 1YECL 2AGJH 1U8QA 3P4LA 5H2BA 1FE8L 3VMNA 1DSFL 1DN0B 2AQ2A 1V7ML 2CRIA 5FKPB 4B7LA 1CICA 4JZ5A 3F12A 3SCUA 3D50A 4LLMA 4U1GB 2F5AH 2Y07H 1R3HA 5EUKB 4B50A 1FVDA 4ENEC 1KCRH 3MYZA 3ILPA 2P8LA 3N1AA 2MMXA 1J1PL 1RU9L 3LKQA 4NZUL 1KQYA 5GJTH 3VXMA 1R3IH 5GRVK 2I07A 1DL7H 2DDQH 7A3HA 3DXAB 5CSBA 1WICA 5F1IB 1J0ZA 3MGAA 3L3HB 5DD5L 4S2SA 3RBGA 4W5UA 4NWUH 5AD0B 1KV3A 3ARTA 3I9GL 3DX8B 3EJYC 3D85B 1FYHB 4G6JH 2F8VA 4LDOB 5FA3B 5ALCH 3V5HB 2PTTB 3X12A 4PS4L 5E0FA 1MWAB 4OQTL 3QDMD 5F96H 2F7PA 3SJVE 2ITDA 4JFZH 1IGYA 2VJXA 5DD3H 5GS3A 1JGIA 4WRLA 5IFPA 3LEXB 1E55A 3QA3B 1OSPL 2HISA 2RQ8A 2GEEA 4GAFB 4HUNB 4IMLB 4KJYB 3RUGE 4JY4A 1OVZA 1XR9B 2NZ9C 4LLYB 3ILQC 4OZGB 1ECEA 1R5WA 1J0KA 2A6KB 1KC5H 3TO4C 4XPFH 4U1LB 2P5WB 2EDQA 4JFFB 4AIZB 4YHOH 1FL6A 2HJFB 4ACPA 5T1MB 3IVKB 1JRHI 3NACH 3QFJA 2H9GA 1CFVL 4HC1H 4HH9B 1R7OA 3G6LA 5GHWH 3ZJ6A 1TFVA 5BJTA 1CLZH 5L8KB 3U9PL 2DBLH 5EOTB 2FJGA 4GLRH 1B3XA 2Z91B 2IQ9H 3QIUD 3QUZC 4NKQB 3RGHA 1D7FA 5HYJB 1C08A 4JB9H 3UCQA 1A9EA 5FO8A 4PJGB 1K8IB 4OCSH 4WY7L 2ERJB 2GTZB 1E56A 3VX0A 1LEGA 1WDSA 3S37H 1X1NA 1YY8A 35C8H 5IHZA 1DFBH 2EE6A 5ACMA 4IOSD 5A8QA 1KLUA 5K9OA 2DSWA 3EOYG 3PGFL 4M7LH 1GZQB 4X6BB 2Z8SA 5A6BD 2VXTL 5EIIA 4NT6A 1CBVL 5IVXB 2CKBA 4HDIA 1Z32X 3QOMA 2AOSA 4QAWA 4MDJA 4OLZL 3MRCA 2DT0A 2W9LA 3RVTC 1FVCB 4YHIB 4UFMA 5LXGL 2QL1A 1G84A 3KPMB 1U8NA 1UC6A 1K6AA 3RVWC 3RM9A 2IGFH 4I2XB 2CKNA 2WHJA 4OF3A 1QNOA 4B3KA 4UUJA 5EU6D 3DVNA 3NJ3A 1TA3B 5FYLH 1A7OL 4HPOL 4F79A 4XCEA 4DCQA 5CD3B 4OD1H 2YN5A 1CXFA 1JHLL 3ORJA 2EECA 4AYFA 1QEWB 4XC3L 4IIQA 4R0LC 1FP9A 3MYJB 3QJHB 3MRBA 4IOFC 3TA3C 3QXAB 2ICES 2AXHA 3RTQB 5I6XB 1RZJH 3KYAA 4GKSB 4WK9A 3PHQA 3VMPA 3N17A 5AUMB 4MNMA 4NKDB 4JN1L 4M7KL 2D7OA 1MFCL 4TQEH 3S34H 1QNQA 5DHXB 1FDLL 3EJTA 5F21B 1C5CH 4ODUA 1V7NH 2EYSB 1JFQH 2VC9A 2CH8A 4KRPC 4YPGA 3CVIH 5AYBA 5TE4L 2QQLL 3E6HA 3IFLL 1NC2D 5DD1H 3G6DL 1KB5L 2CSPA 4PSRA 3BH8A 4J8RA 4X4XA 4DKDC 1QI4A 3SKUD 1G7LA 1FNEA 3SCRA 5ELIA 1MCJA 2OR9L 1U8IA 4KZDL 3T0AA 4FP8H 3GBLA 3KE0A 3LPOA 2BRRH 2QHLA 3RRQA 3OZPA 1HL9A 4JO1H 3GJEB 3VI4E 5T3ZD 1ODAA 3O4LB 1A6TA 1S7UA 4N0UB 4J2XA 1Q94A 3DMMC 1N5AB 1HKLH 4S3KA 5KAQG 4LCWA 2VRQA 2JTDA 5E70A 2VXQH 3ZR5A 2WMIB 3AAZA 3C5ZC 3LKNA 2EDYA 5IMKB 2VDQL 3MSDA 4WFHE 1LILA 4DUWA 3STLA 1TTUA 2IPUK 1C5DA 3MRDB 4YUEH 1RZFH 2AEIT 2NCMA 2DS4A 1TJIH 3FRPG 3P30H 3BCDA 4ZTPL 1YN6B 1RI8A 3E3QE 5D1QC 3MKKA 3AIWA 2G75B 4F9LC 3PZIA 4QDMA 1XH3A 2A77H 2EE9A 3SE4A 1JXJA 5TFSL 3W11D 5CD5D 3HMWH 3PDOB 4NQDA 3CVHA 3KZSA 3MV9B 2BFGA 3MUY1 4JRXE 1JUFA 4LLUA 5D9PA 4I0CC 1EZVY 4M48H 5B4MD 2VZUA 5A6LA 3GTNA 5BVJB 2R0ZH 2FX7L 3AFLA 1CDCA 2W62A 4X6EB 2VLJD 2FYVA 1T20B 1A0QL 3S4SB 4YDLB 5IR1A 1PX3A 1S9XA 5E8DH 1NCBH 5B3JF 5EFFA 4K23H 2E27H 3CFDB 5FYLE 3LEYH 5F7EL 3D4YA 1TMQA 5KVEH 3CFBA 4RWYH 5I2UA 4FQLH 5CBEB 5I17B 3FONB 4LVNC 3W6LA 3IAQA 2QR0A 3S4SG 3DX3A 1FL5A 2IG2L 5BS0A 5EU3A 5I73B 4ZS7H 1FFQA 5DUBB 1HHJB 2HFEA 3RX5A 1OF2A 4NZRH 3F7VA 2CKBL 2ENYA 4HCRA 2J8GA 1MFUA 3N1FC 3RQ3A 4M6OL 5DVLA 1KIQA 1YEGL 2AJ3A 2BOCB 3ARQA 3GK8H 5J9PA 1I9JL 2GSIB 3ET9F 3LQAC 1I85C 2A6DB 2XZAH 3CLEL 1T89A 4UV7L 3WXVL 5DYOA 3RWGA 2KH2B 4Y19E 2AV7B 2FE0A 2DQDL 2ADJA 5FGSA 1BGXH 1MLCB 4HWNA 4WVRA 1JHLH 1QFUH 4QCIA 3DURB 4P49A 2HLAB 4G42A 3WQ8A 1EFQA 1L0QA 4NQVA 4R5EA 3LSOA 3TBYA 2XG4A 1AXSB 1LK2A 3G6AA 4HIEA 4QFUA 2BVPB 2IEPA 2QQKL 4TOYH 4ENED 4LCIH 1IC5L 3GJFA 4CVUA 4PJDE 1MVUB 5I5RA 2QQNL 3QFDA 1ZGLM 3ARBB 2IQAB 4IRJB 1WBZA 3MCLH 5DUPH 1GZPA 4JFHD 3R0NA 1G9EA 1TVBA 1ES0B 5HGDB 1ZSDA 1R6VA 3RWEA 1OOAA 1DDHA 5GGRB 3UTTA 1YNLH 4PGBA 4CBPA 2DIJA 1A1OA 3UJTL 5ADPH 1GOGA 3VVGA 1WTGT 3EYQD 2BDNL 1C7SA 2A73A 3SE9H 5SWQB 5D2LF 1U2HA 4WWKA 2YPLE 2VC2H 2HT3C 5E08L 1IL1B 4YFDB 3UBXB 2XZCH 5T1KB 4K8RH 4Y5YA 1HSBA 1JGEA 3ILQD 3CZFB 3LS5H 4XHQA 2ZXBA 3OPZL 2MCG1 2ILLA 4Z2HA 1C1EL 4NYLA 3TO4D 4BQ8A 1YJDL 2XA8H 5HHVL 3PGCB 4K9EH 3VPLA 4K3GA 1HQ4B 4F15B 2NXYC 2IANE 4QRSA 4ELMF 1NC2B 4OCXL 3WH6A 3GMPB 2R4SH 1G7HB 4Y7MA 3VDHA 1X44A 2X4NB 3AU1A 2W92A 4MLIA 4UOW0 1A7RH 1AD0B 1XGRA 4YHNA 3C9NA 3IU4H 4MAUH 4PV8B 5D6CA 5JIPA 3HUJA 4GKNB 2A74B 1BQSA 4RAUB 2NXZB 4JKPH 4D6IA 4EDWH 3AXLB 1L7TL 3HE6B 3MRQA 1UQZA 2KBGA 2VLRD 3B9VA 4XAKE 2CDEA 2G5RA 4H8WL 4Z5RB 2XWBB 2NX5D 3G5ZA 3L95B 4Z7QF 3V7MA 3EJUA 5F1NB 3MLYL 3OKKA 4G8FA 2MCPL 4Z8FH 1AO7B 4L3ED 2H1PH 3W2DL 4HK3N 1I1AC 3D39A 3ZMRA 5I78A 2VR9A 3ZKNC 3EKCA 3WS6C 1VADA 3BEWA 1MPAH 3WE6A 5EBGA 3MREA 4QLKA 4RFOH 1HILB 3RVWD 3TBSA 1ZHNA 5IBTL 5ILTH 1QD0A 3AXIA 1WFOA 4P59L 4XPHL 1AVAA 5JIHA 1FIEA 4LLQA 4OV6F 5C2BL 2LVEA 3W5MA 1UH2A 4NZTH 3U6RB 4UDUB 4FQ1H 3P4MA 4G5ZL 4WI8A 4IRSB 5IBLC 3EIFA 4IOFD 1K8DB 4LK4A 4LSUH 5FGCE 5F88B 1DN0A 5EO0B 3FCTB 4Y2DB 3GIZL 4LCUB 3IKCA 4XPTH 1FYTE 4HCRL 2YSSA 3PABB 4GO8A 1FZJA 1OCWH 4G9FD 4GLRI 4Q2ZA 3U79A 4QYOA 1P7KB 2OBGA 1MHHB 3R1GL 4AD0A 1GHSA 1NDGA 1FLTX 4DZBB 2AJVH 5DJ8A 3POCA 4KRPD 3PZNA 4MDPA 2ADGB 3WD5H 5JTWA 1M01A 1QYGH 3CJJA 5J6HB 3DSNA 3W9EB 4IPLA 4AZCB 4NO2A 1RJCA 2DQIL 5BO1L 1CLXA 2BS9A 3VWJA 2PTTA 2OSWA 1HSAA 2UWEF 3OHXA 4GW5A 4XC1L 3NCJH 3MFGB 4IJ3B 2W59A 4QXGH 5E99H 3O2VL 1OIMA 3KR3L 1IBGH 2G5BB 3T65B 4YHYC 2DQCL 1IC5H 4MX7A 1X5AA 2A9ML 5DJ0A 3VFTB 3MX0A 4KDTC 4BZ1L 4BQ2A 4P2YA 2KQNA 1XGUA 2DQXA 1N59B 5BXPA 3DMMD 3TH4T 4LQ1A 3QEGL 5TDNA 3VXME 1CFNB 3C5SA 3ZT5A 3U36A 1CVRA 1KIPA 1S9YB 3JV4A 3BESR 3C5ZD 3OWEA 3G9VA 5DRNA 3QUYB 5EZOL 2OQJB 5A6JA 3QEUB 2UY6A 1UUQA 3GI9L 4O58L 3N1PC 1MAJA 4AM0A 1FAKT 5HGHB 2Y8VA 1INEH 4PLKD 5E08H 1WVZA 3ZT7A 2XFXB 3WH8A 4KHTH 1ZVYA 4LLDB 4OZFG 1W91A 2ZXAA 3MRLA 4FN0A 5DD6A 3EOTH 5E8PB 4ZFZA 3L3GA 3REWA 2HYMA 1XYZA 4NBZB 1OGAA 1BOGB 2IAMA 3BIKA 1S7SA 5HJ3A 3LXCA 4PRHD 2AS5M 4OGXH 4YDVA 1QFWL 4KAQL 2YL9A 4DTGL 5KN5B 3VIFA 3QFJE 2FD6H 5DT1L 3WIIL 4K3EL 3DUUA 1OARH 3TT1L 4HA4A 4CW1A 4Z2IA 4JIEA 4JGJA 4KMTL 3FMGL 3CZKA 3HAEB 3IJYA 2VQTA 3GSQB 1WAAF 3QDGB 3KLLA 2EDRA 2QKIA 3NA9H 2XKUA 2XWJB 5HHOD 1PSKH 5EZJB 3TO2B 2W0FA 5IQ9B 4EN3C 1CDJA 3T4YB 4DAGH 5EWIL 4CL7A 4OUEA 4GFTB 3T0BA 1I7TA 3VCLB 5I30H 1QNSA 3TO4B 2GUYA 4W4OA 4UU9B 2FECI 2DQGH 3HAEG 2EDXA 4MB5A 4PMOA 1QEWA 4ONHA 3CVHH 4R26L 5DR5H 2YR3A 5DEZA 3AHXA 4PMYA 4MADA 3RZCA 2ZG2A 3SO3B 5AUMA 2FWOA 3QUZB 5GQBA 3V0WH 2MPAH 2ZOXA 4BZYA 1JTOA 4NHUA 1G7MB 2EDEA 5JR1H 5HPMA 3F6IA 3CLWA 2UY2A 3HE7C 2EYSA 3W0WA 2RGLA 4HT1L 1NSNL 1WZKA 3IF1B 2AJUH 3T0DA 3E1F1 1IAIH 2X4SB 4UDTB 1UWEL 1W0WA 3B8YA 1JDAA 3DVFA 5E1QA 4JM4H 2A3AA 3F7RA 4DW2L 4CU6A 4O2EA 4PY7B 3SDDC 2JJTC 2F53D 3CDGA 1RZKC 1AIFA 1WCBA 3ZHDA 1NGQL 1U8JB 1KJ2B 1NFKA 4Z95H 5EUOA 2BVEA 2APFA 3B2UC 2RGMA 1Q8MA 3MMEA 1RIHH 5F3HA 3FB6A 1JFHA 2WWDA 1N5AA 2W9EL 1PW3A 5D2NA 2ITCB 1WWAX 2VWEC 1IC7L 1H8SA 3HPJB 1TVPA 4XVSH 4G6KH 5IMKA 3ULVC 2IFFL 1XSKA 5CJXA 1EO8L 1DQML 3PHSA 3LQZB 3TA3B 3KDMB 3MACL 3MRDA 4NN6C 2WIIA 2RCSL 2HT3D 1MW1A 4XNMB 2UWEA 3L5JA 4JFXA 4JHAH 4P46A 3D0VB 1R24B 4Q0XL 3VXNB 4PRID 4I5BB 3GJFH 1NGPH 2VQ1B 3LPFA 4OSUH 3O3UN 4M61B 1RP9A 2J4GA 1P5VA 4MJID 3PDOA 2ZUTA 2HKFH 5SV3A 1NGWB 3MV9A 4PP2B 5JPNA 4Q7NA 4G7VH 2PO6C 4LCWE 5SX5H 1BQUA 2NXYD 4NM8L 3VGDA 1QVBA 3OGCB 4KPHL 2EACA 4JKKA 2WINA 3HN3A 4Y89A 4KI5F 1CR9L 3O3AA 4LSRL 1TQSA 3QG7H 5KVFL 4DVBA 3UG3A 4QRRA 2X41A 4W68A 1AFVL 1XF4A 5DXWA 2UUDK 2NY7H 2NY5H 3MLSL 1VIWA 3LDBC 4X6EA 3CH9A 5IWLC 1FNSH 4Z7WF 1MJJB 5TQ2L 4PFEA 1DBKL 1FLRL 4JN2A 2DM7A 4DGIL 1JMZA 2WVVA 2VQUA 1R0AH 1HQRA 1HIML 4LVHB 5CBEA 5I17A 2XPKA 1F90L 1WDPA 5ID0B 1BJ1J 4NQDE 4FQXC 3C5ZB 2YEZB 1CFSA 1NAMH 1MF2L 3UPAA 1EO5A 1I1AD 2B4CH 4UNTA 3ZKND 3MLTB 4JM2C 3CUHA 2EDFA 5EFIA 4ZODA 3WDHA 4ZQKB 4HGMA 1K6QL 4LSPL 1HINL 3QNYA 4JO3H 1BVNP 4PUEA 5MEQA 5DSCA 1P7QA 5FYJH 3OGRA 5D1QB 1KR1A 3CUPB 2MJWA 1FZMB 4IHOA 1XH0A 4JCLA 1WAAA 2P44B 1DVFA 5I1CH 3PL6C 4J6RL 1WBYB 5I0DA 4CAGA 1MW0A 43CAA 1MUJA 2CLVA 4TTUA 3QUMH 3RIFF 1DQJB 5IBLD 3U4BL 4HFWA 4KV5E 1OAUH 4NXKA 4V1DA 5BS0E 2NPLX 4FLSA 1HEZA 5CEYB 2BVPA 5L7XH 4Y4HA 3G5YB 2CR3A 5I1GH 4PBXA 1C3FA 1G7JB 3UROR 4AEHH 4X6CB 3MLUL 2AJZB 4MZ2A 2LTQC 1IGTB 2Q87A 3VXPB 4MB1A 4P2QA 4LL9A 4HF5H 4CN1A 3GUTB 4RISH 4UT9L 1F4XH 2CYGA 1QG3A 3GXPA 2NTFA 1SYSA 4M62L 4PIRF 4G9DB 2FR4B 4ETQA 1IQWH 1KCSL 3LXBA 1OAZL 4LVNB 1HJXA 4KI1A 1EXPA 1UA7A 4AJ0A 4OZIA 2ZOKB 3S97C 4XT1C 2AEQL 4RFNB 4U1NB 1WWWX 4XH2B 3VFMB 2CRZA 2P5EB 4Y4KA 4X0VA 4M7JH 4P8VA 4GKOA 3PIQA 4XCNA 5HYIA 4EIZC 5C09D 4NKOA 3IDIB 1NWSA 3DO7B 5GRXG 1BQHB 1HKMA 4EBQL 4GXPA 3BFOA 3VD4A 1XH1A 1Y0LA 2X2YA 3CLFH 1TJHL 5D96C 3C5JA 3PWJA 3D2UB 2FJHA 3FO0L 4P5TA 4S1RH 3NABH 1OGTB 4PMDA 3FB7B 4KUCD 2BCKB 1HQ4A 4LEOA 1XEDA 3BEVB 1NCAL 1BQHG 3X3GL 3UTTE 1QLFA 3BQUA 1DE4B 1QQDA 1TZGL 3WLWD 2HP4A 3BH4A 3DGGB 4QHLB 4D9RE 5LGJB 2O61B 1YHTA 4JG1H 4GBXC 4EQ3A 4YHPA 3V0AC 1R3JA 4RBPH 1N6QL 4EJ1C 5D72L 2DIBA 4H0GA 1CD8A 2O92A 3HE6A 5ITBL 3NFSH 1FFPA 2EEBA 5IMLA 4L29A 3U4EB 3GHBH 2QHAA 1JCKA 4HKZA 3PQYD 1IC4L 5BXRA 3BO8A 8CGTA 3BXWA 2F1AA 4LAQH 4ETYA 3WLBB 4F2MA 1WPCA 3U7WH 4ZFGL 1SMOA 3WBEA 1HWWA 4QEGA 3QIBA 2X0YA 3C6LC 4QRPD 3TJEH 2X4RB 5D7KD 3I3DA 3BVTA 3QXWA 1VENA 2GQHA 1FLRH 4QOKA 5T1LD 3VGGA 4FXLA 1I8KB 2XZQL 3HUJE 4DGIH 4EN3D 2Z1SA 4RA0C 4Z7WA 1SBSL 3L4YA 3CIVA 5DDHA 2VABB 1C8QA 1UG9A 3OR7B 5HHMD 3U6RA 3I02A 3PWVA 3TTOA 4AIEA 1GPFA 3MFFB 2NXYB 4YHML 3CFCL 2EC9T 4YIQB 3W6MA 1QNRA 4X6DF 2DSVA 5C07A 3FCTA 1YNTA 3D39E 4M3KB 5EB8A 2PWHA 5MI0C 1GQJA 3ECBB 4WV1A 1U6AL 4KJPC 3ZTJH 3QI9B 1FIGH 3VWKA 1NGYB 1PQZB 1INDH 1FFNA 1P7KA 1W0YT 5JUEL 5A3IC 3HE7D 4OUOA 4F7EB 3MRRA 1GOMA 4DZBA 3B2VH 4QTHA 2KUTA 4NQEA 4J6RH 3B5HA 1WE5A 1BIIA 5F3BB 1JF6A 2Z0BA 5DHVB 1G9ML 3O6ML 1E28A 3KLHC 4CD7A 1AGCB 1ZWIA 4ZPTA 4PJ5A 5HYFA 5DC9B 2ESCA 1I1AB 2BJML 4X7TA 3SDDD 1Q4NX 1HH6B 5F71A 4EKXA 1PZUB 4QWWD 2X1QA 1PAMA 2H26B 1T22A 3ISWA 4MZ3A 2E7CA 1UHVA 1TPXC 4Z6AT 4WEBL 4OCLC 2PXYB 3B2UD 2J4WL 1M71B 1D6VH 3JVGC 4EXKA 2DSKA 5MERB 4QRTA 3SKJL 1CFNA 5C08A 3L4VA 4R97B 2HJLA 5ETUA 5CJOL 4ZFOB 1CK0L 3C60A 3SBWA 1CGYA 2AKRB 1OAZH 2A9NH 2XPGA 3TBWA 3JTSA 1SJEB 3ULVD 4OZFA 1GC1C 1RZ8A 2CIKB 2EDLA 2OQJA 3QEUA 4S1SL 3JXAA 2XIDA 4L4PA 3QQ4B 1KN4L 4DK6A 4ZXBC 3ZDXE 4WIQA 1JNNL 4QLRA 4N1HB 2YOCA 5EU4A 1E40A 1O7SA 4H88H 2ZUXA 1CCZA 4L3CB 4U6HB 3D18B 4FTVD 2VCBA 1EMTH 5F9JA 1N64H 2Q1EA 1JBJA 3C6SA 2Y7QA 1JGDA 3T77A 5ICYB 1AP2A 4JZNA 4UIKH 5JNYA 1CLYL 4OCYH 4Y4FB 2EIZA 1DANT 3JWOC 1FC1A 2VO5A 4N5UA 2AABH 2ZPKL 2PO6D 4HKBA 3AMCA 5EORH 1FOBA 1E15A 1UM6H 5D1ZA 1X5JA 1Z3GL 2VLKD 3CHEA 1IAII 2J7BA 5DRZB 1XGTB 5EOQL 4Z0XB 3P0VL 4IM8A 2PYFB 3WO4C 2GTWB 5JHDA 5M7QA 2D4FA 1GOKA 1UM5H 2V2XB 3FB5A 3A6CH 3TO2A 4EUPH 4HXBH 2PYEA 2D23A 1OGAE 3SE3A 4O02H 5JLZB 1QLEH 6CGTA 3FQTB 5DD0L 2PW2B 3BUYB 5E5UB 1E4KA 2Q8AH 5I1DA 4PYGA 1YYLH 3HC3L 3BDYL 3GGWA 5DA4A 1R87A 4JM2D 2YDQA 1WC7B 2X70B 3SDXF 3DX4A 4TULH 2APWA 1EJOL 1JJUA 2WAHA 5FO7B 3T3PE 4HAFA 2F8OA 3GIVA 3PXHA 4X4MA 1B31A 4PBGA 4U1KB 3D51A 5ENWB 1VGKB 1W3LA 3E8UL 3WFDH 3TCLA 3PL6D 5F7MC 3P2TA 3LHPL 5KSAB 2DN7A 3MLVL 2Y06L 4UDTA 3QH3A 3FN0L 2YRPA 3HTLX 1BF8A 4B53A 4MDOA 4ZXOA 4A3HA 1DWHM 5DLMH 4FG6C 4X6DA 2PW1B 4XI5D 3SDYH 1EXUB 2BY3A 1U8JA 5DJ2A 3WJJA 5DURB 1X6LA 4Y8DC 1N2RB 4Z7UB 1ZGLP 4LSDA 3MLXH 3EO1A 1I1CA 3WD2A 2NY6C 2MANA 2HN7B 2WSKA 3WQWA 1RK1B 3HFML 1ORSB 2WC4A 3VXUA 1ZGLA 4YFLF 4J4PC 2Y36H 3M7SA 3W0WE 1H3XA 3MJ7A 2A1WL 4WUKL 2YPKA 3OAYH 1V0NA 3VI3F 3MZGB 2X4TA 5LCVH 5DHYA 3GNPA 1PZ5B 2V5YA 1C90A 2DI7A 1YEJL 2VMFA 3KPLB 3AHTA 2E9JA 1WWCA 1QRNA 2FGWH 2XN9B 2DTML 4H25A 1ZLWH 1G9NH 1FBIH 1D9KA 2XNAB 4Y5VA 1R24A 1U58A 4UV4L 4FNLH 3WKMH 5F89A 3ECQA 1QNZH 2DQEH 4UT7H 3RWFB 2AK4A 3TN0B 3FQWB 5EFDA 1LWJA 2J4WH 4M61A 4W70A 3MA7B 5HNNA 4ZENA 4BSVB 1L4IA 5EUOE 1JZ6A 3OA5A 3ARFA 1NC4A 5IK3B 3VMOA 3POHA 5KVMC 1T7VA 3BISA 3IDUA 5D2NE 4ODHL 1II4E 1XCQA 1YEHH 1US3A 1KTRL 1LL7A 2GFTA 2W0KA 2HRPL 5ESVB 5HHPB 1U2YA 5ISZD 1U3HB 3EOBA 3QEQD 2ZWYA 1JFXA 3DRTA 1BVLB 4GBXD 2VRJA 2ESVB 5K9JH 3OR6B 1ZK9A 1L0YA 1K3ZA 1RK0B 2UWEE 1I7UB 3BKMH 4G8GD 4QXUL 5SWZA 1H5BC 5DFVC 4PMRA 4CCCA 1ZT1A 2BNQB 1VESA 4JR9L 1KBKA 4TSAL 1HHKB 1PKQB 4XBEL 4XNYH 1S8DA 1FZOB 1S5IH 1U9KA 4HBCL 2WBJA 2R1YA 3MV9E 4AMKL 2PETA 3CZJA 3EJQA 5E7BA 4UINL 4BUHA 4GS7B 2GW5A 4WTZG 5FYKU 3MLTA 4TSBL 4KGJA 4JFEB 4NN6B 2D7QA 2VDNH 1P4LA 2FO4B 4XMLL 1ED3B 3C6LD 4PBVC 3O0RL 4QRRE 4F7TB 3WEMA 5CBAA 1IEBB 3RFZC 3HC4H 2VDLL 3QNXA 1R86A 1K4CB 4KMQA 5GZND 2R2HB 4QT5A 4NRXB 5H94A 4TX8A 4U6VL 1WBYA 2WW8A 3IYLW 4M8VA 3IK2A 4XVTH 1WEJL 4E41A 3IDMA 5CIPA 1PG7W 1JD9A 2GCYB 3TIDA 3UDWC 4NGHH 2V38A 2VLKB 1OQXA 1T2QH 2R23A 4UTBH 2XVPA 3S98A 3CXDL 3EDJA 2WKLA 2Z4QA 2C3VB 4GRLC 5IMOA 3F58H 1CXEA 4X6CA 2CNCA 2BSSB 3UJIL 3SDXA 4KJPD 3LDBB 4WFED 1A02N 3GUTA 3VE0A 4RIRA 1XF2B 2EE3A 3SKNA 3DX7B 5DQ9B 1JNHA 3V6OC 3TTQA 1F4YH 1WAAE 4XGZB 3TNNA 1KJMB 5DTFB 4CN4A 3KLHD 1LE5A 2ZOKA 3FKUS 4FQXB 4RE4A 3GNML 4OCNC 4XH2A 1CLCA 2F5BH 3MJ6A 4M5YH 2HFFA 4HOXA 3BGAA 4I0PB 1HXJA 4UQDA 1MHPH 3ALWA 3MANA 1VFAB 3LRSA 4FZEH 3H55A 1GIGL 4V1DE 3ZTNL 3IDIA 1SR0A 3WFLA 4NUGH 4PJ8C 4AW7A 1I4FA 3RMEA 5K59F 4HKXB 2YIHA 2W0PA 3MCG1 5I8KL 4YC2B 2CHOA 3U7VA 3QUKB 1UWGH 4X8JB 4P2QE 1H3UA 2KL6A 4LSTL 1Q72L 1GOQA 3L3IB 4FOMA 5IOPA 5FUOH 1TE1A 3BPOC 2J6EA 4L4TB 1KWKA 4KUZH 4D0DA 1GGIH 5KBNC 2AJSH 3S88H 3MRIB 4JLRA 1IGCH 3RY5A 5DJ6A 1OAQL 5I8CA 4OZIE 1OTUD 3C87A 4KK8C 4LNVA 2C26A 5E0CA 4ZXBD 4RQQA 3RDKA 5IGXH 3WBDA 2P45B 4QHNB 3E6FB 4BFEA 2I9LB 5LQBH 2BX5A 2XG5A 3RGVA 3D5HA 4X0KB 4LDEB 2C7UB 4ACZB 5LG1A 1KGUA 1KQZA 3CC5B 1M7DA 2VDPL 2E7LA 3GSXB 3QHZL 3VSTA 2JF6A 1I1YB 2WVUA 4ONGH 1U91B 3MV7A 1ZANH 2CGRL 3PZQA 4RFEA 3G9AB 1C5BL 5E2VH 3STZB 1I1WA 4U1JA 3EUUA 2IADB 3BVUA 4WKFA 1XYFA 4KXZH 4O51A 5SWSB 1V3JA 1UD6A 1NL0L 3MRFB 1FRGL 4JG0L 1W9XA 2X89D 5DO8A 3GO1L 4UTFA 3SDCC 4DFHA 4N9OB 1W0VB 1CLOL 2ZUYA 4FMFA 5I1JL 4JO2L 5GNYA 1E27B 3SGJC 2FX9H 4LIQL 3VG0L 1TQUA 1XMWA 5CJ5A 2IBGA 3LQMA 2OTWB 1CT8A 2YD6A 5FHBL 1LP9F 1E6JH 3KXFE 4RMWA 5GGSY 1WDQA 5EC2B 3U1SH 5DK3A 4DKEH 1TZIA 4OCRL 2DLEA 4Q74A 2D7PA 5F93C 2R1WB 2CKRA 3TGXA 1T83C 1MNUH 4KZEH 1NAKL 1OL0A 3QEQB 3DHUA 1N6VA 5KJRH 2OW7A 4UNIA 3QI9A 5KG9B 1VFBB 5DA0B 4PJFF 4KI5E 4NHCL 4Z7VF 3QWQB 4PGEB 4F7EA 2JEPA 4OIFA 4QOKE 1GAFL 1B4JH 3QZWG 4PTTB 5CMAA 5T3XL 5F9OH 4Z7WE 5ERWA 2OTUA 4NQCD 1F5WA 1QBLH 2XTJC 1JYVA 5A16A 3QIWA 2J25A 4XVUC 1KIRB 1RJLB 3FXYA 1BGAA 5FECB 4FG6D 1HH6A 3WQ5A 3EJZC 3O45B 1MHEA 4HX1A 4C83A 1LDPL 2CD0A 2Y24A 1QPPA 5C07E 4DQOH 4X5XB 1UCBL 4M5ZH 4WJXA 3AXXA 1FVEB 2WPGA 1YUHA 2NY6D 1XGQA 1BZ9B 4FQIL 4XWGH 3T4AA 1LE9A 4JRYA 1NDMA 3WQVA 2BNRA 5MERA 2VYRE 4Q9QL 3QG6B 5E1AB 4J4PD 3O9WB 4GG6B 4WSJA 5I1EL 1DLHA 4Y16C 3HMXH 4NQEE 4FRWA 4FQHA 4RNRB 4MNQA 4X98A 5DVMA 5I0ZA 3VXOA 1LO2H 3W27A 3W4RA 5C0AB 3CFJB 1VA9A 1J8HD 4KVNL 2WMFA 3N18A 4PJ5E 4WI4A 2ADFL 1GOWA 1YEEL 4EVNA 4L3CA 3LKOB 4ZOEA 1BBJB 2DSZA 5EN2B 4MA3B 5IVOA 3UO1L 4Y4FA 1F8TL 5E9DA 3H9SB 5E95B 4ZYKB 4CDGC 3BWUC 1RJYA 5D9SB 3UETA 4Z78B 2WYSA 3S5LA 4OKVA 1V3KA 1BFOA 2YKLH 5DUMH 5C08E 4K55A 2F54B 4K2UH 4FNPA 1NBZB 2FHFA 3GMRA 3HNTH 3QXUA 2J6EL 3C09B 4FF5A 2NY0B 5H37G 4A3YA 4NJAL 5DRZA 1XGTA 5B8CA 3V0VA 5E94B 1PVHA 4JDVB 3QULB 1DEDA 3PUCA 5C0FB 2MOVA 1QBBA 3RWHA 2YWYA 5I1AB 1T1ZA 1LQ0A 3V6FB 3UPRA 5DFVD 1FO0A 4JZJB 3MSPA 4XPBH 1UZ4A 4BH7A 5KANI 1G01A 4HA3A 2YA1A 3F7YA 3FB8B 5EPMB 5IHRA 3O4OB 4FQQA 3N12A 4LFHG 3U83A 3SGKC 1A7QH 3VXTA 3B9AA 1FGNH 1ETZA 5J6GB 2WMPA 2ZUQB 3CZSA 4JFDD 1EGJA 3ULUC 3HZVA 3OJVC 5FCUL 1OD0A 1SHMA 4H20L 1OD9A 2J7HA 1JD7A 3VFWB 2NR6D 5JHDE 4N42A 4LLVB 5TF1L 3AYRA 1FNFA 4O2FB 1VGKA 4NO0A 4M8QB 4PJIA 1I1FA 4JO2H 1EEUA 1JF1B 4Z76B 3H9YA 2P8PB 4L8DB 4AEIH 2PYEE 3QWOA 4WUUD 5KSAA 2OLHA 3N9GH 5I1KH 3UR8A 1JPTH 4S11A 2GVYA 1CDYA 1TVHA 3LKRB 1H15A 3UTZA 2BVDA 3O6FA 4F57L 1LP9A 5EOCJ 5EO9A 1B2WH 4GRLD 4J3UA 4MXWL 2AMGA 1YEKH 1UB5B 4MA8L 1A14L 4M43H 4TTDD 1DEEB 1G7IA 4KMLB 1O0VA 2VISA 5KZCB 1LO5A 4LRIC 2APBA 4LCCB 1R85A 1SY6H 4PJFA 4X4ME 4D71A 5FYJD 4FFVC 4Z7VA 3AREC 1NEUA 3LZFH 5L88H 1I7RA 1KR0A 1QTYT 4GMSH 2Z31C 3DI3B 4EZMA 5GGVH 1LNUB 2FIKB 1T5XA 3IT8D 1NCDH 4FXKB 1QI0A 4XTRC 2PR4H 1QPKA 3GSVB 1PZ5A 5A2CA 1UADC 2JF7A 1NMBL 5CZKA 1MRCL 3UTQB 3GXIA 4JFYB 3UXFA 1LO3H 5FYKD 1JV5A 3QNZB 4TNWF 4OKDA 1RUAH 4PMQA 1AGBA 1WBXA 4PJ8D 2AXFA 4DOHE 4RGMC 4X6DE 3O6KH 3D25A 4AH2A 5E09A 2EPLX 3TN0A 2OZ4A 3T0XA 1FJ1A 4MNKA 1ZLSH 4PY8I 1F2QA 1P1ZA 4NQXB 1H2JA 3M17A 2XYLA 1MJUH 5C0BB 4C54A 2BSTA 1IT9H 3RNKB 2B1HH 3VXUE 1REIA 3SY0B 4UQCA 1N0LA 3RWDB 4NFCA 3P11H 3BPLC 5FDWA 3BRDA 3L9RB 3II1A 4MDIB 1NMCC 4KK8D 1HCFX 2D24A 3GI8L 2OJEB 1JWMA 3D9AL 4S3JA 2ADFH 1QRNE 2MTPA 4PJXA 4XB7A 1IAOB 3IETB 3WFEL 2B31A 3D6GA 4LQFH 4PUBL 5F9WB 1G9NC 4AENA 3PZOA 1EHNA 3HZYB 2MWCA 2NY6B 4YDKH 1E6OL 3C8KA 4WTZA 1KN2H 2AK4E 1IGJA 3I50L 4NSKA 1NGZA 1DUYB 1IARB 1ZT7B 2MQCA 4BK5A 5HDRA 3D69A 3C2AH 3VFSA 3BWAA 4X4ZA 1MHCA 5BV7L 3EYPA 3TNMB 2CERA 2X4QB 1WIUA 4IS6B 3ALGA 1KT2B 2ZIDA 3BW9A 1VCAA 4GAYB 4NJAH 3WNOA 3LEVL 3VO0A 5CUSH 2E9BA 1V03A 2ZNXA 1ADQA 1BD2D 3S36H 3GMOB 5I1IH 5IJKC 1D6EA 2QTEA 3HG4A 4OM1L 5IF0B 5SWZE 1JGVL 2GK1B 3SDCD 5D9MA 5ECJE 4W6XB 1RUKL 5D7JC 1VEPA 1YN7A 3OV6A 5J3HD 3QJFA 4HU0A 3P0YL 4LIQE 4OB5L 3FT4A 4UILH 1U95A 4ZUSA 5L2JA 2MHAB 4TUJA 4OLWL 1CG9A 5FV1L 1KBGL 3NAAH 4KRUA 1IAKA 3PG2A 4NO3B 1LDSA 1PY9A 5A6SA 2VN4A 3AYSA 4GMTL 4RRPA 2XI9A 3NUKA 1XIWD 3V5DA 1GGCL 1EGJL 2R15A 5TPWH 3IDNA 3V7AG 3WIFA 2PF0A 3MLZH 3AICA 1DQDL 3L4TA 4R9HA 5BWFA 5T3XE 5GS0L 1N4XH 5FOJA 2UZXB 3WDRA 5C7XH 4XMKH 4RGNC 3FO2A 5IQ7L 1EEZB 4ODTH 4NWTL 4XVUD 5LGKA 4E41E 4I0PA 1A8JH 1E9LA 2L4OA 4BJLA 2D7NA 4MHHI 3K3QA 1H5VA 4PR5A 3EJZD 4WO4B 1IKNC 3IDYB 1EEYA 4JKWA 3VXQB 4KK5C 1UR1A 2NMSA 4X6CE 4LAJH 4JY6A 3SDXE 1QSFA 3REVA 4HFUH 1YQVH 3M8OH 3MRPA 4KXZI 4P9HC 43C9B 1A6VL 2XV6B 2FNBA 3KNBA 2H2PD 4R4BB 4Y16D 5DVOA 3W39A 2FGLA 3QXDB 3A47A 4OUUA 4YXLL 1OAYH 3OGOE 4Q6IB 3HG2A 4JE4B 3W82A 3ARDB 2OSLA 4POZC 4ONFL 5FK9B 1AR1C 5D6DA 1JYXA 2VUYA 1U8PB 1UWIA 2EDTA 1X9QA 3FFCB 4KJQC 3TVMB 3D3VA 2ENSA 5I19H 4ZTOH 1LK3L 1KXVC 3ARWA 5HGAB 1QZ1A 1VJSA 2J7DA 1AQ0A 1UASA 2OZ4L 4HZ8A 1UWUA 4G6AC 3P4OB 4H1LA 1SEBA 2WHKA 1YDPA 5SX5K 5TGBB 5GZOD 3PN8A 2V17L 4TVPH 2OR7A 4HQQH 4MB3A 5GRVL 3HG1D 3WHXB 4P4KA 5F7HA 4A4AA 1ODZA 2O5ZH 5AZ2H 1BQLL 4EI6B 5GGVY 3DVIA 4MD4A 3SCVA 5SWSA 1BGGA 3SOBL 4LEXH 4JANA 3QDJB 1V6WA 4D9LL 1YNKL 1L6XA 2H32A 4I48A 1UR9A 3QBTB 2AV1A 2ZJSH 1E6OH 2YMXH 1W0VA 3MUIA 1OT2A 1NCUA 3BX7C 4B15A 3V52L 1NBVL 1Z2KA 1S7XB 1BVKA 4I9WD 3AFBA 2GITB 1AXIB 1UD3A 1WSST 2EO1A 4Y5XB 1VPOL 5JO5B 4NJ9H 2MKWA 3Q1SL 5E03A 4QRQB 2XQYG 3MV7E 2JCCF 2G2RA 1CFBA 1X4YA 3QZWA 4XP6H 4YX2H 4U1MB 3ULUD 1LWHA 1AE6H 1HJUA 3Q6FA 3L4WA 1WWBX 5ANMB 1OGGA 2W67A 3G08A 3WDPP 4NQSB 2ICWI 2QPSA 1ADQL 4NN7C 3PXJA 4HIIB 2OXGA 4LARH 4D9QE 3O3DA 4CUCA 1YY9C 4XP9H 5BRQA 2OJZH 3IGAA 2YK1L 4HUXA 1E6PA 2CIPA 1FO0H 4UB0H 5ITFA 1VRXA 4MLSA 8FABB 3OTTA 1QI5A 4GUPA 2O5YL 4H5SB 3WSQL 2C4FT 4DZ8B 1AKJA 2J88L 4YO0B 2GJ6E 4FQJL 4MAYD 3QGVA 4GSDH 4EXPX 4I3RL 5FECA 3S3PA 3WFBH 2X44D 1GGYA 5KSBB 1KTDB 2OI9C 4XZUA 4XP1H 5K9KB 5EA0L 1IMHC 1MSPA 3KYMA 4MQXC 4OZ4B 5AYUH 5HY9B 5E4EB 5HGGS 4WW2C 1Y18B 3S96A 1NFDF 1QVOA 4YNYA 1BVZA 3GSUA 3ARED 2N1KA 2XKSA 3O9WA 3ZJKA 1JXKA 4ZFMA 5FM8A 1ZL1A 2R0WL 4H8HA 3VGHA 4U31A 1HKIA 4XTRD 1VBUA 1MCKA 2GT9A 3O8XC 2FIRT 3KHOA 3AB0C 3DTXB 4LU5L 4ZSOA 3QDMA 2DM3A 3TT3L 1A6WH 2AEPL 5HVFB 2HVJB 3MO1B 3QO1A 4XP5L 2HG5A 1RIVL 2DQFB 1SJHB 2R69L 5IG7B 1WV7T 2HKHH 4MA3A 5BZDA 4BCEA 4HK0A 5CINL 3S35H 1N7ML 1KUMA 1P4IL 4JRYE 2BNRE 1WQVT 5AC4A 2XTJB 1JGUL 1KEGH 3H3PL 4N5EC 2ZUUA 3VM5A 1BFTA 3EBVA 3WUBA 1AQMA 3CTTA 1ULVA 4MNQE 5GISH 1VGEL 1J5OH 5JOFA 5FB8B 1U3JA 5M03A 3BMVA 4PB9H 4UOQA 4AZBA 4XB3A 4RBPK 3QIUA 5F70A 1Q6CA 3TM6A 1X4XA 1GOFA 5IB1B 3OXRA 2JB5L 4OGYH 2I5YL 2E6PA 5BW7C 5HYSG 3F62A 1H9VA 3BP4A 5DJZB 3FW6A 5E9DE 5K59E 4P2RD 5FF6B 1UM4L 1D5IL 2XACC 2AK1L 1SYVB 5A6BA 3ZSTA 2X4UA 1EHLH 1LO4L 2D4DA 3QCUH 1R3LA 2VX6A 2VURA 3VD5A 4P23C 3WXWH 5KTEH 1BZQK 3F7PC 5BMFL 5FUCE 3MSGA 1YNKH 4FLOA 3VFPB 1AQDA 2QADC 3LN5B 2DKMA 4X83A 5D7JD 1M05A 5GSRB 5EU6A 1IGFL 2X4OA 3N85H 3GDBA 1NBVH 5JW3H 3VFUA 2C3GA 3UG4A 4G3YH 3BIBX 2J12B 4KQ3L 2VDOL 2HH0H 4MQ7A 3HZKB 4OFPA 1MOEA 3LKRA 1Z9LA 3MLRH 3OGSA 4ZUUB 4UR9A 1T1YA 5AY7A 4N0YH 1YQ2A 1QSEB 2FDBP 3NFNB 5DEFB 1S7VA 3MUHL 3V8OA 1FZKA 1UB5A 4LSQL 5IEKB 5ICZB 1X5HA 2JCCA 4XNUL 2Q6WB 4BH8B 3DV6B 2VNCA 2R29L 3G6JB 4GAGL 4LLWA 4P4RA 4XCFL 4R7NB 2P4AB 5LGHL 1TCRB 4AC1X 3GMMB 4PJIE 5I15L 5D7SL 4BSWA 4RGND 4LCYB 1E73M 1UJ3B 4R4FL 4Z7NF 4OIAA 5C6TH 4W93A 3VIGA 3UAJD 3WEXA 1W9DM 3ARVA 2WCGA 2GSJA 3DYPA 4WJ5B 4QXWA 2WZHA 2AJXH 4M1DH 1EBPA 3ROLB 1BZ7A 4PJ7B 4HOWA 1MWAH 1NCWL 4X9FA 1LP9E 4HIXL 5BXFB 1CN4A 1MFNA 3ES6B 2NY2C 3EYVA 2CIIA 5DK0B 3FQUA 5EH1A 4ERSH 5CEXB 5C0GB 2AI0L 3OSKA 1CL7H 3FOLB 2XXCB 2D9CA 3BT2L 3VG9C 1HKKA 3BP5B 4I77L 3RWJA 3L5XL 3IJHA 4H26A 2RAMA 1NFDA 4L4VD 4MB4A 4PJFE 4Z7VE 2V3EA 2XM2A 1TITA 3RWDA 4HMCA 4W86A 3CDCA 1G6RA 4M02A 4NPYB 2GFBB 4ODWB 2H8PA 3NDZA 3RU8L 4LU5H 3MXVH 4POZD 4YBLB 5HI3D 4F58L 1AR1D 3IKKA 1IAOA 4NNXB 2ZCLL 3U0WH 2HVMA 3L3OA 3MUGA 3T2NH 3KPNA 1GCYA 4HLZG 4IDJL 3IFNH 1MCBA 4KJQD 1A6ZB 2FLRT 2VAJA 2P1YA 4Z18A 1CDHA 1A3RL 2QMJA 2L0DA 3KPQB 5BCAA 1M4KA 3H8NA 4G43B 3LKPA 1XR8A 3PGDB 2NNAB 4LXFA 2OXHA 2VDKL 4G6AD 3CD4A 4H8VA 3ALPA 1P4IH 1ZT7A 2WHLA 2Z31B 4AMWA 1MEXL 3EOAB 3ZDYF 1MXGA 4WI6A 2XSBA 4OM0L 3CCHB 2ZUWA 2CQVA 2GUOB 2W9DH 1AGFA 3ESVF 1GJWA 3KLDA 1J1OH 3MNVB 3MODL 5E8EA 3S36X 1LL4A 3JWDH 3IFPA 4TOQA 5ID1B 5CHNB 3WKNA 3AIBA 1KEMH 1NCTA 4G6ML 3CUJA 1IQDB 4JY5H 4PJXE 4RGMB 1BM3H 1XSJA 3SJVB 1JWUA 2VLJA 4HMDA 2GK1A 4MJ6B 4NUJA 4O5LH 3TZVC 3V79C 5HDLA 1FG2B 1QRKA 3MV8A 3MJ9A 3RUGB 2IWGA 5FHAH 4HWUA 3PP4L 2R4RH 4OV5A 3BLPX 4H1LH 3IDXH 3CZLA 4HPGA 2MHAA 5FO9B 3BPLB 3BSZL 4R7DB 3U2SB 4O9HL 3UTPE 3L6FB 4I18A 1LO4H 1R5IA 4PGCA 1NMCB 3H7LA 1Y7VA 4DGVL 3ZOAA 3I75A 4JREC 1HJSA 5GIRB 1EDTA 1QR1B 1LEKB 1MCDA 1CS6A 3T1WA 1VFMA 5D1XB 3TYGL 2GHWB 1T0PB 3MRGA 1N3NA 2A6JA 2JELH 1P9MC 3RPMA 2H3NB 4KK9C 1U8HB 1Q9OB 5DJCB 5SV4A 2CLZB 2XWEA 3MV01 2XXMB 3RL1B 3H0TA 1E6ZA 5J0BA 4PGDA 3SCPA 1XCTA 1DWJM 1LF1A 3X11A 4IM4A 1Q9WB 1X7QB 3IU3B 4KTDL 3RILA 1J1XH 2AXJA 1IKFL 3BKYL 1WITA 1UWTA 4MQXD 3MRJB 4DJMA 3VU2A 1Z9SA 5F1OB 2J8HA 3GXFA 1WZMA 3PWPA 5D7JB 3CH1A 4V28A 5DWUL 2BC4A 2ZCKL 2FZ3B 3EHBC 4M1GL 3NPZB 3U7YH 4TX6A 4Q6IA 3MJGX 4XCCL 4LHUD 1TDQA 2N4IA 3CHDA 5DC0A 5CP3H 5DC4B 3HRZB 2B2XL 1I9RH 4C56E 1EA9C 3W53A 3FFCA 4D6FA 4Q6YA 3TVMA 3ZL4H 2D3NA 3L3DB 5E00B 2R2EA 1NBQA 3GMQA 1BOYA 3GXNA 5BRPA 1QSFE 3BUDA 4X7SH 5FEBA 4HUUB 5TE6H 3EO0A 1KELH 4YBQC 2EIEA 4GXVL 4N5ED 4X80H 3BN9C 3CZNA 3SDAB 2WBWB 3BZDA 1Z6JT 4PRPD 4GG8B 1G6RL 1U8OA 5INCB 4BKLA 4ZAKA 4AZ6A 2DL2A 4LPVA 2XT1B 4F9PA 4HZ6A 3LXAA 1EH9A 1GOHA 4IDJH 1CDIA 5F7NC 3CMJA 1SVCP 4U1IB 4LSVH 1OHQA 2A3HA 4P7LA 1A6UL 1MRDL 3D3VE 5DS8B 3IB4A 4MCZA 2VLRA 5TQ0H 2D0HA 1UKOA 2BVUA 2NX5A 4OLXH 3CO4A 4AXNA 1MEXH 4HWEL 3LPGA 4IMKA 4L9LB 1S7QA 2Z8RA 2CDGA 1FHDA 4XAKD 4YE4H 3NTCL 4P3WA 1KPVB 4Y5XA 2EDWA 4GZJA 4L3EA 1KGCE 1UENA 3SE4C 1HJQA 4BQCA 1PBYA 3ARGB 1F4WH 1S5HB 3OKYA 3WD0A 1IE5A 2IH1B 1C12B 4U1MA 3X17A 4Q9RL 4P23D 3UTSD 4ZD3L 1UD4A 5ICXA 1YMMD 4HMEA 2P7TA 2DLGA 5ACZB 5SWSE 4DN3H 5ABFB 2E8ZA 1JZ3A 3AGVA 3A3HA 3NIFE 3QCVH 3KWWA 4TVSa 4JZOA 1QO3A 2HT2D 3QP3A 4WNQA 4GXUM 2P8MB 3BOVA 1GHFH 3MJ9L 1TIUA 2BSRB 1DBAL 1MYRA 2YD5A 4ZUWA 4R0LA 3B8SA 3PV6B 4ZMAT 2ZUMA 1GPOL 3BZ4A 2VLLA 3P9LA 4JPVH 5ALBL 5E6YA 4K7PH 3BH9B 3KJ4C 2FYYB 4JRXB 1IM9B 3GZKA 5CSZA 4U6TA 1MY5A 3PZUA 3MRHA 1ISVA 3MOBL 5HHQB 2AQ1A 5CWSB 5JQHC 4XCYA 1F45A 2UV3A 2XIIA 4G9FA 1FYTD 3W9DB 1YEFL 5HGBB 4CVWA 2GJXB 1FSKC 3OXSA 2VZVA 2I9TB 4LYQA 3SCNA 4X4YB 1E4XH 3EYSL 4R2GD 1QI2A 1NM9A 1EDQA 1HL8A 1T0MB 3B83A 1JN6A 5HI5C 4NNYB 1T89C 1MIEL 2NY1C 2NW3B 3EYFA 3MXWL 3ZKXB 2OSXA 1SEQL 1I3RA 5C9JA 2EICA 1FP8A 1AQKH 3S35X 2BY0A 1LVEA 2WM0A 5C0JB 5IG7A 3QXVA 4HA1A 2H6PA 4YWGL 3JTTA 1ITCA 4HWBH 3U0PB 2BHZA 3AMLA 4NRZB 3OLEA 2MKLC 3SQOL 2ZE0A 1T3FA 3DMMA 3IXAB 4WENB 4AG4L 2J8UA 4NRSA 2E6JA 4PJ9B 1TTFA 4WCYL 4Y8AA 3VRLF 3KYKH 2V7HB 3Q6GH 3ROOB 2WMGA 3TA9A 4Y19B 1KB9K 4F7PB 5MP6H 5HYSA 3RIFK 1A1NB 2XA3A 1OLLA 4ZSOE 3QDME 2WCAA 5IV2B 3CSYA 1VEMA 1Z9OA 4OI9A 3NIDF 2BNUA 2X7LB 2WNWA 4WW2B 4WKHA 2I26N 1DQLL 1KENH 4F9LA 4Q9CA 3VW3L 5T3ZH 2J1KA 4PJDB 2O5XH 4F3FA 4BA8A 1MJ8L 4AL8H 4Y5YC 4TPRH 5D4QA 3WD1A 3V4UH 1TVDA 1SYVA 3V6BR 1IEAB 3O8XB 2KQMA 1QLRA 5IB2B 1CZ8H 4D6EA 1CPUA 1GGBL 4YK4C 3RHWK 3NZHL 1ZEAH 1ZLUH 1OGBA 1UB6B 1K5NA 3BP6B 3QFJD 3DROB 4HWZA 1AD9A 2DD8H 4DN4H 5FUZH 3P9MB 4HHAB 4LF3B 2YPLB 1JAKA 5C0NC 5E6IC 3TZVD 4CD5A 5HD8C 3LH2L 1SVZA 1UQSB 2PUQT 2GSGA 3UYOD 2VT0A 1CYGA 1V02A 4HXAL 4ORZC 5JHLH 4XNZC 1RULL 4JO4L 3WNMA 5FAAA 4X99B 4U2YA 3T2PA 5EOCL 2VDMH 3BHBA 5EBMA 3HNVH 1A4KB 3P4NB 4PJAA 3SHSA 4PTUA 3IJ7A 5DEFA 3CUIA 4RMSA 2IANB 1KYOK 4AEEA 2F15A 1CF8H 3AZRA 5ICZA 2IF7A 2UY7A 1EFXD 3L7EB 4BH8A 1P2CA 1AHWB 2E7MA 5KS9F 4E8DA 1XF3B 4WU7B 2EDJA 4R7NA 3DX9A 4N8PA 5IB4B 3RCNA 1H0DB 5I18L 1TCRA 4LOUC 4KK9D 3M45A 1QX1A 3B9KB 5EU6E 1UJ3A 4NIKB 12E8H 5ESQA 1HX0A 1G0CA 1ACYH 4EE9A 4QKXB 4FFYL 2YN3A 5D8JH 3PV7A 1KJ3L 5EULV 2BOBA 2Z92B 2FX8L 3JWNC 4HW6A 2Q86B 5HPCA 3GSNA 2F53A 5BXFA 5C86A 5FIPA 2OL3A 1XCXA 4PRWA 5E8NB 1MRFL 3NIGE 4HPHA 2WK2A 3TOPA 2JCCE 3O3BA 4BFIA 5KVDL 2QADB 4KUCF 4U1GC 2EZ0C 2DQUH 1F13A 3IJ9A 4M6NH 3X14A 1E5NA 3BE1H 3VFRA 4JDTL 4OLVL 2QSVA 3EHBD 1IAIM 4UIMB 5DK2B 2ZSVB 5C0CD 1H09A 1XV8A 1JRHL 2GFBA 1Q6EA 2LV4A 3KYNA 1P6WA 3X13A 2PWDA 1MIEH 3RY6C 1NWTA 1NLDL 1KCUL 1SEQH 1BAFL 3MRMB 2DMBA 2WUCH 3NSNA 2OTPA 1U41A 5FGCB 3BZEB 2I60L 4CKQA 3WN5A 4HS8L 4CU8A 4E5XB 3VWJC 2X4PA 5DJYA 4UT6L 2VIRA 4BQ4A 4DFIA 5JDSB 4PRIA 4G43A 1UGNA 1FYTB 4PREA 4TUKL 5T3ZE 1OCQA 5E24E 5BRZD 4K7PY 2OSYA 4HGWB 2IPKA 2WQ8A 2VVSA 4N8VB 1AY1H 5HHXL 3SUVA 1JGLL 3QB7C 1NFDE 4YBQD 3BN9D 4WCYH 2GUOA 2ADIA 1Q0XH 4NXSA 1BFVH 5I9QB 4XP4L 3GM8A 1TNMA 5CG0A 5ECUA 2CITA 3D0LB 2AJYL 4C7DA 4O2CA 3RZWA 3A6BL 4N8VG 5I75B 2D22A 4R90H 1JWSA 1NEZA 4NZDA 1OB1A 5GGRY 2NY2B 5GRUH 1XC6A 4WGVB 5C9KA 1U8QB 5H2BB 1HOCA 1HTYA 3HAEH 1BREA 4YHKH 3VDBA 1BLNA 1CICB 3VW3H 2FB4H 4AZGA 3F12B 3N13A 4LLMB 4N90D 4J3XA 1AJ7L 1R3HB 1FVDB 4J27A 3I2CH 2QSCH 2JKXA 2P8LB 3ILPB 4DO6A 4MNGE 2EJ1A 3F5KA 3LKQB 4H7VA 1U92A 3VXMB 5LJYH 2YHGA 1WO2A 1W2VA 2I07B 4WFGD 3U2SA 4P2OA 4PRBA 1VKXA 3GXMA 1YC8A 3AI0A 5D5MF 4DWSD 4S2SB 3H2WA 4HEPG 4ZDHA 4QCEA 1MFEL 3GRWA 4JAMA 2RFXA 2R56H 1X4ZA 5TH2A 5MENB 3WCYA 3JWDC 3H7BA 3AHVA 3X12B 1ESWA 3K74B 2DQJL 3RVXC 1A3LH 2VLJE 2ITDB 5IHUL 1HF6A 5F7DA 1G0XA 1IGYB 1BEYL 5T1DL 2BP3A 4JO4H 3P77A 4GH7B 3MV8E 1IILE 1TQBC 3CX5K 1R5WB 1T03L 2WBKA 4UZSA 5I1LA 4C7GA 4W4OC 3V7AE 2NZIA 4DGYL 3WF4A 4E9LA 1FL6B 2P43B 5D7LD 1JI1A 5IBUB 5GRZA 2R8SH 5HDQL 4Y0GA 3QFJB 1OM3L 2H9GB 5BS0D 4UTAH 2OMNA 5E9AA 2EKJA 4NNPH 3CMOL 4HUMB 4S1QH 3FFDA 5BJTB 1PBGA 3DWTA 5KS9A 4Z0BH 5IBUG 1C08B 5IFJA 1A9EB 4J3WA 3LQAL 4KWUA 4CJ0A 3ULVF 4W87A 4NFDA 5FO8B 5D70H 5FV2A 3CC1A 3TH3T 3OG4B 4APQD 3VKKA 1LEGB 1X5LA 3WFCL 2CBIA 1YA5A 1YY8B 5HI5D 4FFZH 5IHZB 4LRNL 2NY1D 4P9MH 2X05A 1S9VA 2DYPA 1W9BM 1A7NH 1KLUB 5K9OB 2OM5A 5EO1A 4JREB 5EIIB 4NT6B 1G1CA 2VXUL 2CKBB 4HDIB 4PJBF 4KDTA 2CO7B 3OKDA 4MDJB 4GZEA 5A2IH 3MRCB 1E4WH 3BAEL 5AWNL 5L6YL 2OW6A 4ZO6A 4PB0H 4TTGA 2E7BA 4JPIA 1U8NB 3LS4H 2KPNA 2W1NA 3PWPE 1F3DJ 3C2SA 2WWCA 4DM1A 3FTGA 2DKUA 1MAML 4P0DA 4B16A 2J8FA 4UUJB 3DVNB 4L4OA 3UTTD 1A3HA 4OJYA 4DCQB 4OZHF 3F8UB 4Z7NE 3G5XA 5EZIH 1TUXA 4ONOA 4YH6A 2XZZA 1C93A 2LU7A 4IIQB 5CJXC 4U7KA 3AS2A 3TBVA 1KCLA 4UFKA 1LEIB 3FFCE 1WP6A 5GJSH 3WH7A 5HDOA 5J56B 2BVQA 5CKAA 5A40E 4PRDA 3PHQB 1FNAA 4P46C 1CD1A 3AIQA 5DI8A 4DVRH 5C3LD 4CD4A 5AG9A 1TNNA 3NVQA 3VOCA 2XYCA 4JM2F 1MFBL 4ODUB 3WF3A 3DVGB 1E4XI 1VACA 4C55A 4YPGB 1IGIL 1I3GH 2I25N 3VIPA 3E6HB 4OI8A 5FOBA 4GT7A 1CECA 4QRPA 4X9IA 3BH8B 4J8RB 4X4XB 5ACZA 2V9RA 1G7LB 2ZZUT 1FNEB 3X3FL 5K9QI 1RZ7L 5C0ND 5T1LA 3AUVA 4GKZA 5E6ID 4L1DA 5HD8D 4EN3A 3EMZA 1UA3A 5CEZL 5J7CC 3MMDA 1U8IB 4JAWA 4OF7A 3UBXI 3D3AA 4PJCA 5D71H 2VLRE 1LHZA 1GYAA 4YDLC 2NX5E 3OQ3B 1A6TB 1S7UB 1WF5A 1Q94B 3ZDYE 4LCWB 4L3EE 5IW1A 4GJTB 1O7AA 1S7RA 4Z2KA 2EPMX 1I8IA 4NO5A 3SCTA 3AAZB 1S7TA 1INQA 1UKSA 1B0GB 2DI8A 4HJJL 4OT1H 4FMVA 5M17A 3GRWL 5IP4A 3FO1A 3OKOA 5I73C 1XFPA 3STLB 3D39D 3KL0A 1YEIH 2F9BT 3BKJH 1C5DB 1RIUH 1RURL 5I71B 3HE7A 1NUNB 2NLJB 2HWZL 5JQ6H 3MROA 5DMIH 1ND0A 2HAZA 4LOUD 3U30B 4M29A 4E42A 1E4NA 2PNDA 1FFRA 2ZCHH 1FN4B 3L7FA 4U6XA 4DM2A 5A2AA