1CYEA

Three dimensional structure of chemotactic che y protein in aqueous solution by nuclear magnetic resonance methods
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
RSDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
publication title Three-dimensional structure of chemotactic Che Y protein in aqueous solution by nuclear magnetic resonance methods.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal transduction
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1994-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cyeA00
5GOTA 2HSGA 4MRMA 4MS3B 1LK0A 5KQLA 4L85A 1FSPA 4OBBA 3HS3A 1PNRA 1LBIA 4YO7A 2FSPA 1QP7A 4KRFA 3B2NA 5E3JA 3CNBA 2L19A 1OXBB 3KKEA 2W42A 4N0PA 3RVPA 3NHMA 1PNTA 3OMXA 5KQGA 1PHRA 3KLOA 9ABPA 1EWTA 2RJOA 3T38A 4QYMA 5TPWA 5TQ2A 1R8JA 3M9XA 1VRVA 3EJWA 3KS9A 3MMNA 1K66A 2QVGA 3KG2A 1U04A 4RWEA 3H1FA 5GQSA 3HK2A 1M5TA 3FFXA 1A0OA 2PKXA 4KQ9A 1FQWA 2A9QA 1Z2EA 2WWVD 1HEYA 2FLWA 5JNVA 3S99A 3TD9A 1D1QA 3CZCA 3SY8A 5JNTA 5FWXB 5IX8A 2GBPA 2GKGA 3EQ2A 3H1EA 1ZDMA 3CG4A 3EGCA 3K9CA 4MR7B 5D2CA 3HO1A 2FN8A 2E4ZA 2VK2A 3H5LA 4S05A 1BA2A 3H5WA 6ABPA 2B4AA 4WWHA 1B00A 3KJXA 4Q6BA 2AYXA 2P9HA 4TMYA 1K68A 3I09A 3N53A 5TQJA 1ZGZA 2QXYA 3I42A 4EGSA 1E6MA 1ISRA 4S04A 3QLUC 1F51E 4JP1A 3LFTA 4YLEA 3FGZA 3LUJA 3NHZA 4W5NA 4IRXA 1YMUA 4ETIA 1NATA 4JAVC 4WT7A 1DBQA 1UDRA 3GT7A 1E6LA 1U0SY 3P9YA 4DADA 2HQBA 1SRRA 5CNIA 1NXPA 2IYNA 2R47A 3BBLA 4OATA 4RY9A 3LUCA 1D4ZA 2JB9A 3QX9A 4FE4A 5DCLA 1WETA 4Z4EA 1JDPA 1QNLA 2PJUA 2R4QA 4F11A 5C5EA 3CLKA 3OQMA 4N41A 3SAJA 4YS6A 3DGFC 3HDGA 3W9SA 4Z4GA 1JHZA 4FE7A 2YHAA 2E4YA 4WXEA 3L6UA 4L4UA 5ED4A 3OLZA 5IULC 3OMWA 5IEBA 5EWLA 2FLKA 5JNUA 2R48A 4JB2A 4QICA 4EYGA 4LE1A 3UK0A 4MS1A 2PUDA 3LKVA 3LUKA 3CRNA 3H5VA 3DGEC 3LUHA 4N47A 2FMKA 4W5OA 3HZHA 1NY5A 3Q41A 4PICA 1JL3A 2FVYA 4OG2A 3RVSA 3E61A 2MYPA 2QU7A 2H0AA 3F6PA 3QEMB 2IPAB 4LE2A 4D6XA 3HSYA 1YMVA 2RDMA 2FW0A 3CU5A 1AB5A 3N0RA 4Z99A 1Z17A 1DC8A 4RK5A 4UHKA 1RNLA 4EY3A 1Y1LA 5JS1A 3QK7A 3M9WA 2LUOA 6CHYA 1YK0A 1GCAA 1DRKA 1GUDA 3N0XA 3EQZA 3JTEA 3TO5A 1LJLA 2YHBA 4W5RA 2MYTA 3BRQA 2O20A 3HDVA 3L49A 3OM0A 3OQOA 1U8TA 3UUGA 2QR3A 2PL1A 1TVMA 1A04A 2E4UA 2PUCA 2NZVG 1YVUA 3LTEA 3JPWA 3OLWA 4G0QA 4G0ZA 3MYYA 4Z0NA 2L17A 2J48A 3KLNA 4MS3A 4EYQA 2CHEA 3A3KA 3CZ5A 4RK6A 4LZLA 4RZSA 4QYWA 4F12A 4Y9TA 3GL9A 1ZVVA 1Z2DA 4QPJC 1QP0A 4RSMA 2HQOA 4YP9A 2RJNA 3E3MA 4MGEA 2WJAA 2PUGA 2OENG 3HEBA 3SM9A 4N0QA 4YWHA 3TB6A 1JBEA 3JVDA 3LKBA 1P6QA 3BRSA 4ZJPA 4KNYA 1FFSA 4D6YA 1JX6A 4ML3A 1JYEA 1DG9A 4KVFA 2MYUA 1A2OA 3SNKA 4MYRA 4NCBA 1W9HA 4WXMA 3O1JC 1ZITA 4N03A 3H6GA 5EWMB 4KK3A 3TX6A 5HQJA 3NBMA 1EWKA 4TLMB 1DZ3A 2CWDA 2LIVA 1YIOA 5ABPA 4YRZA 4EVRA 2PUAA 1BVHA 2FN9A 2JCGA 1DCFA 5FWXA 4E7OA 4D74A 2GX6A 3GA5A 1C0EA 3MQ4A 4MAAA 1EHCA 2M1ZA 4MR7A 3FMVA 3O1IC 2IPMA 1YS6A 2E4VA 4TN5A 3C3KA 1OXKB 3G85A 3IPAA 2JVIA 2QW1A 1MB3A 4KMRA 5T7BA 5BRAA 1BAPA 5KC9A 3LUDA 1JWLA 3QX8A 3R0JA 1DRJA 4XASA 5JNRA 1GCGA 1QPZA 4IMJB 1KMIY 3RVKA 2ZAYA 5KQPA 4O5AA 1NXTA 5KQMA 1JFVA 1QKKA 1TLFA 3EDCA 3H6HA 3KYJB 4H3KB 4KQCA 4RK7A 2WY2D 3RQIA 1F4VA 2HPHA 4RK1A 1QMPA 1PEYA 1VLZA 5FWYB 2MSKA 1W25A 1TMYA 2E4XA 3BREA 4RDCA 1BDHA 2JVJA 3I5AA 4RXTA 3HM9A 2FEWB 1P2FA 1NTRA 4N76A 1LJUA 1U2PA 3HUUA 3LUAA 1P8AA 2IPNA 4G0PA 4HNQA 2BGGA 3RVRA 2FTKE 5TQ0A 1ABFA 4XLTA 2QZJA 5I4CA 1YK1A 3OLVA 3N6VA 3A0UA 1DCMA 3ILYA 1C4WA 3IP7A 5TQ0B 3OLYA 5BQ3A 1BDJA 3QEMA 3BILA 1APBA 1DP4A 3JPYA 1E6KA 4EYKA 2M98A 2NT4A 1RZRD 1QQAA 1QO0D 1D2AA 4EVQA 2A9OA 3O2SB 1FFWA 3EAFA 4FB4A 4ETNA 3D8UA 3Q7SA 2LBPA 3RH0A 1D5WA 4P1ZA 3JS5A 2NZUG 2PUFA 4G0YA 2E4WA 3QLVC 3OM1A 3N0WA 3A10A 1U2QA 4WUTA 1L5ZA 2HQRA 2N9UA 2NUBA 3N8IA 4MR8B 5JS2A 4EVSA 3LUFA 1KGSA 2GI4A 3GYBA 3Q7TA 4ZMRA 2HJ9A 3H5IA 3O75A 3Q9SA 4XXHA 3F73A 5TPZA 3I45A 5EWJB 3LMKA 4KK4A 3RVOA 3DLBA 2VUHB 3LUGA 3QLTA 3D02A 3SQNA 5IBQA 1XHEA 8ABPA 2IOYA 1PUXA 4EUKA 2I6FA 3FFWA 3F6CA 3Q7RA 5BRJA 3HJFA 2FKAA 3KHTA 3H5TA 4JOQA 4OLAA 4PZ0A 3CFYA 2PAFA 4RKRA 4LX8A 1URPA 2PE5A 3CKMA 4NICA 2MSLA 3HV2A 4IILA 5DGCA 4G0XA 4Z4CA 1J56A 1JLKA 2WB4A 4LDZA 1Z15A 5CNKA 3IP9A 4DQDA 4KREA 4DN6A 3LOPA 2MSWA 4KFCA 1KRXA 2WJWA 5KC8A 4KV7A 3GBPA 4PEVA 2IKSA 2GWRA 2A9PA 4MQFB 4XAQA 3G1WA 1ZH2A 4MS4B 2LPMA 2F8TA 5EWMA 3FFTA 4NQRA 2PMCA 1EFAA 2QVCA 2JVKA 2JK1A 4RK4A 5CHYA 3ROTA 3QLVA 3HXMA 4Z4IA 4F3TA 3O74A 2WMYA 3C3WA 4GNRA 4JB0A 4IF4A 3F7NA 3H75A 2CD7A 2FQXA 5FBHA 3CG0A 2IDMA 4PE5B 3GBVA 3C3MA 5IUKC 1SD5A 4W5QA 4NV3A 1PEAA 2FQYA 3ROFA 2ID9A 2FMHA 5DKFA 1ZAYA 1YTUA 1M2FA 3GWGA 4RK0A 4RXMA 2FMFA 5TPZD 4ZMSA 3O1HB 2JBAB 3Q15C 2ID7A 3DZDA 4G86A 4YCSA 5HM6A 5KWSA 4MRMB 4MLDA 1GUBA 4M88A 1RZRA 1KRWA 1QO0A 3ILHA 1SXHA 4Z4FA 1VKRA 4H3HB 2XDYA 4RS3A 5T3YA 1ZHHA 2QV0A 4LRQA 1DBWA 1TM2A 3A0RB 4Z9BA 1JF8A 5JNWA 2F8SA 4OTZA 4GPAA 4RXUA 3RVNA 1CHNA 1Z18A 3KCNA 3QEKA 1L5YA 4YR7A 1AB6A 4ETMA 2P4UA 3IDOA 4F06A 1XWWA 1DCKA 4MQEA 1XHFA 3JY6A 5C5CA 3OLXA 4KZKA 4RKQA 3C97A 1M2EA 5IEJA 3OO0A 4YGXB 3KSMA 4O1HA 4H60A 3K4HA 5DLEA 5PNTA 5TPWB 2WRZA 2VYCA 5FWYA 5TQ2B 3RVLA 3KTOA 3HCWA 4MQEB 5HKOA 5B3JC 3URMA 4G0OA 3T6KA 1MB0A 4EYOA 4YV7A 4Q7EA 4KPYA 1Z13A 3MA0A 1MVOA 5TE9A 3HUTA 3H5OA 2RGYA 2X7XA 1RXEA 3CHYA 4LDAA 3OQNA 4LE0A 2PUBA 3DBIA 3EULA 1E2BA 1FFGA 3IP5A 1SXGA 3IPCA 1JFTA 4P98A 3GRCA 4OLBA 1T34A 1USKA 4IMIB 4TLLB 4WZZA 2B1JA 3DLHA 1Z16A 3GV0A 3T95A 3H1GA 3MIZA 2Q5CA 1I3CA 1JYFA 1SXIA 4NCAA 1DJMA 1BDIA 1NXWA 2DRIA 3M6MD 4RV5A 7ABPA 1MIHA 3JVIA 5IC5A 1NXOA 1ZH4A 1Z25A 4RU1A 3QELA 1CYEA 5IUJC 3N75A 2L18A 3MM4A 3RVMA 2AYZA 5F64A 1TJYA 1NXSA 2NT3A 5BR1A 1NXXA 3QELB 1QP4A 1P6UA 1M5UA 5KI6A 1JDNA 4MR8A 4HYEA 1H9CA 5B3JA 3NNSA 4JASB 2CHFA 5EWJA 1ABEA 1ISSA 3O21A 3RVJA 2VUIB 1JFSA 2R25B 1MAVA 3NNDA 3EODA 3KYIB 1YS7A 5CNJA 1ZY2A 1D1PA 3HVRA 2PL9A 5EWLB 1ZESA 1ZN2A 2ZWMA 2TMYA 2IPLA 4F8JA 4MS1B 4Q6WA 3NNNA 3TMYA 1CEYA 4E7PA 3QLUA 4JA2A 4XFKA 4CBVA 3VNBA 1Z12A 2PUEA 4ZPJA 2FEKA 4MPTA 5IUNC 3C6QA 1VPWA 1RXIA 4IGAA 1IIBA 1NXVA 1ZGGA 2JRLA 2MYNA 4Z9AA 3O2QB 1DC7A 1JH9A 2FMIA 3T8YA 5CNMA 4G97A 3IP6A 3UKJA 4MQFA 3CTPA 1EAYA 1EWVA 3O2JA 4MS4A 1Z26A 3VNAA 2FEPA 1USGA 2KYRA 2V0NA 4XARA 3MF4A 1DBPA 2LP4Y 3RVQA 2H3HA 2A9RA 4HNRA 4MR9A 4Z4HA 4RY8A 2QSJA 5FBKA 3SG0A 4G0MA 1S8NA 4UHJA 4ZYLA 4B09A 2OQRA 5HSGA 4W5TA 4MR9B 4PYRA 4RY0A 5DTEA 2FXIA 2PLNA 4O1IA 3OO1A 1QQBA 1USIA 4MLCA 3FDFA 1LBHA 2FQWA 3CS3A 5JNSA 2L2QA 1RPJA 1GLGA 4HNSA 2JBAA
chains in the Genus database with same CATH superfamily
1AK9A 1JIKA 4I99A 3OEHA 1TTQB 1QG4A 3ORSA 4JYBA 1GKYA 1BHJA 4W7IA 4Q9HA 3K96A 1I14A 3N86A 4TMVA 3W7AA 1GZSA 4OBBA 4LRXA 3P71T 4OXXA 4RIEA 5FAXA 2L82A 1ZXXA 3ET5A 4GS5A 1P6XA 1T4BA 2I99A 3MN1A 1I01A 3OOYA 5K9ZA 4MDHA 1BOOA 1XWIA 2BFMA 3HKEB 3W3ZB 1XAHA 3KQKA 2CZQA 1NBEA 2OCLA 2OV6A 2HI0A 2IDZA 1WHTA 3T38A 4ARUA 1YA8A 1ZNQO 1KEZA 3C4JA 4O25A 2F3UA 3PC8A 4PX2A 3SD7A 2V9ZA 3UENA 5JG7A 3P0IA 3WB9A 4C9BA 2LKCA 1ZD8A 1LVGA 3A4IA 3BKXA 3NW9A 5CM8B 2EKLA 5KX5A 4XIJA 3GLFA 2BP7B 1WHTB 1RM4A 1E0KA 3IDAA 3Q11A 4JUAA 1TA9A 4QT0A 3D81A 1Y81A 1QO9A 4GYKA 1RXYA 1D2EA 4RWEA 5CFPA 3IUJA 3ZVLA 1A0OA 2CXHA 4FFPA 4RHTA 4XUGB 1RQXA 3QUCA 2C98A 1CB0A 1FQWA 1N8NA 2PKXA 3EDQA 1AA6A 4AUNA 1UJ5A 4NV1A 2BMDA 1GTVA 3BJMA 3AB3A 3EQ2A 1I2DA 1X39A 1ZDMA 3CG4A 2QX9A 4MUBA 5FL7A 4XGRA 2YYSA 2P6PA 4EAQA 4DY6A 1E4EB 1C30A 3PS9A 4EFNA 2QGNA 4MMZB 3HC7A 4DLWA 2B1QA 5MFZA 4FILA 4GAEA 4C4RA 4ZA2A 1IG0A 4FTWA 3NB0A 2Q3EA 3FVQA 4HSGA 3I23A 3M70A 4ZAGA 4S04A 4MGYR 2BLNA 1E6MA 3WZMA 1TOAA 2DFDA 4CLOB 2I8CA 1KBOA 4V38A 2WU0A 1ZGJA 3FGZA 3QUSA 1G3MA 2G9QA 4HBGA 4JJGA 4YNBA 2ZJ0A 3TGLA 4KE9A 5LDGA 1JLSA 2VL7A 1YMUA 1RWBA 1W5FA 2BKAA 3WIOA 2J5RA 3KJIA 4JAVC 2VDMB 3OJEA 5DK6A 1PKEA 4ZO9A 5AFSA 1Z0FA 3D3NA 1WIWA 5DH9A 4HNTA 3MLEA 2KLBA 5K6TA 1QHIA 1QNLA 2PJUA 2ZRCA 3QVWA 5ES3A 1TVEA 5MN5A 4TZKA 5G4KA 1DELA 4F11A 2N3ZA 1SG0A 2Y6UA 5KOYA 2C7OA 4EARA 1S0UA 5EGNA 2BTQA 3O95A 5AW1A 4PZAA 2NV2B 4MUJA 4YS6A 3EEBA 3BIJA 3FETA 1HZJA 1WS6A 2HBYA 2ZXEA 4ZCLA 4CPDA 2H4XA 4H7IA 1TXGA 2IHJA 4OQYA 3OLZA 1C1DA 3W1EA 3ZNNA 2D62A 1YI1A 3ZTWA 2FETA 2QLJA 1E3SA 5HTOA 1H3NA 1Z7YA 2VOJA 2WIKA 1PFGA 4NH4A 1GO2A 1VDZA 2B8EA 1T29A 3ODPA 4QUIA 3LZCA 4TTVA 3ZVMA 1NJFA 2FEXA 2ATVA 1FJXA 5GADl 4FEAA 4OG2A 1HWYA 3R75A 1E20A 4B3CA 4LE2A 4ZXFA 4TYYA 5JJKA 2G1KA 2O3QA 1JE1A 4QPNA 5JBNA 1A9QA 1R8SA 3ZC3A 1GGJA 5H7XA 3ILSA 4DV0B 1K4YA 1LFAA 4NFLA 3EQ7A 1ISPA 3Q40A 3THXB 2OGZA 3R3VA 4RHYA 4BCDA 3W5AA 1SC9A 2GO1A 2MINB 1IBRA 1MNAA 5BW8A 1H5NA 2YCLA 3BWYA 5C34B 3G7SA 3RHFA 1DLJA 1JZQA 2P5TB 1J49A 3FB4A 3OZIA 3PHGA 1Q1BA 5ALGA 2IH2A 2O20A 4HDOB 1P0QA 3PJFA 4K1LA 2V6IA 4WECA 5F7XA 2RONA 1T9DA 4OVKA 2XUQA 3R9KA 2AEMA 1BXRB 3CRMA 3EVCA 3S70A 1KJIA 1UOOA 1GPYA 5DW0A 1U8TA 3AUKA 3LY7A 1I5RA 4WLUA 4C4YA 1Y4DE 2JC3A 4CTOA 1TVMA 5LYYA 1QLHA 2RE8A 5LNK6 2X4IA 3VR3D 2QYSA 2BHRA 3FNEA 3E9RA 3H3FA 1K6MA 1IUOA 2BHSA 3L4BA 3OAAD 1RHUA 5H02A 4L4RA 5A05A 2G1PA 3CCFA 3RYHA 2GM4A 3JPWA 3MXOA 5B2FA 4C89A 3AF6A 3RO7A 1XJWA 4V0KA 3T0GA 5BN1A 3M2PA 2H4WA 4G0VA 3B6KA 2NG1A 4K1XA 3EG5A 4F5DA 3R23A 3RHSA 5KNBD 2GFHA 3GL9A 1XI2A 4XSHA 2NSHA 4PNPA 3DMYA 2HZBA 3NHAA 1BH2A 1OSNA 3P2IA 1G3RA 2YXNA 3IYLW 4RVGA 5A4FS 1JAXA 1Y82A 4CLXA 2ATXA 1BEUB 1D2MA 3IXMA 4UQLA 5J47A 5K0EA 4MWDA 1JBEA 2VZ9A 2V1XA 2WPDD 1RI3A 3KFXA 3DMGA 3NT4A 5BSUA 1QFXA 1Y80A 1CJVC 4AKSA 5CB4F 4P4GA 4W82A 3CKYA 3EBPA 3JQBA 4FJ2A 1WSBA 1VG0B 4FFMA 3P9IA 3TW4A 1ZITA 4AMGA 2FJPA 1E9EA 3NBMA 4DQXA 2QJFA 1PD1A 1DZ3A 1M1UA 3I3OA 2GCIA 4KH1A 4LZAA 4ARZA 2WDPA 3VH2A 3ZQJA 4EENA 1MR3F 1RHKA 1FFEA 1ODLA 4Y2RA 1DCTA 2QZZA 2FG5A 1QRUA 1BE0A 3OZAA 1C0EA 3GLGE 2QN1A 2LXNA 1I3OA 1UDXA 4DUPA 2O8DA 2GTPA 2FA9A 3CH6A 2OFFA 1YL5A 1VYHA 3K32A 1P39A 3CBQA 4AY2A 5J5CA 4RWZA 3CZRA 4CEJA 2F8LA 1QK5A 1QDEA 3IV7A 2JVIA 1PFQA 2J9FA 5JD4A 2HX1A 4XOIA 1YZTA 2REOA 2VKQA 1K6EA 2VWGA 1WUJS 2QU8A 1KK1A 3AR7A 4GOKA 1O77A 4CEJB 2N1MA 4JJAA 4R9VA 1IB6A 4CM4B 2J9FB 2O7VA 2CE2X 3DQQA 1UJBA 3RAPR 3KUCA 2VAMA 1NLMA 3CE9A 4UNPA 5A2QA 4A4DA 3HR4A 1RPTA 1Y8QA 1HV8A 2XDAA 3SX0A 1HYEA 1Z7WA 2DUNA 2HLNA 3GJ3A 4M7RA 5F2KA 4YROA 1MHPA 1F4VA 3RTDA 3WAJA 2VT6A 3WMXA 1Y5IA 2JI8A 3L4EA 4MEBA 1NBMA 1TTHA 2HWYA 1YR6A 1XVVA 3K9FC 1Q0TA 1CUXA 1V26A 2AG5A 2WG1A 1CZOA 3H3JA 1R6TA 1E0SA 1QIMA 3K4PA 1NW9B 3OAAA 4MO9A 3T12A 3VR3A 4B87A 4PLFA 1BHO1 4YXWD 2J4CA 1A95A 4EG7A 2CE7A 2VDKB 3PDIA 1XJ0A 4HGZA 3VTAA 2XMBA 3IIJA 1A9RA 1CW2B 3PEUA 3BXOA 4DMHA 3KSUA 3CINA 2JHFA 4AUKA 3DMHA 1K7EB 1ZVMA 3PQ5A 1VPTA 1T6BY 1SVIA 2FHSA 4FKMA 4N5MA 2W70A 4KW7A 2VPYA 1Y4ZA 3LWNA 4HDAA 4D9JA 3RSQA 4CR7A 4OSOA 5CXUA 2FPIB 2G1AA 2M98A 4ZVUA 4BB6A 4PZUA 3HP7A 5H59A 4IINA 5K3FA 2RC5A 3MQ2A 4J03A 2C9CA 2OCYC 1FLVA 3NQ41 4C4SA 1N33B 2WPDA 4LC9A 4AWXA 3AHJA 1OKKD 4CKBA 1EFUA 2WUFA 1H8HD 1GRCA 2L0XA 1PW5A 3AJ9A 4E33A 5EQFA 1XTIA 1UQRA 3G9ZA 4TRJA 2P67A 1CUYA 5CB0A 2K2QB 1KAOA 1DL5A 5KNLA 3CPHA 4UHDA 1Q84A 3C5CA 3ESDA 3K1YA 3L1HA 1K1EA 3B3FA 3MTGA 2H7YA 1GG2A 1H2BA 2O9JA 1QC5A 3MWEA 4DGQA 4HEA1 3OCCA 2VA8A 4D02A 4ZMRA 1Q1AA 2OUIA 1NTOA 5JCPA 4BLUA 3KLPX 6NULA 3IAM1 4OM8A 1WXGA 2AHRA 4GPIB 3GMTA 5L3ZA 4D9IA 4EGAA 5J58A 3TLAA 5BQPA 3D02A 3I58A 3KT0A 4BUCA 4TKMA 2X76A 3JQ7B 1POWA 2PSDA 4MPPA 3V00A 2BBTA 3NHRA 4EJFA 4NE9A 1OLSA 4YMIA 4X7PA 3HZRA 1B8NA 1TF7A 1VLQA 2CLLB 1JYSA 3CFYA 1BCRA 2QIPA 1JZSA 2B2NA 1IK6A 4Q9KA 1K27A 1J1ZA 4ND6A 3C85A 4YDRA 5CTJA 1S9HA 5DGCA 4F60A 2HWUA 1A1VA 1OLSB 1ZCAA 4GBJA 4PX5A 5AHXA 4JEIA 4MKZA 3RVDA 3SFVA 2GCOB 1UDAA 1Y8CA 2VAXA 4IMPA 1YASA 3HFRA 2AOVA 2EZUA 2R44A 4ENSA 1DX9A 2MSWA 4XFDA 4ESVA 2C4HA 2PJZA 4TGLA 5CFZA 3DO8A 1X3SA 2CF5A 3PUKA 1T3HA 4XWTA 1TZBA 3UY4A 5BURA 3TE7A 1Q2XA 1T6XA 1UR5A 1ZH0A 3CZPA 3K35A 3F0TA 4FMCB 4LGYA 3SQMA 3T7IA 4DBVO 4DFDA 1X8LA 2AC2A 5CITA 4X1KB 4ZEXA 2NXWA 5C52B 3AF5A 1MCZA 2DT8A 4LHWA 4LPSA 1U3CA 3WNDA 3WLQA 4F3TA 2WYVA 3ZX4A 4R5HA 4BP8A 4B43A 2CJFA 2QUHA 1FDVA 2VYQA 4YXWA 2Q1YA 3TSOA 5LXTB 3U61B 3MUNA 2Q8PA 5KB3A 3ROFA 1ZUD1 2HH9A 5KVSA 3ZVKA 3UBTA 4ZV4A 2MIIA 2IRWA 4L8WB 3OZCA 3M2TA 4BNWA 3FAKA 3DO6A 4V39A 3H3XA 1C2TA 1T2AA 3WJ1A 1KWGA 1XRNA 3M6XA 3DZDA 3MGCA 3FF1A 4C7KA 4D96A 1U7DA 1A4RA 1NW4A 3FCXA 4TM8A 3UMYA 3CVWA 2JEOA 3C1UA 3DHWC 3K5IA 4LBYA 1G6Q1 1JR4A 1PQPA 4AX4A 4Z4FA 3LF1A 4AZ3A 1FNCA 1BE1A 2GBLA 2PRZA 3RJMA 4IZ6A 2GK4A 3U5ZB 4LQDA 3ZHUA 2CV0A 1HTBA 1CXZA 4YHBA 5KEIA 2C3OA 1JHOA 3JALA 2KBFA 3KDPA 4MQEA 1QZ3A 1CR0A 3VH3A 4F86A 3KT3A 1RRGA 1KOGA 3RSHA 1QV9A 4RKQA 3KQTA 1GAQA 1RKBA 2GTHA 5PNTA 4DDHA 1VL1A 1AK1A 1RRCA 1ML4A 4L9SA 3KEFA 4BHTA 4HRYA 3HUDA 1NWCA 4MQEB 3ZD6A 2BYTA 2G9VA 1MX3A 3EIWA 4G0OA 1KZ7B 3UHAA 4Q7EA 4CKYA 4YV7A 3GLIB 1RMTA 2I55A 4NNPA 3KV1A 4QNRA 2DHRA 2C92A 4C08A 3FPCA 5KWJA 5JHGB 4JJ8A 5A1TA 1IJKA 3B85A 1DEAA 1JLLA 4QVIA 4P7BA 2ZBFA 3VO1A 3DLTA 3IPCA 4C2UA 1N6HA 4U00A 5BR8B 4QXPA 5AKXA 1BE8A 2R1TA 1T34A 2WV7A 2X6QA 1L4KA 2DTDA 3EW9A 5AJWA 5DCYA 1CQZA 1RDFA 3A1CA 2NPIA 1FFDA 3E7FA 3VKUA 5A3RA 4QE3A 1JLLB 4W9MC 1KDPA 1CYDA 2IOQA 4DWWA 4GKJB 3CLTC 3BQMB 4HGOA 4YMWA 1IWPB 1QAQA 4DWVA 1RIIA 2EFEB 2PBRA 2UUPA 3U7JA 2VSQA 2C4MA 3NZEA 1Z7EA 3MRXA 4DV3B 4TZ0A 3ICWA 3QELA 3DXYA 3PR2B 3AB7A 2J33A 4U9HS 1ZFNA 1EP1B 4OSPA 1FF9A 5L6LB 1X1DA 2JCYA 1DARA 3QELB 1XNHA 4IXMA 4I1RA 4JX9A 5DHSA 1E5TA 5FUBA 3R3WA 1P5HA 1T9GS 2HJGA 2Y67A 1AGRA 2XCLA 3FA2A 4MICA 4NV0A 4ZQEA 3RE1A 3K53A 2GARA 1JI0A 1H8ED 1Q6ZA 2JIOA 3GLHA 3FPAA 2GB4A 2ZAOA 3AVOA 2ONZA 5JAIA 2JLSA 2QMZA 2VUIB 4RNDB 4B83A 3DQZA 3G5TA 4YRAA 3KYIB 2F4NA 5D6NA 4KPFC 5C35A 3EIEA 3GLHB 3HYLA 1PI3A 1Q5PA 5IZ4A 4F8JA 1Q0QA 1RPNA 4KXMA 4QFBA 4PIPA 1TECE 1NBHA 4KP7A 1RLTA 5T4FA 4NPAA 4RCVA 1YC5A 3SVZA 5C4IA 3EX7C 1YHZA 4WX2B 2FNAA 1J6UA 2H1SA 2YBEA 3CJTA 3CX8A 4DV4B 4IGIA 2M32A 3T9FA 5M2QA 1GU1A 2WWIA 3FZQA 3CRRA 5G2OA 1EWRA 4EJSA 3ZU2A 1BHSA 1J0XO 4UAGA 4MQFA 4L1KA 2F3RA 3PV0A 3M83A 2YV1A 2HV9A 1G5TA 4CRWB 3VNAA 2E85A 1V3QE 1PK7A 3QU4A 3AKEA 5JW6A 4E5DA 4LKOA 1VSUA 3GRUA 1XX6A 2EZ8A 5BYJA 4C0KA 2PS9A 4NTZA 4MYTA 1G21E 2IZ5A 2QSJA 1TIPA 2GBCA 4RE6A 1PJCA 2D4HA 2ZUSA 3M3HA 5BMVF 4P5EA 4Q02A 4EOGA 1Z4MA 3C2QA 3LPAA 4Y1RB 4IP0A 3QU7A 4D1YA 4EM6A 5TXGA 1DT3A 1ZRSA 3BIWA 5CD9A 2R6CA 5AI5A 2YFYA 2JLQA 1FPQA 2IXGA 4ZZIA 1ND6A 1EFDN 1QFJA 2XZTA 3JU3A 3K31A 1QE0A 1QV6A 2VG8A 4OFWA 4ENPA 2YVKA 1MW8X 1J8QA 3VOSA 2AEEA 3TOCA 3KKKA 4BRWA 5CUQA 4C7JA 4PSCA 2G5GX 2RK3A 1OFGA 4HN9A 4AO7A 1OC2A 1T3LA 2VDPB 3WWEA 2OP0A 3HN6A 2Q2NA 3B3JA 5K0JA 3T1HB 5DF1A 1T15A 1EUDA 2EDCA 2QPLA 3R7SA 3LYUA 2I4OA 2XZDA 3R7NA 4DSZA 1F0NA 4M89A 4TT8A 4EUFA 2ISSD 5GM1A 3LX5A 4GPEA 2D0IA 2WJJA 2NZ8A 2YY5A 5A0FA 4NK4A 4R9RA 5TGTA 3SZOA 1X3LA 3W3AH 1EUDB 4KFUA 1DWOA 1IHYA 1DI0A 1TVKA 2VXBA 3FTCA 3K6RA 3KKNA 1YQXA 3OPNA 3GIWA 1KI1A 5CVTA 3OZGA 3KXDA 1ULSA 3AVUA 2OO5A 1JEYB 1R8JA 2ZANA 2W6QA 2HC9A 1PEKE 4NCXA 3DL2A 5REQA 1TVKB 3KS9A 2RCNA 2I3ZA 1H8EA 1P2UA 4HH0A 2QVGA 2ZJ3A 1XMOB 4MWBA 4UNIA 3RUEA 1TCBA 1NQ5A 3MRSA 2R0QC 3EGIA 2Z8YA 3CBGA 2IYFA 4GVXA 5REQB 5IPFA 4S1TA 3HZZA 3SI7A 1EFVA 4N5HX 4C0HA 5K0TA 2QD5A 4H6VA 4HSEA 1QRAA 4EY5A 5D2CA 3BK7A 3K9CA 5K45A 2FHPA 3UGKA 1LK7A 3HO1A 3EDRA 3JZAA 5KNCH 1R5NA 4JC4A 1CY2A 4DQUA 3NDRA 3C6YA 1BA2A 3U62A 1KI3A 2H11A 2P2DA 1BRMA 1KKUA 1SKYE 1VMAA 1WU8A 1TM5E 5TEVA 4CF4A 1YRQA 2NPFA 1XZMA 2E6UX 5A02A 4RGYA 5FOQA 3L9WA 1EPUA 1MD9A 4AP9A 3KQMA 4ESEA 1F8GA 3ZQ4A 3C8MA 2ZB4A 3I4FA 3QKSB 2Q7OE 3UHFA 3VZCA 4C3OB 5JQWA 4B7ZA 4LY0A 3DDNA 1SWWA 1E58A 1MEEA 4D92A 1JNXX 1LRKA 3C4QA 3MT7A 1LZKA 3PEEA 4GKVA 5FNZA 1A2KC 3TAXA 1KVRA 3L0CA 4JUBA 4M60A 4DC1A 5AK6A 4TSRA 2Z58A 3DAFA 4CU5A 2EWVA 3BMCA 1HKHA 4B79A 3T4EA 3UMVA 4AW9A 1UC4B 2QN7A 4XRGA 1SK9A 3FJ1A 3FSRA 2C78A 2ZRIA 1GKUB 4NU6A 2ZWPA 3WYAA 1JIQA 1NT2A 3G1UA 4XX0A 1RE0A 4QECA 5A04A 1E8DA 3O9MA 3PFWO 1PNVA 5JFTA 3ZKWB 5C5DA 1CSEE 2YHAA 3MWDA 1F3OA 4WXEA 1SURA 2ZSKA 4K8RB 4NMHA 4BJ1A 5F3RA 3A3OA 4WV3A 1CCWA 1JBQA 2GZSA 4D4HA 1DMSA 2I4TA 4FGZA 4JB2A 2WEKA 1R15A 1W5SA 2YQ4A 2H48A 2P5YA 4MMYB 4XX0B 3LKVA 3NHSA 3MAGA 3OZWA 4HGRA 3SF8A 3B3AA 4IXTA 1QIHA 3KYCA 2C8VA 1BX1A 4QXRA 1I80A 3ESCA 3W4KA 2H0AA 4B7AA 3H4VA 2ZJ5A 4F4IA 2HDWA 3TLGA 1DIGA 4FZVA 3H9UA 2R6R1 3UFXB 5IF3A 2QR2A 3TOVA 1RI4A 2XGGA 2MCFA 1X2EA 3L93A 3DJFA 3LGXA 1A8PA 3DE3X 4AICA 1SZPA 2HGSA 2VP3A 4YCDA 4Z9YA 4BKOA 4M38A 4N03A 3TLGB 1BG6A 1DAPA 3A1TA 3QEJA 3QY9A 3CNQS 3QK7A 2NUAB 5K0BA 1H65A 2OKCA 3FHJA 3KVVA 1WMDA 4CT4B 2JIDA 1S4QA 1NFRA 3EQZA 4ID9A 4Q16A 4DIMA 5A5DA 5IHPA 4BQNA 2XB2A 2J46A 3KEGA 3QWAA 4YTEA 3BRQA 2O1WA 3ON5A 4KXQA 1VE1A 4DIBA 5K3EA 1B43A 4D0SA 2IXTA 1N0IA 4HDSA 4AJ9A 3DBRB 2OWDA 1YVDA 5G4KB 5J2UA 1U1FA 1CE8A 4AIRA 2A4KA 2EBUA 2OFWA 4B8YA 3A9UA 2AEFA 1U90A 2FWIA 5E0KB 3TCXB 3LT5A 1YR7A 4GOXA 4DV7B 1UPFA 1K9VF 1M1YE 4NBWA 3UK7A 2EFDB 3ZY4A 3AEXA 3RV3A 4PX9A 3IXLA 5EFOA 3GHYA 3IJRA 2CHEA 5F2EA 5JADA 1JN0A 3A3KA 1FNSA 5LQJA 1QX3A 2ETXA 2CN1A 2FK8A 3I8XA 3IQZA 5AI0A 2BI8A 2O2EA 4DY4A 2R11A 3IUNA 1ORWA 3H11B 1ZM9A 3B78A 4MGEA 1Q14A 3N2GB 3R9XB 3SM9A 1V3VA 1AMNA 4TUYF 4KI0A 2ANBA 3CX4A 1C0PA 4E70A 2CNBA 3OOHA 2BJWA 3WICA 1ZOPA 5KOIA 1A2OA 1B1CA 5TJ9A 4B84A 2DFVA 1FP2A 2BPOA 5J2TF 4KK3A 5BWNA 1KC1A 3U2QA 4F4HA 1AV6A 3PIDA 4WUVA 4O4IA 5KOJB 2CWDA 5FTMA 1RE1A 4O4LB 4B2PA 2J7PD 1K63A 1Y5MA 4QM7A 4WKNA 1PJTA 2JPDA 4UMVA 5DRTA 4GLFA 2WC1A 3RIEA 5IBPA 1KBZA 4GICA 4KE7A 4RVHA 5CMLA 3C3AA 4EYSA 3ENVA 3MCZA 121PA 2LR0A 1UODA 5CXSA 4HLUC 3QA9A 4MKXA 1NQXA 4NZYA 2NWQA 4ZOEA 5SV2A 4ZGBA 3DL0A 3HO8A 4XRRA 1QANA 1IN4A 2H63A 1BCSA 1WRBA 1DKOA 1C14A 3U26A 2BI4A 2P6UA 3CCCA 3SHQA 1T1IA 4ENUA 2HU7A 1BYIA 3EPJA 1T5DX 3I62A 3JYOA 4M0UA 2XE6A 1BCSB 1B6GA 4P22A 3BXGA 2WQ6A 1UBMS 1G5HA 3PJRA 3SYRA 2OQIA 4MEJA 1F06A 3R3JA 2HU8A 4XD2A 2BDTA 4B46A 5AKHA 2JHAA 5IVIA 5JXIA 1Q20A 1IN1A 3GVPA 2XUAA 1M0WA 1L7QA 2XUHA 4XI9A 4D82A 2FZKA 1NN0A 2PMBA 1F7VA 1NYQA 4CEHA 2ZRLA 4PPGA 2OEPA 4UEWA 2I8AA 1O9GA 1JXOA 2PWAA 1P17A 3E9DA 1P8AA 2JJ8A 2DTXA 1DVRA 3CF6R 1U7PA 3F5SA 2Q0QA 4MW9A 4P92A 2XXAA 1QF6A 3A1UA 3MGAA 4UBKA 2V7GA 3OQ6A 3K0CA 3G0OA 3LK7A 1UMBB 1B8UA 5J9FA 1Y3IA 3U3OA 1MEOA 1P91A 2IZ0A 3BQ9A 3OI7A 3G9QA 1VCOA 1OB2A 3NPAA 1L4EA 5K3SA 5AJTA 4B3DA 2I76A 2X6RA 2PGDA 1FU8A 1NC3A 1C7IA 1ZUWA 2GAOA 2I6TA 1KO5A 2V03A 4OP3A 4YP5A 1JTFA 5CIQA 3IHTA 1TTTA 5EMMA 1G7TA 2NZXA 3WQRA 4DJ5X 5ALDA 4YMSA 4MW1A 1BGVA 1X77A 3M4XA 2QSUA 4FDMA 4HAOA 1PW7A 3QQPA 3HXPA 5ALPA 5J63A 4DM7A 1UMCA 4UBMA 1ESCA 3T3EA 3QWBA 4WZBE 1UAYA 2FPGB 2HA5A 3F6YA 3LG2A 3JS5A 3EISA 4X1IA 1P4JA 5C1IA 4I50A 1K86A 1W5BA 3QRWA 1YQDA 2ETVA 2CBZA 2XWJI 4D9EA 2RJ3A 2VBGA 4BNDB 1UMCB 3I61A 1NW8A 1DUIA 4Z9XA 2WBLC 4GKBA 2GD6A 2TRSB 3Q4GA 4FS3A 3WNCA 2NUPA 2Z2XA 1MNQA 4YAGA 1LV8A 1LW6E 1U28C 2QVBA 5AI6A 5EWJB 3SM3A 1N9ZA 3KP1A 1ISMA 5DULA 1YONA 5AVOA 3VM6A 3K7EA 3ZLTA 3JQEA 2B5WA 2CDAA 3EGEA 4EPTA 4TMTA 1LPMA 1QBGA 1E1KA 3K6JA 1L7PA 2JLUA 1W36D 4EFKA 1I4WA 1J9EA 5LP6F 5JIBA 4FFBA 1MAUA 1QBKC 4LG1A 2OESA 1EDBA 2DULA 3Q87B 5I7HA 5CCEA 3COZA 4X6YA 3O8NA 1EFLA 1N77A 4I55F 1SMKA 1SZDA 4EF6A 3W90A 3Q98A 4FFBB 5A0TA 4DWOA 4OAQA 3KELA 2FPKA 2Q3LA 1EB9A 3BK2A 5KC8A 1D2CA 3PXEA 5JMTA 2OGUA 4ZTUB 1R6VA 3V5NA 1QIJA 1D3AA 1NQVA 2RAFA 1G41A 3G1WA 3NGXA 3PQ4A 2JHPA 4H08A 1H1TA 4HO1X 5KYWA 4ZYXA 1EWQA 4RA9B 1CD5A 3HY6A 3QVTA 1HL7A 1EFTA 3ZY2A 4I1UA 1Y9JA 4FHCA 4NE2A 4X6XA 3QLVA 4U2FA 3KKZA 4JB0A 3FDZA 4X90A 5H3HA 3PF8A 3TQRA 5I9LA 3G02A 5JH7F 2GZHA 2IGTA 3ACDA 2W0MA 2OFPA 5FLKA 4JEMA 3VPCA 1FYFA 1Z2PX 3GG2A 3CRZA 5HFNA 2I3BA 3FDZB 3ZK8A 1BD4A 2ILTA 4QPDA 2IHNA 2KMLA 1WAMA 1R2QA 2GZ1A 3H0CA 3WWDA 4C1BA 3L6DA 2VQFB 3MUEA 4M46A 3LW7A 1IL0A 1B6TA 2RGNC 2C1EA 2X9LA 3OE4A 3VSAA 4FHZA 3AOGA 1U63A 4GZ5A 4B6EA 4LMAA 3VBCA 4YCSA 4ZHQA 1QZUA 5LKRA 2FR1A 4M88A 2XMRA 3EDOA 3KXIA 5JSZA 1XKLA 4MA5A 5T3YA 1LV7A 4TKUB 3TTTA 3U16A 4QFMA 4DC9A 1ZHHA 2UUBB 4DAEA 1AVTA 1TAUA 1KU0A 2H2WA 1RLMA 4BKMA 4CV0A 1OCEA 3A1EA 4ZHQB 5JS8A 3V80A 4A8JC 1T1RA 3V32A 1R8QA 5JSZB 1Y3CE 1KAGA 1X9GA 3LSYA 4EUNA 3HO6A 4DREA 3N2KB 4QULA 1G6HA 1H3FA 2E4AA 5KSOA 1RBZA 1M6NA 1HE1C 2J6BA 1JNYA 4QHTA 1G16A 3H86A 3PA6A 4PPNA 4XIFA 3PQFA 3OBIA 1NW3A 1WJGA 4H6WA 4M0FA 2AKEA 1NMEA 3UH0A 1BWQA 1PTJC 1GDDA 3FGPA 1WULS 3LF2A 4S1OA 1FRVA 5LA6F 1EFCA 3KPVA 2OOKA 4M1TA 4HFJA 1YDHA 1ZOLA 1U98A 4K0KB 2BFNA 3TB4A 2DSNA 4WOKA 4EIWA 4UM7A 3L7LA 3OTWA 4HP8A 2PUBA 5FULA 1WSDA 2SHKA 1DEXA 2OWEA 3BZBA 4E07A 4YRKA 5BUCA 1P0PA 3TZHA 4AAYA 5KWVA 4HLDA 1KK2A 2VLBA 4RF4A 2DY1A 3GLRA 5ENVA 3MINB 2AKAB 5AD1A 1RAFA 4YAEA 2OV8A 4FNGA 3GAZA 2EFHB 3MJVA 3SNHA 5K3CA 3W2FA 1ZO8A 1THGA 3PUHA 1H2HA 1YQEA 1SFRA 3KTAA 3NCHA 4TN1A 2EW2A 3R7DA 4CMHA 5JJLA 3K15A 3ABZA 1PVDA 3LFUA 1CX9B 4G85A 3OZVA 4LQ4A 5F78A 1AKTA 3WY9A 2INGX 4BJ5A 1B0PA 3JV7A 5BR4A 2J9ZB 3RYCA 4E2FA 2VK8A 4RHUA 4J0DA 1DEOA 4M1WA 4DCJA 5MF6A 2LCIA 3IHWA 1ENOA 1P3DA 2X2PA 3PT5A 2UVQA 5F64A 4U2BA 3RK1A 1L0BA 3U3ZA 3VNQA 4C01A 5CVCA 1UP4A 3VZRA 4DSAA 3JQ8B 2CF6A 1A9YA 4MR8A 1JHMA 2MTBA 3I2FA 4POOA 4OD0A 1CDZA 1UPXA 5F2OA 2F64A 2I3DA 4JASB 4HF7A 4Q3AA 1N5KA 1NVAA 3BTUA 4CCSA 4DBZA 4IJMA 1NBWB 2A58A 1GGHA 3RK4A 3RVJA 2C2WA 1M33A 5KYGA 1YV9A 2BRUA 3D5TA 4QXMA 4MI1A 3PXUA 1E9CA 4O0MA 1JJVA 3OFND 4GR5A 1VTKA 1G6OA 2IUYA 4R1SA 4WADA 3B8EA 2WF5A 4EWLA 1Q0UA 1GAXA 2G4LA 4ND7A 1CEYA 3OIYA 5GPBA 1E1YA 1O96B 1VYVA 5JCOA 3L6RA 3U1VA 1TAHA 2XUOA 1H94A 3L6OO 1LSSA 4KAFA 3O1LA 2H7XA 4QVGA 1SBQA 5A6SA 4C7OA 4QOIA 1PFUA 2OHHA 1TQDA 1XRRA 2IY9A 3O2QB 4XH9B 4YCJA 3LGSA 4S24A 1SC6A 3VDXA 4A82A 3BS4A 1SCDA 2QQGA 2VXOA 3A27A 3KZMA 1RC1A 2XMDA 1SUWA 3ZE2B 4A8PA 5A6SB 2MJLA 1SUPA 3EEOA 4KDRA 5DXFA 3IHLA 3QF7A 1O9HA 1CRQA 3IE1A 3C6XA 1CUEA 1YR2A 1ZGBA 4IOMA 1VL6A 3RG8A 2ZIZA 2BCJQ 3CWCA 5K0FA 4UREA 2FPWA 4B6JA 3OE7A 3TSAA 4KE6A 1RPAA 2ZRFA 1J99A 1UJ4A 2NOAA 1TK2A 5EYPA 3ZLJA 4NECA 2OZLA 4TVKA 3ZNOA 3C1AA 1LNQA 4MLPA 2RHMA 3AR9A 3CS3A 1RPJA 1T9AA 4J49A 4ZO8A 5AKJA 2ADOA 3DAHA 2WAOA 3L1JA 4DTCA 2CY0A 4EVIA 4YCLA 2HSGA 2JAQA 2Y68A 2OZLB 3AINA 1VRCA 3TQIA 2A78A 4EZIA 1Y7PA 2WSSD 1H4QA 2XCUA 2NIPA 2DCMA 3EMBA 5CPFA 5JZVA 4YP1A 1TZJA 2ARKA 3VV2A 2BFEB 3FCOA 1O89A 4JI0B 2H1VA 1XCMA 1YI8A 2ZIUB 2M6SA 3QJGA 1M1ZA 3TUIC 3THRA 4M53A 5H0IA 3FHOA 1A88A 4QNMA 1UZLA 3IT3A 4KCGA 1QHHA 5K5EA 2GFQA 3JAMA 5G41A 3V97A 2PX8A 3T06B 1BN6A 4XQGA 4AWAA 4J6EA 3KZNA 4Q66C 5AKIA 4DLSA 3BD8A 3ITDA 4FW9A 1W1WA 3N6XA 1XJCA 5AW2A 4GE0A 3A26A 1K8YB 4RA6B 4YT2A 3KQLA 1TGYA 3ZBUA 4EMSA 5KPDA 1JHVA 1KP3A 4CMEC 4XQEA 5KWIA 3IX7A 3K1AA 4B3GA 1X9IA 4HN4B 1UWVA 2QB5A 4QODA 2LCQA 4BDTA 4C6RA 4ED9A 3WP0A 5JNTA 5FWXB 2VPZA 4AP6A 1QYXA 1NOJA 2W37A 3OFNA 1N57A 4OGWA 4TWAA 4A26A 3A14A 3LK6A 3K1AB 4N7BA 3E22B 5CDSA 4QJBA 1A27A 3OD5A 4F38A 1RQPA 2N0SA 3GUHA 1EDOA 3AFGA 1Q7CA 3NXSA 3R09A 5FBRB 4XR9A 1ZH8A 3G5MA 2QBYB 1TX4B 4C4ZA 1DQRA 3GAFA 3OC6A 3QLUC 2WG2A 4KLZA 1SO8A 3UGJA 3K09A 1E3DA 2ACVA 1DNPA 3L77A 1TUBB 2Q0XA 3H1BA 5ILOA 1XVIA 4Q37A 4ITRC 1R50A 3AHHA 3DDZX 4KLAA 2HQBA 2QQFA 4EHBA 4D3FA 4D4IA 2R47A 4PYJA 3GPDG 4EELA 3D3KA 3QX9A 4QYSA 3GNTA 4PWYA 3TVYA 1J8VA 2GK6A 3S2FA 3G2MA 3MJHA 3IS3A 3RKUA 4JT8A 1CQJA 3RUCA 4B7UA 1VI2A 1Z6AA 2DBQA 3C45A 3GVXA 4QOSA 2DWCA 4BO7A 3NP9A 4MRRA 4TV9F 3DGFC 4Y1FA 1G8JA 1QE5A 1ZPDA 2I34A 2Q07A 2UZIR 1JHZA 4IGEA 4JL5A 1K06A 1RMYA 1CQJB 3E05A 3L6UA 3C6MA 5GINE 3IEKA 3WMFA 1UJNA 2N46A 2FSGA 1ZCFA 2BCGY 4FYKA 1T1SA 3UK0A 4JXZA 4DA4A 3FN4A 4E1BA 2NZYA 2H7CA 4AJ2A 3PFIA 4PQYA 1Q3HA 4RJ2A 2WSSA 5FNVF 4EKIA 2AFHE 4YONB 3SQOA 3WXBA 3WLIA 3M4YA 2VT3A 1GFWA 2AQIA 4KMOA 4A8JB 4NDZA 5KNBH 5TIIA 3A7EA 3LSTA 1YBMA 2QMQA 2AVDA 5BSGA 5I7UA 4LK3A 3RFVA 2HQ1A 3P2OA 4S1PA 2XNDD 5AM1A 4JT2A 2BGNA 1WKBA 3OM9A 1JU4A 3ND5A 1GCAA 1K6IA 4G81A 3V1TC 3CR7A 5EIBD 4UVIA 5D5QA 3LHFA 3II6X 4UAUA 3TNJA 1NT4A 3KL2A 3MAAC 3TTUA 2J3JA 3R3ZA 2C58A 1YFLA 1DIAA 4O8CA 3SQWA 1QU2A 4L7QA 4JIGA 1AZLA 2W5UA 3DC2A 5TMEA 1H6BA 3D0RA 3DZBA 2OV2A 4G36A 4TLDA 2G8NA 3CPJB 4X00A 3QPCA 1FSFA 3GLGA 3AL3A 1XDWA 3FOFC 2PX3A 1XELA 3BHNA 3V6MA 1P81A 2PN1A 1EJ6A 3U4MA 4RMIA 1BNCA 3GR6A 2C84A 2QTAA 4P82A 1JEDA 4J7XA 3GLGB 5CT6A 1KY5A 4MO2A 2Z9CA 4TYNA 2EEPA 3KT6A 3MC1A 4GM4A 4RH1A 5EXXA 4A91A 4QSMA 2JD0A 4L0CA 1VIAA 1YQQA 1F14A 1E2KA 3OOWA 4M1EA 1JILA 1NE2A 1XRLA 2VPQA 4JGGA 4KN9S 3EAQA 2YRXA 4RBNA 4EMTA 1PR2A 1C81A 1CY6A 1RP1A 2BD0A 2JBWA 2YZNA 1KEPA 3DFIA 3MJFA 4W1PA 5DK4A 2PUGA 1JQKA 3OT4A 1EVYA 3HEBA 1J8DA 1I3MA 2MMCA 3H7IA 4LHYA 4YJ3B 1W34A 3LKBA 3M49A 5GONA 3BRSA 5B53A 5LU9A 4CGYA 1XZBA 1T8TA 1R4AA 2VUTA 2W2XA 5E38A 2QUAA 5CCDA 4GIBA 1U0NA 3HJAA 3Q8WA 1YDWA 4ZOAA 1MOSA 2GERA 1U0LA 1ZHFA 1K4MA 2Z4TA 5G02A 1TT7A 2N75A 3MGGA 4U7FA 3TFWA 2H4ZA 2BEVB 1M1NA 2CHUA 3AEQA 4JITA 5HQJA 3MB5A 2PH3A 4PZCA 1PQ4A 3KO8A 5LZ8A 4MVJI 4RF3A 3B1WA 3CF4G 1G60A 2IS4A 1XAGA 3AW8A 4EVRA 5HIMA 1VPVA 1KOLA 5D3MA 3P9NA 5JISA 1M1NB 5P21A 1KTIA 5IAOA 4FYIA 1ZD2P 2XHEA 3SBDA 1WV0A 1TRHA 3ENZA 3N07A 4OUDB 3U7HB 3FMVA 3S1AB 3SP1A 2CZCA 2JF0A 2QJOA 2PDAA 5GGXA 1VIVA 1BGXT 2EWWA 1UC5B 4DAOA 6AT1A 1QNFA 1E1DA 5B58T 1FNBA 4QJ3A 1DT5A 1CC1S 2CFIA 3U44A 1J5XA 3FBGA 3I4LA 3AZOA 1W2WB 4UDYX 4C14A 1TJ5A 5CYGA 4KUGA 2REQA 2C3MA 4Q1VA 3I2GA 5THQA 3BZWA 3MK31 3NHFA 5IS2A 4EJMA 2O0KA 2COEA 2Z57A 1AHNA 4N18A 4XASA 2NAFA 3ZBQA 2HO4A 2XNDA 4D9KA 1DQPA 1KU6A 1K2WA 4JK3A 5ER9A 1AKWA 3DDSA 2I87A 3IB3A 4V0NA 4I2NA 3WSVA 1V7CA 1NBOA 3BA6A 3SXUB 2DSTA 5KKNB 1V7QA 1NL3A 1D4FA 4KFRA 3RQIA 1OA1A 1SVNA 3N0TA 4ZOLA 3ZDZB 1Z83A 2Q6LA 4DLXA 1VLZA 4H77A 4RTSA 3W2HA 1R0XA 5JI2E 1ODSA 2B9EA 1C3OA 5HCNA 3I5AA 5F33A 2ZCUA 3OWXA 1PG0A 4Q19A 4HNGA 2FRXA 2FP3A 2H17A 5FD8A 2R7NA 1YU6A 3F49S 3TIGA 1ZD3A 2EW1A 1S3GA 5T6BA 4CLEA 1ZIOA 4WESB 3I28A 4C76A 1KQPA 3U80A 1IDOA 5EKUA 4HXGA 5BSVA 5D5PA 2Z3ZA 1M75A 1SVUA 3EWNA 1JLRA 3M34A 5EIOA 5CBPB 3AESA 1JAYA 3SS8A 3G0HA 4R7GA 1ZUNA 4W9RA 4Q3EA 1QR2A 1B15A 3JVVA 5D7NA 3VAAA 1JIXA 1BWRA 2HXGA 2AN3A 3AMVA 3AUYA 3GD7A 4EYKA 4JEUA 3TFOA 2NT4A 1FNNA 1JQBA 2J0QA 2Q3MA 1FFWA 1C7QA 1R37A 1ZUNB 2PCJA 3BCHA 4J2TA 4RESA 4DCMA 4L95C 3P0RA 4AVYA 4J91A 2XB8A 4BV2A 3QOXA 4Y6GB 4PCVA 3DMTC 1SU8A 1IM5A 1PBTA 4L5YA 4TXMA 1HM5A 2QP4A 4PPFA 3Q1LA 2Z43A 4KWEA 3LY8A 721PA 5GP1A 4D9MA 5ITZA 2PH5A 2PRYA 2PUFA 4G0YA 5EY5B 1N6LA 4L4ZA 5I7EA 1CZKA 2O7RA 2J4DA 3NWBA 2N9UA 4WUTA 3N8IA 5JS2A 5JZMA 1Y3FE 4WKOA 3PX2A 2Z1DA 1KGSA 4HK4A 4D46A 4UVDA 5FPHA 1E9RA 5B37A 1GGNA 2IF2A 1N1MA 3ISJA 5JDCA 1WLYA 2WUVA 2OPHA 5ICGA 3UJ7A 3DE6X 3MRTA 4JFAA 2V6BA 1XHEA 3QBEA 4YCAA 5IBQA 3WLJA 8ABPA 3FVVA 1E3TA 1X1EA 3NUQA 5DNVA 2BTEA 2FKAA 1JEQA 8LDHA 3VDMA 1NDUA 4R1PA 3H6KA 3I32A 4IQ8A 5ALUA 2PE5A 1TU3A 3K72B 3NS7A 621PA 4IZIA 3VSDA 4QQ8A 1SIBE 3AZPA 2O1EA 1F4LA 3WO0A 5BSEA 5LWQA 1XCBA 3BMNB 3ZVNA 1UBOS 1OAOA 2J3EA 3HWSA 4GGOA 1S89A 1N34B 4NOKA 3WV5A 1RYHA 1JMYA 3OQVA 3TBHA 1N2OA 1N8TA 3DP7A 4XYMA 2WZCA 3A7DA 5BN3A 1UOPA 2HSZA 5A9SA 2HMWA 1N9KA 3UG7A 1VL8A 2VYVD 1R16A 4CG2A 1ZBDA 1A82A 2C03A 1QV7A 1ZH2A 2GWHA 4DRZA 4KQ1A 5BT9A 4QQRA 2WJ4A 1CUWA 5JDIA 3QEAZ 4ZANA 2QA5A 2W93A 2ZFUA 4OK3A 1OZAA 3ROTA 2X9QA 2R68A 5LP1A 1WDKA 4H4CA 3BWEA 1KQOA 3M6LA 2P8SA 3Q3IA 1A5TA 2FSVC 1V43A 2Z98A 3F7NA 5DHAA 1RBQA 3CG0A 2IKQA 1H2WA 1E3EA 5IDWA 1UBTS 2DE0X 1U9ZA 2H1FA 5JZBA 1XZIA 4WGFA 1YTUA 4IFIA 4N0DA 5CM2Z 2PX5A 4W7HA 1L7MA 1P2BA 1CR1A 1NNUA 2ECFA 4FFDA 4KO8A 5ADWA 2BGIA 3R76A 1Z6PA 1GGVA 4MGIR 5IYZF 3V8VA 2Q29A 3ZHRA 1IQUA 1NR1A 1RRPA 2DLDA 1L4YA 3G8AA 2ET6A 1ZI6A 1U1GA 2QL7A 1CP3A 1Y9DA 1E79D 3U1BA 3UTCA 1VJ1A 1DOZA 2LV8A 1P61B 4H3HB 3BSSA 5EZYB 1JHPA 4TKVB 5K3BA 3I92A 3VUFA 1O0CA 1DAFA 2GZMA 2QN6A 3LX6A 2FPRA 3RVNA 3IR5A 5K8LA 1R0ZA 5FB3A 1VPDA 3DTVB 3HFSA 2FSUA 3IDOA 4PFJA 2RIPA 3JY6A 4RFLA 2YNMC 3BX1A 4KGVA 4WINA 3AY6A 3VR4A 1NX6A 3UICA 1N2IA 1OT5A 2C5LA 2WIAA 4O8ZA 3VU9A 5IEJA 1KQ3A 3HFJA 1AMUA 3K4HA 1V48A 2H9IA 5BUQA 4TXJA 3KXPA 2GNAA 5TQ2B 1LFDB 1LEHA 3AHCA 4JU8A 1V5IA 3W4IA 1ZICA 2FPSA 5ITVA 3E3LA 2ZUCA 3PTAA 4LGMA 2VRWA 3ZD9A 5I3CA 1IHOA 5BW4A 2CUKA 3VU9B 1A8IA 1YJAA 2LCFA 4DSNA 3RU7A 4K9OA 1EK0A 4FEGA 4UFNA 4X65B 1WMSA 1XJ5A 2C7VA 3H5OA 1WW2A 3U4DA 4OA5A 2D2XA 3OJLA 4CKXA 1FW8A 3WYFA 4YECA 5C8VA 3B3QA 1UJ2A 3ABOB 3QVGA 1JFTA 3ICCA 1Q50A 4M7OA 5K09A 1NVKA 4XWGA 2WAXA 1JKJA 4J94A 2UUOA 4RPHA 4XVRA 3T95A 4MW6A 4L3VA 2Q50A 3EY4A 2WJZB 4LOIA 4C05A 4NCAA 1N78A 4B47A 1QG0A 2DRIA 4JYPA 4FR2A 4L9RA 4U6NA 3DMRA 3QI2A 4LZZA 2PWPA 1EGMB 1D0VA 1GFZA 3F7MA 2B4RO 4NMWA 1NVTA 2ASVA 4OHUA 3ZCPA 3T5TA 2E5LB 3FNIA 4BB5A 4P5PA 5CB6A 5JARA 1CF2O 2XXJA 1T5HX 1CYEA 4EA7A 3G2OA 4DLVA 1G21A 4UM5A 5I7OA 1Y1TA 2WWFA 4AY5A 1W76A 2EQBA 1X94A 2FDRA 1P6UA 1M5UA 2J6CA 1A9XB 5T67A 5L3VA 1WU7A 5DZSA 4LSWA 5DIFA 1T9HA 1ZNYA 1RRVA 4L0MA 1G21B 1TPZA 3E58A 1QWOA 4MV1A 5B1EA 1EG2A 1Z5OA 3GXBA 3NYRA 3VHQA 1V47A 4BVBA 4JGBA 1S6YA 1OUMA 1T25A 1V39A 4Q4AA 4GL2A 1N4AA 3WMWA 3RRZA 2H8KA 2F3SA 1FTSA 3E5RA 3EODA 1ZESA 4G4IA 5TGZA 1BQ4A 4EO4A 2FSFA 4UCFA 2OHVA 1J2YA 4RQTA 3G8YA 3TLBA 2QRKA 1ZOOA 2P2NA 4MIEA 1E79A 3ZUGA 1SAYA 3GT4A 3MJCA 1OGJA 4JA2A 3E4DA 1KY3A 5HZGA 1CQWA 3OQ1A 1MV5A 4F9TA 4OHCA 5HFAA 1I7SB 2W6MA 3JWGA 4ZALA 2P6RA 1QK3A 3NHUA 2REXB 2PXAA 4GLBA 3P0EA 4JLNA 4EGFA 4REQA 1GPDG 1HEUA 1EGQA 1OY1A 2HM7A 2JFQA 3Q8XB 5ICSA 4RVFA 1Z26A 2V7QD 3EZ7A 3OG9A 1X7DA 1M8FA 2QMUA 2VZLA 5KHAA 4HDKA 3T5CA 1NWHA 4DMRA 1ZC4A 3KUDA 2J5QA 4HAVA 4KN6A 1FSSA 3SBOA 4ENTA 2H92A 3N39C 2B92A 4C6TA 3G0CA 3IBGA 3L7DA 4HDKB 3GA7A 1IRXA 1XRMA 4KB5A 2EKPA 1BC5A 1L7DA 1UJCA 1G98A 5FLEX 1K3UB 4PYRA 1GZHB 2GYYA 3A6HA 4DE5A 4L07A 4BLTA 2EKQA 1QQBA 2O5VA 5FRDA 4ENVA 3WRVA 2JBAA 4PGHA 3M0EA 4QPPA 3IAXA 1NVXQ 1JALA 1FUEA 4MS3B 2NSYA 4N12A 3B9QA 4HZUB 1RP7A 1YUBA 2DR2A 3DOOA 2E6KA 2PMDA 3RK0A 1J0BA 1TW3A 3HY4A 3QTBA 5CEEA 4HYQA 3OCZA 1P1BA 4Q12A 1MX5A 4B82A 3NGMA 2V6MA 1YDGA 5ESRA 5HWSA 2QRUA 4XYBA 3WIUA 3FSJX 1QTIA 4CJXA 3ZE0B 2QQ0A 4MV3A 3V1KA 1Y7LA 2CYAA 2BEWA 1X15A 5KYUB 3EGVA 3R5XA 1ZA2A 3PNVA 3L01A 1XMSA 4QYMA 5TPWA 1FXWF 1Z4LA 4TTJA 2HA4A 4JELA 3MGKA 2QF7A 3DD5A 1LA2A 1P2SA 3MLAA 3Q7EA 5ALHA 4D9BA 3BWBA 5TC4A 3UPTA 5DWQA 3U37A 1SHLA 4UZFA 4JN6B 1N2EA 1WDTA 1ZW1A 3RSSA 4OX9Y 3NM5A 2WWHA 1HFJA 1Q17A 2FUG6 3P0JA 4M87A 2EDAA 4MQ5A 5CLFA 4U3JB 3WL4A 3QKRB 4YI3A 1IATA 3EEYA 4UPDA 4DEXA 1D1QA 3WGVA 4UMEA 3JYNA 4GH5A 2GBPA 1NV9A 3HP1A 4AY4A 2QOEA 1IB0A 4LJ6A 1HH4A 1QIFA 3EGCA 1JDJA 2XBUA 5BVGB 1WBJB 2CUNA 4KX5A 1ZK3A 4YRCA 3TPFA 4IDGA 5KREA 2VJLA 5LZ5A 3KB6A 1FYWA 4U0KA 3VDRA 4Q6BA 5HM8A 1P4GA 2AYXA 4OH7A 2PT6A 4RPJA 4BYMA 4DZRA 2ATIA 1IMOA 2WHXA 3X1MA 1X1RA 3M6UA 2WILA 3LA6A 4DYDA 4LXXA 4TWRA 3MFQA 1CY1A 1W1UA 4GWLA 4P4SB 5KVCA 1DV1A 4PAGA 2FP4B 3T7DA 4B85A 5EP1A 3U7RA 3ZCSA 1MB9A 3M4NA 2FN3A 4NXNB 4HR7A 1KZGB 3UJ9A 3LQRA 1Z56C 4EW1A 3I4CA 4KYUA 3IAHA 5G1NA 4DDWA 1HR0B 1DU4A 3JSAA 5JPIA 1HYHA 3WGKA 1S9DA 1WZUA 2WJGA 5J4YA 1BYUA 2OOSA 2XVAA 1GRQA 1K8RA 2WUWE 2QSYA 3GZJA 3DZ8A 4RD0A 5I9BA 1WDMA 4J75A 1E7WA 2Y1CA 4ZQIA 2G5TA 2EFJA 4X1YB 5AI8A 1C4XA 4QU8A 2NU8A 3TW0A 4WKGA 3QXCA 1IZ9A 9ATCA 2CXQA 1M1YA 3D6VA 5C8YF 5MDHA 2RSLA 4XDYA 3S2UA 4GW3A 2EP7A 3F4BA 3PUVA 4ZXPA 4TRRA 1ZSNA 2NU8B 1QSGA 2UYOA 3AUAA 3G9TA 5ECWA 4GSKA 4URYR 4GPD1 2BJHA 3MCVA 4N39A 4WE3A 1KMHA 3VHRA 1L1FA 1L5NA 4D8VA 1NPTO 4KEAA 2ZJYA 5ELLA 4E5NA 2W90A 3S81A 1ZD9A 5T64A 2D1RA 2PO5A 4FFVA 4OYHA 2H2AA 1FVHA 1PX2A 1U0JA 1X42A 2OBXA 1MDFA 4KXNA 4Z99A 6ADHA 1I7QB 3WLFA 3F6SA 4Q3NA 4XCVA 4LFBB 4UHKA 1KVSA 4OB8A 1P3Y1 3CUSA 5IMSA 1PZHA 1TU0A 2HDOA 3PE4A 3I9MA 1M73E 4XGQA 3AJRA 4P7KA 5EJGA 2IXDA 4BBPA 1PK9A 4K6KA 5H4GA 3JTEA 1FFXB 3I39X 1Y4AE 1ZX1A 2ZAIA 4DVJA 5KTPA 4H18A 4DDUA 4MW0A 2FPXA 2XMZA 2XJ9A 5BWOA 1E4OA 5JI3E 1P5ZB 5HIAA 1XVLA 4OQPA 2PL1A 3TIIA 3GF4A 2WU3A 5HJEA 2H1WA 3M9LA 3IQIX 3D1LA 1I0IA 3I64A 1UBKS 4GLLA 4GZMA 2PUCA 3JD3A 4L7VA 4PHFA 3CNNA 4K9DA 2R6FA 4AQDA 2VNIA 5E6SA 1ILEA 3AHDA 1B73A 3BA1A 3MWKA 1YAJA 1O03A 2P5SA 4K9SA 2ZJ7A 1ZJ5A 2N42A 2I4LA 3EUWA 3WMEA 3AP2A 4O4JF 2P68A 3QWFA 1HZZA 4MUGA 1TFRA 4DT1B 4BE9A 5E6SB 1IZ8A 5FI5A 3E9CA 5DYIA 4TKZA 4BBAA 1X70A 1ZVVA 4YQFA 2Z2IA 3QVMA 4JQYA 1XDUA 4AS3A 2HQOA 1Z8FA 5EIAA 3PTZA 4GUDA 2UXBB 2F67A 3USZA 2X1HA 5EIHA 1MENA 1KA9H 3LGAA 4JSYA 1C29B 2NXNA 1FFSA 1NG9A 3QIAA 2XIJA 1T4CB 3HB7A 3FPBA 1BGWA 3JXEA 3UOWA 4BMPB 3C3XA 5HF8A 5KNDD 4YRIA 2GZ2A 4N8DA 3O1JC 1PR0A 4F5ZA 5IKXA 3ONWA 3I6YA 3GUYA 3LBYA 1GVHA 3WB0A 2VJYA 1H4SA 3O92A 2BKLA 4LMPA 3U3KA 3C1TA 4MDEA 3CM0A 2CSUA 1AUVA 2Q6OA 1DCFA 2P75A 1KI6A 4E7OA 4X71A 2WHPB 3FWPA 3LP8A 4PO8A 4HNAB 4JJEA 3EYWA 3A2NA 4XB6B 2XRMA 1UBLS 4R7TA 2DHCA 3QOYA 3AIIA 5J4KA 2DU8A 2AE2A 2AUTA 3DE0X 3KEOA 3G85A 4MQ4A 2B8NA 3DE5X 3QQ5A 4LF5B 3R77A 3TW8A 4J1NA 4CFYA 1MB3A 3FROA 7REQB 5CJJA 4KMRA 3AH8A 3LXXA 1RQNA 3DPIA 1Z82A 2XWQA 4FN4A 4Q39A 3NATA 2DY0A 4WLOA 3TNFA 3AKZA 1YZKA 1FXUA 1BDMA 4HXEB 4P53A 3CUEF 3T41A 4D9GA 4DANA 3SE7A 3CN7A 2NACA 3ZV6A 4BX2A 4WZBA 2DBRA 4H7DA 3M4JA 3P96A 4YDHB 3P4XA 4JLMA 2MT9A 2AMLA 3DOCA 1NXTA 3IO3A 3F5QA 4GRIA 4R68A 5G4LA 4CUZA 1OFIA 4JCCA 5B6JA 5MFPA 1O3YA 1NRXA 3TIFA 1J2TA 4YB8A 1G20B 3R3YA 4M6WA 4GQAA 1C9MA 4KIFA 3K9HA 3BB4A 3E9ZA 4E32A 1L7NA 1J25A 2H07A 2D74A 2IYQA 3PC2A 4IM7A 3UQZA 2XCSB 1H42A 4MA0A 1IOVA 1Z28A 3QHPA 1DUSA 1U1CA 4B6PA 4ZEMA 2P2ZA 1NJSA 1RQRA 4M6WB 3J81A 1PT8A 1B42A 3NBXX 1LBSA 2YJ6A 4B4UA 1GYRA 2WABA 3E5MA 2B35A 4MPJA 1YK1A 2ZBQA 2CSXA 1EX6A 1SRQA 2GDJA 3VI3B 2WJ6A 4W8OA 4CF3A 3A1WA 2QRZA 1GNPA 3UK2A 1HSOA 4ND8B 4D4JA 1V7PC 5JOQA 1LRLA 3I05A 1ZR2A 4ZYTA 3SPXA 4C6SA 3JPYA 4EG3A 4JJFA 3KZ1E 4INZA 2W2VA 4U39A 1JSRA 3L8YA 1WCIA 4MRAA 1EIWA 3LLMA 2IHVA 2BE9A 4J76A 4BMZA 3FYCA 5FWNA 4UVEA 8ATCA 1EINA 1ETUA 3C6BA 3KVNA 1PUJA 1TZCA 4ARVA 4BP1A 4KAAA 4P0QB 3D8UA 3H19A 5B7NA 2IUTA 5GIOE 4CV1A 1OLOA 4Y6LA 1RLUA 3V8PA 2D5AA 2X2EA 3OJWA 5BSHA 1QRRA 1XHLA 1ZIDA 2R751 2WQ7A 1SCQA 2GM9A 1SUEA 1ZOSA 5JAZA 1JDTA 3A28A 1XEWX 2YXLA 3K30A 1M9NA 1T5SA 2F3QA 2Q4BA 4NC9A 4U8GA 2X8AA 2NO0A 4RE5A 4INAA 5B6PA 3W8RA 1P7WA 3H5IA 3Q9SA 4Y2TA 4KSBA 4BMNA 2Q4TA 3LMKA 2RH4A 1ID8A 5JPCA 3V55A 5KOHB 4MWSA 5BQ5A 3AETA 2HFKA 2YWBA 3A8TA 1PR5A 3EZXA 4MI6A 4ZOCA 4DMFA 4Q48A 1GWNA 3H9CA 5LJLA 3OCJA 2ZRJA 4GP9A 2K2WA 1WB9A 1G8MA 1XD2A 2LNDA 2NTNA 3GUUA 4L28A 5EHZA 2P79A 5JO0A 3B1JA 4PYMA 4IILA 2QD4A 2SKDA 4YCBA 5DVZA 3ZXYA 2GD1O 2PLFA 2QN8A 1XTKA 4WZAE 1XZLA 3PFKA 4ILEA 1AO3A 5AJHA 1N2SA 1CY7A 3PNMA 1O0BA 2IGBA 5C53B 2BEUA 5E8JA 1OWLA 1KRXA 1W6RA 3BD6A 1Y34E 2QW8A 4LEIA 4KBFA 3GBPA 4NF2A 3ZJUA 1WF6A 3BK1A 4QARA 1UBGA 1E5DA 2VAWA 2X1VA 4IV8A 1Q0ZA 4NY1A 4GZ3A 1D09A 3MEQA 1S2MA 3EXHC 2FW9A 1FCJA 1N3LA 3F7TA 1JA9A 3B1FA 4NQRA 4DHEA 2O8FA 4ZO4A 2QP9X 3MT8A 1TM3E 3MG9A 1H5QA 3OZ7A 1UUFA 2B82A 1TNDA 5F51A 2BGTA 1VGQA 4EHIA 3ZOKA 1KL7A 1W75A 2QG6A 1JB1A 1SD5A 2I8LA 2V7PA 4H3VA 4MARA 4N3CA 4Q05A 4H4DA 5FHQA 4B3MB 3E2MA 3TR0A 2CVQA 2PS1A 4II3A 3HCNA 4B0OA 4DDMA 3ZX5A 2VHVA 3TLXA 2X0IA 2WAAA 4RK0A 2ZDHA 3P4YA 2V6GA 3R5FA 3IAS1 1VHTA 1JG4A 5LPNA 2B6NA 2GD0A 1K8ZB 1U9IC 1E5QA 4J16A 3PFGA 4PX3A 2R1VB 2G83A 1QZZA 4J4HA 4J1TC 1C5KA 2JFVA 1SXHA 1VKRA 1TMKA 2FEOA 2XDYA 4J0IA 4U5QA 2O05A 1FJHA 4L4XA 1JF8A 5ANRB 5BN5A 3CLTD 1F9AA 2C88A 3ITNA 4JOBA 2K6GA 1BS9A 1Z18A 4JVNA 3T7EA 2IE8A 3QWHA 3AV3A 4M9ZA 4ZT4A 3ZXSA 2GPTA 2YY7A 4FHFA 4GKAA 1WCYA 1U1IA 4YCNA 1GXSA 1Z62A 1DCKA 4BX9A 1J00A 2I4NA 1V8BA 1U94A 4MV7A 3THSA 3TRJA 1QU3A 1WV1A 4TT3D 2POCA 1X7HA 5BN5B 1M2EA 1ZN8A 2CMHA 2PGLA 2V7WA 3LI2A 4DG5A 2G9NA 5B64A 5HJ2A 1A8SA 1GNSA 2YN4A 1YOVA 3PSHA 3VYVA 2YUTA 3H05A 3EVFA 1PG5A 1W73A 1U0EA 4KR7A 2ORVA 4HQKA 2FQ1A 1H2AS 1AQIA 3L8ZA 1COZA 1EXNA 3KSZO 2ZPTX 2GFIA 4FD3A 3JAWB 4GECA 4QEKA 5CYFA 4U63A 5T41A 1YQ9A 1QIGA 3AB8A 4NULA 2FFAA 5LP6C 1GFIA 3D4LA 1VSTA 2EG5A 1W6UA 3UB4A 3OTOB 3MPUA 4LE0A 3DBIA 4QQKA 1AQUA 5JWOA 2PG3A 3IP5A 4DNPA 3LY5A 5BSWA 1CY4A 1WNTA 5AW6A 1G4HA 1USKA 2F9MA 5LYJA 4TYWA 5DNUA 3HDJA 3KSDO 3KYBA 4MP3A 1OILA 4WZZA 2G67A 1OASA 5J5AA 1Z0DA 2Y1GA 3P19A 2KX7A 1JYFA 4LXGA 1EDDA 4KQGA 4N5IX 1A4XA 2W6IA 3OJCA 4G8BA 2A3NA 3CV3A 1OFUA 3M6MD 3IVAA 3ONDA 2E37A 3I0NA 4KVZA 3R20A 3K73O 3A6FA 3EHEA 1FUUA 1QGED 1Z25A 3FLMA 4JT9A 1PJZA 3AONB 4MQLA 3Q8LA 4CM1A 4LDRA 5IUJC 2BIFA 2QM7A 4BLWA 2Q46A 3M89A 4OI4A 2RGUA 1MH1A 4MRPA 4DIUA 2AXPA 2H6EA 3TRIA 5NULA 3FTDA 2QZ4A 1E0AA 2QX6A 3BWXA 5KI6A 2CCJA 1IUNA 3RV4A 821PA 5ENZA 1Z45A 1EGHA 3E48A 5BP7A 3FMIA 3THOA 3HUFA 3N6RA 5ALZA 2IU4A 4I4NA 1BEEA 1ISSA 2IZ7A 4J7CA 2VZEA 4TPKA 3QHQA 3FR8A 3M3DA 1JFSA 1YZNA 2R25B 1GIAA 3L4SO 5EAIA 3RRJA 1D1PA 1YE8A 5ECDA 1U0FA 4CIXA 1Q7GA 3U0BA 4KTVE 4NJOA 4S0XA 4MKGA 4HDRB 1IZ7A 1VFNA 1AM4D 2YFKA 1AIPA 1ZZEA 3LWZA 4UOZA 2PZ8A 1GPNA 3EY9A 3IUMA 2M2IA 1FFYA 3MJRA 5JY1A 2X42A 1ZKMA 2DX7A 3HXTA 4O4HA 3V1LA 3OJFA 3VH4A 4B6OA 1HMYA 4HNHA 3TG2A 4BN0A 1WR8A 3ECSA 3R8FA 2CJWA 4YJGA 1B4DA 3DCNA 2WD7A 1FMLA 4XE5A 3W9BA 4DIOA 2Q99A 1R0LA 3UWOA 5KINB 3GP8A 3AM1A 3OZDA 2OTCA 2FMIA 4UW9A 4XTRA 3SN6A 3PHIA 3GEBA 1G63A 1XTSA 1EQUA 4FOLA 3M6IA 5IDYA 3WJAA 4CM3A 5BNZA 2CJWB 1E2NA 1P44A 2ZWAA 3O2JA 2QAIA 3MWGA 4TT3A 4YJGB 3T9CA 4BN5A 4ZIRA 2Z2ZA 4PIMA 5DT9A 5EHGA 4OJQA 3CO0S 4HEQA 1QHEA 4G3XA 4FCCA 4M1OA 3CZMA 1DQYA 2RB5A 4ZIRB 1X74A 2VUSA 3IA2A 3EIQA 4MI9A 1ULBA 3KJQA 5I9NA 5E3HA 1AKYA 1PV2A 4CL0A 1V16A 1BWPA 1GTZA 1NVFA 1E0DA 2RHJA 1N5LA 3IEUA 1R8YA 3EF0A 4BECA 2IS2A 2XTJA 3H0KA 3KVOA 3OO1A 3HLTA 1DC3A 1UM8A 3WWPA 1IEQA 5E9WA 1V16B 4DR6B 1GLGA 2ZTVA 3BRCA 3V8NA 1O95D 3H97A 2VXYA 3A6ZA 4M99A 4D41A 2IUEA 1NRJB 3L6EA 5LQKA 4LXUA 2RHWA 2G7ZA 2ZCVA 3AOEC 3PXDA 1PX0A 3IODA 4RVUA 4R05A 4X0EA 1J2JA 1L9XA 1EGAA 4HI0E 5HX7A 4CGZA 4P3XA 3NEYA 3VX3A 1Q0SA 4IICA 4AURA 4D5EA 3KAPA 1RCTE 1L7EA 5COBA 3RIGA 2X40A 5GZ6A 1VLMA 4Q0MA 3HEAA 2O59A 1E1LA 2Q5EA 4N3AA 3C1OA 3GGSA 5DNYB 4K6OA 4TWBA 1I4EB 4WOJA 4BFLA 3P52A 2E18A 1N3BA 2HT1A 3LAWA 2ZRGA 4QTUB 3QEBZ 1IG3A 2HEIA 4MITA 1KEVA 4ZU1X 1U6IA 2QMEA 2WJHA 4R7ZA 4EG4A 4UHHA 1X2BA 1Y9EA 2I5PO 4P3KA 4EX7A 2YCBA 4AF7A 3K20A 3IVXA 4PBTA 5CDFE 3MJEA 3T3MB 3TQOA 5JUWA 4P86A 3W06A 4OJKA 4YV1A 1P9RA 2RHGB 2GS9A 4M21A 3INGA 5FO1A 3KPUA 3V8MA 3PE3A 3ANTA 1UZUA 1YUNA 4M0EA 2EATA 1XNJA 1K7CA 4K3UA 5KX5F 2DB3A 2AFHA 4ZK2A 3K8YA 3AYXB 4CXMA 4C7XA 5EI5A 2OYSA 3EG9A 3ICQB 1VP3A 1AKUA 2QK4A 1NPYA 2X58A 3KOZA 3IOMA 1A8UA 2PEZA 2AFHB 1RI1A 2FWRA 3EVDA 4JYMA 1I51A 4O33A 4OFZA 1R00A 3SZMA 1PLLA 2KS6A 4LTNA 2C3UA 3LUJA 1N2CA 4M4SA 5A7HA 3AL2A 4BATA 3TZLA 3T99A 3U4HA 1NOIA 2QY6A 4XJSA 1DBQA 2JAXA 2YHUA 3A3NA 1P2TA 4MV6A 1FS5A 4F93B 3MJTA 2G28A 3HDTA 2ODNA 3GFRA 3OCUA 2IITA 2IL1A 2Q1TA 1SVWA 4N5NA 4ZJZA 2X5KO 1M6WA 2HREA 3E70C 3IJEB 5AWFC 3UYLA 4FM9A 5DX1A 4OHWA 1YS1X 3FAZA 1A9SA 1FX0B 4I81A 3UKOA 2O8BB 1FMFA 3GLTA 4N41A 3GFSA 4Q1CA 1LVHA 2FGKA 4PZEA 4FDAA 1Z08A 4G2NA 1QG6A 1T3SA 5BUZA 3BM5A 1DBRA 16PKA 1TI7A 3X1ZA 3GEGA 1P2DA 2GAIA 2O7SA 2IYTA 3OC0A 1O95A 1XMJA 3V4ZA 5F1KA 2PKRA 3NM6B 3VPFA 2C8KA 1KNQA 1KSHA 3NFRA 2Q3CA 3CRNA 3HZHA 2OMKA 1ZHOA 4IIJB 1GV1A 1HDYA 2QU7A 2UDPA 1PDVA 2FN7A 3AUTA 3EBLA 4YRDA 5K1ZA 3RUPA 3T5MA 3WLEA 4A03A 4F3CA 3ETCA 2ZPUA 4H1UA 3FOWA 3D5EA 3T4XA 3FIJA 2A8YA 5FORA 5GY7A 4E5UA 3NP7A 4CN8A 4PHHA 3O3MB 4IDHA 2VWPA 2RI1A 4Y0VA 2AX3A 3DD1A 3SEQA 4IS3A 1TCAA 1P31A 2Q6IA 3ZWOA 1CJBA 1XRQA 2LUOA 2XMQA 4CL8A 4K6MA 1XBTA 3DAYA 3EPPA 3N0XA 1Z22A 2G8LA 2QLBA 3FDIA 5EPUA 2YHBA 2QRVA 4I3FA 2A1TR 4G0UA 2A1UA 4B4KA 4PCLA 2OK7A 1W87A 1UKZA 1E6EA 3QV1A 5CH8A 4YLGA 1VZ2A 1QJ4A 2P65A 2PLWA 3Q9NA 2ONKA 3X0DA 1TK9A 2PNJA 1QS0B 4B6SA 3U31A 2JH9A 4AXBA 5L7TA 1PYDA 1GZ6A 1L5KA 2I3GA 5JHHB 3DL4A 2ZE5A 3L18A 4LX0A 4EDFA 4HGNA 2ZKIA 4LAFA 7MHTA 3V3KA 4G0QA 1SCNE 3MJSA 4C2BA 1M8KA 2K87A 2O8NA 3KLNA 2ACEA 3PQDA 5DSZA 4IIVA 4GEGA 3KLBA 4BMXA 3Q2IA 4Z7OB 2DBVO 1U0HC 2PRKA 3MBKA 4HX9A 3AVWA 4YMGA 4HB2A 4BJ6A 2ZRQA 4Y9TA 2M9MA 2QAGC 5KVQA 1D2RA 3MS4A 5SY6A 4DLPA 2VEOA 1TO1E 1MMFB 1CUUA 2WINI 3TSWA 7AT1A 1W7AA 4YJFA 5HQ3A 5KU1A 1YULA 2VI5A 5F9MA 1MVLA 2FF7A 3KWLA 1U4NA 5AKZA 2HYIC 4ZJPA 2ZUEA 1UEXC 2QNRA 1YZQA 1NVMB 4WN9B 3ODGA 4E12A 3NVAA 3MWYW 4XM2A 4NVRA 1RIFA 1M34B 2IV7A 5KTSA 1RAAA 2QM3A 3EUFA 3MBIA 1OLXB 3WK7A 1ML3A 3HNRA 3H6GA 3PCXA 5LOVA 3DMNA 2F3TA 2C9DA 1IEXA 3SU8A 6Q21A 3IL2A 3AY7A 3NAGA 4NJMA 4IDEA 4L8LA 3LYLA 4QGHA 2B6HA 3PRKE 5IJXA 3TMKA 1YIOA 3X1XA 5CEJA 1RYEA 2ZB7A 3U7FB 2O2IA 5JAMA 4GI7A 1GAEO 3AWIA 5LOVB 3PENA 4S1WA 5DN9A 4G26A 5EINA 2XOKD 4EBBA 2PD3A 5HOQA 3P9SA 4PTYA 3HADA 5DTRA 2V5AA 1C7RA 1VCIA 3G6KA 5LD2C 4R9UC 1UM9B 1D6JA 4WW0A 4P4NA 4E11A 2QN3A 3EVNA 3SIXA 1YKGA 5K6RA 3WADA 4LOHA 3R5HA 1QYIA 2Q27A 3ZHQA 1P1FA 1HFKA 2DJ5A 3PB3A 1XZHA 5EKTA 4XKJA 1XOIA 3IQGX 3V6LA 3W04A 4ZGWA 2N47A 4WEOA 1SG9A 3G8CA 3IJ5A 3PXAA 4X5OA 5D00A 3JWHA 2O3JA 2Z2YA 3K5WA 4BFCA 2IQ5A 1I1OA 1ZEJA 3VUEA 3COPA 4AXXA 5AUQA 2BF7A 3O8CA 1NU8A 1ZRHA 2JGEA 3LLVA 5L53A 1TK3A 3H6HA 4H15A 3I6IA 3TVTA 2UYCA 3A9SA 4YRJA 2HTEA 3CZQA 3I5XA 3PL5A 3VC2A 4OBWA 2GEDA 3F67A 4DCOA 4EPWA 3C98A 3WX0A 1E7QA 1TMYA 3BREA 4L8VA 3WLRA 1QGYA 2X77A 2BGMA 2XMGA 4HDQB 4EATA 1C9KA 3HM9A 2DEUA 3QXXA 1NTRA 1NASA 3LUAA 3UXYA 2Z4SA 5C8ZA 2A5GA 4E6EA 2ZP1A 3HWX1 4LJ9A 2ZIAA 2IIQA 4LW8A 4NZPA 3IBYA 4PZYA 4WEQA 3LV8A 3RVRA 1B0AA 1GL3A 2HKIA 1M1XB 2QZJA 1SGWA 2V8BA 4DARA 1WPXA 1L8OA 4C3ZA 1XZNA 4ZICA 2V8OA 2P1ZA 3A58B 1C7FA 2FWJA 1J4AA 5SZKB 3AZQA 3ROXA