1CYEA

Three dimensional structure of chemotactic che y protein in aqueous solution by nuclear magnetic resonance methods
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
b'RSDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
molecule tags Signal transduction
source organism Escherichia coli
publication title Three-dimensional structure of chemotactic Che Y protein in aqueous solution by nuclear magnetic resonance methods.
pubmed doi rcsb
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1994-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cyeA00
4S04A 4WWHA 4WZZA 2M1ZA 3EQ2A 1JF8A 4G0PA 4JA2A 1URPA 4MQFA 3GV0A 4DN6A 3KHTA 4XAQA 4IILA 5BQ3A 1U0SY 3TO5A 3BRSA 4Q6WA 1DRKA 3GBVA 3KLNA 1EAYA 4JAVC 3IP7A 4RXUA 5E3JA 2IPLA 1AB5A 2FSPA 3DGFC 1M5UA 4Z9BA 3HZHA 3ROTA 2L2QA 1E2BA 2WRZA 3MQ4A 4OLAA 4KZKA 4HNRA 3LUAA 3FFWA 3GBPA 3E3MA 2WMYA 4PEVA 3OQNA 3E61A 3G1WA 4RKRA 4RKQA 3MMNA 1QP0A 3HUUA 1NXVA 3Q7RA 2IYNA 4H3KB 3UK0A 3W9SA 4IMIB 4MR7A 4F06A 5IUNC 3Q7SA 3H5WA 5EWLA 1NXOA 2FMHA 1BDHA 3FGZA 3NNDA 1Z15A 1RPJA 4G0XA 5FBKA 4MR9B 4YCSA 1QO0A 1TJYA 5B3JC 3H6HA 1NTRA 4NV3A 5IC5A 3Q41A 2HJ9A 1D1PA 3QEMB 2PJUA 2RGYA 3RVSA 3UUGA 1R8JA 4DQDA 3S99A 2QVCA 1DG9A 4G0YA 1M5TA 3OQMA 2VUHB 3T8YA 1KRXA 2NZUG 1JHZA 4EYKA 4ZPJA 2PUBA 1BAPA 1F51E 2HSGA 1Z17A 3M9WA 5IBQA 3SQNA 4OLBA 2OENG 3O2QB 2XDYA 1OXBB 4Q7EA 1E6LA 5TPWB 1C0EA 2GBPA 4Z4HA 2B4AA 4IGAA 3NHZA 4ETMA 2FN8A 1ZDMA 2NUBA 1JH9A 1Z16A 4LDAA 5EWMB 4ZYLA 4LE2A 3MA0A 5BRJA 4JASB 1K68A 1RXIA 3O2JA 3O1IC 3N6VA 2GI4A 1ZH2A 1QP7A 3BILA 9ABPA 4KRFA 2LUOA 3F73A 3O74A 5B3JA 4MR9A 5ED4A 3F7NA 5KQMA 2L19A 3EAFA 4KMRA 3RVOA 5JNTA 4EGSA 2BGGA 1SD5A 3KLOA 2CD7A 2FQXA 3FFXA 4RV5A 2FW0A 3HK2A 1DC7A 5JS2A 3D8UA 3QELB 4Z0NA 4W5QA 1EFAA 3N0RA 1DCKA 4RK6A 5BR1A 2JB9A 1ZY2A 3IP9A 1XHFA 1DCMA 3H1GA 3SAJA 4E7OA 1PEAA 2IPMA 3N75A 4KVFA 1SXGA 4G97A 5KC9A 4W5NA 1ZHHA 4H60A 3RVLA 5JNSA 4D74A 1P6QA 3RQIA 4E7PA 2PUDA 3CFYA 4IF4A 4TN5A 3HVRA 4WUTA 3M6MD 4QPJC 3LUJA 3OLVA 2PUGA 1HEYA 4W5TA 3H5LA 1Z25A 1A2OA 4EYGA 5JNUA 3F6PA 3LUCA 2IKSA 3ILHA 2ZWMA 3T38A 2VUIB 4YLEA 1I3CA 2ID9A 3EQZA 2QVGA 2WB4A 1W25A 3P9YA 2PAFA 2E4WA 1LK0A 4OATA 4XLTA 1FFSA 1ZGZA 5GQSA 3SNKA 4NQRA 2PE5A 2N9UA 1DBPA 1TM2A 3H6GA 3C3KA 4LE1A 1W9HA 2FMFA 5IEBA 3HEBA 1ZH4A 2R47A 4Q6BA 2PUFA 2A9OA 3LUDA 3HV2A 5EWJB 4FE7A 3QK7A 2P4UA 5TQJA 3CZCA 4MRMA 4LZLA 1CHNA 1E6MA 1KRWA 3IP6A 3LKVA 1PNTA 3CG0A 1Z2DA 5DLEA 1EWVA 5TQ2A 5ABPA 4Y9TA 5KWSA 2FEPA 3RVRA 1NXSA 3A10A 3CTPA 1YVUA 1JFTA 6ABPA 2FQYA 4MAAA 2YHBA 3OQOA 5TE9A 1BDJA 3C97A 2OQRA 4Z4EA 1D1QA 1U8TA 1NXPA 2FN9A 2IPAB 3G85A 3RH0A 3N8IA 4EY3A 1JDPA 1LJLA 1NXWA 3C3MA 4B09A 1NY5A 2DRIA 2MYTA 2CHFA 2JCGA 5FWYB 4Z4CA 1DCFA 1DP4A 2B1JA 3EJWA 3JPWA 1DRJA 3H1EA 3N53A 4Z4IA 3KTOA 3DLBA 3IPCA 4FB4A 3DLHA 4QICA 3LFTA 3OMWA 4YS6A 5TPWA 2PLNA 1GUDA 1JX6A 1C4WA 3HUTA 5HSGA 1QP4A 1SRRA 2NT3A 3NNNA 2PL9A 4XFKA 1DC8A 3F6CA 2QZJA 2WJWA 1QKKA 1ZN2A 1L5YA 3FMVA 3JS5A 3EDCA 4MS1A 4N0PA 5D2CA 1QQBA 3H5IA 3DZDA 3QLUA 1E6KA 4MYRA 1TMYA 3A0RB 4RY8A 2LP4Y 4GPAA 5KQGA 1NXTA 3MM4A 2PKXA 4Z99A 5TQ0B 1BVHA 2VYCA 3OM0A 1EWKA 1F4VA 2H3HA 2RDMA 1DZ3A 4HNQA 4KV7A 1VRVA 2PUCA 3TB6A 1Z2EA 4GNRA 4KK4A 3OLWA 5IUJC 2MYNA 5JNRA 1ZITA 3N0WA 1P2FA 2FVYA 4EVRA 3QX8A 3HJFA 1LBHA 1OXKB 4XARA 2WWVD 3MF4A 3TD9A 3NHMA 1M2FA 5TQ2B 3LUGA 1JBEA 4KREA 4G0MA 4KQ9A 4JOQA 3CKMA 2A9PA 3CZ5A 4TLLB 3ROFA 3TMYA 5IEJA 1PNRA 1FSPA 1CYEA 2R25B 3LUHA 4D6XA 3A3KA 1QQAA 1YTUA 4KQCA 3ILYA 1JLKA 1YMVA 5JNVA 2F8TA 2CWDA 3I42A 2O20A 3LOPA 4N76A 2L18A 1YIOA 2QW1A 1B00A 4YGXB 1PEYA 1FFWA 5CNJA 3RVNA 1ISSA 1YK0A 4YP9A 4YRZA 4YV7A 2QSJA 3HCWA 5BRAA 3Q15C 2WY2D 4RXTA 4O5AA 5JNWA 2I6FA 5HM6A 4TMYA 3O1JC 4HYEA 3Q7TA 2TMYA 3KG2A 1ZVVA 4MS4B 1LJUA 3EULA 3CS3A 4RWEA 1TLFA 3SY8A 1U2PA 4RK1A 1CEYA 4YO7A 3D02A 5I4CA 4PE5B 4RU1A 2HQRA 2Q5CA 2QU7A 3DGEC 3KYJB 1ABFA 1ISRA 2FKAA 4MR8A 1P6UA 2IDMA 2H0AA 1JL3A 4F3TA 1L5ZA 4YR7A 1D4ZA 3OLZA 5KC8A 1J56A 2KYRA 3NBMA 3RVJA 1Z12A 3KYIB 3C3WA 2AYZA 4LX8A 3K4HA 5CNMA 3A0UA 2FMIA 3I09A 6CHYA 4ZMRA 3IP5A 5CNKA 1P8AA 3LKBA 4OG2A 1GUBA 4RK5A 1JFVA 3VNBA 4F12A 4G0OA 5EWMA 3OO0A 2R48A 3OMXA 2RJNA 4MS1B 4XASA 1EHCA 4IMJB 3JY6A 2AYXA 1A0OA 1D5WA 3OLYA 5IUKC 4L85A 3HS3A 5EWLB 2FEKA 4EUKA 1AB6A 2E4UA 2MSLA 3DBIA 3H75A 2E4VA 5KQLA 2R4QA 3RVMA 1MAVA 1YS6A 3QEMA 3BBLA 5CHYA 2FXIA 1LBIA 1USIA 3N0XA 4Z4FA 3HO1A 3URMA 4UHKA 5DTEA 3B2NA 2GKGA 1JYFA 2HPHA 2ZAYA 3GYBA 3RVKA 1DBWA 3M9XA 5GOTA 2V0NA 2CHEA 3HDVA 2RJOA 4RK0A 2MSKA 3TX6A 1APBA 3HSYA 4MLCA 4P98A 1GCGA 2LPMA 2JVKA 1YK1A 1QO0D 5FBHA 1JWLA 4QYMA 2PUAA 4LRQA 3QLVA 5KI6A 4ETNA 4KNYA 3GRCA 5C5CA 1S8NA 2FTKE 1JDNA 4YWHA 3CU5A 3GWGA 5T7BA 1MB3A 2MYUA 1USKA 1BA2A 1XWWA 3IPAA 3KJXA 1NXXA 3QLTA 1Y1LA 4FE4A 3HM9A 2L17A 5DGCA 5T3YA 5TPZA 2PMCA 2JRLA 1FFGA 3LTEA 2FMKA 4Z9AA 3HDGA 1QNLA 3L6UA 3SM9A 2W42A 4N47A 4WXEA 2NZVG 3CLKA 1U04A 8ABPA 4DADA 4F8JA 4NCAA 3QELA 4N03A 4RDCA 4KK3A 3I5AA 4RK7A 1Z13A 4JB2A 1D2AA 1MB0A 1RZRD 1Z26A 2WJAA 1UDRA 1XHEA 4OTZA 4W5RA 2NT4A 1DBQA 4UHJA 3Q9SA 2JK1A 2VK2A 4N0QA 3H5TA 3FDFA 1WETA 5CNIA 4CBVA 4O1HA 3K9CA 1VPWA 1M2EA 2HQOA 4RY0A 3H5OA 4P1ZA 4WT7A 3C6QA 3GL9A 1IIBA 3T6KA 3JPYA 1USGA 2MSWA 3I45A 5FWXA 3R0JA 4RXMA 4EVQA 5FWXB 4NICA 1ZESA 4PZ0A 4XXHA 3JVIA 2FLWA 4IRXA 4ZMSA 1RZRA 1EWTA 3BRQA 4MPTA 1VKRA 3QX9A 4EYQA 4D6YA 1BDIA 1SXHA 4TLMB 5TQ0A 4ETIA 3LUFA 3QLVC 4MS3B 1MIHA 1JYEA 2FQWA 3RVPA 5EWJA 5TPZD 3HXMA 5HQJA 3MYYA 4KFCA 3CRNA 4O1IA 1JFSA 4EVSA 1TVMA 4ZJPA 2QR3A 1ZAYA 1DJMA 2P9HA 4N41A 3L49A 2IPNA 4MRMB 1Z18A 2JBAB 4MS4A 5DCLA 3O1HB 2JBAA 4KPYA 3O21A 3QLUC 4QYWA 4MQFB 3GT7A 4MGEA 4L4UA 4EYOA 4MR8B 2YHAA 3OM1A 2HQBA 3H1FA 4W5OA 2GWRA 3NNSA 1PUXA 2QV0A 3LMKA 4H3HB 4LDZA 4MLDA 3UKJA 4S05A 1ZGGA 2FLKA 1RXEA 1KMIY 3MIZA 1GLGA 3O75A 4JB0A 2GX6A 2M98A 3EODA 3QEKA 1GCAA 2LBPA 4G86A 4NCBA 2A9RA 3CNBA 3OO1A 1KGSA 2X7XA 3RVQA 5KQPA 2F8SA 1FQWA 2ID7A 5PNTA 2IOYA 4OBBA 3KCNA 3LUKA 4LE0A 4PYRA 1QMPA 4MQEB 1VLZA 4G0ZA 1YMUA 4MQEA 1ABEA 4MS3A 5HKOA 2E4YA 4M88A 1H9CA 3VNAA 4RSMA 4RS3A 3JVDA 3KSMA 2MYPA 1NATA 4PICA 3IDOA 4ML3A 3SG0A 3H5VA 1A04A 1MVOA 4HNSA 5IX8A 1T34A 2A9QA 3KS9A 2JVIA 3OLXA 3O2SB 4RZSA 5DKFA 3GA5A 3EGCA 3KKEA 1K66A 2E4XA 2J48A 4WXMA 4RK4A 5FWYA 4JP1A 4F11A 1YS7A 3CG4A 3BREA 1QPZA 2PL1A 2LIVA 2E4ZA 1U2QA 3FFTA 7ABPA 4MR7B 3CHYA 2PUEA 5C5EA 4Z4GA 5F64A 2JVJA 3T95A 1PHRA 3JTEA 4RY9A 1RNLA 4G0QA 5JS1A 5IULC 1SXIA 2QXYA 2FEWB
chains in the Genus database with same CATH superfamily
1N6HA 4R3UC 5DX8A 1JHYA 3UPUA 2C2OA 5IVKA 4XUGB 3N5KA 1BHO1 3D2AA 2VAWA 1E5XA 1CF9A 3CKLA 3Q1LA 3ZWCA 3C41J 1NVFA 3V7YA 4NXMB 1EHYA 1W5AA 3NBYC 3ZWXA 4BUZA 3SXUA 4PS0A 1IC6A 4LCJA 1AZTA 2PVPA 3NT2A 5C9ZA 2V7QD 4JYAB 1T1EA 1PZGA 2HSDA 4NDAA 4DQVA 4PU0A 4HJXA 4D9IA 2XMCA 3A6DA 3RJ9A 4E32A 2ZIEA 3BJIC 1QF7A 5CYOA 2QYTA 3KFLA 4U7WA 2GN0A 3LF2A 2QD3A 3W77A 1QR2A 2F8LA 3GZJA 4ZYWA 1YVRA 2NYAA 1MO6A 1ZXXA 2VYQA 1TVKB 1IPFA 4LZPA 1MEEA 1TZBA 2R65A 4W82A 1PFUA 3PQ6A 1C2YA 3LWDA 4Y2YA 2GRAA 2ZEJA 1V2GA 3HWWA 4BMYA 3KIPA 4CM1A 3WGYA 1SXJB 2GCGA 3BMCB 3HB4X 2R85A 4C7JA 1OWLA 4FNGA 4W1RA 1DJPA 4DARA 4ID3A 2I54A 1NW4A 1UDBA 2IIPA 3BWXA 4JK3A 1T91A 4R16A 1S9DA 2HBQA 5I4BA 5H83A 5F3WB 3HJHA 2CVQA 4N6GA 1IAVA 1Z15A 1JJ7A 1U1EA 2VL7A 2VK4A 2D13A 4OHWA 3U81A 4YCSA 1N34B 5CW1A 1ZUNB 3L40A 3HB9A 3WICA 1UH5A 1QHSA 1A8HA 2IYWA 1U31A 1C81A 4U3JA 1LDEA 3NV9A 3KALA 4YMSA 4HAWA 2QIPA 3JVVA 4KDRA 3RREA 4ZKEA 1RJFA 4H0NA 3Q6NA 1M8GA 4TL7A 2ZE8A 1OC2A 2OP1A 4PPGA 4V0MA 3PCRB 5AI8A 1Y63A 1KKUA 1V96A 4EH1A 3VU9A 3F9RA 4AWXA 5G3ZA 1CX9B 4AJLA 4MRNA 3MYRA 1GLNA 2P6MA 2WHXA 1LW7A 1E2QA 2ZJZA 1TF2A 1FJ2A 1XB2A 2XAAA 4H4DA 2I7VA 1DIOB 1KVRA 2EJTA 3TMKA 1OXBB 3G1UA 4ZQIA 5FB3A 3X1KA 1JQLB 4WLFA 3WMGA 1YB4A 2DE0X 3G0DA 5JLJA 1SKQA 4Q15A 3TZCA 5DOZA 2C84A 2A1TS 3NHZA 3RKUA 4BNYA 5K2OA 1M0TA 1U3GA 1ZINA 3OWXA 1BX3A 1WMEA 5K3DA 1E60A 4F9EA 3FF4A 4ZYLA 4H0CA 1U6KA 3G8YA 2LV8A 1R6DA 1YR2A 2XGGA 3UJ6A 5I8WA 5TMEA 4MYSA 3I62A 3LBFA 2DLDA 2LUOA 3I72A 3KWMA 4IGIA 3N86A 2Q0HA 3FNGA 2DLNA 5TY0A 2BGGA 4K88A 1SD5A 2XKAA 2GSWA 8AT1A 1WHSB 2YWDA 1Z0JA 1P7WA 4BVFA 1E2IA 5TMDA 4ZHQB 1PSDA 4EAAA 2AG0A 3IUEA 3MTJA 2B3DA 1WSDA 3VR5H 2GN1A 1Z73A 4GSLA 3TLCA 5K0SA 2F8SA 5LQRA 3HZZA 3EG9B 1KDPA 1FMFA 4PLGA 5K0JA 4CFZA 3TL3A 1U81A 3OZBA 4C04A 5KCZA 3SDBA 1D1TA 2GQ0A 3PDCA 2IPMA 5EIHA 2ZPAA 3PQEA 3RS9A 4CMHA 2FPPA 4I3GA 4M9XA 3IEPA 2V97A 2BMAA 5JPDA 2NZ8A 3PNYA 4G26A 4IF4A 1JDVA 2O0MA 3AHFA 1OC4A 3LNCA 4P3OA 4RSHA 2DBVO 3EIQA 4ZAZA 5KSWB 3SC2B 3RROA 1GTVA 1TQHA 4C5CA 5CG2A 4MNTA 2XUOA 2I3BA 3CNQS 3E6AA 4HFMA 1XQ1A 3DJYA 5F5NA 2VTBB 3N07A 1QGAA 1Y89A 2X4GA 3PFWO 1D4AA 1GXSA 4QYXA 4M0LA 2GCOA 3EQZA 1EFPB 4C0KA 2PJZA 3MT0A 2IS6A 3A2KA 1XVIA 4QJIA 4NYIQ 4ZXPA 5JO0A 3U5TA 2MOKA 1ZCBA 3K9BA 4P34A 4S1WA 4LE1A 1W4RA 4KN6A 3JZFA 1Z4OA 2FWMX 1FVFA 4TKZA 1W5SA 3C8HA 3H99A 5E7MA 4WNCA 1OREA 1VSTA 2CGEA 1V41E 3A1CA 3KE8A 1SC3A 4OMDA 5F9MA 4WOBA 5FOXA 1ICIA 3TOZA 4TVSA 5LQMA 4REOA 3Q5EA 1LZLA 4GC9A 4FFSA 1Q83A 2WZDA 3WNDA 1G7CA 1EWVA 2AZ4A 1I3LA 1G7RA 1PYOA 4ARCA 3I1YA 5H8WA 2JI8A 3E48A 4GKAA 2DQYA 1NQ5A 3GQVA 3H2GA 3JTMA 1IBMB 4D9CA 4BWGA 1BS1A 3DTNA 3JZDA 3K0CC 3LYHA 1W5BA 3D3EA 3WYGA 3IMKA 3AJDA 3T7AA 4XOIA 3ASUA 1B0AA 3NWPA 4XCQA 2Q4EA 2DY1A 4RIFA 1OI7A 2BTQA 1Z0DA 3AJ8A 3JQAA 1U8TA 3DLTA 1KMNA 1OLXB 2CXOA 2I3DA 1GTRA 3C16C 3DMGA 4WY5A 4F8EA 2XGOA 1N4AA 3SLGA 1BGVA 3ACBA 4LZWA 1SVMA 1C3VA 2C96A 2CL0X 1AGNA 4DLWA 5BMVA 5K3SA 3TPCA 2XWJI 3KZVA 3PPWA 3BH0A 2YWBA 1YQEA 4XD2A 1G5HA 3TK1A 1CR1A 2VAVA 4PBRA 2HCRA 3H1EA 3HRIA 4RL4A 4IDHA 3VU0A 5DM2A 3P0IA 1INLA 5C81A 1XALA 5JY1A 3DLHA 3LFTA 5AD1A 2Y1FA 3NIFB 4NYJQ 3W3AD 1WEKA 2Q3HA 2Y1XA 1GUDA 1VA5A 3E7FA 2C04A 1KI3A 1M1YA 4NI5A 5A04A 5HSGA 4NBSA 3BIXA 2BFAA 3L4BA 3WGUA 3I9LA 1H22A 2P4SA 4ENSA 2IYTA 3RTAA 4Q01A 5I3ZA 3D9QX 4FLMA 4R2IA 1YB5A 5LB4A 1RXYA 2WI8A 4LHEA 2PR7A 1PBTA 3DZDA 1T43A 4WCDA 5COBA 3ZDZB 4Z7JA 1S7CA 4X7RA 2OGTA 1USVA 5BQPA 3HN7A 3JQBA 2ZTHA 5HJ5A 1KYVA 3MAAC 3LRXA 3JU3A 4MULA 3C5VA 4UXIA 2OO7A 4YCLA 4BEWA 2Q28A 2A57A 5CX1B 4XEUA 2N3ZA 1EWKA 2AE1A 5AOCA 5JJCA 4EUSA 4HDKB 5KTTA 3D3JA 3MXTA 3D64A 3U13A 2NMVA 3PFIA 3VOSA 1VLHA 1C29B 4X7PA 5L9AA 3MBKA 2CL6X 2ZJ7A 5IZ4A 1A50B 1W35A 1MC5A 3ESBA 5EYPB 5SZHB 4HMQA 1JLLB 1L3BA 2NQ2C 4UTRA 1G5PA 1U9JA 2XVAA 2YH2A 4HQKA 1QIKA 2PG3A 4AP5A 1SC6A 2IYEA 3Q9LA 2BFFA 3TQSA 3UJCA 3WL8A 1BYIA 2ZE5A 4BUJA 4L8LA 3CWCA 1JA9A 1SKYB 5BW6B 3IQWA 3QVWA 2ATCA 1NW3A 1CDEA 2VTVA 2I76A 4QAJA 4MRSA 2A59A 3PRJA 2WJJA 4IJWA 3OZ7A 3IUBA 3RAJA 1M54A 1C2TA 1M9NA 2ZI5A 5JNVA 2O6LA 1UANA 3Q0EA 2O20A 3PTLA 4P4GA 1IN4A 1RC1A 2EWVA 2R6HA 4MUHA 4MWBA 4RVHA 4RETA 3LH5A 4J6EA 4DG9A 4XQ9A 3GFGA 2QZ9A 4YPFA 4UQPA 4QSMA 4U9IS 2XPCA 4ZICA 5D6NA 4EHFA 1HLGA 5JRZA 3VKFA 3AB7A 1QYVA 3AEQB 5JQGA 1WBDA 4GPZA 3HCWA 1MRSA 3NG1A 4YHHB 1NNUA 3WRXA 1J2RA 1CY2A 2W2LD 2WY2D 7AT1A 3KB1A 4O8ZA 4TL8A 5FT9A 221PA 2OZPA 3LC7O 3KQQA 3PQFA 4HDNB 3HM2A 1ECFA 2R1ZA 1A5AB 4X1YA 3DDZX 1WDMA 2BFEB 3FAKA 5SYNA 2Q27A 2WQ7A 2B2NA 1LBEA 1SBQA 1T26A 1XVTA 3KKPA 2XKKA 3SYKA 5CVDA 4MV7A 2Z43A 3KXPA 2LR0A 1N5LA 1A77A 1C0PA 1XDBA 3K20A 1DGQA 2HQRA 2FP4B 2QU7A 2PSEA 2WYHA 3QITA 4Q3NA 5JCPA 2O59A 2H2IA 2G5CA 3K0AB 3LP6A 1ONOA 1DINA 4I9FA 2C82A 3VPCA 1U2DC 1DLJA 4R0MA 4LJRA 3VPBA 4FFBB 4NFSA 2VPQA 1GYQA 2JFUA 2YMMA 3QMPA 2GN8A 4YJGB 3RABA 5A5FA 2AEMA 3EYAA 1R37A 3FCXA 2AI3A 1ZK3A 3RV4A 3T5BA 2D3TA 3ET4A 4QQKA 3STWA 3TLKA 4A0SA 2R8PA 2F4VB 5F4ZA 3I09A 4TVBA 5GJWC 3PEWA 3KAPA 3KTAA 4BRSA 4MB6A 2NTJA 2RGEA 1OF1A 3ZH2A 2QV7A 4KTTE 2HPAA 3G2IA 4MKIA 4IKPA 2P9JA 4ZO4A 4K9NA 5IC4A 2EBFX 3U4IA 5K45A 1YJ5A 3IAM1 3UJ9A 3KEMA 5DCUA 2HA6A 4JXJA 3O8NA 1UKCA 1BVYF 3PFCA 1FS6A 1S2DA 3FVQA 4JLKA 4BPRA 3NIBA 4L85A 1L4NA 3LPLA 2WQ6A 1VJGA 1QQ6A 4Z8YA 1SM4A 4UBKA 4AU1A 4IO1A 3TTSA 4EUKA 3U4MA 2K2QB 1YI0A 1RAFA 2R7AA 4GS5A 4HNAB 3SNHA 3MCAA 1KAQA 1UBRS 1KPHA 5KHLB 5IAGA 1KEPA 4J2TA 2O3SA 3A11A 4G09A 3Q6MA 4DQUA 5FQOA 3Q4GA 3WP0A 4ZI2A 4AL4A 1XJQA 4HG2A 3MJDA 4GI7A 5KTYA 3U44B 1DQZA 5FI0B 2HDOA 1OBFO 5DTEA 3E22A 1JYFA 3E5MA 2JFVA 4V24A 1XEFA 3GIDA 3OCYA 1AK1A 1CZUA 2BDEA 1WDKA 2G0TA 4D8TA 4C4SA 3D81A 4JBHA 4E14A 3ZGXA 1XLVA 1VRWA 5KVQA 1V4VA 1S89A 4Q1FA 1WXHA 2JS7A 2E6UX 4TL9A 3RWBA 3JAKB 4K6OA 4CKCA 3QLVA 5KI6A 1UZMA 2Z5VA 1JE1A 1LKZA 4RVDA 1WKBA 4XM1A 1MNAA 2XA1A 4EL5A 4R1SA 4UBOA 2KX7A 2EFJA 3UBMA 5CLIA 3KK0A 5EGSA 1MB3A 2MYUA 2IV2X 1PJ2A 3ULKA 5T7BA 5K03A 3M1IA 2WLTA 3KLBA 1I4LD 4JT4A 4YDRA 4WOKA 1NP3A 1XV5A 2BEUB 2JHCA 3AZPA 2EL7A 1NYQA 2RHTA 3KOUA 1QDLB 3N2ZB 2BJWA 4PSVA 5AT1A 5BSWA 1AQJA 1CF4A 4MRVA 1VLVA 3GP5A 2Z1MA 3SSAA 2FGJA 1P33A 3VRHA 3ZZ1A 1QNLA 3HKCA 4UPDA 2C8VA 3ONEA 3IBGA 2XRZA 4JU8A 1J8VA 3FLBA 4PZYA 1P2SA 3I5AA 4ZAYA 4ZVOA 4B8YA 4R2XA 1ITZA 1DC5A 2IXDA 1LSSA 3BFJA 3WTCA 4G8CA 3BGSA 4RIGA 1UOPA 1QTQA 2FPSA 4YWJA 4BNWA 2IRWA 1LD3A 3H8VA 3UIEA 5KTMA 5MGNA 3QNWA 5EYPA 3ZS8A 4KXNA 3JSXA 3SYMA 5AW3A 3EZGA 4IV0A 3JASB 1W59A 3E1KA 4YHBA 2X40A 2GN6A 3SSNA 1Z0IA 2ZB3A 3FPBA 4YK7A 3EC7A 2WT8A 2QX4A 3NTUA 1GNQA 3E9CA 3PEFA 1FNNA 3N6XA 1ZKDA 2OBXA 1SKYE 4U7JA 1NZFA 2RKBA 3EVDA 3N2KA 1XOIA 1E92A 1TCUA 2GA8A 3GN1A 3MJEA 2JGLA 3HPRA 1ZD5A 3K3PA 1E7YA 2WFAA 3HJAA 4UFPA 4XXHA 4L5YA 3A9WA 3HRHA 1WAMA 4I5DA 4GM1A 5K05A 2D1TA 1KC1A 3AXSA 5H0IA 3VJKA 4FFBA 4D6YA 1WQ4A 2HGSA 5HK9A 2ZBGA 4OHXA 4TLMB 2Y93A 3ZQUA 3GUCA 1MIHA 5B3AA 2O7QA 1KFJB 4D8XA 3VC7A 3STVA 3TQIA 3MLBA 5EWJA 5AKYA 1V2HE 2CYBA 4UAGA 4IZ6A 1SB8A 3UXMA 2A30A 4QOSA 4HKTA 1E2MA 4O4JB 4D0RA 3IT2A 2O2GA 1IONA 1Z22A 4XEHA 2F59A 5J4HA 4C9BA 5C80A 2ZWAA 4QYWA 5L6MB 1NDQA 1X3SA 4M4SA 2QD2A 1QFXA 2A84A 5AXBA 5E8JA 3FLEA 1KO5A 3GEMA 5DHPA 1E7WA 3VUEA 3D4OA 2J32A 1B3BA 1CU1A 2OO5C 2X77A 1MOQA 4MEAA 4B6OA 2PS9A 4ZVUA 2G5TA 4U8HA 3WLJA 1FYVA 3C5HA 1JXQA 1MW9X 2IIBA 2VF7A 2Z3ZA 3C3EA 2PT7A 3P97A 2NSJA 2YMLA 3WRXC 3HCFA 3SC6A 4JP3A 1EESA 1XNGA 1XRRA 1UODA 3E4CA 2JAXA 3PK0A 4EFMA 1VLZA 4MPPA 3IIJA 3S1AB 2HF8A 2ZB7A 3GD5A 3I6BA 1ADYA 4M88A 3TOXA 5KNDD 4PYNA 3BGDA 4JT9A 1T9GS 2A88A 3ZZUA 2X0KA 3RIHA 2AC7A 2IYAA 2N1MA 5BN3A 2RGNA 1C1YA 1ZUNA 4YT5A 3T1QA 1POWA 4YFVA 5ELMA 1JVNA 4ML3A 2W6ZA 2C0QA 2YXPX 2R2GA 5IX8A 3ELUA 2AD5A 3EDQA 2HSWA 4OP3A 3ZV3A 3PR3A 1P31A 4HHEA 4GU5A 4B6GA 4UNSA 5F98A 4R41A 4O4LF 3QGMA 4F2DA 2J9YB 3KKEA 4EYEA 2OA0A 3NDPA 1JR3E 3R23A 4HNTA 1JRLA 1R6TA 3OOJA 2GKOA 3H87A 1EX1A 2A94A 1M7BA 2DFTA 4L50A 1CJMA 1CULC 3ED5A 1HBJA 4WEOA 1L7RA 1TM1E 5JDCC 1AGYA 2WWGA 4H2DA 4EKIA 5IULC 5LWHA 1AVTA 4P32A 4PFKA 3G88A 1U1FA 3PFNA 2HJWA 3AVWA 1Q7GA 3GZNB 1UBFA 4F3CA 4Q1DA 1JECA 5F5LA 2UVPA 3HPQA 4AG5A 2FYTA 1Y48E 2XKJE 2NZJA 4YP5A 4EDFA 2UYCA 3RTDA 4NXNB 1I4DD 1ILEA 1CUVA 4RZUA 2EFYA 2ZSKA 4E5SA 3L06A 3DEFA 2ZR8A 4KQIA 1TCVA 2O3TA 4Q6WA 5D8DA 1V6SA 3UOAB 3FNIA 5IRCD 2W2LA 1U2GC 1ONSA 2HK8A 1Z6PA 2IXFA 4PPNA 3JZAA 1Y33E 4D98A 4KR3A 2WM8A 4OVKA 3DL0A 2AFHB 2WRZA 1AA9A 3U9TA 3G13A 3NAQA 1M67A 5TMBA 1BMFA 5IWCA 1KY3A 3E61A 3P9KA 4NENA 3OQNA 1GL3A 1SHUX 3F3MA 1N5KA 2Q49A 2YICA 4OBXA 1W1WA 3DZHA 2KQUA 3I4LA 3AUXA 4BX0A 5HRAA 3NTRA 1SUWA 3LS2A 4FJ2A 4JIGA 5E6UB 4FFVA 5C2JB 3B1YA 4UU8A 1L3IA 1E0SA 1W4ZA 4IMIB 4KB5A 3OCUA 4CFYA 1KKLA 1HZZA 2AA3A 1UEJA 2ARKA 3NBUA 4WUVA 1UXKA 1TPZA 4KUEA 2C1ZA 1RPJA 4IDPA 4MYHA 1ZJZA 3H7IA 1V43A 3L7BA 4NNJA 3JWEA 1UKYA 1I7SB 2CCKA 5LZ9A 3BGVA 3GBSA 2EZUA 2RHLA 3IV6A 4HDMB 2FH5B 1OYVA 2JFGA 3ZJ5A 5JAZA 3WV5A 3Q9UA 4GDFA 2CBGA 1P9RA 3M33A 3TZQA 3BIOA 2SKCA 2OM6A 3CRRA 4RKYA 5LQJA 3IVAA 4JVNA 1H1DA 4RL6A 5FPSA 5IVHA 2F17A 3R3JA 4MYCA 3EGDA 3ZLVA 1T9ZA 2UZ1B 5I9LA 2LD4A 2D7DA 1R0YA 3FA2A 1O4VA 4G41A 4Z9YA 1AUQA 1P5JA 2ZRGA 4Y6GB 1BC5A 1E7QA 5BWLA 1D0VA 2NSLA 2GN2A 4YRJA 3WWDA 1EUQA 3ABZA 1KQPA 2PD6A 2GJ4A 2Z5LA 4MH0R 1SHLA 3H5NA 1T3SA 1MX5A 3TQCA 3WBFA 2Q6IA 4L76A 3PF8A 4AK9A 4OGWA 2GBPA 4RANA 2VJMA 3NT5A 1J2TA 2HRBA 3AOEA 1CHDA 1YGPA 4NMHA 4UCXA 3E58A 3QVMA 3RRFA 1JH9A 1BN7A 3OQ1A 4P3KA 2D00A 2DWPA 5EZYF 2V1UA 1V35A 3H1AA 4K9LA 4QDKA 5EZ5A 2R87A 2XT0A 1PG0A 4XYMA 3UHFA 2J0EA 1JI3A 1D09A 3QNUA 4REQA 3P9IA 4IKEA 4LISA 1D04A 1QTRA 1ZZGA 3QEOA 3TNDA 4IHKA 4C7KA 2JGMA 2VJQA 1BVRA 4L6AA 2R6R1 3R41A 5EUBA 5BMOA 3OMLA 3W5CA 3CZRA 4C14A 2AQ8A 4Y2XA 5FEUA 2IJGX 2ORYA 2W2NA 2A7QA 3RAGA 3H2HA 1G20A 5JS2A 1VMIA 5FAKA 3E1GA 5LIPA 4ZVQA 2RHBA 2QN7A 4BVKA 2C7PA 2E1PA 1PG5A 3UAZA 3RK0A 1IG3A 3QPDA 3UENA 1O95D 5HZMA 3ZWOA 2YL2A 4AROA 5DSZA 5HS4A 3E22B 3QLJA 2VTDA 3T4EA 1UKEA 4FXOA 1GQ2A 3JQAD 4XDYA 2F43A 3EQ6A 1PZEA 3QWBA 5CJJA 3ZLTA 2FF7A 3N75A 1T8SA 3HYLA 2CY0A 5A4DA 1R9MA 1N5MA 3IE2A 2WJ4A 2BBOA 3FROA 4FLEA 4RESA 4D74A 2WKSA 3LWNA 5A02A 5JV5A 1QK5A 2BFDB 3GP3A 4B3HA 3JVUA 2CMHA 2GB4A 3QVKA 5CA1B 2GHRA 2YIMA 2VPWA 4NH0A 3A6FA 2A78A 3LLSA 5LXTA 4D0NA 3ZZTA 2HWKA 5CTJA 1OAAA 3CM0A 5JMOA 4OI0A 3TTVA 3PKJA 2QVGA 3MJCA 4BQEA 1W25A 1OI2A 4MV4A 1NKTA 4QU9A 3KZNA 2P41A 5A03A 1IK6A 5FCDA 4H7FA 3H4MA 3C3KA 4NBUA 1W9HA 1CJCA 1V45E 4FFNA 4FFWA 1NKSA 1E7SA 1N5RA 1MABB 4LOJA 3TSZA 1BH2A 1DDIA 1YD7A 3O4IA 2OD2A 1IE3A 3FHJA 4QJ5A 3LCRA 1BOFA 5JJ5A 2F4NA 1ZWLA 3KOOA 3N1UA 3TL6A 2AN1A 2BF4A 2C78A 2FEPA 3RVRA 4BWVA 4PHFA 1TYBE 2ZJFA 1YTLA 3T3GA 1GXSB 5HKLA 2WQZA 3F8SA 3U4HA 4CM6A 3HKCB 4BBPA 3B9PA 1EM6A 1QK4A 2Q9AA 4JX8A 4NARA 5AVSA 3L84A 1B1AA 4BN5A 3DV9A 3G85A 1U7HA 1KS2A 3DUFB 1DQPA 4P5DA 4EG7A 1XC7A 2RONA 3MWEB 2XVXA 4CETA 1QIHA 3KTDA 4BAGA 1L5KA 1T1JA 1Q1EA 3FXAA 4DNOA 3PB3A 3VNRA 1TEVA 2J3JA 2DRIA 2EIXA 3HC7A 4B3CA 1J8QA 3EVGA 3REQA 3HCNA 4BQRA 1ZIDA 2WJIA 5CEJA 2V65A 4DSNA 1HQKA 2W6JD 2YOGA 3H2ZA 1L5OA 4DM4A 1EXNA 3PHJA 2O3QA 2DHQA 1HFJA 2B98A 3QSYA 1C4WA 4I4TB 4UMEA 2UZ3A 4IX1A 1MOPA 4KC0A 3GX1A 5KYWB 1OYYA 2C5HA 1O3YA 3OEHA 3TTWA 1DTWA 2ZVQX 1KY4A 2A0FA 4MEJA 4MS1A 4P58A 4XWYA 4QQFA 1T4BA 4MJ3A 1FP2A 4CMJA 2I80A 1G8PA 5PGMA 3QLUA 4KR0A 1E6KA 1KOFA 1JDTA 1LNSA 1VB3A 2I3ZA 1VG8A 2Y1DA 2ODWA 4J9UE 4JLVA 4RZXA 5AI0A 1A8UA 3NXKA 5C31A 3W90A 1BO6A 4Q0MA 5GINE 3UT6A 3OM0A 1M6WA 3DBLA 1SVWA 3ICPA 1F4VA 1VBKA 4HNQA 2Q2VA 1NVGA 4A6PA 4EY4A 3JVEA 3OLWA 1Q2XA 3HP7A 5KYUA 3LO5A 3UQZA 1ZITA 4K86A 2EL9A 5ULLA 5LQDA 1PO7A 4WLNA 4EVRA 3QKSA 4PF1A 1ECLA 1JPJA 2EBHX 2WA2A 4PO1A 1OXKB 3MOIA 3MWDB 2G1AA 3AU9A 1KYTA 1L7OA 3MF4A 4G25A 4JP8A 1R0WA 5DM4A 3QVOA 4J90A 4Q4JA 2XGJA 2GUWA 4YAGA 1OAOC 1QIFA 4RYLA 4TLLB 1Q1BA 1RHRA 3W4JA 4D6XA 5KTSA 1CYEA 1KEEB 2NO6A 2FP3A 4C1BA 3EMVA 4HNAA 3DPSA 4IXDA 1MXFA 3UAGA 4NBVA 4TTAA 1ZCFA 3E53A 2ETVA 5ICGA 3ZGYA 5C3UA 2ZYTX 4RTRA 3MGGA 2FGKA 3LOPA 1J5PA 1FUUA 3DZCA 2BRUA 2N46A 4R98A 4E08A 4WACA 2WM9B 4X92A 3OJOA 3T9CA 4QJ4A 2R6CA 3R0VA 1HE3A 3RTCA 4IIJF 1FFWA 3AJAA 3SC3A 3RVNA 2HY7A 3NHUA 5BNIA 4NYMQ 4A0GA 2CB0A 2QSJA 4GP9A 3WNQA 2FPIB 1GQSA 1CUXA 4JUBA 3JYLA 4UNNA 2J3DA 2G4CA 4YP1A 2I67A 1GGVA 4EAQA 2FUCA 3O3MB 2GR9A 4HRYA 1B6GA 3GXBA 4J0FA 3QPUA 1R4AA 4M2LA 5LR6A 2OQIA 2Y99A 4M53A 3NHSA 1RBYA 3MBIA 2O9JA 1Y7HA 2CMKA 3DXFA 1PNVA 3ZQ4A 3DHWC 5A0FA 4R9SA 1EHIA 4ENVA 5JSZA 5K8IA 2ZIXB 1POXA 2QLFA 2O2ZA 1EFRA 1W8IA 2BFCA 3WFIA 5L40A 3I2IA 5A4JA 1CRLA 2IITA 2OG1A 3RIEA 2P2GA 4UMFA 2FKAA 4ZI5A 1L5LA 2VSNA 3W8EA 3OT1A 1U2RA 2QUBA 3AW9A 1D2RA 3G9UA 1XROA 4GX0A 4MA5A 3WGQA 3P5SA 4J7CA 1VBFA 2QE7D 2XE8A 4IFTA 4DLRA 4ZO7A 2VZ9A 3C3WA 1YRBA 1QHYA 1L5VA 4EARA 1BE8A 1OKKD 2Q7DA 3W04A 2WT9A 1BGWA 3X44A 3S27A 2VJLA 1I80A 4P53A 4S2UA 2G1PA 4B6QA 4QNRA 2W48A 3A4LA 2G1JA 3FWNA 3RRMA 3T1NA 1NSFA 1XZQA 2HSEA 4CT4B 4EY5A 5ALTA 1NUAA 3GT4A 1XDGA 4PW0A 3LCVB 4WKGA 4DQKA 3ZD6A 2ID4A 4QLBA 4C0QC 1KU0A 2DKNA 5F9HA 3O4RA 3SQDA 2AH5A 3ZU3A 3AK4A 1QRTA 4D41A 1PFQA 3QX3A 2AN3A 2F62A 4EHBA 4DV0B 3DE5X 3DEAA 2R8YA 4KFUA 3BBLA 5CHYA 2FXIA 1QK3A 3EA0A 5U1PA 3G2MA 1WIWA 4TYQA 1YZYA 4ZOBA 3RI3A 3VFDA 1V8OA 3E9DA 1T15A 3STUA 1J49A 4YYZA 3EWNA 4LOAA 4B32A 3RUPA 3VPGA 3GCGA 1PR6A 1JHMA 2CHEA 1SU7A 3HDVA 1ZU4A 3IMCA 3V8NA 3NMUF 4HAIA 1JIQA 1ZCJA 1P3DA 2BBSA 4UTOA 4MVXA 4CM3A 4ETWA 3V1UA 3Q3IA 4V0OA 4PXAA 4QARA 4ZK6A 2FETA 3LBHA 1QKJA 2DMRA 2VJNA 1P1KA 4TSFD 5ALUA 3P32A 1JDNA 5IH3A 4BWYA 4R8LA 1RWPA 4IJ6A 3EEYA 5DCWA 4K3VA 1NLFA 4BNKA 3T35A 4KE9A 1USKA 1FVOA 3BXFA 3G5AA 3M0EA 4YI5A 2VDJA 3LQKA 2BFPA 3PVCA 5FFNA 5AVZA 3HM9A 1D9XA 3CX7A 4JB3A 2CNOA 5TPZA 1OTHA 3KUCA 3W2TA 2ZG6A 2IZZA 4RMJA 2DFKB 1MX9A 2FMKA 4YAFA 3O83A 5BV2P 1KU6A 3KPYA 3UMFA 1CIVA 3R0QA 1K2VN 1TOAA 5K3AA 2HOQA 2WWTA 1E69A 2RSLA 1NFRA 2NZVG 3TIVA 5CITA 1KJWA 3O95A 4NJEB 1HNWB 3OICA 4XCXA 4CE6A 1GD1O 3CEJA 2ZWPA 4Y6SA 1ENOA 1JH8A 1TU0A 5ES3A 2EDCA 3TGWA 2NNWB 1V47A 2EFGA 3C7KA 4PC7A 3HE3A 3D6NB 5M29A 3VYWA 4DGSA 4TLCA 3CLUD 1EH5A 3A37A 4JQSA 5SY9A 3ESRA 4PZAA 5JS7A 1CUUA 3HJTA 5CT4A 4R81A 1B7GO 2R68A 2H8KA 4HADA 4PSCA 4A7PA 4PC6A 3B1WA 2JJQA 4XIFA 1K3UB 2DEUA 1GCOA 1UFRA 2ZJ8A 1TFUA 4OGFA 3W8FA 4RA6A 1KZYC 3SLKA 4NU6A 2CVFA 1USGA 1GGEA 2X8BA 4ND4A 2BEVB 3FX2A 1XZLA 1YRLA 2CFCA 3I45A 2XKBA 1L7NA 4ATNA 2PXCA 5TT1A 3KJFA 1TRKA 4UKDA 3CZQA 1KARA 1JGTA 1ZJ6A 3PU6A 2WD7A 1RI5A 1EUYA 5ESXA 4B5KA 2Q3BA 4PZ9A 1MZPA 1FIUA 1FXWA 3DVSX 4GWGA 2OGSA 5EPUA 1II8B 5FIUA 1PW5A 2VZEA 2NG1A 5A0VA 1U94A 2P4HX 5HCUA 2GN4A 2ONKA 4OMFG 3SI7A 3F7OA 4I4IA 1VMEA 3EK2A 3SJUA 3JD4A 4AXBA 2XTAA 4NL4H 3BWDD 2ZREA 3U9LA 3EUEA 2IBMA 1Q0PA 3H83A 1BEZA 2C2MA 1AZWA 1KI4A 2ZRFA 3P7MA 1XA0A 4BC1A 4W1PA 4C3ZA 3PPYA 5I9SA 3FSGA 4HNUA 5KUTA 3B3AA 2VJMB 2IYZA 3GGDA 1QONA 3GIWA 1E5LA 4B35A 3H11B 5LMZA 3FUCA 2A1TR 5IKMA 4J1NA 1UBLS 2F90A 1ZVKA 3MILA 3QLUC 1FFXA 2YBEA 1SEPA 5FBLB 1U7TA 2VBIA 2ZIAA 5LBUA 4YC7A 3GT7A 1IM2A 2DP4E 2BGJA 3U3JA 3ZDAA 2X7HA 3FUTA 1DV2A 1GSOA 1RZUA 1TVCA 1W5FA 4PZZA 1GZSA 3T06B 4BFTA 2ZYHA 4E94A 4KYTA 4IOKA 4TWAA 2Q9BA 3AM3A 4KPGA 3FWHA 4TXJA 3THWB 1Y8QA 2UZAA 4BZQA 2O2SA 4GOJA 2D2FA 4NCBA 2HO4A 2CSUA 4DRZA 1LLDA 1VOTA 5KQPA 2YFHA 2BUCA 1Q91A 3EARA 2DSTA 1ZRMA 2AOWA 5CEEA 1N8KA 5IS2A 3IVRA 1TJ3A 5D5HA 1HI9A 2QW0X 4GR4A 2PWZA 2BP7A 4PC3A 1G5QA 3TQFA 1ZD1A 3UATA 2VOJA 1NONA 1OE0A 1ZQ1A 4Q4CA 1CJBA 1YA4A 3QXSA 2N75A 2ZI3A 2HHCA 5ECGC 4ZRMA 2VCYA 1HZJA 4D9GA 2ATXA 4ZYZA 4UDYX 4M6WA 1RHMA 3IJRA 3PNMA 4AB1A 1DLIA 1YA8A 3FVVA 4AJOA 2WZCA 1P19A 2YN0A 1AK2A 2AJLI 3LT0A 3V4VB 1BRMA 1I6KA 1JSXA 3FIJA 4QRHA 5F3RA 4DSUA 1CBUA 2WIDA 2VP6A 3P4UA 4MRPA 4FOLA 5AQEA 3H8SA 4PPFA 1I4OA 3DT6A 4MKHA 2PMDA 1BQ4A 2WIAA 2ZSFA 3QVXA 3O8BA 4GRDA 4N3AA 5KHOC 3GEDA 2XQVA 5HMMA 2ZAOA 2AF4C 4R69A 3SBEA 1PHRA 3JTEA 2QL7A 4G0QA 5CLLA 4PLVA 3RANA 1PS9A 3RT1A 1WNFA 3OU6A 7MDHA 2XXBA 4Q12A 3L01A 1G4HA 1JF8A 1PK8A 2BM0A 5C35A 1MC1A 3W5DA 2ZIXA 3GEPA 1Z5VA 3SR0A 1X1TA 3QQ5A 5EFOA 3NR2A 4WVFA 2OHXA 3PGA1 4MWSA 4Y3UA 4KQKA 1GGNA 3ZI0A 1DRKA 1KRHA 1L3CA 1U9ZA 4DA7A 2VDRB 4DSTA 4JSTA 1SIWA 3BE6A 4PV7A 5CRIA 1KY2A 1X8LA 2JLSA 1EP3B 3H5RA 3OX1A 4LPSA 3ZDRA 4QT0A 2P4EA 4HZUA 5K8JB 1N2CB 4AN0A 2OHGA 2DBRA 2E7ZA 3LUAA 1U6IA 5TLSA 5C4IA 1RPNA 3ZWNA 1Q0LA 3ZE0B 2Y0DA 4P4LA 4MV9A 4G4IA 1U8UA 4XUEA 2WF6A 2X8JB 3IKJA 2BT4A 3F8WA 4BNVA 2YQ5A 1TIKA 3RAEC 2QM8A 3FKQA 2IYNA 1JKMA 3Q10A 1PR5A 1SKBA 5J5AA 5BR7A 5F4BA 4Q82A 5HXAA 3CONA 3TLMA 1KEEA 1IXRC 1DQSA 2IZOA 3FGZA 2FUG6 4L5BA 4G0XA 4YACA 4ZCQA 4E6EA 2D6FA 2QMUA 5CT8A 1A4RA 3IJ5A 2IWRA 2H2HA 3TYXA 9GPBA 3S29A 1ZLYA 3PQ8A 4X5OA 1H2WA 1NUQA 5AKXA 1P45A 2X76A 3QEMB 3BIWA 2O5EA 3C87A 3ESYA 4YBRA 4OF4A 1L5SA 3CINA 3GAAA 3AV3A 2EZTA 2IY7A 3WS7A 1OUMA 5IK2A 4UU0A 2J45A 2Y0BA 4Y6RA 5FWAA 1W19A 2QJRA 4ZPJA 3BWYA 2FPXA 4D4IA 4LMAA 1ISJA 4ROSA 3E9YA 4UREA 1IY8A 4CCWA 4ZGGA 1XLUA 2ZPUA 3FDXA 3UMSA 2B4QA 4RABA 4PRYA 3HLYA 5ERGB 5K0BA 5E7JA 2BP7B 2QUKA 2B4AA 4A15A 1TM5E 2OK7A 4PYOA 1ZDMA 3O8DA 6REQA 1JS1X 3ZHBA 5EHNA 4JEMA 4KSCA 3MA0A 1H05A 4EEZA 1SIUA 2GKSA 1VL0A 3REGA 4C03A 3BILA 4M49A 4YP7A 3RVDA 1RAGA 4ZREA 3F7NA 3WIBA 1G42A 3JQ9C 1IWPB 1M2WA 1U5AA 4GLJA 4ZEWA 4MUBA 3SQOA 4LAFA 3QWIA 2O7SA 2QXTA 3VTKA 1E1YA 3W6NA 3QELB 1YIDA 1T0BA 1F06A 3UWMA 1EFAA 1D03A 3P5BA 2I2CA 1DCKA 5E9QA 2B8TA 2W7TA 3R9XA 3I53A 4R51A 3VKWA 4NX2A 1CDZA 1JPNA 4XIJA 4YRDA 3LSYA 1DCMA 4LDNA 4D9FA 2XHZA 4YA6A 1EM8B 3IUNA 1TIBA 4QBIA 4P7BA 4D1YA 5JARA 2B1QA 2VXYA 4HH0A 4KGDA 4LTDA 3Q40A 2YJZA 4TROA 1C3OB 4QTZA 1G5FA 4QZVA 3TQTA 3RQIA 1QRDA 1EINA 4MJXA 1KDVA 1EX9A 3LUJA 4UEWA 3WWPA 2ORWA 1EX7A 3BDIA 1W49A 1ZSNA 1GGKA 4R1MA 1YS1X 2DCUA 4M1MA 1WB9A 1EE2A 4IVRA 2ZCUA 2IKSA 4DCUA 5DB4A 4MOWA 1JE0A 1NT2A 2RHJA 3ZVNA 1B43A 3DDCA 4RF2A 4FDLA 3ONNA 2CDRA 2AXQA 2W90A 4GBGA 5EZ6B 3FNQA 4FWTA 2C92A 3QF7A 3QXCA 4DR5B 1Q2UA 3NIWA 5CK4A 5DGDA 3T7JA 1CR6A 3CUYA 4O59O 4V0RA 2IV7A 1ESNA 4YIKA 1E2PA 3HEBA 4FDUA 4Q6BA 5COAA 4F3KA 2FPRA 1KIAA 3LHKA 1T8TA 2V7EA 3VH1A 4TQAA 3PJEA 3Q2OA 4N54A 3WDLA 5IYZA 3L1JA 3PUHA 1Q7CA 5LD2C 4JI0B 3TDMA 3K9LA 1CY7A 1KA9H 3I6QA 1JAZA 1QGUB 3QFSA 2D2XA 2C4MA 4KO1S 3EFOA 2O2XA 3LDAA 4CIXA 4BRWA 3CG0A 2BH9A 5DLEA 1RJWA 2X8WA 3K4QA 1NXSA 4JENA 3CTPA 4DL9A 3RBVA 3HYCA 1JWAB 4Y1RB 1JFTA 1W2GA 2FG6C 3G0HA 3SFVA 1ZW1A 2FWJA 1VHLA 3DJFA 4Y6QA 3JARA 3DBHA 3E9EA 1WHSA 4Q02A 3BMQA 1P0IA 4GHWA 2ZYVX 3ICWA 1M1UA 4PLYA 1RWMA 2K4MA 2IPAB 2ODQA 4I08A 3K2QA 1F3OA 2GK4A 5SYAA 5D5PA 1QYDA 1VYHA 3A7EA 4GPBA 3ADKA 5M34A 2HW8A 4P35A 4M9UA 1FF9A 3BBPA 3RYFB 4Q7MB 4UAJA 4YBZA 1RPZA 3HCRA 1DP4A 2VO1A 4EQ6A 1W94A 4YCAA 2OGUA 2ZJ5A 1NSTA 3N53A 4R3WA 4FFMA 4KP7A 3KAQA 2I1VB 4FDTA 3OIDA 2GZSA 3TM4A 1CZLA 4QICA 4YS6A 4JLWA 4A6XA 2ZZMA 5FBQB 4M0EA 2IKQA 2YW9A 2ECPA 2LKCA 1WHTA 5DT2A 1QBGA 1Y34E 4GLFA 4OAOA 3L9WA 2QMEA 4OI1A 2JI4A 3V8EA 4AS2A 1S7GA 3AM4A 4RPJA 4TWRA 3IE1A 4TN1A 4EA9A 1V9CA 4IIEA 1K7SN 2QZJA 3FMVA 1XN4A 5IFLA 2HCBA 2BFCB 4IUYA 1W47A 5ALXA 4CHGA 4CM7A 1Y6JA 4IINA 1QQBA 4FWBA 1SUEA 2QIOA 5GADl 3DCNA 3PPXA 2ZRBA 4R1PA 3EBLA 4L9WA 3L7NA 3E5NA 2WUDA 3T3OA 4UTNA 1YWGO 4PAOA 2AHOA 4Z99A 5AW8A 2O8EA 1IATA 5DZSA 5KOJA 2PK3A 4H6WA 2AYYA 5IDXA 2H3HA 3AYZB 3RUIA 2H59A 1WF3A 2CK3D 1Z2EA 2HJSA 1MF7A 2Q6VA 3KB8A 1F0YA 3KQMA 3VDRA 3UT5A 1QH8B 3ZCXA 3TD2A 5I7RA 2Q3LA 3QX8A 4URFA 2B9EA 2E49A 3HJFA 3AZOA 3ZX4A 3N28A 3TD9A 1T0PA 2Q50A 3MNFA 2O2CA 3HMKA 3LUGA 4G1MB 5KSOA 4QFBA 4BE4A 1CVIA 1U2EA 1GJRA 1SCKA 2BEUA 4EUNA 4DB2A 2NXEA 4C76A 2OLEA 1ACMA 4RYDA 1C7ZA 2XGMA 1KMQA 2XH8A 1JHOA 3DFIA 3JQ8B 4JH0A 4OUDB 3LY8A 5AH0A 2V9CA 4R8RA 4OQNA 1DAEA 1GPLA 2GSDA 3T38A 5IHPA 5BORA 2F8TA 4CLRB 1KZ7B 4NEQA 2R7LA 5EXDA 2QW1A 5JZOA 2HYIC 1AKYA 3NEAA 4I4TF 4TX1A 2Z58A 3RS2A 1SVLA 2ZPTX 3O2NA 5FJJA 1RHKA 5HIMA 3N7TA 1USUA 1B8VA 5J5VA 1LPMA 1OFHA 4RACA 1EFTA 1L8OA 4WADA 1GGMA 1B0ZA 2BCEA 3F74A 3GGOA 3R5TA 4GMHA 4OXYA 5CJPA 3WGNA 6GPBA 2GEDA 4B9EA 3RAPR 1F1BA 2PYZA 2OFWA 4ZMBA 3VO1A 1A9OA 1FYWA 1N5IA 3K9WA 3Q7TA 4KLNA 4YPVA 2BFEA 2EEZA 4TOIA 4INZA 4QUBA 4YRQA 1TKCA 3AC0A 1WUTA 1XDZA 2WAAA 3DHYA 2HMTA 2KS6A 3FPFA 4KUGA 5F73A 1G8HA 4FS8A 1ES9A 4I3FA 2IUTA 3JWHA 1T36A 3JYHA 4RGYA 3ENWA 4J0KA 4LMPA 1QVRA 3JQAB 2ZJ6A 4HXYA 1HYGA 3QRWA 1J4AA 1LPPA 5A9RA 5JYCA 3IOCA 1OXXK 4IDQA 3ND7A 1O54A 1UBHS 1X1QA 3D31A 3NWJA 4L57A 3T34A 3TTUA 4JJZA 3KWFA 3QUSA 1HMPA 1TL7C 3NJRA 4YRNA 1XP5A 4MJLA 1H69A 3L7LA 3DS8A 3GEEA 3CXRA 4PFJA 3JV7A 4IH4A 3RB8A 3FUUA 2AYZA 1U0RA 2WSSD 1EFKA 4JU9A 3TXYA 2R00A 2IK8A 3PGMA 3V00A 4CDRA 5B1EA 6CHYA 1JW9B 1LI4A 4ZMRA 1OH8A 3GUHA 3IJPA 3IQZA 2MMCA 5HUQA 7MHTA 1GYRA 3IJEB 3FB4A 3DP9A 1MQ9A 3NEJA 3LJKA 4M1TA 1EQ2A 1ZWKA 1VJ0A 2CL5A 4DIOA 2ZRDA 2EG5A 3FYCA 2DPYA 3JY6A 5BNTA 2HHJA 4EFDA 3HS3A 4MI9A 2YS7A 1ZN8A 5CUQA 1CRWG 2PN1A 4Q47A 4D5GA 3DF7A 2Z6QA 2OAP1 3AB3A 1IQ0A 5CYPA 1RIFA 2BWJA 4XYBA 4AKIA 1T5HX 4GG1A 2UYGA 4X3OA 4R1OA 3OY2A 3DM5A 1DX4A 4YQEA 2DUJA 4K28A 2EP7A 1J9EA 2XB2A 4UPEA 3HU3A 1QMGA 3HVIA 3RVKA 3UXEA 3QW2A 3WK6A 2X15A 1OAKA 1UFKA 2NU7B 2TECE 4GGOA 4JLMA 3EOBI 4KPUA 3OE5A 4LGMA 1GAJA 4AZ0A 3BQMB 1XTPA 2LPMA 4NJMA 3O1LA 3QPWA 2PVCA 3RK1A 2FB9A 2ISSD 1D2GA 3PI7A 1XP8A 1PEKE 2PQ6A 2VWQA 3BD6A 3GRCA 3I1FA 1JTVA 2FR8A 4FZVA 1GPWB 4WJZA 5HP4A 1F5NA 3FMGA 1I3OA 3BCHA 3C98A 4LYAA 3ON5A 4B7XA 4N5IX 4P5EA 2HFJA 3DG9A 3CZPA 1UINA 1ZNYA 2J5KA 1RQNA 1ZH8A 3EHDA 1BEUB 1TKAA 1FFGA 2NYRA 2OYCA 4M0MA 4PYJA 1TUIA 3S8YA 4POAA 2HU8A 3NDJA 3P0FA 4R9NA 2VP4A 8ABPA 3T9FA 1Z6QA 1JI0A 1DAKA 3LIIA 1FY2A 1OLXA 4RDCA 3O93A 1MEOA 4KX3A 4YRSA 5KJFA 1U0OC 1SXPA 1Z26A 4RHEA 1XHEA 1BW9A 4UE3S 4HVCA 1G8YA 2YWRA 2NUTA 4N0QA 4DA4A 1S2OA 1SU4A 3CJRA 4ZAFA 4LKRA 1XD8A 1VI6A 4HGQA 1YE5A 4IIFA 4QE3A 4CMIB 3RSCA 3GJSA 3ZY5A 4K0RA 4GH5A 1JZTA 4YCDA 1BE6A 3CXUA 3S8MA 4H6VA 4YAEA 4FIDA 4TVOA 1J1UA 3W5AA 4RXMA 3IO3A 2H1VA 4U3JB 2BAGA 3CH5A 4U2DA 5J2TA 2IHVA 4KEAA 4P83A 5EVCA 3WGTA 3EPLA 3W6OA 5H02A 2IOQA 2WV9A 4GI1A 4IHJA 9LDTA 4KDCA 3EW7A 3GYGA 3H0EA 4FMPA 2NXWA 5KOYA 1BVUA 2JGRA 3P9QA 5JS8A 3BMCA 1ESEA 1M2KA 1T1GA 4M0DA 3ID6C 1A27A 1QH1B 1B6SA 1RWBA 4U7FA 2C4NA 5HQJA 2LCIA 3R5XA 4C87A 5C7LO 3L8ZA 3WMWA 4RA6B 2B8EA 2L42A 2ZUDA 4B5LA 4ZJPA 1QE0A 1HL7A 3L49A 3PXDA 3ONVA 621PA 5J2UF 4G5RA 4M98A 5H4GA 1ZS9A 3U3MA 3B48A 2AV6A 4Z4QA 4Z53A 5L3RA 3IA7A 4X7BA 3SN6A 2YYZA 4FSHA 3RNOA 1DEKA 1NBAA 3LHFA 3QA9A 4WOJA 1XQ9A 5ANRB 4JC4A 2MSCB 4QXRA 5HZKA 3EXEA 3KQYA 4PTZA 2AMFA 3PITA 5CLFA 5IC6A 3K30A 3KSDO 2XUZA 4JB0A 2M98A 2POCA 2XDQB 4Q1AA 3QEKA 4Y2UA 5I9BA 3VHLB 2A9RA 1NVXQ 2FZ5A 3AR9A 3LY7A 3E18A 3PKZA 2PEYA 4UZFA 5BQ5A 4FPXA 1FSZA 4WJLA 1I33A 1G6KA 3LPCA 3BX1A 4BKPA 3HVUA 4OH1A 1XEXA 1JKXA 5ESDA 1UZLA 2VPZA 4CKEA 2PSFA 1Z9BA 4UVIA 3Q5DA 1T3GA 1V9SA 4QQRA 2QBYA 4N8DA 1JNYA 4CF3A 2XNCA 1M3SA 2PBFA 3F2IA 2OCLA 2J87A 2DUMA 2PGXA 1SUAA 4M1OA 4PGGA 2R7MA 1YVPA 3ILSA 3NPAA 4UATA 4QEZA 1OASA 3QU5A 2GYYA 4O4JF 3AEXA 1BMFD 4LY0A 4CG2A 4F2PA 4EMSA 2IXAA 3QEAZ 2C77A 4XCVA 4LXIA 2V3WA 1F2VA 2YC4C 3QH4A 2E4XA 4QG7A 1PT6A 4M0UA 4ARAA 4A1FA 2RHRA 3HRKA 1HQDA 3CLVA 4P7KA 4M87A 3SHVA 1LC3A 1NLZA 4GECA 4BO6A 3WKEA 5IM5A 1PJSA 2ZYUX 5JBQA 5D85A 2OV4A 1HURA 1YULA 4I9UA 4JELA 4OQEA 1ZOSA 2HEGA 3T95A 3O4HA 4Y30A 4LSWA 3WISA 3NNDA 3UWKA 1XU9A 3OZDA 4G1VA 1G8FA 4HAOA 1R3DA 4JBWA 4KG7A 4NG5A 1DQNA 4PSDA 4UEQA 5AXCA 3DEJA 3ZS9A 4HFJA 4XIIA 4HXEB 3G1TA 2F3UA 3ET5A 2L69A 3CRVA 1CQIA 1PG2A 5I9IA 3V32A 3ZIAD 4H6PA 1OXSC 2DY0A 4EPRA 1EUDA 4NZZA 2XRYA 4NBRA 2D0OB 3Q88A 4LJAA 2FZCA 3H9UA 4PLPA 3GBVA 4JLUA 3AFMA 4MVWA 2XWSA 4QM7A 3M81A 1GNVA 1T5LA 1Z68A 4C7VA 1K75A 4XH9B 1N36B 3CMCO 2Z9DA 3O4VA 1UBNA 2GEKA 1PL8A 4HI0E 3G68A 4KZKA 4B71A 1QX3A 3THYA 5EJ6A 4ZRDA 2C0PA 1R5JA 2D59A 2AOTA 2XMDA 1OV4A 1KOLA 4KBYA 2KW5A 4WJKB 2Y68A 1K5DA 4IGEA 4RKRA 4L4YA 5E0KB 1BEEA 3ZWMA 4B4VA 3QE4A 5ITZA 3HI4A 1VG0B 3A9CA 3DMRA 4WFJA 4GRAA 5GP1A 4H3KB 1UQRA 2QTTA 2LCFA 3CTMA 3Q8XB 1T2VA 2AJCA 2P69A 3B70A 3BGIA 2FMHA 1H8HD 2FNAA 2W6CX 3G0CA 1SVKA 3I0NA 4YECA 4EG1A 1R16A 4CKCB 4ZZ2A 4DUZB 4MR9B 5BPHA 1H8HA 2DQZA 4O2BB 4DCPA 2O2JA 1W36B 3C3JA 3NP7A 2UXBB 1DJOA 1P7VA 4MVCA 4ITUA 4B84A 4DHEA 4KWCA 1G2QA 1RRFA 4X1IA 4MDEA 1WZCA 1XYGA 2HJ9A 3AIOA 2I2BA 2QU8A 1Z2CA 2RGYA 1QHEA 2VK8A 4JBGA 4MQMA 4MRRA 3LGSA 4D5EA 2OLKA 4KAFA 4Q1EA 5D7BA 5DEOA 4IOJA 1OB5A 2W22A 2F1KA 2ZFUA 1R0ZA 3IS3A 3KR0A 2RE8A 3F98A 3S2YA 3GJ6A 4CG0A 3JQ7A 4OK6A 2Q0XA 2QL6A 2Z98A 3EGXB 4K3UA 4MKGA 4KKXB 4M0CA 1MJHA 4OH7A 4YJ3B 1LU9A 3N7AA 5GGXA 3GLIE 5KOIA 5CVEA 4R8KA 3B53X 3PXAA 3UAVA 1BD4A 3OEYA 3W78A 1KZGB 3IAEA 5INTA 3PUIA 1Y5RA 1R0XA 3O2JA 4NBLA 2GI4A 1J1IA 2YN4A 1T9BA 1QG6A 4XWGA 1MJNA 3WLFA 9MHTA 3NHRA 1U1GA 1SKMA 2RHOA 4UD2A 1PQUA 1PJRA 1RLOA 3A1UA 3AVQA 3TAXA 3KLOA 1E64A 3LA8A 3OM8A 2IYOA 3N0VA 4V39A 1DC7A 1NDHA 4KLCA 4MQBA 4OOEA 4BGVA 4W5QA 2ZSBA 3QVTA 4EFNA 3DC7A 5E6RA 4MIYA 3OZGA 3OVMA 5FI1B 5DM60 4G67A 3ZW9A 3L82B 5BR1A 1PJLA 1VFNA 1TO6A 2JB9A 3BZWA 4BP8A 1N77A 1JSRA 1O9GA 4WBXC 4BQNA 3B36A 1I6WA 4ZO6A 4YY3B 3WB0A 2PWPA 1NOIA 4TMFA 4YNBA 2Y2VA 5EJ2A 4LZNA 3WLSA 3LYLA 3OD1A 1F0PA 2DZDA 4UBNA 4X6UA 1DZIA 2W58A 5FOSA 1OZHA 1TC1A 4NS1A 3UYLA 3L8CA 4LC1A 4DDMA 3MTGA 2CKMA 4QPJC 3MPUA 3T94A 4WKOA 4LWZA 2YQ4A 4X45A 2IL1A 4AN4A 2BTQB 2O7VA 1V8BA 3BYZA 4ZHSA 1V4BA 4LOKA 5C32A 2JGNA 3I04M 3SKXA 5TJ9A 3WSTA 3GNLA 5HZGA 3GELA 4O4IA 5DLQC 4D3ZA 1NUTA 2ALJA 3OPYA 4N5HX 2P7HA 1GSIA 2FFBA 2QDKA 5NLLA 1H8ED 2JIZD 2XUHA 4XLTA 5EJGA 3WO1A 1G9SA 3ZEAA 4E3WA 3QVSA 4KMMA 1ORDA 4H1TA 4MWZA 5AFSA 5L3SB 1OH5A 1OLOA 3ZTTA 3I01A 4LHXA 1Z3CA 3ROKA 3G59A 2N0SA 3TTYA 5JCOA 2QB5A 3KWJA 1RACA 4M1QA 4FI3C 3MAJA 3OM9A 1O97C 3LF1A 4KUHA 3CIFA 4RDIA 3DV2A 2Q7OE 1U7DA 2H48A 4ZKDA 1EVJA 3IP6A 5A1TA 5HKKA 3CGGA 2P62A 3R6WA 5D1NA 5TMPA 3NCHA 1U99A 1MH1A 5TQ2A 4UE2A 4IDCA 3RYHA 2HMVA 3TOSA 1NE7A 3RSLA 4CXMA 2CUZA 2C9DA 1Z36A 1CQIB 1O94C 3AP3A 5I8ZA 1IN7A 3PS9A 1EUCB 2DUNA 4GUDA 4YJFA 4WKBA 1X42A 3PHBE 3NOXA 3VJRA 3MS2A 3IOMA 1Y8ZA 3D4NA 1NXPA 3TZ6A 4ZDIA 3HZOA 2QRVA 5JYDA 3QYFA 4FHZA 4CKWA 1PE0A 2YV4A 5FR1A 1VKJA 3IPYA 5ALGA 1JAHA 4YLYA 5GPBA 3V9PA 1V6AA 3SS8A 1Y6FA 2GUGA 1NXWA 2PLWA 3OIWA 1I4WA 3IA2A 1NY5A 1PNQA 2PKCA 2O5CA 2EX4A 1OYOA 2QG9A 3GEIA 4IHAA 4AY3A 3HR8A 5JROA 1VBMA 5TB5A 1L5QA 4JD5A 4YJGA 2ODEA 3IPCA 2FEXA 4D0LB 1MVNA 3DOCA 2II6A 3VYSB 3AT1A 1SOWA 3L6RA 4R1UA 1KAHA 4J7AA 1XRQA 3VNQA 1Z6TA 4CHTA 4CL3A 3K31A 1E0KA 2W71A 2O19A 4D0GA 1TVEA 3E5RA 3FTDA 1YKFA 1ULTA 4C2BA 4EJ6A 3HJNA 5BW5A 1P9OA 2IVFA 2GYVA 2A5FA 4J4BA 4QUHA 1QJ4A 4F9GA 1AGPA 2WPDA 2VPYA 2XIJA 1OU4A 3D6UA 2AT1A 4QASA 3IUJA 1Y3BE 2WD7B 3ELWA 4N39A 3NGXA 4KL8S 4C78A 4E21A 3OU7A 4YJ2B 1ZIYA 2W6OA 1BU5A 1IXZA 4GPAA 2W2PA 1XZIA 1QC5B 4JC8A 1C7IA 1OBHA 4TKUB 5F2OA 2PNJA 3GP8A 2VJPA 1N25A 4GZMA 4C05A 1XZHA 3OIFA 4BV3A 4L78A 3DZJA 2Y0EA 5CFLA 3K16A 1SAYA 2BGIA 4IQ8A 4YRPA 3TB6A 3I8OA 3NC0C 1ZCAA 3TSYA 5LYJB 4KQ1A 1KIMA 4ZEXA 3N0WA 1HSZA 1KI2A 3D3KA 4LNAA 5BV7A 2EFEB 1KHHA 1FCJA 1IRXA 1WD7A 3O8OA 4ALJA 4BWFB 3ORHA 4URWR 4R40A 5JWHA 2EC5A 4YUXA 3PQ5A 4ARIA 1EZZA 3NHMA 3H42B 1JU4A 2C57A 2O05A 1NNLA 3C6MA 5KYNA 4DNQA 4OCZA 2GCEA 1OIWA 1UCFA 1H5QA 2EF0A 3WYCA 1N7JA 4INAA 1AU9A 4CKBB 4HDQB 2Y6VA 3R09A 1AO3A 4XDZA 1RPTA 4JN6B 3ENKA 1OA0A 3QSGA 2WWIA 4FOPA 4F7WA 1RQGA 1HKUA 2JAHA 2HI0A 3PC8C 5KTKA 3GFVA 1M2VA 1Z4LA 2V5UA 2VDNB 4KQMA 1Z7GA 6Q21A 2WFZA 1CS0B 5EWLA 1I0IA 5HW0A 1EX6A 2J9FB 2JGDB 3EC2A 4EK9A 1N7HA 2OAEA 1Z62A 2JC3A 1F60A 5EP3A 3V1YA 2J4DA 5CNJA 3RWMB 4F3RA 1NG1A 3RRJA 1F12A 1HDRA 1VKHA 1YK0A 2BBWA 1VSQA 4OU4A 2X86A 1ZR2A 4W6ZA 4QVKA 3WG9A 2C3PA 2NTVA 2ZSAA 4DT1B 2PFGA 1KSFX 2Q4DA 3QU2A 5AWFC 3HBNA 3DDHA 2HZ7A 1H0RA 4TMYA 2JH8A 3ELDA 3ESQA 2BHTA 3FCEA 3O1JC 2COEA 1GVNB 3OE4A 4FS3A 4HYEA 4YAKA 3HR4A 1ZUIA 1LJUA 2C9OA 4LSZA 1EKXA 1GU1A 1XJ5A 3GRKA 3N0TA 2OXTA 4OXRA 1EXWA 1YSCA 4DIKA 5IJZA 2H7VA 2R62A 5FWDA 4KI0A 1NBWB 3GG9A 1AY0A 4YASA 3P0JA 4HGRA 3AVUA 3GNTA 3U60B 4X00A 2BGKA 1AKQA 4DXAA 1P6UA 2H2AA 3OF5A 1IVNA 1JL3A 4IDFA 4H31A 3IVCA 3V1NA 3RUEA 3Q11A 1L8XA 4RGBA 3Q0IA 1KDRA 3OE1A 1J56A 2JEZA 1AKWA 4O2AF 3RVJA 2BBTA 4HYQA 1Z12A 5IF3A 3VA7A 3D8RA 1P91A 2OFOA 3UMCA 1VHDA 4TTSA 1CEQA 3K4HA 2DCMA 1H6AA 3CVVA 1KMHB 1PDVA 1G2PA 4BNDA 1CIJA 2SKDA 4Z6KA 1PR3A 1E4EB 3OUUA 1U0EA 2ZVDA 1K6IA 4NPHA 1SY7A 5E4JA 2G6BA 5FV7A 4QHSA 3QXGA 2I03A 3QVLA 4IDAA 3VNBA 4CKEB 1P5ZB 4RJKA 4CPDA 1KSJA 3EPHA 4TZ0A 4JBNA 4WA7A 3HV0A 4MS1B 3CSSA 1JEJA 5JEEA 1EHCA 1CIPA 4IMJB 3V4OA 4CUZA 3FTEA 1FRFS 2DWCA 3ADBA 1G59A 5EWLB 1M0SA 4FK8A 3FLMA 5DV9A 1H65A 4HTFA 2IUFA 3NCTA 1DC4A 1AA6A 3D4PA 1QB7A 3I9KA 2HTEA 1SD2A 3AHJA 4W1SA 1RKBA 3HO1A 2I2DA 5GAJA 2ANCA 1EK1A 3HVJA 1YL6A 3DO5A 2P9FA 4U2CA 1E59A 4JHLA 1CETA 4NZOA 3V46A 3KOXA 4DSAA 2AE2A 1DBWA 4HWGA 1EIWA 1QFMA 4IYRA 4Z0TA 4OX9B 3L0YA 5GZ1A 3DDWA 1FTQA 1Z38A 1DXYA 2XOEA 1LA2A 1KH1A 2BM9A 4QXQA 2OZLB 4QYMA 1S8NA 3U1VA 4PZDA 3EB9A 1QGYA 1DJNA 2DHEA 3WGVA 1TO2E 4CM8A 4E13A 4GD3Q 4P3XA 3QLTA 2ICAA 5FQNA 1IAQA 4GR9A 1IBCA 1Q0RA 2YNMC 4N65A 4QC2A 2K7ZA 3UANA 1MVLA 2QEQA 1SBIA 2MMGA 1RBQA 3PYMA 5BN3B 1V37A 4LYGA 2VH1A 3F6RA 4AMYA 1HE5A 4QGHA 4CEJA 2CVHA 4G23A 4TPKA 2NPOA 4TV8B 4O4LB 4P0QB 3AI7A 2BDUA 2Y77A 3HDGA 3M2PA 2A5LA 4IDGA 3RFXA 4IDOA 2H0QA 1H1TA 1PJQA 1I4TD 2CXUA 2YW2A 2VKQA 1YUBA 5DWQA 4NR0A 1JSLA 3DUFA 3SHQA 3CVOA 3TINA 1R9JA 3GAZA 1P17A 1SU6A 2OV8A 4QHTA 4TRJA 1FDUA 4ZZ3A 5LM3A 4OTZA 5EHGA 4HP8A 4H27A 5MN6A 1NYRA 3P1JA 2ZWIA 3OFKA 1ZZEA 4ZT5A 3WNVA 3AU8A 1YB1A 3ETJA 3ZWQA 3P0EA 3W3ZB 1M7HA 3N87A 4IV5A 3UJPA 3O8CA 1OHHD 3NKLA 4GPTA 4BZXA 3AIMA 5CYFA 5JDIA 4BKOA 3GJ0A 3H5OA 4LJ6A 4Q1CA 4WT7A 1CLEA 1RWXA 1TUBA 2COUA 2JBWA 1PKXA 3GJXC 3MSXA 2VBGA 4ZC8A 2C31A 2GM9A 3GJ4A 1X7WA 2OSVA 1LSUA 3EVFA 3WGGA 4Q34A 2MSWA 3PIDA 5FWXA 2CLFB 4TQGA 1Y1QA 1LCIA 1JT2A 5FHQA 3ZDXB 2FHSA 1XZFA 2QJFA 1HLPA 3ODGA 2PWAA 2E9SA 3NBQA 4OQFA 4PRZA 2QN9A 2G7ZA 2BEWB 3SK0A 4NBWA 4N01A 4HDOB 2YV1A 1VM6A 2OCPA 5EE9A 5KNDH 1OTXA 4JLSA 3CRW1 2VP5A 3HXQA 5AK4A 4DB4A 3PE4A 3OX2A 4DCTA 1OIXA 4ER6A 5AOVA 2VAXA 3DONA 4UFNA 2E6KA 1XZJA 1DRWA 1JYEA 2JFPA 4QGFA 3SZRA 1IXKA 2KPOA 2MIIA 1SPBS 3E2PA 1UAGA 5DW3A 3VJLA 4PANA 4NCKA 2Y92A 2XAUA 5HDBB 1F7VA 1I2AA 4MO2A 3TLAA 1E1NA 1WVGA 2NO4A 2AK3A 3VX3A 2PZEA 2E89A 2J5XA 5CCDA 4R6XA 4OHPA 5DCLA 5K7SA 1F2DA 1ZUWA 4DJDC 4KXXA 1TGYA 1IUPA 4JCOA 1QU2A 4WZBA 3M4XA 1U3CA 2WNSA 4D4GA 3E81A 3FNRA 3R5JA 1BHJA 4GKVA 4MLDA 3SC4A 3SS9X 4B7CA 2R66A 4BNIA 3UM9A 3FI0A 3MJ4A 4OQZA 2BD0A 3DHEA 3SJ7A 3G0GA 1XZBA 4LNUA 2RAFA 2X7XA 3SQXA 3RIXA 3FVTA 3UYKA 1RRPA 1SRQA 4I1UA 4AYTA 4BJ5A 2BGUA 2A3NA 1M8FA 4DBZA 3LUKA 3BB1A 5JZSA 2AXPA 3QYJA 5C1DA 5K99A 4M7OA 4Q4DA 4Y2QA 5A5GA 4G0ZA 3K73O 4XE5A 4P4TA 4GX1A 4J4TA 3C8DA 2QVLA 4YDHB 4BFYA 3K8OE 5FI5A 4D82A 3D3QA 4BU1A 1O9BA 1XA4A 1L9KA 2DBZA 3OPXA 5H68A 1W88A 1Q44A 3SEFA 4A9AA 3D59A 3HXLA 5HIKA 3MAGA 2JCBA 3OTHA 4GP7A 5GONF 1IY1A 1UWLA 2CFIA 3T9BA 3PLAE 3WL3A 4L3VA 4L5CA 3UJBA 3PDWA 5FOTA 3TGLA 3L4KA 3WLKX 2JNWA 1XUOA 1XNHA 3D5TA 1EE1A 2YYAA 3O2SB 4HDCA 2M32A 3I12A 3K5IA 3RC2A 4B17A 4DIDA 1PLLA 2WSMA 1C9JA 4I55A 1S1MA 3AO0B 2P6OA 3IOYA 4RK4A 3DMPA 3TW8A 5FI3A 1JDZA 4W9MC 4P84A 1JR3A 1E77A 3FFTA 2BKLA 2SBTA 1ZA1A 1USWA 2X8AA 4Y0NA 4HUTA 3G3EA 3LP8A 5K8TA 3JZIA 1DKLA 2GAJA 2XEDA 4BGIA 2KMLA 2VXOA 5ED0A 3PUKA 2V4ZA 2JI7A 5FLXA 1Z0AA 2FCAA 3U17A 1E1DA 3BMNA 3T7TA 3Q6IA 8ADHA 4MQFA 1ZI8A 2BZGA 1VL6A 1IH8A 3AOGA 1ZGAA 4GX5A 3OCVA 4E11A 2BVNA 4JYMA 3DNPA 4B43A 1KQGA 5B6IA 1E3LA 3D6VA 2CZCA 3KUDA 2XTNA 1XLTA 2J0UA 2CEAA 1KFBB 4X62B 1VLMA 2WTEA 2YZ2A 1O97D 3VDXA 3T41A 3I1JA 4CM9A 4RZQA 3HZHA 1PJ4A 4MMZB 2X1VA 1MDFA 1FP1D 2Q07A 2Q2WA 4HRVA 4OXNA 1X1EA 3P2MA 3X1ZA 5IYZB 1AT1A 4TUYF 2O8CB 1V1MB 4RH0A 5EXSA 4IQ0A 3NBZC 3T9AA 2P75A 1LSOA 5EJ5A 1U1CA 2V7WA 4ZVLA 2VBFA 2YVLA 3FW1A 4CKYA 2I34A 4F46A 4S24A 1PP4A 1DVRA 1Z4QA 2A9FA 4HO1X 5AHRA 1NXVA 2YRXA 4CV2A 3Q7RA 4DDVA 4M83A 1R88A 5HZHA 2QTVB 2Z5FA 3PSHA 2I55A 1R1DA 5KMGA 1K3TA 2QMHA 4R8MA 1RYEA 3FPAA 2V74B 1QOZA 1NX9A 1NP7A 5E9AA 3V4FA 1P3JA 1MOSA 5CDTA 3CZ9A 4I1OA 3H6HA 1ZK0A 4C3UA 1N2GA 2QI9C 4MGKR 1S3GA 1U0TA 4ZODA 3HB0A 3GRFA 3MJVA 5KDLA 4B4DA 3RCBA 1Q17A 4TV9F 1WXXA 3M4ZA 4TWBA 1A5TA 4HH1A 3T12A 3MWFA 1LK7A 1H94A 2B69A 3PENA 3PNPA 1W36C 3V7WA 1UT8A 1TJ4A 4XIYA 2PMKA 3HA2A 2VUHB 1SNYA 1T4DA 4CLOB 4HX2A 5JQWA 1O08A 2HX1A 4JZKA 1L5WA 4TVKA 3PUXA 2GLTA 2R4TA 4F3NA 1QU3A 1NHGA 4A6DA 2OYRA 2Z1NA 5ALKA 1P1CA 3IMFA 1MZVA 4L74A 4EHJA 1LX7A 4JJEA 3P45A 2KM1A 3NFRA 3V8QA 2FN8A 5IABA 4L8GA 2I9KA 1Z16A 1Z4IA 1K7XB 1HK7A 2ZQ5A 4H08A 3AYXB 2GAFA 4OMUA 1DTSA 2NVOA 5IJAA 3RFTA 4TLEA 4N40A 2NXCA 3O74A 2TRSB 1SQ6A 4M21A 2R751 3EQ8A 3PFKA 5DH9A 2EGUA 1LVHA 4PGMA 5KQMA 2ZRLA 4FMCF 3STXA 4MV6A 1JHDA 4U7TB 3MSCA 4YFYA 4B79A 2GGSA 3D1JA 2YFQA 5CD1A 2HLHA 3FFXA 1L1FA 3BF8A 4HDRB 4KQ6A 4S1TA 4BKMA 2OQVA 2LZ0A 4EG4A 3RIGA 5FUVA 2VLBA 5DGHA 3HL4A 3HLKA 4AKEA 1L4GA 4PAQA 1I1NA 4LCEA 4I5IA 3IRVA 1ECPA 1SUDA 4R1NA 3M9LA 4DQXA 1ZN7A 2ZRIA 3H4TA 1CR0A 4XTCS 3DWGA 1A2KC 2P9CA 5JMPA 4L6IA 1XHFA 5JRDS 1C0IA 1EWRA 1YR1A 5B7GA 4EA8A 1VPDA 4WW0A 4US2R 3JYPA 1ZAKA 3JQEA 1I13A 1Z0SA 2GH1A 2ZYSA 4TYMA 5I7EA 1UQTA 3HEMA 2VDPB 3KT6A 4M7PA 3EF3A 1P6QA 2JFBA 2H4JA 1ZD2P 1Z8NA 2ZVJA 1L4UA 4IJKA 4NU0A 2AL7A 3E7WA 4PNPA 2FRXA 2GBLC 1Y8RA 3M6MD 4RY2A 5AUQA 3MWYW 1WABA 5DNYB 3OAAD 1TAUA 3SGLA 4C7BA 3HFGA 1RWQA 4CF4A 2PIAA 4RVGA 1I3MA 1J21A 5DULA 4MXDA 2PQ2A 2UYQA 4TZKA 4CMBA 1E3TA 2WILA 1FPQA 2NU6B 2Y8EA 1G21A 1EEXB 3H2YA 4AJIA 1I94B 1HX7A 1NL3A 2PGIA 4I55B 2ONYA 4F93B 5IZCC 2A9OA 3F5QA 4AN1A 3WB1A 4X97A 4QOIA 3PYLA 1HUQA 1E1QA 3INGA 2BR5A 4MRMA 2GPJA 1IPEA 3C8MA 5J43A 4RADA 4F60A 2LWIA 5CA0A 2IUSA 4M22A 3WL4A 3WYFA 1KBQA 1VSVA 3FMPB 2J4FA 4J0DA 3EVZA 4L8VA 2O1SA 4L0MA 1Z7EA 1WV0A 1G98A 2PX3A 1W48A 2YUIA 3MTQA 2ZIUB 3DFFA 4UU7A 2ROQA 3S5JA 3ZDFA 1A9ZA 2WJYA 2ZITA 3BD8A 1DIAA 4B46A 1E1QD 1SHJA 2NZWA 1TCCA 3MCWA 4JUFA 3PRYA 2OQRA 2EW2A 1I8TA 3LT4A 4OQLA 4RHCA 3DAYA 5B57C 3IV7A 2PSJA 3WADA 3N8IA 3ETLA 3NS7A 5LJIA 3D8SA 1E6CA 2N1BA 4HDSB 4E30A 4DDTA 5H9WA 3C6YA 2XOKA 4J0QA 4BB0A 2Q5QA 3EZLA 1UJCA 1PD1A 4GP6A 1TCBA 3IAM6 1GRVA 1X7YB 3QQPA 3KTOA 1OZGA 5CDUA 4KXMA 1RYBA 2JA1A 4COKA 4DUYB 2IY9A 3IBSA 2PLNA 2RC5A 3C4VA 5CFQA 1JX6A 3NJ4A 1T6ZA 2YZ7A 3AERB 1AXRA 5THXA 4GM4A 4HX9A 1OU0A 2XI4A 2XMRA 5DHTA 4NPCA 1A4UA 2G5PA 3F6CA 4DJAA 2VIIA 3ZU6A 2H00A 1EVLA 4I19A 3ORQA 5J9FA 1FS5A 3L0OA 2VNHA 1FXSA 3F6SA 1VCMA 2B4KA 3K1AB 5L4LA 1BXRA 1WULS 3JQDA 4UEJA 4CEHB 1OLUA 3R74A 3IXLA 1F9AA 1KYIA 1YQDA 3QWAA 1RQPA 5A05A 4YMHA 5C8YA 3ANLA 4OHUA 4CQJA 1Z6ZA 4NZ9A 3WK5A 1S2NA 2I8LA 2PUCA