1CYXA

Quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
158
structure length
158
Chain Sequence
KPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMHSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGICAEICGPGHSGMKFKAIATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYOA
publication title Crystal structure of the membrane-exposed domain from a respiratory quinol oxidase complex with an engineered dinuclear copper center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 41
structure length 158
sequence length 158
ec nomenclature ec 1.10.3.-:
pdb deposition date 1995-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF06481 COX_ARM COX Aromatic Rich Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1cyxA00
1NICA 1OCRB 4CSZA 1T5KA 3WI9A 2FTAA 1XB6A 4KNUA 3DKHA 2QPDB 3UAAA 2OCCB 4A2DA 2YAQA 5B7FA 3FPYA 1JXFA 4QKTA 1PNCA 2UX7A 4PAZA 1VLXA 4YSOA 2XWZA 1A3ZA 4P5RA 1SHWA 5B7EA 2WO2B 2XV2A 4QLWA 6PCYA 4G7SB 3BVDB 3X1BA 2FJSA 5PAZA 2IDFA 3EH3B 1AQ8A 1BQRA 3TBBA 2R7EB 2B08A 1PF3A 3NJNA 4ZK8A 4BWUA 1KYAA 1CYXA 2MRYA 2WSDA 1RZPA 2HLEB 1JZIA 5F7AA 4NAJA 1E65A 5PCYA 1W6WA 3S3DB 2FT8A 2VSMB 1BXUA 5LDUA 1GY2A 4HCGA 1BEXA 1BYPA 3DTUB 4F2EA 1GW0A 3NJJA 3NYKA 2GBAA 2CJ3A 2TSAA 1AS8A 1QNIA 3ABLB 4L0PB 5EHFA 2BW4A 1NIBA 4DP0X 2GC7C 3QJTB 2CUAA 3IEAA 3PXLA 1E30A 1N70A 4M3HA 1TKWA 1QLEB 3PLYA 1SJMA 3ZIYA 2I7OA 1SF5A 4A66A 1FA4A 2IDQA 2Q5BA 1HAUA 2R7EA 3GXUB 4E9RA 5E9NA 4G72B 1ZPUA 2BO0A 1N68A 1AS6A 2FQEA 1XB8A 3EHBB 3PPSA 2AFNA 2CALA 5FC9A 1NIEA 3GDCA 5TK4A 1ID2A 1KDIA 2UXGA 4YSPA 1PLBA 2HXAA 3GYRA 4UANA 4YVNA 2TSBA 3V9EA 4HCIA 2EILB 1NPJA 5I6NA 1EZLA 4GYBA 1DZ0A 1E5YA 3PAVA 4N4YB 1IC0A 1IBZA 1SHXA 1I53A 1L9PA 4YSAA 2QPEB 2GHZA 4F7KA 2GI0A 2E86A 4GXFA 1JOIA 1ILUA 2FQDA 1JERA 4M4RB 1GSKA 5B1AB 2UX6A 4W9ZA 3AG2B 4YSQA 3KW7A 1PLCA 2BZ7A 2XVBA 2EIMB 4G7RB 4AI7A 3L45A 1GS7A 2XX0A 2PPDA 1ZDQA 1JXGA 4KOCA 3FU9A 4DP2X 4HHGA 3S3BB 3NP4A 3QQXA 2DV6A 1A4BA 3CVBA 4RH4A 1L9RA 1V55B 2H3XC 1M57B 3IE9A 4DPCX 3MBWB 2HZHA 3DIVA 2IDUA 4HZ1A 3WKQA 8PAZA 1L9OA 2W88A 5I6MA 4Q89A 2PPFA 3QJVB 3OD3A 4GP4B 2NRDA 2IAAC 1NDTA 3AW5A 2PP8A 3V9CA 3OMAB 3ABGA 4KO7A 4P5SA 4AKPA 1HAWA 1ASQA 5I5IA 3QJUB 5AKRA 2XXFA 2HX8A 3FQ2A 1JXDA 3CG8A 3NJMA 3TU6A 1KBVA 1ET5A 2IWFA 2PPEA 1OCCB 1SF3A 2QT6A 1FFTB 3AY2A 1NIAA 1NWOA 5D4JA 4E9XA 1IUZA 1BQKA 1OV8A 4GY4A 6PAZA 2BWDA 1A8ZA 3TA4D 3WKPA 4JKNA 4NB7A 1JVLA 3X1NA 1J9QA 2GIMA 3WIAA 4HHWA 1J9TA 3IBOA 2IH8A 3HB3B 1A4CA 5I26A 4DP1X 2DY2A 3NSDA 3JTBA 7PCYA 1L9TA 2VW7A 2MTAA 1ASOA 2RACA 1L9QA 4FAAB 1FWXA 2H47C 1OE3A 1RKRA 2J57A 3NJKA 2X88A 1J5CA 1KBWA 2PCYA 2ZWNA 3S8GB 1F56A 2CAKA 2HX9A 3FSAA 2XYBA 1YLBB 1GS8A 3AZUA 4AX3A 3ZX1A 4KO9A 3NJIA 2BWIA 2N0MA 1RCYA 2GB2A 3C75A 4AKOA 2I85A 1GYCA 2OJ1A 4BXVA 4G7QB 3SBQA 3UABA 1NTDA 2XLLA 1QHQA 4A2EA 1AZBA 2BZCA 2XV0A 2EINB 1SDDB 3ABMB 1OE2A 1AG0A 2LLNA 3EH5B 4KNTA 3ERXA 5IY5B 2IDSA 2XX1A 4GP8B 3HEIB 1JZHA 1URIA 2Q9OA 1ET8A 2PCFA 3U25A 1HFUA 1CUOA 4HCFA 2BHFA 3NJLA 2EIJB 3FSVA 3X1FA 3PAUA 3UGEA 2YXVA 1E5ZA 1JZFA 1A4AA 3NJHA 3QJQB 1AANA 1IKOP 2HRHA 2XUWA 4YVUA 5I6PA 2IDTA 1PNDA 4G70B 4HALA 4YSEA 1JZJA 4KO5A 3PAZA 1ZV2A 1NIDA 2EIKB 2DYRB 1L9SA 4KNSA 4BDVB 4E9QA 4DP7X 1PZCA 2X87A 3PCYA 3FYEB 3T9WA 3ZDWA 2BW5A 1PLAA 2ZONA 9PCYA 2VN3A 3WNIA 1WA0X 1SDDA 5B1JA 4JHVA 2JFCA 3CVCA 1V54B 1AG6A 3NP3A 1PY0A 1ETJA 2YAOA 4GP5B 1J9SA 1MZYA 5AZUA 2AVFA 2VSKB 1ZIAA 3OQRA 1PCSA 4A2FA 1UATA 1AZNA 1BXAA 4DP6X 1GY1A 3AG4B 1B3IA 2WO3B 1TEGA 3AG1B 3ASNB 1KCWA 4JHUA 4DPBX 5I6KA 1KDJA 1AOZA 1TEFA 3BQVA 2PPAA 3IN0A 5AFAA 1WS7A 2YAEA 3FU8A 2AZAA 1W6LA 2QDVA 4UF7C 3TASA 1J9RA 4CSPA 3CDZB 1NINA 4A68A 3QJSB 1AZRA 2FWLB 5I5MA 4BDVA 2QDWA 1ET7A 4E9TA 2J55A 3JT2A 2XXGA 2Y69B 3T71A 1PMYA 4YSRA 4E9SA 1M56B 2UXTA 3FT0A 2VMJA 3FPXA 4A2HA 1GR7A 1BXVA 3QPKA 1MZZA 2IWEA 4HIPA 1WAEA 1BYOA 3NT0A 4YL4A 4E9WA 1AR1B 1KV7A 2OV0A 4DP8X 1OOWA 1ZIBA 2JKWA 2I7SA 1ADWA 3G5WA 1BAWA 1OCOB 2VW4A 4HAKA 5I5JA 4A2GA 3FU7B 1SFDA 3FYIB 1E67A 2XV3A 3CZUB 4YSSA 3NSCA 1X9UA 3H56A 2YAFA 2YQBA 2CBPA 3FQYA 3UADA 2YAPA 4G71B 4DP4X 2H5UA 4DP9X 4PCYA 4TXVB 3FS9A 3NJFA 2PP9A 3T6VA 1OF0A 3S3CB 2ZXWB 3SBRA 4DP5X 4YSUA 3CDZA 3WG7B 4UAHA 4BXSV 3MX0B 4E9YA 1W8EA 2Y1AA 3KW8A 3H4HA 1A65A 2PLTA 3D12B 4Q8BA 4E9VA 1EHKB 3N2JA 1JZEA 2DWTA 4BWTA 2BP8B 4ENZA 2HX7A 2YARA 2IWKA 1J5DA 3ASOB 2GSMB 1M9WA 4YSDA 4MFHA 1XB3A 4FA7B 4YSCA 1ILSA 1OCZB 3T6ZA 2ZOOA 1XMEB 2GC4C 2FQFA 1GS6X 2J56A 3FU7A 2AZUA 2YAMA 1IBYA 1V10A 2UXFA 3UAEA 4EF3A 4KOBA 2VM4A 1AS7A 1JZGA 1SFHA 4X4KA 1TU2A 1WS8A 3NSYA 2W8CA 1CYWA 2PPCA 3OM3B 5B1KA 2VM3A 3SBPA 1AIZA 2BP0B 1WA2X 3CVDA 2FT7A 3NJGA 1R1CA 3NSFA 1NIFA 4BK5C 3T6XA 1AAJA 3IN2A 3H4FA 1NZRA 5B1BB 4A67A 3N55A 3X1GA 2J5WA 3OMNB 2B3IA 1MDAA 2BP8A 1NWPA 4YSTA 4AZUA 5B3SB 3FSWA 1OE1A 4BWWA 4AKQA 5F7BA 2P80D 1PAZA 2UXVA 2DYSB 1AZCA 1KCBA 1JVOA 3S8FB 5D4HA 3WNJA 1WA1X 4K9JA 4F2FA 1PZBA 2PP7A 2IH9A 2JXMA 1PZAA 3UACA 5A7EA 1CURA 1MG2C 5D4IA 5B1JC 3QJRB 5TK2A 2DWSA 4W1TA 3X1EA 3TBCA 1AACA 1NPNA 5I6LA 4WKXA 3RYMA 1RZQA 3AG3B 4KO6A 1KGYE 5B7MA 2BP0A 2YAHA 4WTQA 3ZBMA 3ABKB 1DYZA 1SNRA 3T6WA 4DPAX 1AZUA 1ASPA 5I6OA 3SQRA 2FQGA 3EH4B 3X2QB 5ANHA 1BQ5A 4N8UA 1ZDSA 3OMIB 2XU9A 5I28A 1X9RA 3FQ1A 2VW6A 2A3TA 7PAZA 2FT6A 4NERA 2CCWA 1CC3A 2FNWA 1MG3C 2P80A 2AANA 3EF4A 2HRGA 2YXWA 3FSZA
chains in the Genus database with same CATH superfamily
1FZMA 5BZWB 4UMGA 4CSZA 5G5DA 1T5KA 5DJ2A 1U3NA 3WO3B 4ANWA 3TYFA 1MFDL 1MAML 1QSED 3DKHA 3HPLB 4YHLH 3VWKD 5ADPL 3OF6D 4BH7B 5DZ9A 5L2JB 3IDJB 5FFOA 4RDQF 3B9EA 1HJCA 1QSEB 2ZCLL 3SDAC 1KBGL 3VWKB 5IMMA 5TQ2L 4HKXA 4JB9H 4PRDB 5ICZA 3ZHNA 4Q14A 5AZEL 5DRNA 4DHLA 3QUKB 4MZIA 3WD5L 2YWZA 1FGNH 2DQ6A 2GBUA 1OB1A 1OAUH 3VXPA 4P05A 3C60D 3GLDA 4BWUA 5K9OA 3WTUA 1G0DA 4N3TA 1KYAA 3U7AA 2OMTA 1KV3A 2ITEA 1XEUA 3C60B 4OQTH 1S5IL 4QTIH 2MCMA 5JW4N 3QPQC 2XZQH 3WE6B 4ODHH 1X5YA 2A9NL 2NQDA 3BP6B 5IB4A 3CFKB 5EU6E 3B7SA 4GUCA 2Y7LA 4DFIA 1OHQA 1DR9A 1DFBL 1K4DA 5DHVH 1KFGA 4KMTH 3ATEA 2JKXA 4IBVA 4PP1D 5IROC 4F8QA 4QXUL 2J43A 1ZLDA 3GF8A 4ZFFA 2WLKA 1SXBA 1IFRA 1DO5A 3IEAA 4ZUVB 3UO8B 1E30A 4OM1L 5DQJB 4M3HA 3TH4T 4U7KA 3MRNB 1VGEL 4F3FA 3UGUA 4RESB 3ECWA 1WV7T 2I26N 3TM6A 5IB3A 3TEUA 4Z7VF 3MR9A 3MRRA 2QHRH 4PWGA 4WRLA 4KKRA 3WNOA 3ULUL 4MQXD 1HC1A 2Z8WC 2QTEA 4EUPA 4FHJA 4CMHB 5FYJH 1LE9B 4M7JH 2R2EA 2VDMH 5TD4A 3GTNA 4FTVD 3IPEA 1F8TH 2PXYD 1WAAF 4PJ8D 1AC0A 1QZ1A 1EDQA 2E5EA 2LVCA 2CBQA 4I2XE 4X2UA 4AGMA 4FTVB 5KVGE 5I76B 3B5HA 1I7RB 2PXYB 4PJ8B 4NZFA 1L9PA 5GGVL 2QPEB 4FKEA 1R3HA 2FVNA 3VJ6A 1ROWA 4ZSOE 5I8CB 1FO0A 5EMYA 5GGUB 1T5WB 3WL9B 2B20A 4IBWA 4ESKA 4MRCA 3O4LD 3RPBA 1O6SA 1HE8A 1H8SA 3C9NA 3L7EB 4KDTC 5DFVC 5C9KA 3NCFB 2BIQA 3HI1A 4Z23A 3MRFA 4GKNA 4QRQA 1Y07A 2CA3A 4UBDC 1PD1A 2NW3B 4LCYA 4QTHA 3T2OA 4NWUL 1MREH 3ARPA 2I69A 4L3EA 2MCG1 1X5ZA 3GS4A 4HHGA 4P2QA 2H0PA 2W9EL 4R4FH 4I3SH 3GZOA 5KG9B 2J88L 5AOMA 1OF2A 4LQFH 5D4QA 3MJ7B 5CEXA 2LU5A 2AJUL 1HXYB 2Z64C 5F8QC 4BZ1H 5K9JL 1DL7L 2C3HA 2VR9A 3N0PB 3EOAA 8PAZA 3OD3A 4AEHH 1NFDB 5FYKH 1NDTA 3IDXL 5J57B 4WKZB 4OCSH 3OMAB 5DSCA 3E9TA 4HIHA 2CWRA 1PL3A 3IMUA 4ZTPH 3PDOB 3PE9A 5AVWB 3FOMB 3R06B 4CAGA 3AGVA 1ZTXL 2E9GA 5AW3B 1AYRA 2AW2A 2VDLH 1IFHL 1AYOA 1II4E 3QQ9D 4Z7NE 1P4IL 5KSBA 2V2XA 5FA3A 1LO2L 4QTFA 4DVBB 1L5GB 4N26A 4U0RB 1BQKA 1CFNA 5LBVA 2YA2A 5I15L 2FEEI 3BEWB 3T3ME 3TA4D 1IGYA 4ACTA 5LDSA 3QCVL 4IM8A 5D7LE 3X3FH 4L8CA 5ESAA 2CDFA 1RZ7L 4X4ZA 1JWSB 2R1WB 2BVUA 2DTML 1HNYA 3IBOA 5L6YL 5T3ZH 4N8CH 4N0YH 2FO4B 1DSYA 3DRQA 3NJXA 4Q9CA 5IF0A 2HAZA 3TBSA 3AS2A 1QSFD 1JHKH 3DWTA 2EACA 1WZ1H 1WO2A 4BSJA 4OKVB 1CG9A 2ZSWA 1E6JH 1XZ0B 3QNFA 2D03H 3SYPA 1QSFB 1WDAA 2FX9L 4N1CA 4AY0A 3MKKA 3KEDA 4HW6A 4JRXD 4WQOA 4HJJH 1JNLL 1UA6H 3HI5H 2C3XA 3P02A 3RWEB 2ZWNA 3T08A 3EAKA 4DN4H 3IDIA 1MJUL 2VXVL 1FO0L 3VH8G 3RFZB 3L3KA 3AZUA 1MLBA 2CGRL 4UINL 5CJQL 1HZLA 4AMKL 4AGQA 3F6JA 5E7BA 3QYNA 4QRBA 4DT2A 3G6AB 3ELAT 2JMRA 4UILL 4AKOA 1R5WA 2F61A 4D7BA 4GFTB 5E7FA 1MHHB 4LPTA 1NUGA 1CQYA 4OIBA 4I1PA 3LCYA 4JPIB 3WXWH 1KLUB 3TC9A 5DUBB 4CUCA 4CSTA 1KGCE 5E8PB 2KQMA 1AG0A 4KNTA 5DC9B 3BESR 2XN9A 2XX1A 2EH8L 1B9KA 2YMXL 3HEIB 3RZCA 2EYRA 3F62A 5LGHH 3UJIH 4HD5A 1XCQB 1S7RA 4ODXB 2EAEA 2PO6D 5ETUA 5EIIA 3H8NA 4HLZG 2CIIB 1QW9A 3DIFA 3QT2A 4X99A 3CLEL 3FCBA 2HSIA 2PO6B 2V7NB 4LSVL 3MRMA 4M7LT 3CX2A 4J4PA 4OLXH 4GUQA 5MHSD 5B4MC 1KB9J 4NQXA 3U4BL 3LZNA 4X9HA 4UV7L 4KKCC 3I50H 1BPVA 5SWQB 2R0KH 3KZ8A 1N2RB 1F4XL 3DSNA 2Z1PA 2EIKB 4HK3J 4HMCA 4JVPA 3VNZA 2FL5B 3I2CL 3T8XA 5DJAA 1UJ3B 5DU7A 5IVZA 1IKNC 4E42B 5IUSA 5LKNA 1IEHA 1NSNH 3SDCD 1MY7A 1NA8A 2OZ4H 3WYRA 5E2WL 3E8UH 3IFPB 4P4RA 1GGYA 2NUTA 4IS6B 5TGBA 2X6MA 3EFFB 3SDCB 5FWQA 1PZUB 4RFEB 3B6SB 3WS3A 3U0TB 2YAOA 2C1PA 1ACYL 3OGCA 3IAGC 2VLRE 1BXAA 3VFPA 2RIKA 3JZ7A 1JRHH 3MI6A 1NOFA 4KAQH 5L2KE 1RUAH 3FNKA 1ZHNB 2E0PA 1TEFA 1X5JA 3FUEA 1P4UA 3DVNB 1G0YR 2WYTA 4B7LA 3KNBB 1ZSHA 2QDVA 3P3TA 5FUOL 1J9RA 5GHWL 1OP3K 4S2SA 3QJSB 2IJ0C 3OPUA 5ADOL 4X7FC 2X1XR 3B9AA 4AK1A 1QLFA 1S9VB 5I5MA 3JT2A 4LSPL 3ZU8A 4Z7VE 3ARGD 1OTUD 1QKZH 2OI9B 3O81A 3UIYA 3QDMA 4FQJH 5IQ9B 3QO0A 3MRQB 1BXVA 5F9WC 4U7MA 4CDGC 1MH5B 4PREA 4M6AA 3ARGB 4NN6B 4CKVX 4U6HB 1QR1B 2IH1B 4JFFE 2DQHH 1SDAB 5KVEL 1K8IA 1WAAE 1ZV5A 1NFAA 1NFIA 3GINA 4YK4B 1Q0XL 2VJ8A 4DPRA 4JZOA 5GJTH 1FL6A 3N50A 3ARDA 3E3QC 4HAKA 2WBJC 1N0LB 2H2PC 5A3ID 2MCAA 3FYIB 3D3VA 1T3FB 1R19A 3LB6D 2R0WL 3M1BA 4RRPA 3FT4B 3ASWA 4M8QA 5TDPA 1UUSA 3ENEA 1UKQA 5KW9H 2FATH 2R1YB 3NEOA 4B9FA 4KH2A 1DE4B 4WUUE 2X4OA 2C26A 5HDQH 2XPZA 1MCDA 4JO4L 4NENA 3GLZA 4UT7H 4JKKA 1BD2D 3LHPH 3QFGA 4BXSV 1W8EA 4UU9A 1D5ZA 1TQCC 1QYGL 1BD2B 1U8OA 5EF1A 3FRUB 3KWVA 2Z31C 1QHOA 4ZW7A 1T83C 4BWTA 4NQSA 2H3NB 4AIEA 3ILQD 4OFPA 5H2BA 2FNBA 1IBGL 5AD0B 1M9WA 3G5VB 1HWWA 3VXMA 1AQKH 1R3KB 4BJLA 3QEHA 1CU4H 4OF3A 5SWZA 4OB5L 5HDOA 3L3DA 5KYUB 1K3ZA 5CU5A 2PTTA 3GBML 3K6NA 1ETB1 2RFXB 1Q9WB 1X6LA 2Q3ZA 2R29A 3OPZH 3SKNA 3UH8A 4AVIA 3IDGA 5I0DA 2ALAA 4JR9H 2ENYA 4XO8A 2F6AA 2XQBH 5E6ZA 5MERB 3FB5A 5FGSA 1ZWIA 4L1HA 2WIMA 3QNYA 4H25B 4XNBA 4YFLI 4GI8A 2XCMC 4ELMB 4F5CA 3SOBL 4OFYD 1RXLA 3LKQB 4XAKE 3MX0A 5FUZL 4KKAD 3V79C 5C6TH 1RULH 2MJWA 4L3FA 2QJDA 1T22A 4LLWB 2R56H 4CC1A 1NWPA 3VO0A 3T1FA 4AKQA 1A7OH 4WF7A 3KGUA 1PAZA 4ODUB 3BSHA 1URLA 3BW9A 1BIIB 3IXTB 5M94B 1OGAA 4V11A 4P9ML 5CZKA 5IJDC 2PP7A 5FKAA 2IH9A 1IBDA 1FPTH 4GG8A 1MI5D 2F68X 1IE4A 1TSRA 2XA8H 2K1MA 3V0FA 3QJRB 4N24A 4G1EA 4Z7IA 2FSEB 3OXRA 3ZT7A 3D4YA 3MJ6A 1HH9B 1KJ2A 2C7UB 3FONA 1E8WA 4K71C 2C9UA 1KGYE 2WV3A 1IEAA 3MCLL 4GAGH 1LK2B 3U9UA 4L8BA 1PG7X 2NLJB 3E9UA 5E0FA 2ITFA 2X6VA 1OPGL 4XBMA 1CE6A 1KG0A 1NGPL 1V05A 2CO6A 4YDVA 4BIKA 3JVGA 3Q5YA 2VERA 2APTA 3HS9A 1U8QA 5TE4L 4FNQA 4FI8A 5M95B 2CXGA 3L3JB 3A4DA 3LIZA 2P5ED 2DB8A 2WYIA 3VMNA 2CU9A 4OCLC 3LH9A 2HWZL 2XT1B 1P7QA 3A4FA 3IMWA 4LVOB 4L4VA 3ZDZB 1BEYL 1PZ5B 1TVHA 4QRFA 1XVSA 2P5EB 4GLRH 4PJ7A 1QWNA 3S5LA 1CT8A 4YFDB 2CHDA 3TJHD 4YQXL 1CXHA 2W95A 4DQOL 3EGDB 3PWJB 3V0IA 5FOJA 4MBOA 3HRPA 2IOOA 5IMKB 2DBLH 2MHAB 3L1FA 1RHFA 3GWJA 4KNUA 2VDQH 2WUCH 3OKKB 5HGBB 3PJSA 2ERJC 4TNVF 2ATAA 3G5ZB 3AXLA 2NY7H 3KJ6H 1JXFA 1YNKL 4DGIL 2HA1A 1YYML 5D5MF 5C6WH 3H6JA 5DJCA 1YECH 4WHTA 3BAEL 1GJUA 5CILH 5AVTB 1YQVH 2CZNA 1KPVA 2ZOKA 3MGTA 4A7UA 5JA9A 2E9IA 3ZTNH 2Y23A 3FH5A 2G60H 4XH2B 2IGTA 1COBA 1JPGA 1RIHL 1SEQL 2WLNA 3TCTA 5CD5D 3U4EA 3A5VA 3K1KC 3FUNA 1GVIA 2ADFL 2WSDA 2NMSA 1JZIA 4N8VB 5DK0B 4FQHA 1WJ3A 3V5DA 2EYTB 3TS8A 3MUJA 5BZWA 2EO7A 3VXRE 5EEUA 4TNGA 4F92B 3RNQB 4JVUA 3BH4A 3B9KC 1QRKA 3DV6B 4HPOH 4O4YL 4BH7A 4XOBA 8CGTA 3LKSB 3IDJA 4XRCB 1I3GL 2GC7C 1QSEA 3EBAA 3HB3C 1ANUA 3VWKA 2NY5L 3OF6A 1FF5A 1L3NA 4PRDA 5K1JA 3RZCC 2YRBA 5F1KC 3V0DA 1C8QA 3QUKA 3MGOB 1UWGL 1QFUH 1E50A 1MNUL 4J27A 3PWVB 5AL0A 3K4AA 1OD7A 2F19H 5TFSL 3UTOA 4EZJA 3EHBD 2B5IB 1IIIA 3TOPA 3W5MA 4J4PC 1E4KA 4L1DA 3EHBB 5F7YC 2DJUA 1M2OA 3C60A 4FQ1H 2GJPA 2H3KA 2UWEB 2TSBA 3WE6A 3UCQA 3BP6A 4OCWL 3CFKA 5D1QC 3ZKMC 4FLQA 2ZPKH 5KS9B 2GJZB 1NCCH 3VD3A 3O6FC 1BP3B 2ZCZA 3Q8FA 3BC9A 2BVYA 3NG5A 5EBWB 4IDLA 2EUVA 4V33A 1MW2A 2E3VA 1DTUA 5CO1A 4ZTOL 4K3HA 1FNLA 4OFQA 2CR6A 1U8IB 4ZUVA 1TFHA 1XR8B 4JFVA 5DQJA 3C12A 1C12B 2IPKB 3MRNA 3UPAA 1LWJA 2O5YH 4JO5A 2X4RB 5H37A 4TQ8A 5ERWB 1KFAH 3BVXA 1KC5H 1ZA6B 3GLAA 5EO9B 1U3JA 1NDMB 4KVNL 5DQ9B 3ZQWA 5DHYB 3R7RA 1OAZL 3MAWA 1QBMH 1KCSL 1IKFH 3EJCA 4ODSH 5ES4B 5E1AB 3NP4A 1LE9A 1G9ML 2P46B 4LEXL 3ZW3A 4KVCH 2I9LB 3HI6H 5HI4C 3EYOB 1WTGT 2I9TB 4FTVA 2XWBB 1I7RA 2HZHA 2PXYA 1VCAA 4PJ8A 2FRGP 1ZLSL 4QXTB 3PJLA 3L48A 1JFHA 1BAFH 5I8CA 4KO7A 2UZXB 3MLUH 1CIUA 4GPVA 5I5IA 5GGUA 1IM3D 1T5WA 2GCYB 4HKZB 3WL9A 3C8HA 1BPLB 4YBQD 4WFGE 3JWDC 4YHYB 1MCLA 3JWDH 3N91A 4Q2ZB 4NCC1 1IM3B 3L7EA 2WXFA 1NCWH 1CMOA 1NAKH 3BUTA 1C08B 3GXIA 5CEZL 4IJTA 4NKOA 3O4LA 2YC1B 1D7DA 2FX7L 2NW3A 1IUZA 1OV8A 4J3OD 1Z2KA 5KG9A 1KLGA 5DFAA 1AE6L 3L2LA 3MJ7A 3V0VB 3ZDXB 1WPCA 1I3RB 3MLYL 3TV3H 3G6DH 2A77H 1HXYA 2IWGA 5D7KD 2R27A 5I1GL 3PPEA 3OLGA 4U1NB 1CL7H 1JE6A 3NSDA 3N0AA 1OD9A 3RUGB 1NCDH 4DKDC 2FZ3B 2RACA 4K55A 1NFDA 4KZCA 1H8LA 5SWSE 1GXEA 3PDOA 2C9VA 1WF5A 4Z7UF 3FOMA 3R06A 5E1IA 1FH5H 2A99A 4HULB 5K9QG 4NC2B 5HDBF 1J5CA 2JJTA 1MELA 3BXNB 4F7CB 2CAKA 2X41A 1C7SA 4WI0B 4J2XA 1YVLA 1G9NC 2B9BA 2X0WA 3FF7A 3P73B 4XWGH 4CC4C 2HT2C 5DD6B 4DVBA 1P9MC 1L5GA 1O6VA 1RUMH 2IFFH 3O8XD 2XVLA 1RCYA 2AJYL 2VUOA 4LB8A 4AYID 3QUGA 2Y6SD 2O5NA 4LPVA 4ODTH 2VLKE 3ETTA 3BEWA 4WI8A 5HI5C 4TVPH 4G7QB 3N1MC 4YHKH 3WHE1 2LTQC 2DKMA 3MNDA 3UABA 1ZGLB 4XO5A 2ICWB 3MV9E 4FNLL 4R90L 3VTMA 1AO7D 4MD0B 1UOKA 4FULA 2FO4A 4M8VA 3TO4D 1AO7B 1JZHA 3C2AH 4FJ6A 4WGVB 4GSQA 2R4RL 4RRPM 2ZXBA 4OKVA 2X3BA 1XZ0A 3Q5TA 3TO4B 3W0WD 1S8DA 1QSFA 3OJVC 3SDYH 3X1FA 3V0GA 3RWEA 1JZFA 1A4AA 3W0WB 1XO8A 2WAQA 4MA7L 2Q20A 4FA6A 1L0QA 3GKZA 5I6PA 4JRXA 3RFZA 3FU6A 5FAAA 1BHGA 5IG7B 4Y1TA 3VG9B 2BP3A 2P48B 5D5ME 4XHJD 1JDAA 3G6AA 5DD5H 4LDLB 1MJJB 1WWWX 1JJUA 1MHHA 1QFWI 5AZ2H 2V5TA 1T66C 1I75A 2MQ0A 4JPIA 4AGPA 1KLUA 5EZOL 1ZA3B 5DUBA 5EU5A 1DLFL 3DC0A 4YMPA 1GL4B 5E8PA 4PJIB 4I8DA 5EN2B 3TBWB 5E2JA 2CO1A 1UB6B 5AZUA 1E3FA 1MZYA 1XCQA 4ODXA 2K8QA 5DJDA 3OQRA 5F96H 2KZWA 2QHLA 4M1DH 5HYQB 2HT3C 4TRPH 5SX5H 3STZB 4JRWA 2ZUVA 4WEBL 5AG8A 4XO9A 2CIIA 3P1VA 2PO6A 1SYSB 2V7NA 3LNGA 5E4EC 3VB9A 1MF2L 5I0XA 4XP5H 2B2XH 1BREA 3K2UL 2GUOB 3OSKA 4BKTC 1QI5A 3VD5A 2Z4TA 4MA8L 5K33A 4IRJD 2D0GA 5SWQA 1N2RA 2VC2H 4ECNA 1JUFB 3RB7A 3N43B 1NMCC 3NH7H 4KX9A 3QUYC 3QJXA 3LRKA 4IRJB 5CGYD 3FN0L 1UJ3A 4E42A 4OLUH 4QT5B 4QXVA 5DFTA 2XHNA 3ZL2A 3ZSTA 4DETA 2X9WA 1FFOB 4IS6A 3SPHA 1DQDH 3EFFA 1P4LB 2DQIL 3C8KA 3SDCA 2DM2A 4HMEA 4KPHH 4RFEA 3B6SA 2ZWKA 3KYNB 3U0TA 4YOKA 2VTFA 5AW2B 3CBRA 3C8DA 1JIBA 4P04A 5FO2A 4PRID 4PCSA 1RAMA 2PETA 3N85H 1ZHNA 3M6DA 4WGKA 4PRIB 1XGYH 2WWMC 1TO5A 4FQCH 4YC2B 5BQDA 3DVNA 4Y5XB 5IBTL 3KJ4B 5I2IB 1GC1C 3EJPA 3KNBA 4LP8A 5CD3B 2CG9X 1DCLA 1OF0A 3BCFA 4PV8B 3ULVC 3ULVH 2AV1A 2EEAA 3IKCB 3X12B 1S9VA 3TT1L 1VIWA 3V4UH 2BMKB 4G42B 5IQMA 3TEWA 5C8JB 1XBRA 4R7NB 5IQ9A 3AUWB 5K93A 5T1KD 2YARA 1MH5A 3ARGA 2EH7H 4UTBH 3TT3L 4U6HA 5ACLA 2IH1A 3BUBA 3VWKC 1HTYA 4D8OA 1QR1A 3US0A 5T1KB 5H8DA 2C9PA 4Z95H 1FBIL 2EXSA 4N2NA 4AM0Q 3BOVA 4ZFOB 1U33A 4KROD 4NQDE 2J56A 4JY5H 2XWTB 4XNUL 2AJZB 1T3FA 4HBCL 4EF3A 4F58L 3PP3K 5GSRA 4KROB 3FT4A 1UJTA 1JZGA 5JW3H 3HTLX 1E4KC 4JFED 1E4XH 2R1YA 3Q7JA 4HK0B 4NC1C 3RIAF 2YIHA 1DE4A 3C60C 1OSZB 3KVPA 3QEGL 2Q2EB 1LP9F 4JEGB 3HZ3A 4MD5B 4JFEB 4OJFH 4K94L 4WFFE 3T6XA 3QDJD 1BD2A 4FNPA 4OV5A 3FRUA 3OMNB 4XVOA 5ISZE 3ETBJ 3CIAA 2H3NA 4HEPA 3QDJB 4MKTA 4NKIL 4BWWA 3G5VA 5JIKA 4PP1C 5EUOF 5F9JB 1R3KA 4FHBD 2HVKB 4JG1L 1I1CA 5B3NA 4K9JA 3WY4A 5KYUA 1EH9A 2V3FA 3V8OA 5CCJA 2CBTA 2RFXA 5I0WA 1Q9WA 1QFHA 1MCNA 2Y6TE 5I6XC 4BCYA 4TQIA 5C07D 1HJBC 4B9ZA 3TCXA 1SLWA 3VFPB 5I8EB 5B1JC 4XPFH 4WFHD 5TK2A 1LDSA 5IQOA 2FSDA 3DOIA 5GSVB 2J1YA 3X1EA 5MERA 1MCHA 1PBYA 1NBZB 5C07B 3LKPA 4YDKL 5BRZD 1DSWA 3L1GA 4H25A 4XP6H 4Z7UE 1RZQA 1OSYA 1F3JB 5T5FH 4ELMA 1H9VA 5HDBE 2V0AA 3LKQA 5BRZB 3OAUH 2Y1ZA 4OZFG 1T20B 3CSFA 5HYJD 2XN0A 4F7TB 4OFYA 4S1RH 3CXDL 5DLML 1IILE 4B9IA 3EJJX 4P5KB 4L0YA 2FIKB 2IIJA 2AQ2A 4Q6KA 3SD5A 5HYJB 3VE0B 3O6KH 1HCZA 1X9RA 2YPVL 5IEHB 5IJKA 1FORL 4ODUA 2BM3A 1IB5A 4BFRA 4HIQA 1BIIA 4GMSL 1YEGL 3IXTA 2D7TL 2J8OA 4KK9D 1CFVH 3GXFA 2C9XA 5DMYA 4UNIA 4BQ6A 1A22B 4P59H 4G7VL 3U79A 3BVVA 4JPVL 4B9YA 4F8OA 5AW4B 2LU3A 3EYVB 1UH2A 4PS8A 5JHBA 4M62L 1S7VB 2FSEA 1MI5A 1PDKB 1HH9A 4PP2A 1RUPL 1J18A 1FHNA 4H1LB 2QQQA 2VAAB 2E7CA 4Z6AT 1HE7A 1Z5HA 1LK2A 1XBDA 4NJ9H 3L2MA 1KEGH 4FN0A 2NLJA 3RA7L 1PG7H 3FOLB 2X44D 3F05A 1X7SA 2CLZB 4P5RA 1SHWA 6PCYA 2W0FB 4C56D 2WQ8A 3Q1SL 2RGSA 3WSQL 4V1DD 1AI1L 3L3JA 4C56B 4QR7A 3L5IA 4V1DB 2MTPA 1Z0NA 3N1GC 4XI5C 1PZ5A 2JJTC 4ZK8A 1U8JB 4IOSD 2P44B 2P5EA 1T1XB 4M1GH 4YPGB 3INUH 2B1AH 3B83A 2QL1A 4BUGA 3HNVH 2WXOA 1PG7W 2XACC 4ZPVB 3QQ9C 1SLVA 4R5XA 5I1EH 4Y4KC 5I23A 4U0RC 1CXEA 3EGDA 3PWJA 1NGWB 2FBOJ 3K6DA 1LGVA 5IMKA 3JYCA 3UTSD 2MHAA 2P28B 3OAZK 3OKKA 3T0ED 3UTSB 4H8QA 5IFAL 3G5ZA 3WOVA 2J73A 3HG2A 1M05B 1A21A 2R4SL 2CUAA 3T0EB 5EZPA 5FR3A 1I7UB 1UWEL 4QKXB 5JIPA 3PLYA 2YZ1A 35C8H 1H3VA 1WBZB 2DI9A 2WKOA 3AT0A 4FFWC 4HJ0C 4KZEL 4YXKH 4QRPD 4Q0XH 3HKZA 4OFDA 4XH2A 1T2QH 4PTTB 2WXQA 2CHZA 4QRPB 3B34A 2LLLA 5GISL 4P9HC 4P9HH 2CALA 1FNGB 3RFZC 4L0ZA 1KCKA 3TNNB 5DK0A 2O1AA 2EYTA 3DROB 3IFNL 3IWVA 4TPRH 4WCYL 2WANA 2QKSA 5DCCA 3D0VB 3TZVC 5I6NA 3MRPB 1E3XA 3HCVB 4ZUSB 2QGBA 2H0FA 3SGKA 4JHZA 4WDIB 43C9B 4R2GD 2D7MA 3D30A 3HE6D 1AD9B 3SKUD 3DV6A 5KYYB 4PWEA 4PJGB 4J3XA 1MJ7L 3LKSA 4XRCA 3FT9A 2FWOB 4UNTA 4R2GB 4G8GD 3HE6B 2JELL 3F65A 1TJIH 2DQTL 4JS7A 3FO2B 5BZXA 3MGOA 5F6IB 4G8GB 2R2BB 2EEFA 4JB9L 4KJPD 3PWVA 4QHPA 3ZYIA 2GSIB 1B4LA 3AQYA 2XN1A 3KLSA 4OBSA 1TEYA 2PO6C 2JJUA 2R0LL 3MJ8A 1OP4A 12E8L 1OAUL 1A4BA 1OAKH 2PYEE 4U6VH 4QXGH 2UWEA 5JPMC 4FG2A 2F53D 3BPCB 4UAOB 4OQTL 1WZMA 3HZKB 2VGLM 5KS9A 5D6CB 2J6WA 2GJZA 1MAKA 5DDHB 2F53B 2WNXA 3RX5A 2ESVE 1UJ3C 4GP4B 5EBWA 3VGEA 4FA8A 3GIVB 1BG1A 2WVSA 4KMTL 3V9CA 3OHMB 1HAWA 3EJUA 3TBVB 1I3UA 1S7TA 4D9RE 4LLYB 5JA8B 4OZGB 1U8IA 2XXFA 1XR8A 1DO6A 2OP4H 1JXDA 3SDCC 3LEYH 1C12A 1PEZA 2DMGA 2J4WL 4TLKA 2CD0A 2X4RA 5ERWA 1KJMB 1LP9E 1ZA6A 2H2SD 5SX4H 4GO6B 5EO9A 1BZEA 1NDMA 3QH3B 1H8OA 5DQ9A 1S7UB 3AY4A 3IAPA 5DHYA 5BUAA 1JTPA 2F18A 4JFYB 2MOQA 3FKUS 3DETD 3K4ZA 2XJKA 3GSRB 1BM3L 4NB7A 3KG5A 2I9LA 4ZMPA 3DA0A 1IE5A 2VDML 1RSYA 1RFDH 1VEMA 3EYOA 2I9TA 5EUOE 3OKMB 2XWBA 4Y2DC 2Z1KA 2KZBA 4E0RB 2YUVA 3W38A 5HDRA 2H26A 4QXTA 2WXRA 4LCUB 2NYYC 1AR2A 2Z7YA 2CHWA 2YKKA 3B2VL 4JM2C 3PL6C 4HSQA 4WK2B 2UZXA 2OI9C 1B0IA 1PFOA 2GCYA 4HKZA 5D8JH 3TF4A 3ARGC 4NN6C 2XPYA 2OX5B 2JQAA 3K2KA 4XMUA 3IU3B 1XGUB 4Q2ZA 1IM3A 1ZKAA 3GZKA 4K3EL 5CZRA 4YK4C 1W72H 2BSDA 4GW4B 4PLOB 2YC1A 3MV01 3V4VB 4YHPB 2NY2C 3A6BL 5F7KC 5A1AA 1IZKA 1WGOA 5IJVB 5C3IA 3NGBB 4G5AA 2ZUWA 3HPJB 5IM7B 3MCG1 2AJVH 1DUYB 5A3IC 1MREL 3PGCB 1U21A 4I3SL 4Y9EA 2COVD 3RL1B 4AIZB 3H54A 4AT6B 3V0VA 2SODB 1QEWB 5FO7A 1I3RA 1E42A 3Q9PA 1HYRC 2VKXA 4F20A 4LQFL 1JGLL 1AKJD 1Y1DA 2WVTA 4U1NA 1Z9SB 4QHNB 1RZ8B 5F9AC 4Q4EA 3HVNA 5E5RB 3RUGA 5IB2B 1CFTB 2FZ3A 4KFMA 5AW5B 4ZD3H 1AKJB 2Q9OA 1TQBB 3MFFB 3UG5A 3L3HB 2OZNA 3DX7B 2WB1A 4XPTH 2ORBL 3U25A 2BWQA 2HTLD 3KYAA 3EOYG 1BFVH 2EIJB 3HAEH 4BK5A 1BW8A 4L9DA 4WI9A 4LOEA 5I19L 4U4IA 3DOSB 3MACH 5JQHC 2AQ1A 3BXNA 4F7CA 3RGVD 2VDLL 3CZGA 1SJVA 1L0YA 3N40F 4WI0A 3P73A 3FT2B 5K69A 3ILPA 4M93C 4Q9QL 1CDUA 5DD6A 3BIAX 3GPSA 3NZSA 2WNKA 4I48B 3RGVB 4CA4A 2M1KA 4H8HA 1IV8A 3ZE0B 2Y5EA 3GSUA 3O8XA 4XCEB 2DLHA 4JQXA 1PZCA 4YL9A 1ZGLA 3PCYA 5F7MC 2BW5A 2ICWA 4GQZA 3EH1A 1WVZA 2JE8A 2XKUA 3X3FL 1PU0A 2NXZD 5DS8B 4L29B 1S9XB 3GHPA 1WSST 3O0LA 3R4RA 2E27L 1AO7A 4GP5B 4N8CL 4OGXL 3LVTA 2ZX7A 2Z8VC 2NXZB 3JWOC 3JWOH 1EJ6A 4KKAC 1QX1A 1JHKL 4MQ7B 2IPUK 3TO4A 2D3VA 1WZ1L 4LCWE 4ZZKA 3EYUL 4ONFH 4OCRH 3S5YA 1GGTA 4IOFD 5E08L 5IJKC 2MQCA 1L6XA 3W0WA 4QY8B 4JFSA 3SE3A 3UTTE 3PWUB 1UA6L 3HI5L 3VMPA 2EE0A 3B7YA 4DN4L 3M7OA 3DURA 5IG7A 1J8KA 3AC0A 3IWUA 4NHCH 3VXQB 1KXQE 3UBXG 1MJJA 1MPAH 2DQUL 5HI3D 1AJ7H 5J1SC 2Y7NA 1ZA3A 3D2TA 1ES0B 5C7XH 1X44A 4EE2A 4PJIA 3WXWL 5EN2A 3TBWA 4RBPH 5DS2A 5DR5L 1KTJA 2GIYA 3GHBL 2QGCA 4MD4B 3G5WA 2I7SA 1BAWA 2WLLB 1WH0A 5HYQA 3LAFA 5LGHL 3STZA 1DQIA 4A2GA 3QWNA 1SFDA 5JXED 1QATA 4IBQA 3MQIA 3DJSA 1SYSA 4LVOC 2GUOA 4G71B 2RA1A 2Z3FA 4YDZA 1TU2B 4OLXL 5CLTA 2QGEA 5D7EA 2EP6A 3T6VA 1BZOA 4N2MA 4KHXL 1R0AH 2VLLB 5I71B 4I3RL 3PDGA 2R0KL 4IRJA 5DRZB 1M3JA 2X89D 4HGWB 4QT5A 4F37K 1Y0LB 1DBJL 1XDTT 1USQA 3CVIH 4HIXH 4HUMB 1FFOA 2MPAH 4DKTA 4JGUA 1P4LA 1QBLH 4OGAC 4YSDA 3E8UL 3KYNA 1XB3A 4FA7B 5C6PB 1JPFB 1G7PB 1ITBB 4NKMB 4G8IB 1Q8MA 2VL4A 1O5PA 1AFVH 1SQ2N 1KT2B 4G6JL 2KHAA 5DVPA 5E2UH 1JRHL 3WUWG 2FGZA 1D5BB 4PRIA 4X9FA 4KAQL 4Y5XA 4P8QA 4NP4L 5I2IA 1VEOA 2YPKB 2PPCA 3MXWH 4PV8A 3BAIA 3QJHB 2IDCA 4ZDHA 3L9EA 4BH8A 4QXWA 3IKCA 3X12A 1N7ML 1ORQB 3B3IB 1O9VA 5F3HB 3SGKC 4XCYB 3V0HA 2E4TA 2XXCB 2BMKA 4G42A 5DEZA 4KZ0A 1DSFL 1MDAA 5C8JA 1SOXA 4R7NA 4PMFA 2AK1L 1QKZL 4FQJL 4NM4L 4QRRD 4AV5A 5T1KA 1KCBA 4ZFOA 4R4BB 2DQHL 2EE3A 2FLMA 2YSSA 3FQUB 4JFDD 4CN1A 4EIUA 4QRRB 5M7QA 2XWTA 2AJZA 4YE4H 4ADGA 4JFDB 4X6BB 5L9DH 2ZXCA 3D50A 4XNZB 1MG2C 4K8RD 2BK8A 1FGVL 2XWJB 2DWSA 4W1TA 3QJOA 3OKNB 1ZVYA 3EHBC 4XN4A 1WWBX 4HK0A 1TMCB 3ZE1B 3L4WA 1OSZA 3UP6A 3OHXC 3T0VA 5KW9L 4MD5A 2D2OA 2G0LA 3IETB 4BFOA 3GSWB 4JDTL 4JFEA 4L8SB 5HDQL 4EN2A 4DPAX 4UT7L 2ZOUA 4O58H 2YD9A 3LHPL 1Z9MA 3GEWB 3SQRA 1NEPA 2DF3A 2AXHA 1GYUA 2ZKHH 3FCGA 4FL4B 3BZDA 3QDJA 5EWIH 4EI0A 2WINB 1QEXA 5C08D 3V6FB 3W39B 1QO3B 4PU2A 5F9JA 3WUZA 4NERA 2CCWA 2HVKA 5C08B 2H32B 1AQKL 1FZOB 3HC2A 4PFEA 4ILDA 3DSFL 1CU4L 3PGFH 1A6ZB 4XXWC 4XXDB 1WISA 5KVGH 2CRIA 5L0QB 1A6WH 1PYWB 1F86A 1JV2B 1M4KA 1DQKA 1OCRB 3B7TA 3MOAH 4I13B 5HDLA 1WWAX 5DF0A 5I8EA 2EQDA 4B5ZA 4J28A 2Z7WA 5GSVA 3UIZA 5C07A 1NBZA 5G4NA 1NGXB 1F0LA 4WFEE 3NK3A 1F3JA 3Q8EA 3BRFA 4PD4J 5BRZA 4F7MB 2XQYK 1KEMH 5CJOL 2XY2A 1T20A 4F7TA 3PY9A 1TKWB 3TXAA 4P5KA 4LLQA 4G7SB 4Y16D 1A9EB 1RULL 2FIKA 5HYJA 3VE0A 3UGXA 4JAMB 3EH3B 3GJEB 3WIIH 2Y3AA 3TBBA 2J5LB 2R56L 5DWUH 2V5SA 5IEHA 2Z7UA 3OX8B 4Y16B 2JIXD 3X14A 2YFNA 4YHYC 2QFPA 4PRHE 2VKWA 3OJDA 2ICCA 2JIXB 1RK0B 4NXKA 3P3YA 2MRYA 3TGXA 4HEME 5F7AA 4Q56A 2IANE 5DHXB 3VQLA 2VSMB 1BXUA 4N90E 2GPZA 2CPCA 3EYVA 1TZGL 5K1VA 3V8CA 2NX5D 4HCGA 4ZFOL 1S7VA 3Q2VA 1PDKA 1MCKA 3KBHE 1WFOA 3TEYA 2NX5B 2QZ5A 2Q76B 2CJ3A 2TSAA 1H3XA 2VAAA 3MZGB 4H1LA 4L5FE 3BUQA 4PJBF 3WEOA 5TF1H 3TVMC 1EJOH 4GAGL 1PS3A 3PGDA 4HWZB 5IWLA 5BV7C 2CLZA 5BV7H 2FYYB 5EH1A 1QLEB 2W0FA 4X5PA 2A0LD 3U46A 3NPSB 2C9SA 3BN9C 2AK4D 4XVUC 3RTQD 1MNNA 3UYPB 1FJ1B 1GZHC 5FUCE 4C56A 4XCCH 5KYWB 1SM3H 4V1DA 3SGJA 2AK4B 3RTQB 2O26U 1U8JA 1IRAY 3L5WB 1T1XA 4YPGA 5AW9B 5LBSA 3WIHA 1KOAA 4WEEA 3PPSA 5DO8A 3V95A 4ZPVA 1VPOH 4N2GA 1M7UA 1AGEB 4IOSA 4NFBA 3L4XA 5GGTA 4JMXA 3UZEC 3LS5H 4RGMB 4MXVF 3O3UN 1EFQA 2GYSA 4ZMZA 2XQ0A 3WDHA 1NGWA 3OBAA 5B8CB 2PNDA 2OYKA 2EYSB 3WFEH 3SGEI 1SXZA 5E6RB 3UTSA 4ZO7A 2PTVA 3L81A 2VDQL 2OM5A 4LGPB 1M05A 1JYXA 5J06A 4C59B 3DYMA 4X4YB 3T0EA 5J0BA 3KJ6L 1I7UA 4X6DF 1LDPH 2I5YH 3EYFB 2BZ7A 4HD9A 4HXAH 4JLRB 1WBZA 1YECL 1FHGA 3JWNG 1SUHA 2E9WA 5CILL 1YQVL 4OIAA 1H6EA 3S35H 4EKJA 4PTTA 3ZTNL 4KJWC 1INEL 4LNVA 4U6TA 5K5YA 4OI8A 1T0MB 2G60L 2WTRB 4N0CC 4QRPA 5J3HC 5D2NB 3SE3C 2GJRA 2E9JA 2CRMA 3CHXA 2OMVB 3VW3H 1GGIH 1FC2D 1FNGA 4KTDH 4PYGA 3QHTC 3BD5A 3TNNA 1XF5B 1G9EA 4QF1A 5ANMB 3DROA 5KEZA 1YJDL 1TYRA 1NGQH 3D0VA 2Y7MA 2X2HA 3MRPA 3HCVA 5LNEA 4ZUSA 3MTRA 32C2B 4EBQL 2UUDH 3D52A 4WDIA 4Q89A 3WBDA 4FFVD 43C9A 4XHJC 1IJNA 2NZ9D 3EOBA 1FFQA 1AD9A 5KYYA 5EEZA 1KYFA 3CSPA 4MAUH 2DQMA 2VLME 3QDGE 1SJHB 4PJGA 3D07A 3EOTH 2FWOA 3WO4B 2NY6C 5EG6C 1BV8A 1ECYA 3HE6A 4FXTA 1WFTA 5DEFB 3IPBA 2OK0H 5AL8A 5FB8B 3FO2A 2E7DA 4G8GA 2R2BA 1F4WL 5HD8D 4D3CH 2GSIA 4EZMA 3OSVA 4ANUA 4HXBH 1QFUL 2EE9A 3ARSA 1ZGLM 2HFGH 4P2YA 1ZHKB 2H45A 4PVLA 2F19L 3ZYOA 3QYMA 5IIEA 3RVTC 1A8ZA 2NCEA 3KGSA 1L7TH 1M6OB 1MXGA 3I6GB 3RGBA 4RIRB 1F42A 3KGRA 4G9FE 3HMXA 3BPCA 2CLRB 4FQ1L 5EC1B 3VVVA 3HZKA 2PW1B 3PWPE 5D6CA 1ZD6A 3X3GH 4Z7OF 4IRJC 3SQOL 2F53A 2XTSA 4I7ZC 3ZKND 1BYNA 2M83A 1NCCL 5GGTL 3GIVA 3KH4A 1KY6A 1N19A 2WBKA 4LVNC 3TBVA 4WY7L 1NAMB 4LLYA 1MHPH 4OZGA 5G4MA 5A2FA 3BE1H 1GCYA 1V7NH 4P3DB 2F5BL 3BN3B 4YX2H 4PJXF 3SN6N 1CE1H 1KJMA 3L16A 4P3WA 5DMGD 4A2LA 3QPXH 5IQNA 2E6PA 3L5HA 3QH3A 4KRMB 5EOTB 1S7UA 1E2WA 4L05A 1KC5L 4PG9B 3GI8H 4JFYA 5HHPB 3QRBA 4YC2C 3GSRA 3N1FC 1IKFL 4G5ZH 3UYOD 4JREB 4APQD 5FECB 1TTFA 1YEHH 3DECA 4XE5B 4KVCL 3OKMA 4OLVH 3S37H 1MW1A 2EC9U 4APQB 2Y07H 3K81A 3LZQA 4PB9H 5T33L 2LLNA 5DI8B 2IV8A 2BHZA 5CIPB 5CEYB 3EZJB 4FYRA 4Z7QF 4KI5D 4GP8B 1TJXA 4H0IA 5FK9B 3HFFA 1BCIA 4LCUA 4UT9H 5HHOE 1KN2L 5H94A 1RLWA 1OK0A 1UUNA 4HWUA 4OLWH 5KZCD 4NS0A 1BAFL 1R5IB 2B39A 5KZCB 2OX5A 3PAUA 3GSOB 4PTUB 3IU3A 1XGUA 4PJAF 2OQJB 4AJVA 5CR1A 4LLUB 3SE6A 3DUHA 5FDWB 1YYCA 4Z3JA 4GW4A 4MS8D 1NCWL 5D9SB 4P5TC 1EQWA 1NAKL 4YHPA 2WQRA 3V4VA 1XV8A 4WEMB 5IJVA 3K2MC 5JQ6L 5IM7A 1ZV2A 4KROC 2ICES 1DUYA 2CM6A 3EW3B 5C0JB 3PGCA 1HL4A 5LXGH 3DI3B 2FIRT 3GJFB 4BFNA 2VO5A 4AIZA 4AT6A 5CZXD 2ROXA 4EI5B 3FYEB 3H42H 1QEWA 3HUJF 9PCYA 3B5GA 1MUJB 4U1GC 4U31A 2IQ9L 5AB1A 1Z9SA 3TV3L 3G6DL 1RZ8A 4QHNA 3FQ4A 1E27B 5IB2A 1CFTA 1IC5H 3APDA 1ETJA 1AKJA 1CL7L 4FQXD 3MFFA 3HMXL 1NCDL 4EKXA 3L3HA 4TM9A 3DX7A 5H4ZA 3JV5A 1OCWH 4LSQH 5JR1H 3QUMH 4FQXB 2HMID 1TTAA 5LWYH 2O6EA 4QHUA 4DPBX 5I6KA 3DOSA 1SN0A 1G6VK 2ZSVA 1SBSL 5I1HL 1X4XA 4OSUL 4PJBE 1WS7A 2GW5A 2ADYA 5LN8A 3FT2A 1R6VA 2LOEA 4I18B 5AOLA 4DVRH 4XXCA 4XWGL 3RGVA 3ZKSD 1G0XA 1TDQA 4PSRA 2Y4SA 4A68A 5KBKA 2IFFL 4HKJB 3QZMA 4A38A 4HV8B 4NFDA 3LY6A 4XCEA 3EF7A 4ODTL 1AHWB 4YSRA 4MMXB 4YHKL 3LSOB 3BP5B 1X4YA 1A7PH 4XNAA 2PWEA 1EAJA 4ATWA 5DS8A 4YL4A 4L29A 1S9XA 2EXWC 4M5YH 2V4LA 3QNZB 4N28A 1AGCB 4ORGB 4UQAA 2IFGA 4MQ7A 3WJJA 4MXVE 4F27A 1JCKA 4LT7A 2Y7QB 3H2WA 3ZR5A 5JPNC 4NIKB 3B9VA 3U2IA 3ARTA 3K6FA 3LN9A 1YN7B 4QY8A 5F7FA 3SDYL 2BIOA 3PWUA 5EOCH 4N2CA 4Z1PA 4DAGH 4FQQB 2GTQA 2YPLB 3VXQA 4X6DE 4KK6D 1WT5C 3LKNB 3Q13A 3RG1C 5DYFA 1FL3B 5ITFB 4M6ML 4JCMA 3UTPE 4L4TE 2FEEL 3LV3B 2WLJA 5AZ2L 2WMPB 5I73B 2EIBA 4TLTA 1N0XL 1VENA 1ED3B 4K5PA 5EU6D 4HT1L 1DBKL 4AW4A 2OYPA 1UA7A 5IWLC 4M02A 4MD4A 3KYOB 5EU6B 1ZANL 2C4FU 4K0OA 3CBJB 3O9WD 1GS6X 2FHBA 2QMJA 1UOVA 2PUQT 3ML8A 4GIPD 5IUCA 4HWBA 4TNWF 5IV2B 2CM5A 1V10A 2CPUA 2H6UA 3HC3H 2KBGA 1YEIL 4MNGE 5ABAA 5A40E 5KBMA 3O9WB 4W4OA 3U6XS 3SGJC 5JXEA 3TX4A 4XE0A 4PJ9C 4FNRA 1TU2A 3WFCL 4XP5L 2W8CA 2B2XL 4JDZB 3RVXD 5FGRA 2AI0H 4FF9A 2D9CA 4TTGA 4PV9A 4AIXA 3GTVA 2VLLA 3WFDH 1AKPA 2G5RA 3JWNE 1R9FA 2ATKB 3APNA 2LAAA 4HGWA 1NZRA 2NY0C 1KJVB 1Y0LA 3MUGB 5GGQH 3TO2B 2APVA 3D85D 1UQSB 4GBXD 2GK2A 4IRSC 4OLUL 2X89A 2QPUA 1XTMA 4PR5B 4YS4A 5B3SB 3TEZA 4FG4A 1RZKL 4M29A 3D85B 1WTLA 4GBXB 5FM4A 3W11D 4X7DC 4NQQA 4R3SB 5EEWA 1EFXD 1AZCA 1JPFA 2DH2A 1G7PA 2AHIA 1OOAA 2OSWA 4NKMA 4G8IA 5GRJL 3GRGA 3QORD 1ADQA 4HUXB 4I5BB 1KT2A 2AS5M 4Z7OE 3GT6A 2VDPH 2EXYC 2AVGA 1D5BA 4HDIB 4ZSOB 4HS6B 2WGXA 4OR1A 2ZYHA 3OZ9H 1SOQA 3N85L 1XGYL 2A4CA 1AQHA 2YPKA 1VKXB 1A8JH 3QJHA 3S9DB 3ATDA 4PJXE 2HG5B 3ABKB 1SNRA 4DO5A 3NACH 1ORQA 2L7QA 3B3IA 1QZNA 3LQAC 3LQAH 5F3HA 1K4CB 5IB5B 1RV6X 4XCYA 2DM4A 2J8UB 3FFCB 3U1QA 4LHUD 3NCBB 1T0NB 3MJ9H 4ZW5A 3L6FB 3QUHA 5AAWA 5BQ7B 5L8LB 3UDWC 4LHUB 3OMIB 2BVQB 3ZQXA 1L0PA 4R2GC 4WAFA 3HE6C 4PLNC 1TJHL 2EH7L 4UTBL 5FV1L 4R4BA 5JUEL 1U36A 1E40A 5F6IC 2IG2H 3FQUA 4Z95L 2DQGL 4QRRA 3VSUA 3QHFH 3BKYH 4Z7QE 3M07A 4JFDA 4X6BA 4AH2A 4K3DL 4R6UA 4MXQD 4XO4A 2XWJA 1DQML 5E56A 2F8OA 3OKNA 4U4BA 3ZTCC 3FUMA 4DH2A 3UFIA 4MJJA 2FTAA 4HWBL 1RLBA 3W82A 4Z7NB 5BRPA 4DN3H 4P2RE 1E4XL 4XP4H 3IETA 1MLCB 3B2UD 1GAFH 3GSWA 4R97B 4UAOC 4PJAE 3QA3B 4JO3L 3FPYA 3MUUA 1J1OH 4OJFL 4W9HC 2HRPL 4YXLH 4AYGA 4DGVH 4O2CB 1MWOA 5KSUB 1R47A 2AEQL 5D7LD 1ZT7B 2HH0H 3VA6A 5C86A 5FYJE 3T3MB 3GXNA 2WINA 2XY1A 2X4PB 3CHSA 3SYQA 3W39A 1QO3A 2BSRB 1W80A 2MCPH 3CSTA 5D7LB 1B90A 2YQ2A 3ET9F 2CQVA 3EDFA 5C08A 3HUJE 2H32A 2Z91A 1FZOA 3H2QA 3C5JB 4WI6A 4AYEC 1A6ZA 4NBZB 4TUJA 4XXDA 1UGNA 1A3RL 3CZKA 1JV2A 2GT9B 3C6LC 3HN8A 4OD3L 2P24B 5FHAH 3EO9L 2DIBA 4EUPG 5GS1B 1ADQL 1YEEL 3KHQA 3EYSH 5EO1B 1RZJH 5E0QA 1NGXA 4HOMA 1UENA 4GIOA 3DETC 4XAWH 4WWPA 1RERA 3I9IA 1QNIA 1Q4NX 5C0ND 4KKBD 2DQCL 2BW4A 4F7MA 2WXHA 1MFBH 3WKML 1N70A 1NQBA 4EIBA 1BWWA 4FZEL 4C4KO 1TKWA 2Z65C 3QG7L 2HT4C 1A9EA 3L4UA 4S1RL 3TWCL 2F58H 2CHXA 3VXSD 4JAMA 1H5BA 3GJEA 1X5GA 3CFJB 4S1DD 5BZDB 1ZVSA 3BAKA 3OX8A 2EKSB 3O6KL 4XP1H 4Y16A 4DTGH 4E9RA 1CXKA 3JBG7 4NI6A 2YR3A 3DBXB 4R7DB 1ZPUA 3VXSB 2J7LA 1RD6A 3B2DC 1WG3A 2GTWB 2JIXA 1RK0A 2EO1A 2APFA 5F1NB 4GRLC 3GEFA 3CFBA 4D9QE 4YVNA 4P59L 1M7IB 1QBBA 5FYKE 1A64A 1EZLA 3NGBC 1EX0A 1TTBA 4HCRH 1MCPL 3ZTJG 1CO1A 1LMKA 1RUKH 5EFIB 2ZF8A 3AWEA 2NX5A 1FRGH 2Q76A 3MRJB 4Y5YB 3OVUB 3T4AB 3SCMC 5FWRA 1MQ8A 4XWOC 1OT2A 2YS4A 4MNQD 3KLKA 4HWZA 4UIMB 1AQDB 1R5VB 3QG6B 3A23A 2FYYA 5ELIA 3PUCA 2MOGA 1TQBC 3GJFK 4MNQB 3WFHB 1ULVA 4DOHE 1UZGA 3NRFA 3D5OF 3UYPA 1QABA 1FJ1A 2H6OA 2EDBA 3KAAA 3ORJA 4HA1A 5D1XC 5KYWA 3KVQA 2WC7A 4PH8A 2AK4A 3RTQA 3L5WA 3OAYK 1QA9A 2R15A 3CVBA 1HCVA 5T3ZE 3V4PH 3QB7C 2P3YA 3K1DA 2B1AL 1V55B 1ZSDB 4KK8D 4PJHF 4MYWB 3FHQA 4JL1A 3HNVL 3RGVC 2YRLA 4XB8A 3BP7B 5I1EL 2VOTA 3DIVA 4ZNEA 5B8CA 3PUUA 4TL5A 1YMME 4KRPD 2ZWSA 4TLUA 2OR7A 1SXNA 2PP8A 4ANVA 5IB1B 4OU3A 4F2MA 2B1HH 1UURA 3CTTA 4KRPB 1Q9OB 1RMFH 4X4YA 2FD6L 1TVBB 4DKFL 3ZZSA 3C09B 5I1DB 4ALAH 3EYFA 3QIWD 1VFMA 2WYHA 1OCCB 3EYQC 4GIAA 4GW1B 1CWVA 4JLRA 2NXZC 4YGVA 1NCAH 3F7PC 3WJJC 35C8L 4P3CH 3HG4A 3QIWB 4H8WC 4Z7VB 4YXKL 2YD6A 3RX9A 4J1UB 5IR1B 4MYPA 1T0MA 5D2NA 1QSZA 1M3IA 1T2QL 2WAHA 5JIIA 5DHMC 5KSBF 2OMVA 4IOFC 3VGAC 4AVHA 5KSAC 1JF5A 4F80A 1XF5A 3LOWA 5ANMA 3N5AA 4MDIB 2N1KA 5D72L 4MWFA 1QAWA 3OWEA 1BOYA 2EEXA 32C2A 4GI9A 4NRXB 2XWXA 4N25A 5GZND 3RHWK 3SZ6A 4WUUD 4R96A 1SJHA 1KBBA 2XOTA 1WHOA 2YGQA 5DEFA 4IBYA 5HHNB 1J5HA 4WUUB 3NJKA 1TLKA 1TQVA 2YD0A 3WAKA 1CB4A 2W9DL 4MZ2A 4PS7A 1TJIL 3HOGA 4KV5F 4ZXBD 5C0BD 1FLTX 1AZVA 1ZHKA 3L3IB 3F7VB 3B1TA 2FBRA 4W4OC 3EJZD 4ZXBB 5C0BB 3B2XA 4M00A 5JXEC 2QV4A 1JGVH 3O6MH 1M6OA 1NTDA 4FG6C 3I6GA 2CKBB 4RIRA 3U0WH 1OAKL 1FFRA 2BZCA 4I89A 1Q9LB 4BE5A 5IKCB 2CLRA 5EC1A 4MXWH 1MCRA 2MNUA 1XAUA 3MUY1 2PW1A 3UROR 2YUXA 4PHXA 2FJGB 2AJ3B 2XI9A 3SPVB 4XN5A 1U41A 1TO4A 2X38A 3P40A 3PP4H 4Y4FD 5ITBH 4FFTA 3TYGH 1NAMA 3F2LA 4JO8A 4Y4FB 1KJ3L 4XAKD 3ZKXB 1J5OH 4P3DA 2YXVA 1HEJC 1CFSB 1U8HB 4XPGH 3RJOA 2OP4L 2DMKA 2G3XA 4AWJC 2EDTA 5A16B 5F3BB 1MXDA 5EOTA 1PNDA 3MNMA 2A5UA 3AQXA 4KO5A 4D7PA 2VZSA 4PG9A 5HHPA 3PAZA 2B4CC 2B4CH 2D3NA 1KB3A 3TPUB 3DDFA 4KJQD 2DYRB 2VNCA 1JGUH 1KCRH 1M42A 3MUZ1 5FECA 3X13B 1MVUB 3KWWB 1EJFA 4ZMTA 3KXFE 2JNZA 4EZLA 3MNVB 4APQA 5LLIC 2J72A 1RFDL 5DI8A 4U0QB 2DD8L 4G9DB 5CIPA 5CEYA 3WFBH 4AL8C 2PCPB 3E3QE 2V9QA 1AG6A 4M48H 4R4ND 1JAEA 4XMXA 2QV2A 1J9SA 1LYQA 5J6GB 4AEIH 1F1GA 2H4EA 3D18B 2XWRA 5AAWC 3MLVH 4P46C 4DP6X 4R9HA 3LQMA 2ZYIA 5I1KH 2DQJH 3CGTA 2CE6A 3HA0A 3ASNB 4M43H 3GSOA 4PTUA 1MCIA 3OKDB 2OQJA 3RX7A 3CDGB 4LLUA 1JXKA 4ZRGA 2PPAA 4OGZA 4YO0A 3V0AC 5FDWA 2GUYA 4TTDD 5D9SA 1YNLH 1HK6A 2F1BA 5C0JA 5IOPA 2E7LC 4RRPG 3AB0C 3GJFA 2WVUA 2AJVL 3QXDB 3ZQ9A 5DUPL 2XC8A 3QW9A 2BRQA 4K8RC 1W8NA 1XFPA 2K3TA 1MUJA 1CFQB 4TLSA 3QGVA 4L8SC 4X4MA 2HKAA 3NT0A 1E27A 4FFZA 3HW7A 2LQRA 3OTTA 4FL4C 4W6WB 4FQXA 1E67A 2AF2A 4JE0A 4RQQA 4JHBA 4Z7WF 2H1PH 2PCXA 3GRBA 5EU7C 2CBPA 3FQYA 4XNXH 1BFVL 1DVUA 4I9WE 3QZWG 4FDWA 1CDHA 3VXUD 4BSVB 2VDKH 4YDJB 3GRWH 4IHOB 3FS9A 4I18A 2CRZA 3VXUB 1D6EB 3S3CB 2ZD0A 3SZKC 2RALA 5L0QC 3L5XH 4LNRB 1YN6B 4TUKH 5F44A 3WG7B 4HKJA 4WI2A 4HV8A 3EJYD 4FABH 1D2OA 1WUNT 1A65A 1CBVL 5DEGB 1KMGA 5D2LB 2NSXA 4MMXA 3LSOA 3BP5A 1JPEA 4Y2NA 4WHYH 2AJXL 4ELKB 3VXRD 1BOGB 3QNZA 4HYTB 5E6SB 1U91B 4XMLH 4ZYKB 2DWDB 4IBLT 3H6AA 2GAZA 2MOVA 3KPOB 1AGCA 4ORGA 2W5PA 4PJHE 1XMEB 2H41A 3VXRB 5JIDA 4P2QE 1V8HA 2AZUA 1HKLH 2Y7QA 4MB5A 1Z0MA 1OTTD 4YEEA 3U30B 1SLUA 3HVDA 3IVKB 1YN7A 1KN4L 4ONFL 4OCRL 5F2FA 3NRPA 5F97E 3SPCA 1CZ8H 4GAYB 4GKOA 4H26B 2D31A 3TFKD 4DEWA 4FQQA 1DQLH 4G80B 4W6XB 4DW2H 3DX6B 3I3BA 1ZY9A 4Y9GA 4LKCB 3CVDA 4QO1B 3LKNA 4NHCL 5C2BL 1FL3A 5ITFA 2WTOA 2AXWA 2JJSC 3IN2A 3RWIA 3LV3A 2J5WA 2YJQA 1MPAL 4M7KH 2WMPA 3PHOB 5JIHA 3NDZE 2AEPH 1AJ7L 1ED3A 5KSBE 1VFBB 3VI3F 3V0WL 5C7XL 4U3SA 5CFHA 5KBNC 3LZRA 5CJXA 2DIEA 3RPIB 1JVOA 2L7UA 3F5WB 3KYOA 1QLEH 1A7RH 3R18A 5EU6A 1FH2A 1AXTH 2BY2A 3NPSC 1FZJB 3HMWH 3RJQB 1UACH 5CLYA 2IBZY 2ZKWA 5IV2A 5J56B 3O9WA 2JB6B 1TZIA 4NT6B 1ZOXA 4H0GA 4FYTA 4TNFA 4U1LB 5IFHH 1PJWA 5JIQA 4JDZA 3EDJA 4FJZA 4ZS7H 2ITDB 3SIKA 3A4EA 3P2DA 4DERA 1C5BH 3DK2A 4X7EC 1RVFH 1OAYL 4MDJB 2P49B 2AJSH 3T6WA 2G2NA 1R0AL 1EJ8A 2ATKA 3WTXA 1KJVA 3MUGA 3VGBA 4KV5E 3QUZD 1UQSA 1A6UL 3FUHA 5IHHA 3SDDD 3VFUB 1QFWL 4PR5A 1W91A 4PEEA 2XZZA 5FDYA 3QUZB 3D85A 4GBXA 4KDVA 1C8PA 3BPLB 3SDDB 4HGMA 1MWAB 4M7ZB 3ROLB 2YSTA 4J6IA 2X6BA 5DT1L 4WU7B 2IBBA 3MJWA 2WN2A 4N22A 1EFXA 3H3KA 4I5BA 5DRWB 4DFHA 1H3TA 5CJ8A 1JPSH 4U1MB 5L7XH 4HDIA 4ZSOA 4WFGD 4HS6A 3QORA 5HDWA 4HS8H 5E2UL 4MB3A 2JH2A 1S3RA 5DZAA 5AOIA 1VKXA 3CMOH 4LOUD 1N8OE 1XSJA 2DOCA 2J1KA 3FQWB 5ACZB 1UGKA 2HG5A 3OB0K 1XAKA 1SY6H 4PIBA 3KLDA 1TITA 5JW5B 1LE5B 1K4CA 5IB5A 2J8UA 4M8RA 1T0NA 1ZT4B 4LAQH 3L6FA 4RGNC 4JN1H 3P4LA 4NDMB 1F90H 5BQ7A 2FYVA 2FJSA 1TJGL 4LHUA 1FNSH 2BVQA 1A7BA 4CGTA 1AQ8A 4FFVC 3WO4C 1YC7A 4HSAC 2NZ9C 2EDXA 4UYPA 3V6ZA 1V5JA 4B3EA 1LXMA 4UT6A 4QJ4B 4KXBA 5DVLA 4TVUA 2IAMD 5KJ4A 1CYXA 3FRPB 5D1QE 5SWSD 3FTVA 2EIZA 1JK9B 3JTTB 5J12B 1YY9D 2IAMB 4NAJA 5CKAA 1OLLA 4MMZB 1XR9B 3K7UA 4P48A 5SWSB 2VJXA 5HD8C 3CC1A 3I9GL 2OAAA 4YE4L 4AQ8A 5CGMA 4K2UL 3DTUB 1F6LL 1BG9A 4RVBA 2GI7A 3NYKA 4OCNC 1CD9B 4EPSA 3ULVF 1EV2E 1GGCH 2WTPA 1E0OB 4XC3H 1MLCA 3ABLB 4L0PB 1YEKH 3QA3A 2F15A 2H9GB 1NMBL 5D71H 4PWIA 3VA2C 4K3GA 1OK8A 2AGJL 4O2CA 4O58L 5LHDA 4HU2A 3KPRE 5KSUA 1ZT7A 5AB9A 2B3RA 1HHJA 2Q5BA 3CN0A 5DD3L 1CS6A 1ZT1B 2X4PA 2QQKH 4PVNA 4X8GA 2BSRA 1CF8H 3GXUB 5CINL 5D7LA 4G6AD 5EWIL 2F5AH 3ALPA 2OL3H 1CGSH 3ZMNA 3IMTA 2AQ3A 5HVGB 2Z8RA 3IRCA 2YXMA 3L3OC 3FC8A 3C5JA 4O02H 5JHDE 1JZ5A 1NIEA 5H37G 1OY3B 1AMXA 1C1EL 3V52H 3VDBA 4XPBH 5DMGC 4JL2A 2JVUA 2GT9A 4K7PX 4PHZA 5KVGL 4PY7B 1HKFA 2P24A 1E5YA 2Q6WB 5ABDE 1FZKB 3PAVA 4N4YB 3VTAA 5GS1A 5EO1A 4JREC 4Z7WE 4GXFA 3UJJH 3U1PA 4OF0A 3MMEB 3Q05A 4KXDA 4JFUA 1TMQA 3D3VE 1V27A 4AV0A 1N9PA 4Z77A 1A1OB 4KI5C 1HT6A 4HGKC 1AGDB 3CFJA 4JY4B 5BZDA 2EVGA 2WWOA 2EKSA 2F1EA 4FFYH 4X6EB 5DK3A 3WIIL 4UV4H 3DBXA 4R7DA 4DP2X 1BIHA 3QXTA 4IYKA 5E6ID 2J71A 1MW0A 5AVRB 3S3BB 3QQXA 1G7HB 2GTWA 3DDGA 3P30L 4HJ1A 4PJ5E 5F1NA 5E6IB 5ABZA 5TE6H 1MVYA 1M7IA 5EN3A 4DPCX 2QTVA 2XZCL 3PHSA 4MS8C 4X5WB 2EDJA 4AQZA 3WIFB 4Y4HD 4HPHA 5IBLC 5EFIA 2PPFA 1QPKA 5AVXB 3CQPA 4FRWA 4RNRB 4EI5C 4OZHB 1TYEB 4Y5YA 3NCYP 4DGWC 2VRQA 3ZL1A 4P5SA 4Y4HB 3T4AA 4PS3A 3KR3H 3NZHL 1XSKA 5DLLA 4JJOA 3CAFA 3WHXB 2HX8A 2ZE0A 1AQDA 1OZUA 1R5VA 3CG8A 3QG6A 4UIMA 1EJOL 5E8OA 4OZFH 1ACCA 4MNQA 3WFHA 5T1MB 3QRFM 1AVAA 1NIAA 1NPUA 1NWOA 4J3UA 4UYQA 2X1PA 4XNYH 2Z92B 4X7TB 5D4JA 4TVPE 1SOKA 3IM1A 2OKMA 4PLKD 5AVZB 2VR3A 2ZUYA 3MV8E 1SN2A 4XCCL 1SM3L 5FKPB 4PJCB 4BINA 1U95B 2HMIC 1FV1B 2P1YA 4IKLA 4NQEE 4MHHG 1ZSDA 3VI3E 4WLCA 5F7UA 3SSGA 1VPOL 4NZTH 5D7JD 2VR5A 4MJ5B 2YGNA 3LS5L 3IJSB 4NM8H 4PW9A 4BGDA 1L9TA 5CP3A 1CN4A 2IGLA 1AHWC 5D7JB 4J3TA 2VR8A 5IB1A 2K9FB 4MMXC 1TUPA 3DGCR 4UQEA 3MO1B 2VZ3A 1FNHA 3WFEL 1Q9OA 3TLRA 2CSPA 2DI8A 1F3RB 1TVBA 1NOLA 3G6JF 4XR8C 1V3KA 5I1DA 4U3CA 3BIBX 3SE4A 3FSAA 1JWMB 3TV8A 1LDPL 2I5YL 3LD8C 3MLSH 3DUSB 3QIWA 3ES6B 2EIDA 4Z7VA 4TSBH 4J1UA 5IR1A 2YXFA 3LKRB 2BY0A 3KWXA 5HGHB 2I85A 3QAZB 4YWGH 1HL5A 2LV4A 3HE7C 1ZJAA 2KPNA 2NZ1A 2VQ4A 3NDYE 4JJHA 4NQDD 4R26L 4X5XB 5EUKA 1WAAA 5LG6A 4KTDL 4MDIA 5DVNA 1FQ9C 2UYLB 3WGUB 3GXDA 4FX5A 1B4RA 4NQDB 2DW5A 1I8KB 4NRXA 3A67H 4U7SA 3OR7B 4OCYH 1FC1A 4OLZH 5J13B 3RWJB 3Q1EA 3IDYB 5GZNA 4MAUL 3S34L 4I1NB 5HHNA 5T8IA 1UM4H 3ULUD 3B7RL 4WUUA 3EOTL 4E0RA 2DN7A 3CHOA 1QFWM 2LABA 3D0LB 2OK0L 3VVWA 4ZMNA 2GSGB 4J23A 5ISZD 3GS7A 1CGVA 5EOCJ 1I9IL 3IJ9A 5A43C 3K6SB 1RURH 4ZO8A 3RWDB 1V3JA 4N86A 4XMPL 3L3IA 5ISZB 3KHOA 3LZPA 3F7VA 2DWEB 2HFGL 3O9WC 4ZXBA 5C0BA 3U4AA 1L9SA 3UTQB 2P26A 4LCVA 1BVNT 3RFRA 3Q8CA 4JBSA 3ZDWA 2CKBA 2OYLA 1Q9LA 1OHZA 1LEIA 1L7TL 3RDJA 5IKCA 2VDRH 1WA0X 4DKAA 3FN3A 4XBEH 3SOTA 3RVXC 3U0PB 5I18L 3PWLB 2FJGA 3ATBA 2AJ3A 3GIZH 3US1A 2EDHA 3PQYD 3SPVA 4A04A 2X5PA 3X3GL 3CHRA 2VSKB 5DJ2B 1J8RA 4K9EC 3PQYB 1AZNA 4K9EH 3TYFB 4KTEH 2E56A 1GY1A 3AG4B 4GRWH 4Y4FA 3P4MB 4Z7UB 4GBXC 1CFSA 1U8HA 1RJLB 5C0EA 1MHPL 5HDBB 3ULVE 4POYA 1V7NL 3AUVA 1I8MB 2OTPA 3ZHFA 5A16A 3H9YA 4YX2L 3H0TB 1CE1L 3EADA 4U2YA 4DJMA 5IESL 2K8MA 3HKFA 4ETQB 4FQIH 1NINA 2IADB 5GRVL 3TPUA 5GZOD 1ODAA 4GMTH 3HLAB 2WQXA 4E9TA 1I1RA 4MQSB 4A6YB 2OYMA 1LILA 1MVUA 2YFOA 3KWWA 4G5ZL 4TF4A 1AR1D 1NCBH 4UTAH 1WRFA 3MNVA 4KKQA 1YEHL 4YDIH 4A2HA 5DJ8B 4EEEA 3HNSH 4S1SH 4KVPA 2CK2A 1FYTE 2PCPA 3LPOA 1AR1B 3HBZA 2Y07L 4PB9L 1D5IH 2ENSA 2W65B 1ZGLP 1OOWA 5J6GA 2KS0A 4IRZH 3D18A 4RZCB 1OCOB 5AB2A 5G55A 4PB0H 5I5JA 3US9A 2E8YA 2NPLX 2ZXEB 3RWGB 3ZK0A 2XV3A 3FTUA 5EZIH 4NC1E 1E5AA 1IX2A 3OKDA 2FWUA 1PSKL 7FABH 3CDGA 2YAPA 1D7FA 2EE6A 4IGBC 1SZNA 1ZS8B 3KL3A 4M6OL 3WV0A 4F8NA 3BWSA 4DP5X 3FBKA 4WJ5B 3L95A 5J5EA 4AQ8C 4Q74A 4AYBA 5BW7C 1DJSA 2ZKXA 1WBYB 1CGXA 3QXDA 2L7EA 5A2BA 4MVBD 3EKCA 4KWUA 4X6CF 3ZGIA 4E9VA 5LXGL 1LQSR 4PW4A 2V3DA 1CFQA 2BP8B 3T3PB 4R97C 3AT8A 1J7VR 1S5HB 2IWKA 3E0GA 3MU3A 4AG4H 5FGBC 3B3BA 3GMNB 5JLZB 3B2UC 4JM2F 2ZJSH 5D7HA 2WXPA 3FB8B 4M7LH 1IC5L 2GC4C 4IK6A 2FHFA 3F12B 1HOCB 2JXMB 1OGPA 4I88A 1YPZF 1OCWL 4HEPG 3HAEG 1QOKA 3BAYA 3QUML 4G6MH 4BHUI 4IMLB 4ORZC 4BSVA 3P9MB 2G9HB 3P0YH 1B88A 3NFSH 4YDJA 5F70A 4IHOA 2P5WD 1E3ZA 2G75B 4NO2B 4TQPA 1D6EA 3VXUA 1AIZA 2NZIA 5AVYB 3U4KA 2UY6B 1PX4A 2P5WB 4LNRA 1YN6A 4RX4D 3GC3A 4DVRL 2CBOA 4OM0L 3ROOB 2KMWA 1W16A 1GJIA 2I60L 4CGUB 5DEGA 2C8NA 5J7CC 2PW2B 1SXAA 2C1OB 2IV9A 3E1ZA 3M17B 1D6VH 5T3XH 1UWXK 3IJYB 3P11H 4UQDA 3LRLA 1A7PL 4KK5D 3D1MC 2X4TB 4LPCA 3T4YB 4ELKA 5G4OA 3KS0H 4O2EA 4OZ4B 2R0ZH 2B59A 1U91A 4ZYKA 2DWDA 4KKBC 5EO0B 2A6DB 4EI6B 3EOAB 3KPOA 3S8FB 2DDQH 2Y9RT 2ZX8A 3VXRA 4F2FA 1WWCA 4HLEA 3LRMA 5I1JH 2OMWA 4TNVK 5DSCB 3IVKA 3FULA 4FLSA 1UCBH 3OLEA 3VI4F 4AUJA 4GAYA 4H26A 4NBYB 3T77B 4S1DC 2W38A 5EF2A 4L5FH 5EOCL 4G80A 1BJ8A 1EXHA 4DIXA 3DX6A 3B37A 4DAGL 3ULAB 5AW8B 5IEKA 4LKCA 3POHA 2HUHA 3G6JE 4LRIA 4OLYH 4QO1A 3DHPA 5ACMA 5BVPH 3IGLA 2X28A 1BZDA 2XWDA 3CD4A 3RVWD 2DJ4A 3KDMB 1IAIH 4J3SA 2PYED 3DJRA 1NMAL 4ELMF 5EDSA 1Q0YH 3CK0H 3IYLW 4N8UA 3T4AC 3GGWB 2M8XA 1E2ZA 2PYEB 4QHKI 3WY1A 2CUMA 1OAQL 3OGOE 1KELH 3EFDH 3W9DB 1OWRM 3MBED 2ESVD 3RPIA 3F5WA 4G7YL 3Q6FB 4FGMA 3HR5B 2AP2A 4HIJA 3MBEB 1FZJA 2ESVB 1F6FB 4NPJA 3BCDA 1N10A 4HC1A 4S1QH 4WNJA 3Q01A 4EQ3A 2JB6A 1NICA 3HC3L 4U1LA 1QPPA 3EO0B 3WI9A 3HHSB 4PBVC 1MVFA 1EAQA 2UZYB 2ITDA 3NCCB 2ZIDA 3BLBA 4R7XA 4Y1AD 2AI0L 4MDJA 2X2IA 1EHAA 2PKDA 4YGAB 4H88H 4BZYA 3WFZA 2K4WA 2NW2B 3RVVC 4MZ3A 2ZCKH 4YSOA 4Y1AB 3UJTH 5E2TH 2A74C 3D06A 4YXHH 1OM9A 3V6OA 1R5WB 4Y2OB 3VFUA 5GGQL 4W81A 2IDFA 1KTRL 4ZUUB 4KRPC 4L1BA 3QUZA 2B08A 3SDDA 1PZ3A 5KBDA 1MWAA 3WLBB 3CZNA 3C09C 2OTWB 3ROLA 2A9MH 4WU7A 1HWGB 1T7ZA 5DC2A 3DNKA 2VXQH 3SEPA 5CFAA 1I9RL 2EYRB 5F7DB 5DRWA 3QIWC 2VXTH 5JOPD 2MQGA 4O00A 4U1MA 5E5LA 1JRHI 1MCOL 3OB0H 4AENB 3II2A 2AQSA 2P7TA 2VDOL 3U7WH 4H8PA 3VFSB 1HL8A 3K3QA 4MA3B 1KB5H 1YSOA 1TG8A 4N8VG 3FQWA 3FTYA 5ACZA 5LCVA 1TLMA 2CR0A 2O72A 2RHEA 4FADA 5HP5A 4AVKA 1E9QB 1LE5A 5JW5A 2F9BT 4LLDB 4YFEA 3T0WA 5KOVC 3IMBA 4MAYD 4UIKH 1ZT4A 4NGHL 2NY3D 1SJMA 4N20A 2X9XA 4NDMA 1OLZA 1MFEH 3DX1A 3MJ9L 2IDQA 1FA4A 4JUTA 4MAYB 3PREA 1GYAA 2NY3B 5C92A 5GZNC 3DOHA 3QRLA 2DRUA 1OEZW 3BZEB 1U3YA 5AVVB 5MHSE 3VXTB 3S48A 2NNXA 4JRFA 4R8WH 3WNPA 5FC9A 1JK9A 2IAMA 2UXGA 4TULH 4MMZA 5EPMB 1XR9A 5SWSA 1NPJA 3BKYL 3C6SA 1FFNB 1IGCH 4P99A 1A5FH 3VRIB 3ECUA 4RMQA 1A9BB 1MQKH 2XBDA 2YWYA 3EJZC 3IK2A 6FABH 1JOIA 1AOHA 2ENJA 2GJ6E 5B3JF 2Q7YB 2WNWA 2H9GA 4DN3L 1F6AB 3L4VA 4XP4L 1GSKA 1EDYA 3MLRH 1BMZA 1GAFL 4JG5A 4NWTH 5GXBB 3EG9B 4KQ3H 1A7QL 2VZVA 2BC4B 1ZVNA 2FJHB 1TIUA 4FD0A 4YXLL 4AZ8A 1WICA 1ZV9A 1VACB 1MFCH 1ZT1A 3MA9H 1X5HA 4ZQKA 3CVHH 1DCEA 3H3PH 3SDXF 3QO1B 3L45A 4KTGA 1YEJL 2YK1H 2Z0UA 3QO0B 4KOCA 4X6CE 2CH8A 3HG1E 3FH8A 5I30L 2ODIA 3O3EB 3BAJA 1LM8V 4RH4A 5EEVA 2FWSA 1I8LA 4LCWD 4QWWD 5ILTL 5GS0D 2OMNA 4MTMA 4PY7A 1FNFA 4K7PH 1FZKA 5F72S 4LCWB 4U49A 3UTTD 4YLCA 4QGYA 1HYSC 2X1OA 1CPUA 5FHAL 4HFUH 1RIVH 2VDNH 3UTTB 1DDHB 1YPZE 1TJMA 3DGDA 4AKPA 3MCKB 4AQ1B 1RZJL 3MMEA 1G6RH 4XAWL 1MRCL 4M56A 4QUOA 2PTUA 5AKRA 2XZAH 4JFHE 5LXVA 2NT1A 1MFBL 2VN4A 2A7BA 2AQQA 1A1OA 2E46A 3MLXL 4TSAL 1XCXA 5LCVL 1DVFC 1AGDA 1U8OB 4A7SA 3CCHB 4JY4A 4R4NC 1RP8A 5E8NB 3RBSA 2NNAA 1RJYB 4X6EA 1IM9D 4A7VA 4JPWL 4YIQB 4XP1L 4DTGL 1G7HA 1TFPA 4PG2C 1IM9B 3V5HB 1YC8A 5E6IA 4XBPA 1KNOB 5EULV 1BD2E 1J9TA 5TE7L 4A7QA 5L4IA 3Q0HA 4TTDC 5I26A 4X5WA 1NLDL