1CXZA

Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
SMAAIRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181))
total genus 58
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 1999-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cxzA00
2J0UA 4N0EA 3TE6A 4WXRA 5JJKA 1L7VC 2WJVA 4H1VA 3MWJA 4UJ3A 2G9NA 3MRSA 1W4CA 4LSGA 3RRZA 3EAQA 5CK4A 1XRJA 1TAGA 1ONBA 1TQDA 3PUYA 4ASUA 2ZI9A 3JVVA 3QBTA 4AKEA 4A15A 2O8EB 2ZE5A 2HT6A 3RS2A 1JI0A 3IUYA 4ON9A 2GVZC 1VCOA 3Q9LA 3M4YA 4V0NA 3TSWA 4DDUA 5JRJA 4QHSA 4EJSB 3OE7D 1HT2E 1NG1A 3WMEA 4QRHA 1KDRA 3DOFA 3ZS9A 4EPWA 3C5CA 2A78A 4Q66C 5E4FA 2HJGA 1R0YA 2JJ8A 5CIWA 3W5JA 5B30A 3AVYA 2BBTA 1IN8A 1COWD 1XMIA 3R9WA 3FKSD 4M1MA 2IX3A 2VHQA 2FA9A 5KPJA 4DIDA 3A58B 4XTRA 2I3BA 3N70A 1RVDA 1RJ9B 2BHRA 3U3KA 4C0KA 1VIAA 2AFHE 3CRQA 4JL6A 1N6LA 3DM9B 1KDPA 3RS3A 2FDCA 4HAVA 3VMFA 1MRSA 4DZZA 1R5NA 2O0KA 5BN3A 4XWKA 4MDFA 2XEXA 4M1SA 2QM7A 1DAEA 3CNNA 3E1SA 3FMIA 3WXMA 4BASA 2LKDA 3OZXA 2EYUA 3HPRA 3HU1A 1KO7A 2NGRA 2QPOA 3RVBA 3T15A 1U99A 4ZDIA 4MDEA 2GCOA 1JR6A 4FMDF 4CIDA 5FH9A 2WOJA 2A3RA 2OT3B 2IYLD 2BEKA 1KI1A 1OSNA 3GEHA 5LB2A 3AVTA 4OQNA 4PANA 3FFBA 5D3MA 3TMKA 2O8CA 3FHTA 4Q4AB 2YJTD 4RZXA 4EFLA 1IONA 2AWNA 1R10A 4PAOA 1KTVA 1R7RA 1NKTA 2ZJYA 4Q01A 1II0A 4HB4A 4ESHA 3SJBA 4KITB 4DXAA 2BCJQ 5DN6D 3B13B 3HDTA 3O8BA 4OK3A 3QKRA 1UEJA 2PZEA 5EJEA 5FBWB 3F3YA 1CKEA 1Z3IX 3OESA 5C4MA 2CXXA 4NH0A 2G83A 3DKVA 3K8YA 4I1OA 3UANA 2W83A 3B5JA 4GL2A 4A8JB 3ND9A 2JLXA 1XZQA 1J8MF 3KXKA 3KX2A 1KI9A 2VF7A 3BAFA 4RCZA 1WB9A 3GQBA 3KJIA 3VX4A 4IOJA 3Q3JB 4JKIA 1G19A 1XTSA 5JRZA 3ZJYA 2CHQA 3HJNA 2VYFA 1FMLA 4ACAA 5EE5B 3TUZC 3P27A 4KV9A 2PZGA 2JDIA 3EASA 4TMTA 2C95A 2I1QA 1RPZA 2P65A 4M1TA 4MYCA 1YZNA 1KKLA 2WVJA 4LJ6A 1OIVA 1J2JA 3VX3A 3K9LA 5CB8A 1IXSB 4BFTA 4QGGA 4CYMA 3QF4B 1Z6AA 4GOXA 1TEVA 1KZ7B 4TL7A 3OE7A 5G3YA 4FMDB 1G6OA 1I4TD 1CF4A 4B3BA 2GA8A 3VR6A 4DLWA 2QAGC 4G1UC 3U4QA 4GSYA 1WF3A 4OHWA 2KWIA 2D3WA 3TK1A 4QL3A 4Q7LA 1RW4A 4RZ2A 3QQ5A 2W2VA 2N1BA 1G1MA 2GKSA 2OZEA 3NXSA 2RGNA 2D7DA 1A2KC 1XNJA 1TX4B 3I61A 1C1YA 2IYSA 2AL7A 4E09A 2G77B 2Z6VA 5TVKA 5A4JA 4JJZA 3GJXC 4I99A 3PVSA 2G0NA 2QP3A 1H8EA 3PUWA 1KNXA 4OK6A 4ZV4A 2BDTA 1XEXB 2ZUCA 5B2ZA 4MRNA 1IN4A 4URZR 4YMSA 2ZI4A 2ERYA 1OXXK 3ZZ0A 3KB2A 1DS6A 2C99A 2OXCA 2YC4C 2J46A 4NCIA 3T35A 5LDDC 2IC5A 1OHHD 5HR5A 2BV3A 1KI2A 4PFSA 1JR3A 2QT0A 5FBQB 2CEAA 2V6IA 4IOLA 4KO8A 4M1WA 4E07A 1CJVC 2CK3A 2ZE7A 5TB5A 5FOWA 2DFTA 2EFGA 2QROA 4MUBA 2FX3A 4IVRA 5ELXA 1CXZA 1I4DD 2JIZA 4FCTA 2P5SA 4Y0AA 5AUQA 5JS8A 2JLWA 5B57C 1IM2A 2GK6A 1T3SA 1XFAA 1FZQA 3ZIAD 2ZR0A 3B1VA 1P9WA 3CO5A 4C0HA 4F4CA 1D9XA 4RCYA 4DUGA 1IJFA 2IHBA 2O0HA 1N5KA 3HYRA 5G41A 5CITA 4PC3A 2Q9AA 4Q4JB 3M6AA 1JJ7A 1E9FA 3ZDQA 1IXRC 3SN6A 1GKYA 1U8YA 2F9LA 1WQ1R 2WWIA 3QY0A 1HA3A 1XD2A 2PCJA 3T06B 3X1DA 3PR1A 4DCSA 5AUNB 2GESA 3UKDA 1Z29A 3MJRA 4NBSA 1E9CA 3SJZA 1KO8A 3H2YA 1TQ4A 1OH7A 2J41A 4DLYA 1G8PA 2ZETA 5KHOC 3THXA 5EP1A 4TQUS 1IAQA 2ZI6A 2ANBA 3BGWA 4JZKA 1KSJA 1V5WA 4WZBE 1NBME 2H17A 4RKFA 3VHLB 6Q21A 1AKYA 4M9SA 4AC9A 1E2QA 3CH5A 1T3LA 3A4NA 5E95A 3EZ9A 1KJWA 4OHYA 2WWXA 4BFWA 2O8FA 4U00A 1SXJC 5AWFC 4YMVA 1NVUQ 3BB4A 1UPTA 4Q4AA 1NL3A 2ZYTX 3U4QB 2BWJA 3VU9B 1FNNA 1UKEA 3LXRA 4QC2A 621PA 4KBGA 1DG1G 4LCBA 4OKSA 1GILA 1N6OA 3DOEA 2IS1A 1BKDR 1ZRHA 2HJVA 2QNRA 5F98A 2ASEA 3QKRB 4HAYA 1EFRD 1G3IA 5FOSA 4F4JA 4RKEA 4WAUA 1E1QA 1DAFA 3SJAA 1VG8A 1P9NA 4BRWA 1P2UA 4L4UA 3W8NA 2J87A 1EFUA 1F6BA 1GSIA 1W4AA 1X1SA 3QKTA 5FFMA 2YOHA 1BYIA 4Q7KA 1VYVA 2GHIA 2WM9B 1NN3A 1ZINA 2YHSA 5EXSA 4XVUA 5EXPA 1KK0A 5BYJA 4R71A 1U8AA 5HE9A 2ECKA 1EK0A 1R6BX 4CT5A 3GLIE 3QI2A 4F38A 3FGNA 2R6FA 1ZVQA 3QKUA 4FMCB 3U3MA 4URWR 3CZPA 4TMXA 1YR6A 3RWMB 3VAAA 4WOPA 4ABYA 2QT1A 2WPDA 3RS5A 3R9XA 4JLDA 1CP2A 1OFTA 3PFIA 1WCV1 4TL9A 1D8TA 1NIPA 3TW8B 1TQ6A 4I1SA 1W0KD 4YXWA 1XPUA 3LY5A 1GNPA 1N6PA 3L82B 4TL8A 4C0LA 1E94E 5KSPA 4NONA 1Z2AA 5EUMA 3WNCA 2WKRA 4IJMA 4EPYA 2G1JA 2IHYA 1E2FA 1Q0UA 3A36A 3W90A 5BN4A 2UZ3A 3GFTA 4G3XA 3SQXA 4NE2A 1E9SA 4LK2A 3PUXA 2JLZA 4ZDWA 1QHXA 4P4UA 1DEKA 4TYQA 4EQ6B 3ZQ6A 2ODWA 2CCJA 1XEWY 1TF2A 2R6AA 3U61B 5BXQC 2CMKA 3N5CA 2H7VA 3HR7A 3EZ7A 2K5UA 2Q3HA 5KTYA 1E98A 4QM6A 2YVUA 1X6VA 2VL7A 4G5OA 1MO3A 4XSHA 1NBMD 5DGXA 2P6RA 4HATA 1TEXA 4HDCA 3BB1A 5DISB 5DYGA 2HUPA 2J3EA 4D4MA 4KVGA 1JBKA 2QMEA 1ZU5A 4TMWA 3H84A 3X2SA 4RD2A 1V43A 1Z6TA 5J4YA 1U81A 1KNQA 4OJKA 4ZCMA 2HCBA 1Z6GA 1T9HA 4IEIA 4B3FX 5IF9A 1AQYA 3KQHA 2VLIA 5FTMA 221PA 1D5CA 3GLIA 3DDCA 4EFNA 3QG5A 4PX9A 2I4IA 1EWRA 2XXAA 4EDHA 5AUPB 3OIUA 2JLSA 4PXAA 2RHMA 1W4RA 1CR1A 4HI0E 2FFQA 4N3NA 3R20A 1U0JA 4PQYA 4U7DA 3AEZA 1U98A 4YQFA 1QG4A 3L0OA 3TRFA 1GIAA 3A1TA 4D0LB 2BM0A 1FOEB 4UQOA 2AN9A 3C15C 4DSNA 4MA4A 3LQQA 4LZZA 1S9HA 1KI6A 2ZJ5A 5EZ6B 2WWGA 4KLNA 3BH6A 1EXMA 4C30A 1XTQA 4QJ3A 1DAKA 3UMFA 3AF1A 1G20E 3CIOA 1UF9A 3AUXA 1FMJA 1PUIA 4K8OA 4NTZA 1ZC4A 3TLXA 4AG6A 1YZUA 5TARA 1E79A 1UBFA 5F2EA 4TMZA 1KIMA 3ZZUA 4KFSA 1G7SA 3SNHA 3GJ3A 4GOKA 3Q85A 4Z51A 1S0UA 4ARZB 4RJLA 5BYKA 2FPLA 1UFQA 4FD2A 3FB4A 5KYKA 4U5XA 3C16C 4OBEA 4P32A 3THXB 4QKQA 4ACBA 3NC0C 4TSFD 2XNSA 4ZIRA 4CT4B 1E0AA 4MKGA 3FMFA 2NO0A 4QGHA 1MR3F 3BORA 5LPNA 3RABA 4RFSB 1DE0A 1EWQA 3SU8A 1G64A 2DHRA 2GBLA 2OBLA 2OG2A 3KJGA 1ODFA 2D7CA 5AJYA 2JDID 4KODA 1Z6YA 2RGBA 1GNQA 2NG1A 3TUJC 4QM7A 4DB4A 1MO6A 3Q5DA 2H18A 2OHFA 2GJ8A 2OCAA 4HAUA 1VCIA 2JCSA 4AWXA 4MYTA 3MWYW 4B74A 1AGRA 3UK6A 1Z83A 4ILEA 3FE2A 3KFXA 3SR0A 2GNOA 2JJ2D 4KYUA 4WXPA 3WP1B 1O87A 2XSZD 2GETA 3QXCA 1U94A 4RD0A 1GL7A 3KB1A 3GLGA 2RMKA 3B8HA 3ONWA 3EA0A 4MYUA 1E2NA 4ZKDA 1I2MA 4DT1B 1YZLA 2FPMA 3DL0A 4BLRA 1N0UA 4J0QA 5SZKB 4RZ3A 1S96A 3K0AA 5FBVB 3OFNA 3QXJA 3WBJA 3THWB 5CIQA 4JLVA 5B64A 4A82A 3A6PC 4QNRA 2ZS9A 4YLGA 4M22A 5E3HA 2PMKA 1P5ZB 4L16A 3X1XA 1LF5A 4B35A 3LWNA 3HU2A 1QHSA 1PLJA 4IEEA 2FFBA 1ZW6A 3OAAA 4CZ2A 4PPFA 3THYB 1NLFA 3TNFA 4DIEA 3IEVA 5AJZA 2VHUA 1YZTA 2B92A 5J5CA 3HYTA 2IXFA 4DLTA 4BFUA 4EUNA 5FTLA 1PV4A 1US8A 1ZD9A 4LHWA 1A1VA 1GL9B 1E9DA 3SFZA 3ZVLA 1VHLA 4OK5A 1KI6B 3GEEA 1XF9A 2WV9A 4A2QA 4NMMA 3EWSA 1HY3A 2R44A 4TL6A 4DCUA 1EX6A 4TMKA 1MKYA 4URXR 3KKOA 1G41A 1IQPA 1SXJB 1GDDA 3K09A 4NU0A 2A2ZA 1N5JA 4QNMA 4UNSA 3I32A 2QG6A 3CF2A 1O3YA 2PX0A 5JWRA 2GEDA 1N6NA 1W2HA 1II9A 5LD2C 1W0JA 4DSTA 3B6EA 4Z54A 4GFDA 4MITA 1XWIA 2C96A 2WAYA 3UWOA 4JKYA 1BOFA 3BFVA 4M4SA 3MGCA 2QGNA 4ZDJA 4MRSA 1ZC3A 1DAHA 1GITA 2C78A 4LYFA 4IVQA 4C9BA 2NO1A 2BBWA 4TYPA 4C0BA 2IYQA 2ZI3A 1QDEA 2R62A 4KBFA 4ZO4A 3QG1A 4RFSA 3VHXA 3UWKA 1VKJA 5FPSA 4X8OA 3IIJA 5A0FA 1CBUA 4B47A 4G5RA 4POAA 1G21E 2BEJA 3VTKA 4Q7JB 1Z08A 2HV8A 4MGZR 4KLZA 2QPAA 2VP2A 4JYBA 4AKIA 3FYHA 1NRJB 2VSXA 2OLJA 5H70A 2F1RA 5FTKA 4A36A 2NO7A 3RANA 2B21A 3X1ZA 5FOXA 1ZP6A 2IXGA 2ZRLA 1IN7A 3QVVA 3CX7A 3RDPA 3O8RA 1UDXA 3HPQA 4D26A 3EXAA 5UKDA 1ZIPA 1M6NA 2OSBA 4PSKA 2CHVA 4UXHA 1MRNA 5EP3A 3D3QA 4Q00A 3Q7PA 1CRQA 3AKCA 2XZPA 2P3SA 2XGJA 2NPFA 1S8FA 4DSOA 2CE7A 4HUQA 2A30A 2WWFA 5CM9C 1A82A 3S1AB 1BH2A 3D31A 2VP6A 4IDNA 1Z0AA 4D4JA 5GJWC 1E2EA 5TMPA 4PQRA 2E87A 1ZNXA 3LX5A 1PJRA 3VR3A 2JLYA 4ITRC 2O52A 3OEHA 5GVSA 3W6OA 1XPOA 4WVFA 2VP0A 4H1UA 2J0SA 2G1KA 2XTMA 5CLLA 3VKHA 3SEAA 2AK2A 2OFWA 5H68A 2P2LA 4C7OB 1ZJ6A 5C18A 2JATA 2AX4A 4LJ8A 1N5IA 2J5XA 1M74A 4Q4HA 1XTIA 1KYIA 1MABB 1Z6XA 3U3RA 3SZRA 2AXNA 3QIAA 5DSZA 4IFBA 2A9KA 4AY2A 2JGNA 1GVNB 4I81A 3CLVA 1VCMA 3BH7A 1KJZA 3REFA 4TN1A 1KK2A 2ORVA 1QHYA 4DB2A 3H86A 3LW8A 3EPLA 2ODBA 3I1FA 5CJPA 3TAUA 3VR4A 3GLGE 5CYOA 1DELA 4G01B 5DHAA 4DC9A 5HCNA 2KBFA 1TTTA 4FN5A 4L9WA 4DBLC 1X86B 4TZ0A 3Q72A 1IN5A 3AKDA 4D0GA 1KK3A 1COWA 2I1VB 4JLPA 4LBWA 1VHTA 1Q3HA 5KSYA 2TMKA 3EZFA 3B7GA 1NSFA 2YV5A 1T0HB 3AV0B 4DLVA 5IDVA 4DEXA 3AP1A 2BMDA 2QORA 1K5GA 4DT1A 1AK2A 1OE0A 1P72A 3RC8A 1A4RA 1TU4A 1NLZA 4YMWA 1AIPA 1SVSA 4OQFA 1UDWA 2VP9A 2JLVA 3RS4A 2MMCA 3ZD7A 1YQTA 3TSZA 2H16A 4GI7A 3SBDA 1UBGA 2RKOA 5J40A 3ZVRA 2F55A 1XD8A 2PJRA 1I4LD 3QBVA 1S1MA 1VECA 1SQ5A 5KSOA 1KK1A 1HQCA 2O8BA 2P67A 4BZXA 1G7RA 1E9RA 1RJ9A 4B3DA 3E70C 2ZS8A 1R5BA 1IY0A 4US0R 1VG0B 4A9AA 2QE7D 2ZSBA 5DI9A 4JBYA 1TADA 1XD9A 4HAZA 2CCGA 2OBNA 2AHOA 4PO9A 5P21A 4JT4A 1Y3AA 2ZR7A 3ZYCA 5J4VA 2ZUDA 1E32A 3AGPA 4EIWA 2O8DA 1IXZA 2JEOA 1Q1QA 2WTUA 5D3MB 3T12A 2WJHA 4JJKA 2WWWA 3V4RA 5SZHB 4MYHA 1G8FA 1LVGA 4MUAA 3RLFA 5F3WB 3QPWA 2ZE6A 3BJIC 4RD3A 3HU3A 2DFNA 4BLTA 2FGJA 3JZMA 1S1CA 3B82A 1M7BA 1D2MA 3LQRA 4U02A 3AVUA 1P7CA 3PEYA 1G5TA 4LBYA 5G3ZA 2ZYUX 3I8SA 2D06A 2YYZA 3MUFA 3F5FA 1N25A 4V02A 1X3SA 3OEEA 2QMUA 4Q4HB 4EPTA 3CF6R 3MWLA 3C7KA 1BO6A 1Q44A 1TPZA 1JECA 5JI2E 3EPKA 2CVFA 1JEDA 2JJ1A 5L3SA 2DY1A 2VH5R 2G88A 2ATXA 2ZJBA 4QBGB 5JS7A 1P3JA 4JVLA 2DB3A 4XVQA 2QP4A 5FUVA 3BRWD 4DDTA 1ZM7A 1NSTA 4LHVA 2VF8A 2ZJAA 1E2MA 4Q1AA 4B76A 1D2EA 3IEUA 1MT0A 4LJ4A 2XITA 3DEFA 1GAJA 2KE5A 3TW4A 5CM8B 1UKZA 5KNBA 5K8TA 821PA 1G3UA 4CEIB 1DAGA 1Q57A 3SYKA 1Z63A 3KUDA 4EKDA 2OCPA 2VO1A 2GCNA 3QSYA 1Q3TA 3NC1C 3I62A 4Q5IA 2CJWB 1L4YA 1T5LA 2B6HA 4M1KA 3F8TA 2CLDX 4II7A 5L3QB 4FW9A 4C0AC 1QHHA 4HUQB 3QF4A 4S2EA 3VR2A 4B2IA 2IL1A 2REBA 3KKMA 1OB2A 2AXPA 1E2KA 2BMFA 4HYYA 2X77A 3OFND 4KAXA 4FIDA 1HEIA 3LA6A 1M34E 4MKHA 5H1YA 3CRMA 4BFYA 1HE8B 3ZGXA 1XU4A 2G3YA 2CHGA 5KUTA 1M8PA 2FSHA 3BD9A 3VKGA 4Q9HA 1E3MA 2XSZA 3U44B 2ZRBA 1U2RA 5BWMA 5FUYA 1VG9B 1G7TA 2QTFA 2Q3MA 2MSCB 1ZBDA 3AF3A 4LGMA 4KJZA 2GEVA 1DBSA 2Z4SA 4C7OA 4I4LA 5JHGB 2FV8A 1GUAA 3K0EA 1EFRA 4ERNA 4CEHB 2IS2A 4V0MA 5FUWA 4KFTA 1M2OB 3CUEF 4KCGA 3PV0A 3GLFA 1YKSA 5FPTA 2AFIE 2C04A 2KBEA 2ONJA 4Q7MB 3TR0A 1JEEA 5AUOB 3GCGA 4I1VA 2XZOA 3U3JA 1E4VA 4D81A 1UEIA 3LW7A 4Q1CA 5K8LA 2J0QA 2O8DB 4PAQA 4LDJA 2C9OA 1R0XA 3IBGA 3IPXA 3NWJA 4LI0A 2X2FA 4QJ4A 2B8TA 1W48A 4GOJA 4JMPA 2HF8A 4O2LA 1Z2CA 1AM4D 4GDFA 4X8MA 4D82A 2KSQA 1IY1A 1XMSA 3SYLA 5C1BA 1NN0A 2GEUA 1R0WA 4PHTA 5LBIA 4Z1MD 3NBYC 1IBRA 1XEFA 3NBZC 3WP0A 3GJ0A 3RAPR 2OE2A 5EP2A 4URVR 2IUSA 2C9YA 3VR1A 2AR7A 4PC6A 5HCIA 3T1VA 3WNDA 2OAP1 1GG2A 3AVVA 4IRUB 1NY6A 3A1VA 4DLRA 2ZIAA 1FX0A 1GNRA 4Q18A 4LYJA 4BLOA 4AKGA 5FUXA 2NTYC 1YR8A 2Q0HA 3GJ7A 3P20A 3QKSB 1GTVA 3G82C 5JBQA 2QAGB 4M9XA 4Q4JA 1E2DA 3N2EA 2GAOA 3QOFA 2FH5B 1XDBA 3EPHA 4W5JA 3T61A 4A1FA 3CX8A 1PZNA 4YDHB 1LS1A 3IGFA 3T1OA 1FNMA 4XOIA 3O8DA 1N5LA 2EWWA 2OILA 2IYUA 5CDFE 4QBFA 2DWOA 2IYTA 3C5HA 5KDOA 1FUUA 1MO5A 4Q1FA 5CJ2A 2GF9A 3KQKA 1KAGA 5DN6A 5EE1A 1NVWQ 2ZQ5A 3CM0A 2C2HA 3MWKA 4BPBA 3EZ2A 4IDOA 2ZYWX 4D25A 1T8TA 4OQXA 3EARA 1J90A 3GLHB 4YONB 1JAIA 4FINA 2R65A 1GM5A 2P0EA 2ZRPA 3GMTA 5TY0A 4EQ6A 2ORWA 5B58C 3SC3A 2MSDB 1N2CE 3K09C 4OHVA 4JS0A 1DOAA 1E79D 3QEJA 4C0SA 3P26A 2FEOA 3P32A 2AWOA 1E9AA 4B75A 4BGDA 2IK8A 4B2PA 2YKGA 1SULA 2W0MA 1VCNA 1MO4A 2DYKA 2XB4A 1IJEA 4NP6A 3QE0A 4WZ6A 3W8RA 5D3QA 3AF0A 3WHLA 3AF4A 1UBEA 2V55B 4Q47A 4KSCA 4QGAA 2ZVPX 3RRYA 2R6DA 1LB1B 3AGQA 3NHBA 4B43A 3KTAA 2P5TB 4AURA 1ZUNB 1UKYA 4W7SA 1RRFA 1U0LA 3MD0A 3NEYA 1KSFX 5DHFA 4A0FA 1E9BA 3U7FB 1YR7A 1E0JA 1GKUB 3AP2A 4N1AA 2A5FA 4W9MC 3CNLA 2BIFA 2X19A 3UG6A 3R8FA 2HLDD 3OEHD 2FFAA 1NG9A 4JLKA 2VQSA 3IIMA 3R8CA 1LF0A 4C3ZA 3WYAA 3U60B 2EYQA 2J7PD 1TUEA 4GPTA 2O5VA 4XD7D 5FR2A 1YVDA 1N0WA 3ADBA 1RC8A 2XNDA 2ZJ2A 1CJUC 2NOAA 4GMDA 1CR2A 3FMOB 2JIZD 3QXHA 3SJCA 4P4SA 4BFSA 4O3MA 1M1YE 4YMTA 3CPJB 3CNOA 3I72A 4OI1A 1Q1EA 3OAAD 4NYJR 4DDVA 2GK7A 1E6CA 4DRZA 3ADDA 3LH5A 4LV6A 2HXYA 3U7EB 3AVOA 1GKIA 1RIFA 5L3VA 5GJBA 2VHCA 3CZQA 3I8XA 2YWEA 2RGNC 1H8HD 2ZRJA 2GILA 2OUKA 2XOKD 1IY2A 4D2IA 1CTQA 5L3QA 1HURA 5DI3A 4C0JA 1UKVY 4JL5A 2PLRA 4QBIA 2RGGA 4A8JA 4M1OA 3AP3A 2HYIC 1JB1A 3CKLA 1G3QA 1A2BA 5JZVA 4ESVA 1DVRA 1X8LA 1QHNA 2VSOA 1W46A 2ZXUA 3RC3A 3E5HA 1LY1A 3I73A 1X8JA 4ZI3A 4W5HA 5HKKD 2B7BA 1OXVA 1DG3A 1YRBA 4JLOA 4TT3A 2HXSA 1F5NA 1LTQA 1CU1A 1E1QD 1MH1A 1J70A 1ZAKA 3P1JA 4OHXA 3UMSA 4E22A 2BCGY 3QEOA 4JIMA 5G40A 4UKDA 1HUQA 4CEHA 4ARZA 5DYIA 4H9GA 4HLCA 3GLHE 1KI4A 3TR5A 1JALA 4A4DA 3NBXX 1GRQA 3K9GA 2GVDC 1ZM3A 5HZHA 1ZNWA 3D7MA 1WDTA 1EGAA 2XZLA 3IQWA 3PJRA 2A7QA 5CB6A 3SFVA 4RD6A 2CL7X 3U2QA 2ZRAA 4NYIR 1SGWA 3LVQE 3L8ZA 1F48A 3RHFA 8OHMA 4LHZA 4GP6A 2QI9C 3SHWA 2YINC 1ESMA 4EAQA 4UNPA 3GD7A 1CR0A 2OM2A 1VDZA 4BLPA 2V1UA 2BVNA 1Z47A 4GT1A 2QY9A 2ZRGA 3KUCA 4TZ6A 2WJGA 2NQ2C 2RGEA 3LBNA 5GADl 3KDSE 1SXJD 3RYTC 3NHAA 3TKLA 3B1XA 4ZI2A 4EPRA 5AJVB 1IHUA 1F3OA 3I3SR 2D2EA 4QFMA 3WRXC 3EWAA 1KI3A 1C4OA 3ICEA 1FPMA 3A4LA 1Z0KA 1CIPA 4F93B 4OYHA 2EW1A 4G5GA 4YC7A 1OYYA 2EFDB 2OFXA 2GXSA 5JEDA 3TQFA 121PA 1E1RA 3OIVA 2GZDA 1NY5A 1T6NA 2AD5A 2PEYA 4B3GA 3BFKA 3BERA 3BC1A 3PIRA 1G3MA 5KSZA 1W36B 4AG5A 1GFIA 1Y63A 1L4UA 3TIFA 2Q21A 1KO4A 1US8B 2UVQA 1EG7A 3A1WA 4DJTA 4Q9IA 3X1YA 4ZIRB 4DDWA 1KMHA 4TTPA 4URYR 3RSLA 3Q7QA 3PITA 3GLHA 1OIXA 1ZMXA 2FFHA 2W6ID 5DI3B 5E7MA 4IDPA 2B8WA 3MMPA 4Q48A 1P4SA 2J0UB 4QJ5A 4MKIA 3OIWA 1G8YA 2ODEA 4PHFA 3HR8A 1SHZA 3T34A 1MOZA 2N46A 2FSIA 3MFYA 4A8JC 2J45A 3A4MA 4G5QA 2QQEA 1AGPA 1W47A 2OO7A 1KSGA 4KHZA 3GEIA 1L2TA 3KKQA 4M9QA 1XTRA 4TT3D 2QPTA 4MGIR 3NBFA 1U9IA 2JJ1D 4M53A 1E2JA 2Q3FA 1Z0DA 2RGXA 2AD1A 2Z0MA 1Q1ZA 4NDZA 4PQFA 1II8B 4HUTA 3AVPA 4JVNA 3GLGB 2PMDA 4AIIA 2IF0A 4P3YA 5BQ5A 1XEXA 3QPVA 2OXRA 4GZLA 3NDPA 2ZM5A 3PUZA 2IXEA 3ZQJA 2IF2A 3B1YA 3TBKA 1J7KA 3BB3A 3RRNA 5JWHA 1XZPA 3WMFA 1QG2A 4ZKEA 1YR9A 3ND8A 3VQTA 1DO0A 2Z4RA 1KAOA 1BMFD 3AVWA 4PPQA 3AKEA 4Y0VA 2ANCA 1UAAA 1XMJA 4TLCA 2ZAOA 4I1UA 2NO9A 1G5PA 2FOLA 2ZS7A 4DHEA 3O8CA 2GTPA 3W3ZB 1GWNA 2GXUA 3W6NA 3THOA 2WZQA 1Q22A 2F43B 3K0CA 3PCRB 2ZJZA 2W6JA 2HT1A 1Z28A 1OFHA 5EE0A 1BYUA 4Q9KA 1OYWA 1VTKA 5TXGA 1HYQA 5FL7D 4JBXA 3W9YA 2RHDA 721PA 1PLLA 4JLNA 1E4YA 1G4AE 4CRWB 4RY2A 2WSSA 2E1RA 1KMQA 2FU5C 3DVLA 5EZ5A 3CR7A 1P9RA 2WOOA 1YZKA 5HPYB 1PVOA 2EFHB 2F1IA 2IT1A 2XNDD 1E99A 1P61B 2OV2A 2BM1A 3ZZTA 1NP6A 3I92A 3BBPA 2V1XA 4TLAA 2AK3A 4V0LA 4P0TA 2ZU0C 3GFOA 1J8YF 4QG7A 1XCPA 2FMXA 2QP9X 4L9SA 4GMXA 4XH9B 3KJEA 4BFVA 5JWOA 3FOZA 1J99A 1P60A 2X2EA 3OHMA 2V7QD 3HP1A 4NPHA 3KQNA 1F2TA 4CEJA 2HF9A 2QM8A 1TNDA 4HLUC 5IHPA 3PEUA 1RKBA 4PC2A 3QUSA 1IOZA 4LC1A 2REXB 3IBYA 2H57A 1CEEA 1KDOA 2A5GA 2JAQA 2JJ2A 2BKEA 2WHXA 3IHLA 4TSFA 4HLQB 4WW0A 2XTNA 3ZS8A 1FL9A 1QBKC 4ZCIA 4LBVA 4BZQA 3K9NA 4R2IA 1VYUA 1XCGB 4PSAA 1ZCBA 4NL4H 2WSMA 4BWYA 5J4HA 1W4BA 4A0HA 3MCAA 4WA7A 4JL8A 5CK5A 1NIJA 3SBEA 3GLFE 1GRNA 1U9IC 1Q1BA 1G291 5SZIA 3L2OB 4HB2A 2ZRNA 2RGDA 2VEDA 4LOAA 4PZYA 2IEZA 4PO8A 2O8BB 1AN0A 2R2AA 3U6KA 2ZVQX 4JLJA 2CLCX 4ZDKA 4OQLA 3DHWC 2XTZA 1G4UR 3LDAA 4FWIB 2QU8A 3IO3A 5J47A 3PENA 2FJUA 3KKPA 4NCHA 2GJAA 3LBHA 2ZPTX 2PEZA 4XWAA 5HE8A 4A6PA 1OH5A 3Q5EA 5DE3A 1KHTA 1OF1A 1BMFA 2XJ9A 2WJJA 4EPXA 1SVOA 1CJMA 5JFGA 3CW2A 2ZI7A 4DCNA 1K8RA 1U0HC 4URUR 1BS1A 4NCNA 3GLIB 1HV8A 2QTHA 2ZSAA 3LBIA 3W34A 4C2UA 1SVKA 3FHCB 1EX7A 1FP7A 2V7QA 1JJVA 1LV7A 2PLFA 2QMHA 5JCPA 2QBYA 4RD1A 2WMNB 3U7GA 3IO5A 3CRRA 3EIEA 4RFVA 5FPHA 1AJEA 4C0QC 2O8FB 1FQJA 1Z0FA 5HTKA 4XD7A 2BBOA 1G3RA 1D2NA 5AJWA 1N6KA 1NBMA 4MGKR 2XB2A 2KB0A 4MKFA 3CRW1 1G8HA 1R8QA 1ZD8A 1ZIOA 3OIYA 1T91A 1ZNZA 2LKCA 4KI0A 5FPKA 2QTVB 2WSSD 4YDSA 5DLQC 3ZVNA 1OIWA 4IW3B 1JXMA 2FWRA 2XJ4A 1KI8A 3DPUA 4CVNA 3QPUA 4YMUA 4BEBA 4AD8A 2FPKA 1KJYA 1Z22A 1VG1A 2GJKA 3F0TA 3LNCA 3VFDA 5AK0A 2F9MA 4Q03A 4DVGA 3BIFA 3EZ6A 3EA5A 3TJZA 4LYAA 2GWHA 2IYYA 1CRPA 1WXQA 1QF9A 5TDHA 4CEJB 4C2TA 1YRAA 3VNUA 2XAUA 3FFAA 1XD2B 3EC1A 2FZ4A 4F7WA 5E7JA 4D0NA 5DH9A 1A5TA 2QEQA 4F91B 4MH0R 1KZGB 2QMOA 4PPNA 1N0VC 2JASA 1AKEA 3CB4A 3LO5A 5FBRB 4E5UA 4C4PA 3TQCA 1KGDA 1OB5A 1G5RA 2CJWA 4HB3A 5M04A 2BJVA 4UNQA 2BJWA 1KMHB 1WRBA 3GP8A 2R6GA 4M2LA 2DCUA 2F43A 1SZPA 2WWHA 1NVXQ 3C4JA 5FI0B 2CNWD 2VSFA 5EUQB 2PCLA 4BE7B 2GJ9A 1LNZA 2HDNB 4JVSB 1YZQA 1JR3D 4JLAA 4OJQA 1L8QA 3L0IB 1N6IA 5CDFA 3T5DA 3L8YA 521PA 1F60A 2F3RA 2LWIA 5E7IA 4TYYA 3OEED 3AF2A 3CX6A 4HB0A 4M1YA 5IK2D 1YU9A 2A5JA 3TVTA 1P2TA 421PA 2ZE8A 1ZUHA 2C9CA 5JCZA 3THWA 1FFHA 2D4HA 3PQCA 4HSEA 3KQUA 1NJGA 4JVMA 3OF5A 4JLMA 2L0XA 3GJ4A 3ASZA 3EG5A 1DAIA 4N0DA 2JLUA 2BKUA 2GJSA 4IDQA 3RNLA 1SVWA 4GP7A 1XJQA 4JSYA 2H5EA 4F92B 1NN5A 2GBLC 3BK7A 4TQAA 5EP4A 5JEEA 4P33A 3ASYA 3ADCA 4OL0A 2GXAA 2QUZA 3B9PA 2Q9BA 2A5YB 1XXHE 2E9SA 3EIQA 3G0HA 3H1TA 2FG5A 2ZREA 5KPDA 3RS0A 2ZRHA 1GP2A 4TLBA 3GJ8A 4IHQA 2OFOA 5L3SB 1UJ2A 5KU1A 1Z0JA 3AQ4A 4V0OA 5FTNA 2ERXA 1ZM9A 1JAHA 1ZYUA 3DMDA 3KJHA 4LJAA 1DAMA 2ZUBA 1ANKA 5EXXA 2ZRIA 2O8EA 3LLMA 1SHKA 1P75A 1W36D 1W0JD 4M8NE 3T5GA 1UBCA 1XJ0A 2KJQA 1P6XA 4X8LA 3B2EA 1SKQA 2XXAB 3A8TA 4KXFB 2IWRA 3TSOA 4NZYA 2W0SA 3SOPA 2IA5A 3V9PA 1P73A 3K70C 3JZAA 5FOVA 4JT2A 4BECA 4NCKA 4LPSA 4AYXA 3NG1A 2VP5A 4JYCA 4BFXA 1QVAA 5JI3E 5L8VA 1ESNA 3AB3A 2VRWA 1BIFA 2GCPA 4UXIA 1QHHB 2YWFA 4UNNA 2C5LA 2ZSFA 4O25A 2VTKA 3IKJA 1DTSA 1W44A 4GZMA 1NJFA 1TQ2A 3P4YA 1NN1A 2OEPA 5IRCD 1FTSA 2VHTA 3ICQB 4NYMQ 2QGZA 4B44A 3DKPA 4EFMA 4UXJA 1W49A 1AZTA 2WIBA 2BC9A 1R5OA 1KO1A 4LJYA 1KDTA 3TAHA 4PHGA 2YZ2A 4R2HA 5GVRA 2GCOB 2V9PA 2C8VA 2RGAA 1XEWX 2G6BA 4US1R 3QXSA 5L3RA 5LD2B 2FZLA 2VBCA 3U5ZB 1NVVR 1ZM2A 3K9HA 2IBMA 2UZIR 2FE4A 2V4ZA 3M0EA 4PSVA 5FI1B 5HZKA 2Q9CA 1RE0A 3G5UA 4QHYA 4FCWA 2H92A 2OBMA 2PJZA 2W00A 4R98A 2OCBA 2HLDA 4LPKA 4QHTA 4LC0A 1OFIA 3W3AA 1S2MA 1X8KA 2QE7A 4HDOB 4RZUA 4K81B 3K1JA 1OFUX 4X8HA 5FL3A 3A1UA 1N6HA 5GJVC 1VMAA 4LRWA 1JR3E 2ZRDA 4TWZA 2CK3D 3TGPA 3ZVMA 4Q21A 4P4TA 1JPNA 1SVMA 3QENA 4Q4LA 5FBLB 5KO2A 2YOFA 3RRMA 5J4KA 5KNCA 2OLKA 2EU8A 2N42A 1E9EA 4BQSA 1TF7A 3WRYC 1XXHB 1U90A 1U8ZA 4UJ5A 5EXTA 4Z1MA 3KKNA 3H4MA 5KDDA 1NVVQ 1OKKA 5TV2A 3U6BA 4MGYR 1MABA 3B1WA 4YXWD 4CGZA 1W36C 1AS3A 2PZFA 4NYIQ 2CBZA 1KOFA 1CJTC 4B32A 1TMKA 2PL3A 3QKSA 2QSZA 5FOTA 3B85A 1CR4A 4FMCF 3TUIC 4HEJA 1QRAA 3QVUA 5JSZA 1M7HA 3KQLA 2OAQ1 3BOSA 3R7WA 3H0KA 3ZIAA 4A92A 1TU3A 2ZSDA 1X1RA 2C98A 1FTNA 3DZDA 4US2R 4L8GA 5F9FA 2ZI5A 5ANRB 4B71A 4FWTA 4DCVA 1Z0IA 2H8KA 3K0CC 2RAPA 3WYFA 4A0GA 2G0TA 1E1RD 1AZSC 4LJ5A 1SXJE 2CL0X 3K0SA 3GPLA 4TTRA 1G6HA 3DO6A 2WICA 3C8UA 4LUCA 1AA9A 3M1IA 3CONA 1E2GA 4B3XA 3HWSA 2ZTSA 3SYNA 2D62A 2QL6A 1CS4C 4M9ZA 2UKDA 4D4LA 4AI6A 3NDBB 3UATA 3DM5A 4TYNA 3LFUA 1ELOA 4NKRA 1IN6A 1E2IA 2F1HA 4L15A 1SXJA 1OKKD 4DSUA 3AVQA 1JNYA 2QRNA 4DEYA 1OW3B 2HYDA 3PEWA 2Z83A 4CW7A 2FNAA 2YWHA 2NZ8A 3WHKA 4M0LA 1RRCA 3CWZA 2W2XA 4O0MA 4OI0A 2ZRCA 2PBRA 5LB4A 1R0ZA 2EFCB 2WKQA 3UG7A 1E0KA 3EC2A 4CDGA 2DFLA 2W6IA 4HLUA 4AKHA 1W5SA 4GRAA 4IXNA 3MAAC 4IOMA 5K8IA 4P31A 1VIYA 1E96A 3BH0A 1OXSC 2QSYA 4D80A 1OJLA 2VPPA 2YWGA 3FKQA 5KOYA 3QNUA 2RGCA 1T8UA 5A5GA 1OV4A 1Z06A 1B23P 3B78A 3AKYA 4NYMR 3ZD6A 1JQLB 1T4GA 4MRVA 2R6CA 1E2PA 2GZAA 3BE4A 2ZRKA 4QGFA 3GFPA 3ADKA 4NHOA 3A1SA 3VKWA 1P2VA 2ZR9A 4FI3C 4D4KA 3CPHA 4P4SB 1HH4A 4PC7A 1KSHA 2NIPA 4LYHA 3L0SA 4B33A 1RRPA 3SI7A 2JLRA 2OESA 1B0UA 2PT7A 1YZGA 2WMOB 2BMEA 1UM8A 2P6NA 5EE3A 4Z8YA 4O2RA 1DARA 4JBWA 2X1VA 2C03A 1QHGA 4B6FA 4DLZA 1GL6A 2QA5A 3V4FA 2ODNA 3GJ5A 1OLOA 1S3SA 1OT3A 2W58A 3KFVA 4XWOA 2P6UA 4KFRA 1ZNYA 1XB2A 1WMSA 4JSTA 1R4AA 3RSOA 3SE0A 3K70D 3KXIA 3WBKA 1R8SA 1E0SA 2EQBA 3C14C 5BW8A 1UADA 1PUJA 1SKYB 4PTLA 2ONKA 4GNKA 3W5IA 5IK2A 1F2UA 3N2IA 2WIAA 5JSZB 2FF7A 5KNDA 3BS4A 2YNMA 1K6MA 3QF7A 1QZXA 2DWQA 2LCFA 4DLUA 4IFEA 3SQWA 3KXLA 4G5SA 1Z5ZA 2IUTA 3RWOA 3UPUA 3WNBA 1DO2A 4ASUD 4HZUA 1HTWA 4IKEA 3CR8A 4Q1BA 4M21A 2X8AA 4LBZA 3L0PA 4RVCA 2CDNA 2QENA 5F9HA 4TTQA 1YJ5A 3BWDD 4FMBB 3B9QA 1SVIA 4PAMA 1JPJA 1RFLA 3K0FA 5C46F 2IW3A 4BLQA 3NH6A 5BN5A 1K5DA 3L43A 2QN6A 1E69A 1GZSA 1H8ED 3VU9A 1G18A 3IDQA 3PEVA 2DWPA 4IXMA 4HZIA 2AKAB 5K8UA 1OPXA 1NLYA 5JJLA 1CLUA 1AS0A 1W0KA 4R7ZA 4TQ9A 3EIHA 3ZLJA 4NYJQ 1XJCA 4S35A 1EESA 1C9KA 1DADA 1S9DA 2WJYA 1KKMA 4V0ME 5AJXA 2YOGA 4TLDA 1OHHA 4BUJA 4OI4A 2DBYA 4KYIB 4D6PA 3T1TA 4Q9JA 4BRUA 2W6JD 3X1WA 1N3BA 1KI7A 4DLXA 3IIKA 4F4IA 4TYWA 1XXHA 2KI5A 4LWZA 2IWHA 3AH8A 4BLSA 1P62B 4FCVA 3NVAA 1N6RA 2GF0A 4HDQB 5C4GB 3FTQA 2J59A 3S1AA 3NIBA 4LHXA 3C41J 5JMTA 1EFCA 4Q1EA 1VYTA 3T1QA 5EQTA 5FPYA 2ZITA 3QXXA 2IYZA 4ZPXA 1TL7C 2IS6A 4Z8XA 3PG5A 2ZJOA 1W2GA 1G7CA 3FHOA 5FTJA 1A7JA 4Q02A 5H8WA 2ZAMA 5JHHB 3AM1A 4EPVA 1WBBA 5FOUA 4MRPA 5KDLA 2DPXA 1G8GA 3LX8A 2RCNA 2ZYVX 4KVAA 3WY9A 2IS4A 2CCKA 1YE8A 2HCJB 3LAWA 4AYWA 4DCTA 2VHJA 2FSFA 3K53A 5DIFA 4EJSA 3MLEA 4DUGD 1ZCAA 2RB4A 4PPGA 3MG9A 1SVLA 1SKYE 1RYHA 2IYVA 1RYFA 1ZUIA 2J0VA 3LVRE 3I5XA 4ZCLA 2PX3A 3AVXA 4BEJA 2WPDD 2Y8EA 3TH5A 5C2JB 1XTJA 2VA8A 1Z07A 2QAGA 3TVDA 4B3CA 2VIIA 4QOSA 1H8HA 1OH6A 1F2UB 1FW6A 2Q6TA 4XTCS 3K70B 1E2HA 4HAWA 3U44A 4OHZA 5J4LA 3BFXA 1XMVA 4HLDA 1W7AA 2FN4A 1FP6A 2W2TA 1GOTA 3NKVA 2V8OA 4HZUB 5DO9A 4A2PA 2D74A 4OI2A 3KL4A 4FXPA 3SS8A 3WYGA 5G53C 1NMXA 1F2TB 1NKSA 4UNRA 2ZRFA 3FVQA 1II8A 1EFTA 2IEYA 3KZ1E 4Q19A 2IYWA 2NPIA 3VR5A 5FR1A 4W5WA 2XOKA 2REOA 4DLSA 4PHHA 2B7CA 2V54A 3R7WB 3FPAA 2O8CB 3V00A 3GJ6A 3CPEA 2OCYC 4B48A 4V03A 4BFZA 2Z5FA 3CRVA 3CWQA 3LD9A 5AR1A 2ORIA 1Q20A 1W1WA 2D2FA 3RS7A 2EVWX 2EWVA 4HAXA 4CEIA 4LHYA 1FUKA 2AKYA 1MV5A 4JLBA 2F1JA 4EJSC 3D8BA 1TUIA 1T5IA 1H65A 4DKXA 1NNEA 2JA1A 2MSEB 3FMPB 3CF0A 1XPRA 1P2SA 2GAAA 2ZROA 4PR0A 1LFDB 2GXQA 1WE2A 2DR3A 1KY2A 3A37A 1G9XA 2F7SA 3BXZA 3U3OA 1FX0B 2J7PA 3K0AB 2GRJA 3U7HB 4KU4A 2R8RA 5SZJA 2YC2C 3LRPA 1ZM4A 3NTUA 2BBSA 5CYPA 3PUVA 5GJCA 2ATVA 4QXAA 2DFKB 2ZANA 2BOVA 3LV8A 1T0JB 2ZRMA 1NMZA 1QHIA 4A6XA 4PZZA 1D6JA 1S3GA 2QRZA 3EW9A 3IQXA 3SDZA 3FDIA 2QBYB 2J1LA 2IUUA 3P4XA 4R9UC 3UIEA 3JVUA 2GDJA 3CH4B 3GLFB 1T3HA 2F3TA 5IT5A 4G0NA 2SHKA 4LJ7A 3MJHA 1HQYE 4XSGA 3EX7C 4PZLA 1WBDA 3O47A 4LV8B 3E2IA 2ZEJA 3ECCA 3FWYA 1VPLA 3NH9A 4WBSA 2QQ0A 2NO6A 1DPFA 1LS6A 4TMVA 3QJYA 2CL6X 2CVHA 4MRRA 3WMGA 3UXMA 4LJ9A 5HKKA 5FL7A 3LXXA 3J81k 3IILA 4L5BA 3R9IA 3ZH9B 4WIAA 4A0RA 3CBQA 4KSBA 2Z43A 4AK9A 3DZ8A 4IVPA 1AS2A 2HEIA 2V6JA 2F6RA 2IYRA 1W5TA 2NZJA 2RH5A 4PO1A 1HE1C 3SHFA 4BZPA 1OH8A 3LLUA 1CULC 5JJIA 4WZAE 1ETUA 2R9VA 4Q9LA 1HT1E 1KY3A 1GRRA 2WKPA 1XBTA 4B73A 2ZSEA 3IPYA 1CJKC 4V0KA 5DNYB 2XX3A 4RSGA 2FGKA 2CNWA 4XVRA 1ZU4A 2CLSA 1EFHA 1YHNA 3B1ZA 5EE9A 3AUYA 4B34A 1G16A 1WA5A 2WAXA 4KFUA 4DWJA 2V3CC 2QAJA 3W6PA 3I5YA 2PT5A 3MSXA 2CE2X 1Q12A 1KO5A 1XCMA 3THYA 1XX6A 4QBHA 1AQUA 4TLEA 4LY6A 1JXOA 1OXUA 2IYXA 1LW7A 3I4LA 2JLQA 2J9RA 4A2WA 3DMNA 5JECA 2J7KA 3VNVA 3K0FB 4IOKA 2FSGA 4Q1DA 4XJXA 5JLJA 1NF3A 3FKSA 4OQMA 4K46A 1Z8FA 4GBMA 2QZ4A 1QVRA 2ZJ8A 4LV5B 2NMVA 4IDHA 3REGA 1RZ3A 2PH1A 3Q8XB 1FQKA 2O0JA 2BMJA 1R2QA 1G17A 1XP8A 2A5DA 2ZU6A 4LX0A 1M7GA 1PLKA 2FEMA 4AYTA 1OXTA 1ZD1A 4CF7A 1I2DA 2WBLC 3ETLA 1WP9A 2WJIA 4E03A 3UMRA 4B6EA 3EPJA 1XTKA 2C77A 4B2LA 3B60A 1NMYA 2H1LA 3KTAB 4XIGS 1JQJC 4MQBA 4PC1A 2VP4A 1NI3A 1TF5A 4NCJA 1S4QA 2MMGA 5CLQA 4RD4A 3D6TB 3IHWA 2WWYA 1D9ZA 1Q21A 2GZHA 3NEJA 1E2LA 3PXGA 1RRGA 2EFEB
chains in the Genus database with same CATH superfamily
3C6KA 4IWXA 2PRIA 3JARA 1QNLA 4XCVA 1RMTA 3FTDA 4WXRA 1L7VC 4UHBA 1ARZA 2VOEA 2P2DA 2NUBA 4L5AA 3CWCA 1W4CA 4Y1RA 3MUOA 1EVIA 3GCWA 1ONBA 1TQDA 2RJNA 3EPPA 2E4YA 4CG1A 2ZI9A 4WK2B 1RABA 3QYAA 3BQNB 1J6UA 4MWCA 2OV1A 4NY1A 2UZ1B 5I7VA 2VYND 4F12A 1V7PC 4RXUA 3SQOA 4FE7A 4KK4A 1EJ6A 3M4YA 4RDIA 5U1PA 3ADOA 1DCMA 3AYXB 3EDOA 3NNNA 1BE0A 4JGIA 4ETIA 5KREA 1U80A 1N2ZA 1TZJA 1T6BY 3EDRA 1OA1A 4KIFA 4P81A 3OE7D 5T5QA 1RQPA 4LQCA 5EUCA 1XZEA 5ICEA 1XU7A 4QPPA 1NM5A 2B3DA 3IOMA 4RLHA 1PDWA 2A78A 4Q66C 5E4FA 1RLJA 3GNQA 3G7NA 3AVYA 5F76A 2IXDA 3GP5A 1IN8A 1BHJA 1XMIA 3B1FA 3R6LA 2YJGA 1DRVA 4HYQA 4PLTA 3Q7IA 3GCDA 2ZVJA 2FA9A 4DEVA 3ZV7A 2I3BA 3T7CA 2DUUA 1OXBB 1RVDA 4GOOD 2GBCA 3U3KA 4KQEA 2YMLA 1WX1A 3NFRA 1D4AA 1PZEA 1VIAA 2AFHE 3QU4A 4L9RA 3MWEB 5HBGA 1KDPA 3ABZA 3WK8A 3VMFA 4PE5B 4RKWA 1XCJA 2DH5A 4XFKA 1GNLA 4COKA 3DKRA 2ID7A 4H7PA 2OCXA 1YQDA 2WSYB 4PCLA 5CH3A 2BE7A 3DHYA 1Q77A 4BO2A 4HWSA 3T38A 2LKDA 4BASA 3HPRA 4CM9A 4G4SP 1G8JA 4MDEA 1JR6A 1U99A 2IITA 2MYUA 3K6SA 2FZGA 1S3FA 2JHGA 4KACA 4BBJA 5CFZA 3NM5A 4YACA 2Q45A 5FH9A 2BEKA 1KI1A 2F8MA 2HRZA 1UBSB 1NQVA 1DT5A 3HKCB 4F9EA 2VJDA 1JVNA 3AHIA 3TMKA 2Q7OE 2BCEA 1RXYA 1NUSA 2C29D 1U5BB 4L6AA 4Q4AB 3SQMA 4PBRA 2WUEA 5GONA 4B6SA 4M7OA 1R7RA 4CDMA 5IP5A 3UUGA 3WSVA 4KBYA 1GQFA 1MENA 4H0CA 5C7YA 1P5FA 2AXQA 3AI1A 3ZE7A 1UMKA 4RV4A 2BM8A 1T1GA 4E5MA 4PG6A 4XEUA 1CRLA 1SOWA 4AUMA 3E2PA 2POCA 4HXGA 4DANA 4MVJM 2XPCA 3T7JA 2PR2A 1BVUA 1CVRA 2Q5QA 2BJHA 5EJEA 3OESA 1X0VA 5IKPA 3CG4A 1UKAA 2XBUA 3K6KA 3S1SA 1HDRA 3RQSA 4GL2A 4DIKA 4MB6A 4WGFA 2JLXA 1J8MF 5IF3A 3HLKA 4MIKA 5I3ZA 2VCEA 4J0HA 4CQNA 3IS3A 3ROKA 1Q50A 1P33A 1RQLA 2CVQA 2JLBA 2RJ3A 1V39A 1BJKA 2OB1A 3GQBA 1JWBB 4D9HA 4OP3A 3GWZA 1FVXA 4RA9B 2XWJI 4G9EA 1TE2A 1SXIA 1DV2A 1A1SA 2AF4C 4OB7A 5JRZA 4X66B 1U63A 1GPWB 2JI4A 3H5VA 5KS2A 1MFPA 1YOVB 1YQWA 1JG1A 2O1EA 3H2SA 4MWZA 1Y34E 4BUZA 1L5FA 1F9EA 3DD5A 3EEIA 4FR2A 4KV9A 2M2IA 4RYLA 5EE5B 4L57A 5L45A 1I7QB 3GJYA 1AHHA 3HI4A 4F6CA 2UXDB 4CIAA 1YZNA 2WVJA 1PGPA 2QTCA 3PQEA 1OIVA 4L8VA 4LZWA 2Z1MA 3J81A 5C1IA 5FV7A 1EWVA 3F4LA 3NRJA 1GQRA 4JGBA 5BR4A 1OLXB 1FDIA 1JA0A 1ZGGA 4BFTA 1TK2A 1W73A 5TMEA 2GPAA 2VRBA 3C1AA 4F85A 1WOYA 1YJQA 4DV0B 3THRA 5E2AA 1X1EA 2YXPX 1KZ7B 2ECQA 2XCRB 2QTNA 3OE7A 5G3YA 5CW1A 4FMDB 4QUIA 4HT3B 3FFXA 5JQGA 4UW9A 1QP0A 3VR6A 2P8SA 4DLWA 1V5EA 2R4TA 2JVJA 1WF3A 3WSTA 2KWIA 4PLFA 3T54A 2FPOA 1J24A 3OA2A 3NAMA 2I3AA 1Z56C 2XI4A 1TD9A 2J9ZB 4CKCB 4QL3A 1RW4A 4OB8A 1BN7A 3I53A 3PFWO 3M9LA 2N1BA 1G1MA 4R05A 2I7VA 1D1QA 3NXSA 3TD2A 5JDCA 3WIDA 4PTZA 3MWEA 4FU0A 1EM8B 5G0WA 2M1XA 3QFSA 3DTNA 3TZLA 4E09A 2R8YA 1R88A 3UMYA 1DQYA 5ICMA 1YO6A 5A4JA 2BEVB 2C2KA 3PVSA 2VCHA 1OILA 1UT5A 5BQ3A 1H8EA 2B99A 1WV1A 2YVAA 4K9SA 2GK3A 5IC6A 3D3EA 2BDTA 2DQKA 1PJSA 2NSDA 1G0NA 2Z2IA 2ZI4A 3ZI7A 3RADC 3ZZ0A 1DS6A 4H0NA 2OXCA 2YC4C 2HO5A 3TAXA 2VDUE 5BSVA 3WA7A 5KNCH 1DJPA 4H4DA 4QQKA 1SBIA 4M87A 3F7NA 1OR8A 3STTA 4PFSA 2J9YB 5FBQB 1BFDA 1DAOA 2YIVX 4KO8A 3EAGA 3HZRA 4F5YA 2D5IA 2I4TA 5TB5A 1T13A 1VKHA 3B2QA 1JEQA 1NVAA 3GJRA 2QZ9A 3T3MB 1XNGA 2EL7A 3QU5A 4E51A 5JQWA 2QX7A 4YUXA 1EIWA 2P5SA 3H4TA 2JLWA 2R96A 1XFAA 4H35A 2R5WA 4FD3A 2E48A 3B1VA 3Q9NA 4C0HA 1TQHA 3H1GA 4RCYA 3ETCA 3FZQA 3QMMA 4DUGA 1ONOA 4I55A 1WHSB 4O1HA 3EODA 2IHBA 3HYRA 3ROQA 1FDOA 4ZU1X 3DDSA 5CA1F 3TOCA 3CX3A 3S2GA 1GFWA 2EARA 5EHGA 3H11A 4C6RA 4RA9A 3QU9A 3ZDQA 2ZKIA 1S6YA 4ZHQB 4NOMA 5CDUA 2F9LA 2JI8A 3SSOA 3QY0A 4AZ0A 4HDSB 2PXCA 4FLFA 1XQWA 4NZMA 4NG5A 1PL7A 2YIJA 4PRZA 2AN4A 4R1MA 1ZONA 4XX1A 3RI3A 5BYAA 1JFRA 4EZEA 1Z29A 1U5AA 1HORA 1E9CA 3I04M 1W4ZA 3UBMA 4I50F 4PYOA 1JILA 1TQ4A 2HFJA 5AJUA 1N78A 2HXGA 4D56A 5HQ3A 1RHMA 2QMQA 2ZJ4A 3PUIA 2FK7A 3B5EA 3O31A 5F12A 2ZI6A 5G2OA 5KVAA 1C9EA 1G60A 1NX6A 1NBME 1R0CA 2E5WA 2G07A 2YIDA 3EG9A 3IJRA 3P2IA 2IOQA 4RKFA 3UT5B 4V3BA 3UT0A 4P83A 5HMMA 3GLRA 3WQBA 3KPWA 3EZ9A 5DGDA 1KJWA 1WLSA 3T41A 3THWA 2EJWA 4AXBA 3PI6A 1ZXLA 4Q4AA 1NL3A 2JVKA 2WU1A 2XA1A 1ZI9A 3AOGA 1XDUA 3IV6A 2WP0A 2IV7A 1UKEA 2VZLA 4TTSA 4K0RA 3MTDA 3UA3A 4BQIA 3ELBA 5K20A 4KDRA 3BA1A 2EWMA 1FP4A 2BFEB 4LCBA 3IMEA 4YJFA 3UC9A 1YUBA 3CSSA 5A2QA 2RDMA 3L5OA 3BXHA 2QNRA 4D3XA 5F98A 1PFYA 1TQ8A 3KSAC 1CUXA 3ZEAA 2JJMA 2DLDA 3HJBA 1J09A 1DBWA 1CE8B 1EFRD 4HQRA 1NTRA 4EG5A 1DAFA 1RWXA 1VG8A 4BRWA 2VUHB 1P2UA 2WTEA 3JW8A 3OZAA 4L4UA 3QKTA 4YAGA 5FFMA 2XCSB 1IIBA 2XWQA 2YOHA 2HA3A 4E32A 4X62B 4YJDA 4CCSA 1Z4OA 2DJIA 2Y1OA 2F2TA 1BEUB 5IC4A 2GHIA 4DABA 1EGMB 2YHSA 1GCIA 3L7LA 5JFTA 1EFKA 3EXG1 1QG6A 1MORA 3H6GA 2O19A 3VZQA 1U8AA 1YZHA 3CG0A 3KD2A 1EK0A 3NCTA 5HE9A 5K3CA 1MVNA 2GO1A 3QI2A 1I36A 4F38A 1Y7HA 3F90A 1QTNA 3H5OA 4NU8X 3QKUA 1M2FA 4PNPA 4FKZA 2QIPA 2AZMA 3CZPA 5F5LA 2FQXA 1A88A 4ZT6A 3VAAA 5B4TA 1ZJYA 3HYLA 4HRVA 1NV8A 4MWDA 2RG1A 2HPZA 4Y6SA 1PJ3A 2LDXA 1KFEB 7MDHA 4EY7A 4JLDA 3AX6A 2A88A 4F7DA 2QWXA 3CLSD 1ID8A 1K7SN 1ZSVA 3DZJA 1K2VN 1TQ6A 1V7QA 4YXWA 2IUEA 2VUSA 1N6PA 1UOEA 1ZJ5A 3NEAA 1IPEA 3P0RA 4DMUB 1TM7E 3TKYA 3ANSA 5HILA 4DS3A 1UZUA 1D4FA 3TINA 4DJAA 5AW3A 2ZBPA 1WR8A 1JVSA 4RH3A 1B00A 4XX0B 1W88A 5DMXA 2IYPA 4H7IA 4NONA 4PLYA 4I5IA 5KSPA 3H65A 5A0VA 3O5AA 2RGUA 5B1YA 3TNYA 1UQTA 3GZ4A 2UYGA 5MN5A 2D0IA 2H1SA 3D1JA 3HVRA 2PZ8A 3FCAA 1D03A 5TLSA 2VZEA 2RD2A 3HGMA 1E9SA 4WFKA 2AA3A 5D51S 2RBKA 4MEJA 1PVDA 2YV1A 2JLZA 5DULA 2QN8A 2IUYA 1QHXA 2ZT8A 2YHIB 4FTWA 4UUNA 4DQ0A 2ODWA 1JLHA 2CCJA 1XEWY 2O06A 2R6AA 2WZBA 2XAAA 3FCYA 3FLAA 3H9UA 4Z5XA 2BZ0A 3EZ7A 3L92A 2K5UA 4PCVA 3ZWWA 2Q3HA 1VGVA 3UCEA 2XGGA 1MO3A 1X19A 3B36A 3VAYA 1NBMD 5DGXA 4CLHA 2WG2A 2CYAA 1Y9AA 3JRXA 4HDCA 4DV3B 4MQUA 4OMCA 1M1YA 2E4VA 2J3EA 3U7IA 2X14A 3JU3A 4RGVA 1BCSA 5HUHA 3O74A 2ZZKA 1JBKA 2OD2A 4RZIA 3KAKA 3RBVA 5JSKA 5AOCA 3MTGA 5C8ZA 5BVGB 4RD2A 1Z6TA 1RHKA 3FYUA 3BA6A 1XJWA 1I94B 4NDNE 1ZUWA 1N0IA 1U81A 1VE3A 3KJNA 1OT5A 4TRRA 3GUVA 4XIFA 3B1KA 3FLBA 1KRWA 5DCUA 3ZWPA 4R2XA 1IEXA 4BX3A 3MB8A 3HRIA 4CV3A 1FBTA 1JHDA 4IS2A 3S8MA 5JPDA 4DUZB 4KNWA 3DE6X 3QX9A 2E3JA 4EARA 1YS7A 5D01A 1YNSA 2VLIA 4HS9A 4ND7A 3QVJA 3UV7A 1D5CA 3BRWA 3L3BA 1LFAA 2OORC 3SBOA 3RRJA 1C1XB 4QGBA 2XXAA 1B8NA 4PXAA 1Y80A 1PEYA 2VJKA 4MAFA 3CN7A 4H6XA 1CR1A 1XZAA 1Z74A 4DAOA 2XD9A 1IRIA 3JWJA 3R0ZA 3WGKA 5B6PA 1Q91A 4NJOA 2ESRA 3M1YA 1XAJA 1P0IA 1UJCA 3AEZA 1U98A 3UJHA 1QG4A 3Q3GE 4PNHA 3L0OA 3E03A 1GIAA 4QO7A 5BSWA 3R6TA 1OVGA 1RBYA 2CJFA 5E1DA 4UQOA 3UJNA 2VJMA 4YPOA 1NQOA 1TAQA 1U7HA 2YIMA 3KAQA 2PLAA 3KUKA 3EUWA 1KI6A 3LQQA 1XZIA 2ZJ5A 3JQBA 1BFUA 5FHRA 1EXMA 1IZYA 1XTQA 3CCFA 2G25A 3ETJA 4OQQA 4C30A 1NJSA 1E8NA 1UF9A 1PUIA 2IHTA 2IUFA 1C3VA 1ZC4A 4NTZA 4EB3A 3R0XA 4R8VA 2X2OA 5TARA 4TTJA 3U4GA 5KQRA 1KIMA 2JIQA 2VPYA 4I4TF 1N8SA 4KFSA 3Q85A 3V1YA 3ZH2A 3NHJA 1JU3A 4JNCA 5CFMA 3INTA 4CLOA 4O63O 1ZH0A 2JEYA 3C16C 3DLIA 4O4HF 3IKTA 3OLQA 1AB6A 2FPWA 2UDPA 5G0TA 3F73A 1DZIA 4XYEA 4G36A 3HB7A 2GBPA 3SSAA 4ZCRA 4LZAA 2XNSA 4YMGA 2W6QA 4MKGA 5CBKA 3L0YA 3FYUC 1Y42X 5CCEA 2CUNA 5CB4A 3TTSA 3MS2A 4NABA 4ZVUA 4ZRDA 3BD8A 3RABA 4FCCA 1A8HA 2I9PA 4M0KA 3ZNQA 2GBLA 4DMLA 2OG2A 1ODFA 3M6WA 4WK6A 3ZHOA 5AJYA 3HCEA 2JDID 1PJTA 3V8MA 2C4HA 1CP3A 2NG1A 5E8RA 3VZPA 2FN3A 4CM3A 2OHFA 4LF4B 3F98A 4CMHA 5BMVA 1K5HA 2PG3A 2OCAA 3G02A 4X24A 1VCIA 2HA4A 1FDTA 4IHAA 4UPDA 5JYDA 4H7HA 1YDMA 3FNRA 2B94A 5GINE 1WW8A 1AU9A 2I99A 3WB2A 3N7UA 4ZEWA 1OZ0A 3RVLA 3KNZA 3DPIA 4JC0A 1H4TA 1U1DA 3KFXA 5BRAA 4M36A 1CB0A 4C4YA 4WNAA 2PAAA 3WLFA 5HRUA 5AKXA 2XA9A 3OJCA 1Y3BE 1BROA 3ZKAA 1AHIA 1LV8A 1E5TA 1Q11A 1NXVA 1YI8A 1IK4A 1KXJA 1M1YB 3B8HA 4EHJA 4MYUA 5I5GA 1I2MA 1A97A 1F2DA 1FRFS 1TUBA 2XYHA 3H11B 3QVKA 5JLAA 2CZQA 4LSMA 4BLRA 1TAUA 1L5RA 3TF5A 1F1JA 3E22A 4RMGA 3EEYA 3U26A 3AR7A 2X5NA 4LOKA 3DLBA 1YS4A 3QA3E 4UHEA 3QOYA 3K0AA 1IUOA 5FBVB 2FW9A 2DHDA 3THWB 5CIQA 3DBLB 3M4ZA 3DTVB 2ZS9A 2EHJA 5C32A 1DRWA 3KJQA 4O2BB 1SK9A 4M22A 1V41E 1EVKA 1MB4A 4OAQA 4MAAA 4L16A 3X1XA 1G38A 3K8ZA 1NHGA 3HU2A 3KXPA 4J1TA 4F8JA 4CV0A 1PLJA 4BNDB 4CZ2A 3OAAA 5J2UB 3WGUA 3TNFA 1T2DA 4DIEA 4EUFA 2XNJA 1JLKA 2VHUA 3L1UA 4H1HA 1QIKA 5J5CA 2G5TA 1Z3CA 4BFUA 2P5UA 5LLDA 2Y1WA 3I0ZA 1GPYA 4IILA 1ZD9A 1EDEA 3ZHBA 3W2HA 5CBPB 1GAEO 1E9DA 2V65A 2VPWA 3TR6A 1RYMA 3D6VA 1YWGO 4Q1VA 1HFJA 1NUQA 4FYYA 1Z39A 4CKZA 1KI6B 3FPKA 1RWVA 2QRLA 2BKVA 3T4XA 1EX6A 3WL3A 1MKYA 1V16B 1YS2X 3KKOA 4DCUA 4DDMA 4URXR 4YJ3F 1E5VA 2X7JA 1CE8A 1WDKA 1NYLA 3PKZA 4NF2A 3BZBA 3V1LA 2GEDA 2JLUA 3ENNA 3F49S 3RUEA 3QWIA 5BR7A 3DDZX 3B6EA 4DSTA 3GW8A 1JIKA 4IGIA 4MITA 4Z54A 1ECGA 5JMOA 1PEKE 1Q7EA 3BWCA 1M0EA 1KOJA 1BOFA 1OLUB 4JKYA 1OI3A 5LXTF 3YASA 3P2YA 5GWXA 4B7CA 1KFKB 1CQIA 2D5LA 4TYPA 4ZAZA 3NQ41 2R62A 3G23A 2V0CA 2C7VA 5FULA 5HFJA 4BMZA 1JEOA 3QG1A 3DOHA 1XHFA 1SCAA 4L73A 1OBVA 1H0RA 1XYYA 3IIJA 5BQXA 4M55A 3C0KA 1KAQA 1UJBA 4QDKA 4PS1A 2X8BA 1K92A 4G5RA 4POAA 3IVRA 4B47A 3IB6A 1NOIA 2BEJA 2OHIA 4ZWNA 3SLRA 2OP1A 4F2GA 2Z09A 3R4CA 2HV8A 2JHAA 2XRFA 5HOQA 3INNA 4KLZA 1Z4QA 2QPAA 4W6ZA 3GA5A 3I2KA 3FYHA 4CV2A 4AZVA 3ZCTA 1B0ZA 5H70A 2F1RA 1J07A 2GEFA 4C78A 4A36A 4L85A 3ZW9A 3ZNPA 2W2OA 1GTZA 5KEIA 3FKJA 3WLEA 3ZDYB 3QVVA 3RDPA 1IN7A 4JT8A 3CX7A 5AVUA 4YCCA 4OUDB 1GZDA 1OUMA 2C31A 4HDMB 4HGOA 4QICA 5SY6A 4DQXA 4EHFA 4ER0A 1ZIPA 4IGFA 5BUSA 2QTWB 1J2EA 2GAIA 1I3CA 1SUBA 4D97A 2CHVA 3D59A 1MRNA 1ZHHA 2NU7A 3L8FA 2HRDA 1CRQA 1FNBA 1NATA 3NBAA 2C7PA 4C88A 4Q37A 1M5RA 3OD5A 2XIJA 2P3SA 1QTIA 4DSOA 1TKAA 2HD4A 3O1IC 1A76A 3F5QA 3PJFA 2A30A 1X9GA 3K7EA 4HUQA 4NZZA 5L4NA 1BH2A 3R44A 3K2IA 5C0OE 2Z1NA 2F67A 4ZVQA 3L7OA 3LT1A 2Y0BA 3LX5A 5KYVA 5C5CA 2CYCA 4G8JA 1XF1A 4N47A 3OEHA 3SD7A 1SELA 5GVSA 3OZDA 4PSDA 4M99A 1KARA 3FPEA 5BWBA 4K9NA 4H1UA 4IV0A 1ZWLA 4K1XA 1V9LA 2XTMA 1NAIA 1LDYA 2C8KA 3WMRA 2OFWA 2JFHA 5KYWA 2JD2A 3NOVA 1G2QA 2JATA 4FC7A 2X1HA 1XC7A 3PFHA 1GZUA 2V7WA 4EHKA 2HADA 1NI5A 1YDFA 3EYAA 4GI3A 4BNYA 1VI2A 1XTIA 1ZGAA 4J9UE 3RSFA 2GA9A 3AHFA 2MWMA 4HWKA 1I5EA 3AINA 3O8OA 4XCQA 3TCKA 2A9KA 4MK4A 2JGNA 4KMSA 3K35A 3TW6A 4YV7A 1GVNB 1O1YA 4D98A 5B6JA 2HRRA 3IR5A 2HIGA 3BH7A 4U2EA 1O94A 3FVTA 1KPGA 1LZLA 1QHYA 2JKZA 1KQFA 3H86A 3LW8A 3EPLA 3I1FA 5CJPA 4I1YA 4OY3A 1T5SA 4LGCA 3LCCA 4EW1A 3SEFA 1V6AA 3B3QA 2KBFA 4L72A 3G0BA 4EA7A 4FHGA 1XDDA 4XB2A 4TZ0A 2CXOA 2E18A 2XCQA 1Q2XA 4ZOCA 4D0GA 2BFCB 1TZCA 3O8NA 4KR6A 4JLPA 3UXEA 1PG2A 2WSBA 4G8DA 5AM3A 4YBRA 1OAAA 2YQ5A 1XAHA 5LP6A 5MDHA 2QI9F 2ZBUA 3EZFA 5KSYA 1SHTX 1ZI6A 1NSFA 2FRDC 3KPJA 1O95A 1RYBA 1JDJA 4HRYA 4MINA 5JAHA 3AV0B 1A8IA 3W79A 5LJIA 3W2GA 4LXIA 2BMDA 2VH1A 4M49A 3TTVA 2ZOSA 4RU1A 4UMVA 4EB6B 4H0FA 3ZY6A 1YI1A 3DF7A 1JKJA 2GPBA 3PBKA 4OQFA 4EJ0A 1U0SY 3RS4A 1T9ZA 1U28C 2ZT6A 3F9IA 3PC6A 4D8UA 1UBGA 1JHRA 4ISBA 2X5KO 5J40A 2NUAB 3ZVRA 1U9JA 1PJ8A 3ASVA 1YFZA 3ZGYA 1M8JA 2PJRA 5DM0A 3RIYA 2Q2OA 2D2XA 5AK4A 1HQCA 3KQOA 4EUKA 1NU6A 2ZWMA 1RJ9A 1MAHA 1YAHA 2ZS8A 1R5BA 2CLIB 4RHXA 1QP8A 2OYCA 3SE7A 4BKPA 3AR5A 4R3WA 4A9AA 3PTLA 1J1UA 1Z8HA 3FDXA 3J80A 5DI9A 5KTSA 4B87A 1QR2A 4XRRA 4YR7A 5AVZA 2W6PA 3EVTA 4JXXA 3EVZA 5LMNB 3N7TA 1XMQB 1IZ8A 2G08A 2YS7A 2AHOA 2FWBA 1L4GA 3Q0IA 4JT4A 3CEMA 4PO9A 2YYAA 4R84A 5JMPA 1SQSA 2ZUDA 2SNIE 5J4VA 3V97A 2J5KA 1FNCA 2PL5A 1IXZA 1Q14A 5D5PA 3ZU3A 1A9ZA 3FJOA 1Q0RA 4CM9D 1LSSA 4HCJA 3T12A 1RPAA 1KY5A 3FZEA 3KT8A 3QFHA 4HDNA 2WWWA 2FF5A 3EQ6A 4D45A 5IJAA 4E4TA 5CVTA 2XE8A 3RLFA 3K5HA 3KOYA 4G8BA 2ZE6A 4Z4CA 5IXJA 4F9GA 5KYGA 1C0KA 3IVXA 3HU3A 3NRCA 3OPYI 2FGJA 1AXEA 1DFGA 1S1CA 2O1WA 3JZMA 3G1TA 3PQ7A 4MVCA 3TI9A 2W42A 1VJDA 3G2LA 3LQRA 3QUQA 1C3OB 1N3LA 4ALLA 3PEYA 4RSMA 4QUBA 1JFFA 2H9AA 3DZGA 1CX9B 3WGHA 1J20A 3IUMA 6REQB 3EDCA 3JTMA 3F5FA 3MUFA 2WF5A 1L0BA 3CLRC 3ZWDA 3M1LA 4EPTA 2HIHA 5ES4B 1V8FA 5FNVA 2MIIA 1Q44A 3AR6A 4JUCA 2GTHA 2RARA 3COVA 5JI2E 3MCWA 3T5DA 3KOWA 3IODA 2CVFA 2Z9DA 2G8NA 4MW0A 1JLSA 5AICA 1FUIA 4TXMA 3MB5A 5I8WA 5I7HA 2BR3A 2VH5R 2XQJA 4F2DA 2ZJBA 5EKSA 3A4VA 1FJHA 1P3JA 2P69A 5JS7A 1L1EA 5ECDA 2OENG 1D2GA 2XCOA 1ZM7A 2H2GA 2IOFK 1E2MA 4Q1AA 1V1RB 3HUFA 3DOOA 3MXTA 2AVNA 2HRQA 2OC9A 2YHAA 3QELA 3WS7A 3WO1A 1L9XA 2KE5A 3HCDA 1VMEA 3Q11A 2G28A 3OZWA 1KETA 1NW3A 3O3NB 5K8TA 3B20A 3ZDAA 4YRCA 3WWCA 2Q41A 5DTQA 2NSJA 1X39A 3KUDA 4Q9AA 5MHTA 2QRHA 3WIOA 1WB4A 2VO1A 1ODIA 3IV7A 1MLDA 1FTGA 3OUZA 2CFRA 4MVJH 3BMQB 4OXXA 4X1IA 1OV6A 4BNTA 1L4YA 3MJVA 2B6HA 2CLDX 3JQGA 5L3QB 4FW9A 1PF7E 1EWKA 4HUQB 2XDWA 1AKTA 3KKMA 4DV2B 1QOPB 1Y3IA 1CDZA 1E2KA 1MU0A 2AXPA 4LRTB 4KAXA 5JMWA 2X22A 4KRGA 1NF9A 3W1WA 5H1YA 2PKWA 3BXOA 3HB1A 1HE8B 3LTEA 2IY8A 3MT0A 4BEWA 1GCAA 1X38A 3ID6C 3VO2A 2CHGA 3AM5A 2NACA 4ZT3A 1VRWA 1M8PA 3EA4A 3LP5A 5ALGA 4MW6A 3WGVA 5KUTA 3U16A 3ZJUA 2VQ6A 4Q4CA 1O6FA 5HX7A 3L1IA 3O4IA 2ISQA 2ZRBA 3LRTA 2YWRA 5IS2A 3PX2A 3L4EA 3R7FA 3U3MA 2Z2XA 1OGIA 3AF3A 2QTFA 1EUZA 2MSCB 4MJLA 3T0IA 3W3AH 4E1BA 5IYZB 4J03A 2AC7A 4F2HA 1UAGA 4JJ6A 3ZWBA 3FWHA 2O3TA 3H19A 3BMNB 4V0MA 2GUWA 5FUWA 4TUYF 1M2OB 3DDOA 3AEUA 1P3Y1 3PV0A 2YJZA 1YKSA 4OHFA 4PX2A 3UHJA 2KBEA 5J2TB 4B3TB 3BXXA 5DP1A 1MQSA 1Z75A 2J6IA 1L5NA 1ZXXA 3GCGA 2XZOA 1F17A 1D4ZA 1VKOA 3N2ZB 3FF1A 3O1HB 4GZ3A 4KRYA 3U3JA 1RZVA 4PG8A 2R3SA 5FLYA 2ADMA 1R4ZA 3CF4A 3IPXA 2AF3C 3O8QB 3STHA 1R4MB 4LF5B 4E4YA 3GU3A 1NVKA 4FDLA 4AAYA 4BWVA 4NBVA 5KTRA 3MFQA 2B8TA 4JMPA 2HF8A 4GPD1 4MW9A 5AW0A 1AM4D 3EDYA 3DCIA 4D82A 4GDFA 2XEDA 3BDAA 2WZDA 4B9EA 1X77A 1LK7A 4DBLE 4UCQA 1WBJB 5HIMA 2GEUA 2IVFA 4Z0PA 1ITZA 1ZN2A 2FPGA 3LJKA 3ZDCA 2DPYA 1V95A 3GJ0A 4M0UA 2OE2A 3RAPR 2GZ3A 2XMPA 2GAFA 1PFWA 3VR1A 3M5PA 3QLTA 2Q50A 4LVUA 3EZNA 2H48A 5HCIA 2HPAA 3T1VA 3WNDA 3K71B 2OAP1 1HDCA 3GDWA 3RKRA 2BGIA 3F5DA 3D7SA 1LI7A 2O23A 2QXYA 3PT9A 4BMNA 4UDYX 1NY6A 2CV2A 3A1VA 1AT1A 1Z7BA 1TJ3A 3AIOA 1FX0A 1GNRA 1WD5A 1P2GA 4BLOA 3W2EA 2NTYC 1NQXA 1QGZA 3P20A 1KU0A 1GTVA 1O54A 3RYCA 4G86A 2QAGB 4QJIA 5ERXA 2X0JA 1JW9B 4LCJA 4GI1A 1Y7PA 3CKMA 4LTNA 2VKTA 1NAHA 4A8TA 1F7UA 3NDJA 3RVJA 1C30B 1SBNE 2I66A 3MELA 1YV9A 2ZP1A 2PKRA 4N3GA 3VYTB 2YHBA 2FFJA 4P0QB 1JL3A 2P6PA 2QLNA 4FP9A 5TC4A 4XOIA 3O8DA 1CUZA 3F47A 2DWOA 1H69A 1MO5A 2UUAB 1VBKA 1KAGA 1H0HA 1T8PA 5DN6A 3LRXA 4KO3S 1KQOA 3CM0A 2NO4A 4ZO6A 4X1IB 3OQJA 4BPBA 1G20B 2OGZA 2AG5A 5HF9A 3LBAA 4D25A 4RM3A 2Z2YA 4NZ9A 3SZLA 1L7NA 4KQ9A 4YONB 3D4IA 3ZBUA 1G6Q1 3VC3A 1THGA 5THXA 1GM5A 2UAGA 5IDQA 2ZRPA 3GMTA 3PFFA 4L51A 4Q7EA 4FUQA 3E9QA 3SC3A 1N2CE 3K09C 3KQMA 3W7BA 3V2GA 1YS1X 1E9AA 4BGDA 1EUDB 4LDPA 3H2BA 2YKGA 3HRHA 4CM5A 1VCNA 1MO4A 4ER7A 4OYRA 4U7FA 3RC9A 1MF7A 2Q62A 1BVYF 2V55B 3GJTA 2I1LA 2YY5A 3RRYA 4YV1A 3FUUA 1LB1B 2DF8A 3IIEA 4HDAA 2QD5A 1UKYA 3NORA 1GEGA 3OPMA 1K4MA 3T9CA 3A6EA 3NEYA 4JP2A 2KX7A 4ZO9A 5DBEX 1LPNA 3LQFA 1E0JA 1GKUB 5HYVA 3PF8A 4N1AA 4F5DA 1Y4DE 4J49A 5C35A 4X6XA 4W9MC 1U5CA 1UBLS 2F3QA 3CNLA 3IPRA 4GI5A 4MV9A 3R8FA 1PYDA 3AK4A 2X0RA 3K94A 5H80A 2QRVB 2FFAA 4QDOA 4JLKA 2EP8A 4WFJA 1NG9A 1LF0A 3FD8A 4NU6A 3HKCA 5DXAA 4Z0NA 1E66A 4B6GA 2EYQA 2HJWA 1BSVA 3JWHA 2O5VA 2XDQB 1PGQA 1YVDA 5FR2A 1XZKA 3DXZA 3JAWB 5DW0A 1MJFA 4GMDA 2NU8A 5AI4A 2PYIA 3FMOB 1IK6A 2HY7A 3O2QB 4G0YA 3SJCA 1L5HA 3GVXA 2P9ZA 1LUAA 4GMKA 1Q1EA 3CZRA 3OAAD 5AI8A 2GK7A 2O7VA 4EENA 4XRGA 3LO8A 2O0MA 3LH5A 3TJMA 2H4ZA 2WTXA 5FUMA 1MAAA 1ZOPA 5GMOA 4B3HA 5GJBA 2CXRA 3G0CA 3EZLA 5NULA 3F67A 4F04A 3CUWA 2OUKA 3ILYA 3KKLA 3OKCA 4D2IA 4U8HA 5L3QA 1J0AA 1KOGA 1E4EA 2PGNA 3O90A 5AM1A 4O4JA 1COZA 3NHKA 1RLTA 2RGGA 1NLUA 2KS6A 5BNIA 1QYRA 4XWYA 4RUKA 2IODA 4AY5A 1YVRA 1RZRA 4ZOLB 2PUVA 1OVMA 1G3QA 2DQ4A 2PKCA 2QLFA 4JJ4A 4PXSA 3W6UA 3ZY3A 1X15A 3MS7A 3N87A 5LJLA 1SKMA 4W5HA 5HKKD 2B7BA 3JQRA 1T9KA 3EDQA 1CZLA 3D2LA 2HXSA 1OBOA 5HJEA 3RAEC 3RB8A 1WV0A 1DIOB 2JFVA 1ZAKA 4TS1A 3UMSA 3VI4B 4E22A 2BCGY 1I7SB 4YV0A 3W8DA 4BO1A 1F06A 3GJZA 4JFAA 4ARZA 3VNBA 2WTNA 3L0CA 3P0EA 3WLQA 4H9GA 1Y33E 4K86A 4TWAA 3TR5A 2HM7A 1JX6A 1JALA 4BLVA 3I28A 3BTVA 4YP7A 4BO6A 3K9GA 3LPMA 1TMYA 1E6LA 2GVDC 2J9FA 3VR6D 1I01A 5HP4A 1UFRA 3CVJA 2GZSA 5A4IS 1WDTA 1EGAA 4FJ2A 3S2ZA 4H3SA 1CUBA 1DTWB 1U0EA 1DEHA 2JAPA 3CUYA 3J7TA 4BNZA 2ZRAA 2GHRA 4NYIR 3H9BA 4WKCA 4CG0A 3UEOA 3I30X 1XLVA 5ADUS 3GZNA 1E0DA 1VBFA 3DDHA 4DR1B 8OHMA 2I6FA 3HDQA 4EAQA 1CR0A 1QE0A 3DAOA 1S2IA 2OM2A 3LKBA 4JFRA 4LJRA 3C2QA 2BVNA 2XCLA 4YJ3A 3TN7A 3H9JA 1PV1A 2G63A 2ZCVA 3CFYA 2ZRGA 1CNFA 5JXJA 5TPWA 4A2CA 3SP1A 1B2RA 5KB3A 2JFXA 3P9ZA 3S7TA 3T5AA 1A9SA 4D02A 1LH0A 5GADl 4M89A 4EHIA 1FJXA 4DCPA 5I3CA 3RYTC 3NHAA 2OVBA 1P0MA 4GVXA 3MJEA 4NE9A 3OLCX 2C4VA 5DFAA 1KKUA 4QFMA 5C7LO 3QTLA 3P7MA 1Z82A 5DASA 1CYEA 3DULA 2D0DA 4CL2A 4X1YA 3ZOKA 3ICEA 1ZSNA 3RYCB 1CIPA 4BNWA 4F93B 4LY3A 4G5GA 3I9MA 5E0KB 3K9FC 2EFDB 1AXRA 2GXSA 4N4AA 4YTEA 3OCUA 1D4OA 1EJBA 1T6NA 2AD5A 3HJTA 3P2MA 4UE3S 2WQ7A 3IUSA 2H08A 4B3GA 2V3VA 3IR6A 2EEZA 2KHZA 3BERA 3BFKA 1ACLA 4ADSG 1IXYA 1J2TA 4OX9B 6LDHA 1S02A 2X42A 4RESA 2YN4A 1ORVA 2F64A 1C9MA 5C4IA 5CA0F 1OBCA 1US8B 2GYUA 1EG7A 4J6FA 2P78A 3LDGA 3X1YA 2OC4A 4AUNA 3LU1A 4DJTA 4ZIRB 1KMHA 4TTPA 4JOSA 4NPAA 5DTMA 2NP7A 5FQOA 4RJKA 3QLUA 2W6ID 2FFHA 5EPUA 3AJEA 4F3NA 1J00A 4IDPA 3ZHTA 5ADVA 2FUG1 1IHDA 1QWOA 1KEVA 1XHEA 2O3UA 3CPSA 3L6OO 3MMPA 2MJLA 4MQMA 4MKIA 4U7WA 1TT5B 4J0KA 1FTYA 4V0SA 3TSAA 1FFBA 2ODEA 3M6XA 2IP1A 3KSMA 4QTXA 2GD2A 4KVZA 4LE0A 2AHRA 5DTRA 3DMYA 2X0NA 2BI8A 2SICE 5GTDA 1GV0A 2E55A 1TRHA 4M0FA 4MX8A 2AG6A 4A8JC 3A4MA 3F3MA 3BWEA 4FBGA 2CL5A 4G0MA 2Y1GA 1R3DA 3JWGA 1W47A 4QDTA 4WZBA 5H82A 3LWBA 4K2AA 4MLCA 4PAGA 3GYGA 4ZOAA 1G21A 5JNUA 4B79A 4TT3D 2BFAA 5HVNA 4B46A 2E89A 4MGIR 1T5HX 2E5FA 4TS4A 3DW1X 5IM4F 4GKKB 3SZGA 2A9OA 2VSYA 3MBOA 4D4HA 4DRXA 1Z33A 3GRUA 3BHMA 4PQFA 3RFCA 4HUTA 2W5UA 4UCWA 4M76B 3M8KA 4Y6RA 4JYMA 4C03A 4FFSA 1YACA 2GLTA 4JXJA 4GZLA 1WU7A 3I76A 4FEGA 4XGIA 1XKXA 2J9GA 4TTVA 3SC4A 3A2KA 2A3NA 3RBAA 4XKJA 4BMPB 5B4UA 3HFJA 3WMFA 1G2OA 2R8BA 1BHO1 3BGVA 4QAQA 4TKZA 3AZOA 3AVWA 2AJ8A 3R5FA 1OGJA 5G02A 1RJFA 1KBZA 4BMXA 1S89A 1BWPA 3JQDA 1NUAA 2Q1WA 4L75A 2AFVA 3ZJVA 1ODSA 2NO9A 4DHEA 2VJQA 4ZAXA