1CYXA

Quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
158
structure length
158
Chain Sequence
b'KPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMHSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGICAEICGPGHSGMKFKAIATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYOA
publication title Crystal structure of the membrane-exposed domain from a respiratory quinol oxidase complex with an engineered dinuclear copper center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 41
structure length 158
sequence length 158
ec nomenclature ec 1.10.3.-:
pdb deposition date 1995-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF06481 COX_ARM COX Aromatic Rich Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1cyxA00
1ILSA 3PAZA 1RKRA 1AZCA 3QQXA 1XB3A 2FQGA 1OE1A 2IDQA 2HRHA 1XMEB 2PPCA 1PNCA 1AG0A 1M57B 4A66A 4HCGA 4YSAA 3UGEA 1JVOA 1V55B 5E9NA 1A4BA 4CSPA 4G70B 1TEGA 2PP7A 4P5RA 3RYMA 4G7RB 2PPAA 1HFUA 1IC0A 2DYSB 4E9QA 5B7MA 3FYIB 3IN0A 3TBCA 1M56B 2QPEB 1JERA 1SDDA 3AG2B 3CVCA 2XWZA 2VSKB 2ZXWB 1HAWA 4A2FA 1B3IA 1ZPUA 4AZUA 1F56A 1ILUA 2IAAC 4E9TA 3U25A 5FC9A 2FQDA 1WA2X 5TK4A 4DP6X 4G72B 3S3BB 4NB7A 2QT6A 3ERXA 3PCYA 1BEXA 5AFAA 2DWSA 4HZ1A 1KGYE 3MX0B 1DZ0A 2EINB 4DP4X 1PF3A 3KW8A 3DTUB 2P80D 4GY4A 2EIJB 2YAOA 3ABMB 2X88A 4DP1X 1QNIA 2PPFA 3FT0A 1OCRB 1QHQA 4GXFA 5I26A 3ASOB 1CYXA 7PAZA 3T71A 2YAHA 1PZCA 2YAFA 3FYEB 2XVBA 1SDDB 1NPNA 2B3IA 2EIMB 2IWKA 1NIDA 3AG1B 1MZZA 4F7KA 4GP8B 2HX7A 3NYKA 3N2JA 1PCSA 5IY5B 1WA1X 3HB3B 1MG3C 1ZIBA 1JZEA 3EHBB 2YAMA 2PPDA 3HEIB 2VN3A 3JTBA 4AKOA 2B08A 3FSWA 3NJFA 4AI7A 1BXUA 1PZAA 2UXGA 5A7EA 5D4IA 4KNSA 2DYRB 1KCWA 1UATA 3CZUB 3FU7A 3T6VA 1SHXA 1URIA 1SJMA 1SNRA 3X1BA 1JZHA 1NIFA 1GS7A 1AS8A 3QJQB 1KBVA 4HHWA 3S3DB 3T6WA 1A4CA 1AZUA 4PAZA 1BYPA 2GSMB 1NDTA 1NWOA 5F7AA 1T5KA 1JOIA 1OE3A 1PLAA 1AR1B 1E5ZA 3EH3B 2HXAA 5LDUA 3C75A 3FU9A 3UAEA 1W6WA 2AZAA 3CVDA 3NJJA 3QJSB 1JXFA 1AZNA 1J5DA 2IH9A 2W8CA 2ZONA 3AG3B 4A2GA 4DP5X 2WSDA 3BQVA 2WO2B 1ET7A 1W6LA 4NAJA 2VW7A 4M3HA 4PCYA 1PLCA 3GYRA 4DPAX 2I7OA 1WS7A 2EIKB 1GS8A 2YAQA 3BVDB 5B7EA 3FU7B 1RCYA 2BW5A 1A3ZA 3KW7A 3PPSA 2BHFA 1VLXA 3QJTB 4HCFA 3TBBA 4WTQA 5B1KA 1NINA 1J9TA 4KO7A 4YVNA 1SF5A 3ZX1A 3ABKB 4A68A 1KDIA 3MBWB 4AKPA 4AKQA 1N70A 1GY1A 1KYAA 4CSZA 2BZ7A 1E30A 2X87A 1BQKA 2VM4A 2PP8A 2PPEA 1OF0A 3N55A 1BXAA 2Q9OA 5AZUA 3WG7B 4DPBX 1IKOP 2UXTA 4KO9A 5I6MA 2IDFA 1AG6A 3OM3B 1TEFA 3AW5A 6PAZA 2FWLB 4BXVA 1A65A 3GDCA 1J5CA 3NSYA 1JXGA 2DY2A 1CURA 2QDVA 1GW0A 2OCCB 3OQRA 5EHFA 4FA7B 2H5UA 4G7SB 2N0MA 2Q5BA 2FJSA 4DPCX 3NJGA 4DP9X 3IBOA 4KO5A 1ET8A 4TXVB 2OV0A 1FFTB 1ZDQA 1MDAA 1OCOB 2QPDB 4DP2X 3D12B 2BP8A 2FNWA 2FTAA 1AS7A 1FWXA 3WIAA 3IEAA 2HLEB 1SF3A 2XYBA 2XV2A 1A8ZA 1ETJA 3FPYA 3OMAB 3PAUA 4MFHA 2IDSA 1CUOA 1WS8A 3OD3A 4UF7C 3NJLA 1EZLA 2FT8A 2BWDA 1E65A 2YQBA 4Q89A 1BXVA 1CYWA 2FQFA 4Q8BA 3UAAA 4F2FA 6PCYA 3H56A 4HIPA 3PLYA 2IDUA 1FA4A 4E9WA 4KOCA 1HAUA 1PY0A 3NP4A 3FPXA 3NP3A 3EH4B 1AIZA 4UANA 2W88A 1GSKA 2Y1AA 4KOBA 2E86A 1ASQA 1KDJA 3X2QB 2LLNA 1NZRA 1BQ5A 2UXFA 2H3XC 4A2HA 4X4KA 2UX6A 2AVFA 2IWFA 4HAKA 3V9CA 4DP7X 1SFDA 2BP8B 3ZBMA 2PCFA 2PP9A 5I5IA 2NRDA 4ZK8A 4E9SA 2H47C 1XB8A 2DWTA 1NIBA 4YSQA 4BXSV 2VSMB 5B1JC 3FSZA 1PMYA 1OE2A 5PCYA 5I5MA 4YSRA 3QJRB 3UABA 1JZGA 2AFNA 1JZIA 3CG8A 2TSBA 4KO6A 1AACA 1E67A 4DP0X 1IUZA 2IDTA 2YXWA 3NJIA 1KV7A 2XV3A 4HHGA 2XUWA 1MZYA 1J9SA 2HX8A 2WO3B 1JZFA 3FU8A 4ENZA 3CDZA 7PCYA 1I53A 1NPJA 2VW6A 2DV6A 4GP4B 9PCYA 2PCYA 4AX3A 4A67A 1ZIAA 1N68A 1NWPA 4E9RA 2XX1A 2GC7C 5B1BB 4E9XA 5I6PA 2JFCA 3IE9A 2J56A 1AZRA 3ABLB 4BWTA 4YSSA 1NIAA 2XV0A 3DKHA 1BYOA 1TKWA 4YSOA 3CVBA 4WKXA 4GYBA 1GY2A 4BK5C 1X9UA 3FS9A 3AG4B 3SBPA 3X1NA 3L45A 1ASOA 3X1FA 2CCWA 1M9WA 2CALA 2R7EA 3FSVA 3QPKA 1E5YA 1NTDA 1RZQA 1J9RA 4W9ZA 2VMJA 2AZUA 3WKQA 1ID2A 3ABGA 5I6LA 3PAVA 3SBRA 5B1AB 2HX9A 2BWIA 2CAKA 3ZDWA 1PLBA 3CDZB 3TU6A 3NSCA 2ZOOA 1ASPA 3WKPA 1R1CA 3AZUA 3EH5B 3OMNB 2OJ1A 4KNUA 2EILB 4KNTA 1GR7A 3FQYA 5AKRA 3IN2A 2UX7A 1RZPA 2MRYA 5I6NA 1PNDA 1V10A 2BW4A 1NICA 1EHKB 1OV8A 2CJ3A 4YSDA 4A2DA 1KCBA 2Y69B 3PXLA 1OCCB 4N4YB 1GYCA 2FT7A 4BWUA 4YSPA 3OMIB 2R7EB 4QKTA 4HALA 3WNJA 3UACA 2YARA 1NIEA 4GP5B 1AZBA 3DIVA 1IBZA 3FSAA 2BP0A 3NJHA 4N8UA 5B1JA 3WI9A 3X1EA 1AQ8A 2J5WA 1GS6X 5TK2A 3ASNB 4YVUA 1SHWA 2XXFA 1WA0X 2IH8A 1PZBA 5D4JA 1AAJA 4JHUA 1IBYA 1L9TA 2HRGA 4P5SA 3H4HA 3NJNA 3ZIYA 4E9VA 1MG2C 4QLWA 1X9RA 4L0PB 2XLLA 3AY2A 2GIMA 2MTAA 4G7QB 1XB6A 3JT2A 3QJVB 3T6XA 8PAZA 2XU9A 2VW4A 1L9OA 1AANA 4M4RB 3NT0A 2J57A 3TASA 1WAEA 2AANA 1ZV2A 2BZCA 2J55A 2JKWA 2FQEA 3S8GB 4RH4A 1AOZA 4DP8X 2CUAA 4BDVA 4G71B 4FAAB 1BQRA 4UAHA 2XXGA 1L9PA 2BP0B 2TSAA 1ZDSA 1TU2A 3QJUB 4NERA 1L9SA 1BAWA 3FQ2A 3TA4D 3SBQA 3NSFA 3H4FA 1ET5A 4YSTA 1YLBB 2PLTA 2ZWNA 2CBPA 4K9JA 5ANHA 2HZHA 2VM3A 2GC4C 3UADA 4YSUA 4YL4A 3SQRA 3T6ZA 1V54B 2GB2A 5I28A 5B7FA 5D4HA 2YAEA 1PAZA 2GBAA 4HCIA 1OCZB 3GXUB 4F2EA 1A4AA 2I85A 1CC3A 2QDWA 2P80A 3NJKA 4JHVA 1JVLA 3S8FB 3NJMA 2BO0A 4YSEA 2JXMA 2GHZA 3FQ1A 5F7BA 4E9YA 2YAPA 1W8EA 2I7SA 4EF3A 2IWEA 4JKNA 3S3CB 1J9QA 2XX0A 3V9EA 4YSCA 2A3TA 3G5WA 4BDVB 1OOWA 5I5JA 2FT6A 1L9QA 3X1GA 3T9WA 5I6KA 3EF4A 2UXVA 5B3SB 1JZJA 1L9RA 3NSDA 2RACA 1KBWA 1SFHA 4W1TA 1AS6A 1ADWA 2YXVA 4BWWA 1JXDA 3WNIA 5PAZA 2GI0A 1QLEB 1DYZA 4A2EA 5I6OA
chains in the Genus database with same CATH superfamily
1W0VA 3G6DH 4H26A 4Y4KD 4LO9A 4R9HA 4XT1C 2PF6A 3QR0A 4PLJC 3CFDB 3DIFA 3K5RA 4HCGA 3ES6A 1U4EA 1I7UB 4IEFB 3TTYA 1GH7A 5HGHB 1H6UA 4BFGA 1IAOA 2CDEA 2D8KA 2VMFA 4F3FB 2PP7A 4OZHA 2XVGA 1JWMB 3GDBA 3V6ZA 2EE0A 4XNQA 2K7PA 4JY5L 5IHZB 3KS0H 4GIOA 1VEPA 4H1LG 3IN0A 4JJHA 1JYNA 3TBCA 1JCKA 2FX8H 4QTHB 1D3CA 2A0LD 3OR6B 5F0LB 2GK2A 2K6WA 4PW9A 4Y9EA 5F7FA 1HCYA 3WHE0 4GSRA 2XVLA 1UOKA 5ID0A 4R5TA 3BXNB 1JGLH 3CFJA 2MCAA 4GUCA 4S1DC 4UQ2B 5DK0A 3MYZA 3QISA 4F57L 2X6VA 2VDPB 5TK4A 1A4KB 4OIAA 3PCYA 4MRCA 4HWUA 2HP4A 3O0RL 2EINB 5F9OH 5LDSA 1Q0YL 3J8F7 2DWDA 4XNUH 3BCFA 4FEIA 1GRWA 2IH3A 1CXFA 1XH1A 2OJZH 1K5WA 4ZOEA 4LLMB 5D6CA 2AQ3A 3UO1H 3C60C 3VTAA 2FEEL 1KCRH 2YGQA 3CBKB 4WHDA 4QHPA 4BRVA 1IFRA 1KIPB 4HMDA 2OMXA 1CFBA 1DEEA 4APXA 3FFDA 5A2JH 1VB9A 1CYXA 3ASOB 4R4BA 3T71A 4ALAL 3BOVA 1GAFH 4MA8L 1HDMA 2WBJD 2J8HA 2NY6D 4GRMA 4GI9A 3FTVA 1R3HB 3B2XA 5HHMB 5TE6L 1MFBH 2XWTB 4LCVA 2IFGA 4XWOC 2NY2C 4S0TD 2XWXA 3SDAD 4O00A 5I2IB 3WNPA 4U05A 3D30A 3VM7A 3QEQB 3UXFA 1HKLL 3G5XA 5E5MA 1FLRL 1OGAE 1UKSA 3LS4H 1BX2B 2DEXX 1QQDB 1M6UA 5IFAL 4MD0A 2PPDA 1D7FA 1WG3A 2IANA 3Q7JA 1AZVA 4XRCA 4X4MA 2B08A 3B6SB 4JO3L 3AXLA 3EGSB 4WNJA 4B96A 3KCPB 2UXGA 3SPVA 2FEEI 1AE6L 1RUQL 4DUWA 4NPYA 1A7PL 2R0WH 3FU7A 3FFCB 4EI5B 2ATAA 2ZIDA 5I1HL 2D7OA 4S1QL 4P5KA 3X11B 4N87A 4KKQA 3T6WA 1A4CA 4RWHA 1W0WA 5LLIC 3CVHA 1CICB 5FK9B 3LIZA 4ORGB 1GGUA 1T5KA 3BZ4A 1N5YL 3MV7E 1G7MB 5B3NA 1CD1B 1ZJAA 4NQCE 4XN8A 4GMTL 3S88L 3L54A 1D5IL 2VDLB 4ODUB 4Y4FD 3MHZA 4Y4HA 1Q72H 2YGNA 4UV7L 1DSFH 3BO8A 3E8UH 4JDTL 2BRRL 2X2HA 4XP6H 4L3CA 2RJMA 1IM9B 2EDKA 2K6YA 2BVQA 2DQHL 3C6LD 2Z8WC 3NN8B 4LSVH 4X9YA 1ITBB 3WAKA 1DQMH 3K72A 4XCYA 2XPGB 5T8IA 1M3JA 1K2DA 4JO4L 3K5SA 4GW1A 1FVCA 3N50A 4ZW6A 1EK3A 2VN5A 5T1LD 1MXGA 1VFAB 2EDWA 5MERB 4NZTL 5D7JA 5BPPA 4R5XA 2X9ZA 1QFPA 1UWGL 1TQTA 3QYCA 3D0VA 1VJSA 1RCYA 3STLA 3LS5L 1U92A 2VLRE 3KAAA 1R19A 3BHBB 4OD2A 4P23B 4Y89A 1A14L 2YGVA 1CFVL 1UFUA 1IC7L 4U33A 1BA9A 5E4EB 3RZCC 4JANB 4ZG1A 5I1CH 3QI9D 3MBWB 4P4KC 5DVMA 2AMUA 3DYPA 3VD3A 1VADB 5E2UL 3MBXL 4JN1L 3I02B 4ALAC 1CLZH 4F8LA 1VZGA 5F6HI 4G9FD 4LOEA 4ZFOA 3DROB 4RSVA 2E27L 5AD0B 5C97A 4DPBX 5JMOC 5C09E 5HBBA 4KZEH 5LXGL 1RAMA 2LOEA 3KYMA 4U0RB 3IE4A 5T3ZH 5D9SA 4Z78B 1C1EH 1GGBL 4PG9A 3VU1A 3BGFB 1S7WA 4NRXA 6PAZA 2ZSWB 3QAZB 1ZT7B 4LCCA 4GKLA 3EO0B 4KY2A 3TBWB 1UXSA 1TJMA 3EOAB 4L3FA 4U0QB 4F91B 3GPSA 4N8VA 4ODTH 3G5ZB 4HIIB 1XF2A 2EKSA 2AK4D 2GEEA 3FB7A 4DPCX 1X5FA 4AGMA 1SJVA 3VGFA 1DQKA 2F5BL 4LFHG 4F2MA 4UTAA 2ZYHA 3PDGA 2WVTA 3D12B 3D48R 4WU5B 3DJRA 3GXMA 3ULVD 3E1ZA 1GJWA 3IEAA 5FCUL 1EO8L 1M7DA 1G0XA 4EPSA 2Q76A 5HVHC 4N25A 4I13B 4U1SB 5DHVH 3GSNA 4NUJA 3Q8CA 1IARB 2VE6B 5DMIL 4IGBD 3ZW3A 1U0QA 4KKLD 3HC0B 4F8TA 3UAAA 1V27A 3VFNA 2NCEA 3OJVC 3HZYB 2DMHA 5DD6B 2G0LA 4PJ8B 5C6PB 5EDXA 4I9XA 3IPBA 3DRTB 3SDXF 2YD9A 2QQQA 4N6RA 3D85B 2BNQD 1V8HA 4EO5A 4I0PD 1EEYB 3V0VA 2JNZA 1IEAA 2IEPA 2VLLA 4N1EA 2BVPA 4GLRH 1HINH 2R2CA 5D71L 3CK0L 1AD9B 3U9UA 3SDXB 3GI9L 2XBTA 3EYQC 3P1VA 2NY0D 2XFXB 3LXAA 4HUVA 2F2HA 4K55A 3MRJA 2I9TA 1IGCH 3AABA 1QI3A 4HD5A 4NUGL 5DVLA 3AREA 3L95B 4XOEA 2LGNA 3NCJH 3F58H 2HJFA 1JPSH 2BOCB 3U7YH 4AEFA 3F5WA 1KYUA 5ABDE 4X6CA 5BRZD 2B1OA 3QPQD 2D7TL 1CGSL 3UABA 2VGLM 4NP4L 4Z7VE 2EXSA 3LKOA 3VFVB 4A6YH 5JUEH 1GXEA 4HOXA 1K8DB 3WY4A 5I1IH 4TVPH 1XXFC 4JHZA 4Z0BH 4W4OC 1FO0H 2OZ4L 3FNKA 3PWVB 2NX5A 2DN7A 1C12A 2NLJA 4PJ7E 4P3DA 8FABA 4ANUA 1R24B 1ZS8A 5GSVB 1N68A 1YCSA 2ZKXA 4CVZA 4NZRL 5D1XE 3MRKA 5AOIA 2ZXCA 1WZAA 3MJ7A 5JHDE 4W4NA 2W9LA 1N6QL 4KTEL 3CVBA 3A0OA 3MJ9L 1KCLA 1EPFA 4HXBL 4PWKA 1PFCA 5D1ZB 5IZ7A 2VITB 2FUTA 4N2AA 2PXYC 4F7TA 3AS0A 3D8MA 1KZYA 4HVBA 2X28A 1HYSC 3LN9A 3QIWC 3WY2A 1XCQA 3QFJB 4YHIA 3D34A 3LQAH 4U2YA 1R0AL 3FSOA 2QVIA 3CWGA 3GRWH 2QLVB 1G7HB 1QFUL 4NN7B 1LD9A 3L2LA 4XHJC 4MA7H 4GXUM 4WK2B 3UIZA 4L29A 3NCYP 4UZUA 5AWNH 3UTSE 3ZL1A 4BSVA 3NCWA 4BCYA 2RALA 3DVNA 1X5XA 4Z95L 1JZ4A 1GCFA 5EU3B 1ZCRA 4BH8A 1BWWA 1I8KA 3H54A 3V4VL 3KLKA 3DHMA 5CZRA 4AYDC 1MRCL 3ZHLA 1G9HA 3QJFB 1XZ0B 1HEHC 1W9XA 4IBQA 5I6NA 1A7OL 1DJIA 1PNDA 32C2B 1XBDA 1MCBA 1OV8A 3ARDB 1YJDL 4JGJA 3T0ED 1T1WB 2VAAB 2WTRA 2E6QA 4MASA 4N6QA 4DZ8A 1KXTA 3TS8A 3TBSB 5TF1H 4YSDA 1BYNA 3PXLA 2DBLH 1DBMH 1OCCB 4NLHA 5E08L 4MNHA 2X4QB 2QSVA 4JM4H 4JNXA 3EYSH 4NRYB 1P4IH 1QEWA 5IB5A 3MLYH 4PBXA 2H32A 2VSCA 2YIHA 3HNTH 4M3JA 1OOAA 2HH0H 4HHAB 3KZ8A 4TUOB 4BA0A 3ETSA 5GRVK 2Q10A 5CEZE 1FC1A 2NQCA 1NMBL 1OGAA 3QEUA 1RULH 4GUPB 3WJJC 1NM4A 3LOWA 3I85A 1I3UA 1MCWM 1HOCB 4HUNB 4XPGL 1IBYA 2ADFL 3WFEL 1FNEA 4O4YH 3VFSA 1HEZA 1RD6A 4FKHA 4MSWA 3ARYA 3VWJD 2XLLA 4MJIB 5GHWH 1D9KA 3BUQA 3B8SA 3UBXI 2HT2D 4JE0A 3VB9A 5IM7B 4OCXL 3UPAA 3T0BA 3HBGA 4OZGF 5C0DB 1DVSA 4PRHB 2VABA 1ZGLB 1MI5B 5I6XB 1RIHH 4LLDB 1UB5A 4KU1A 2Y4SA 1AOZA 1I7RA 5IB3A 3MV7A 4OZGB 4NQCA 2ODHA 4W9JC 1I7TA 1PZ5A 4QWWC 5BO1H 3NZHL 4YE4H 2EDOA 3KPSB 1RUAH 5IIEA 3G6JF 1GYAA 2CHXA 4ZTEA 1ZDSA 5FO8A 1PS3A 3I75B 3UIYA 3QG7H 5D6DC 3ZYZA 1Q9OA 2QJDA 1MHEA 1X5YA 2JTDA 5M94B 4ELKB 3QQDA 4F8NA 4KROB 3V6OC 4HWEL 2LW3A 3SE8H 3G6JB 5ANHA 4F58H 5HHMD 2CNYA 4HFUH 2LU7A 4M56A 3O2WH 4GSXA 3EXJA 1Q0XH 1EAOA 4QRUB 1LO2L 2WLLA 3NTCL 1ZV5A 3QXWA 1AQKL 3BWUF 4KI5C 4PJAE 5FR3A 5CP7A 3RGVA 1CPUA 1QBBA 5E94B 2VLRA 1TETL 1K6QL 4Y2DA 5EUOF 2YAPA 7FABH 1JGIA 5ALCL 3ZQXA 2QVTA 3V4LA 1LWRA 4UT7L 4ANXA 3QXAB 3C5ZB 1JV2A 1KIRA 3OB8A 1YJDC 1QLFA 3GNML 4HMEA 1G7JB 1WC7B 3UYPB 2VXTL 5EUOB 5E6IC 3UEQA 1QFWH 3SDCB 1P7BA 3OGOE 3SY0A 2VR4A 3RTLA 4QT5B 3CFEA 4KHXH 4OLVL 3FFCD 4EI5D 4KRPC 2I26N 3HAEH 4P2RE 3LKPB 5DEGB 2BNRE 5FHAH 5C09A 4A2EA 1EANA 5KBMA 1S7TB 4YGAB 5HGDA 4C47A 3RWJA 5ISZB 1BQLL 2A4CA 5AL0A 1QW9A 3ECWA 3VRJB 2XBZA 4UCFA 4I3RL 2BRQA 1FC2D 3LRLA 2I60H 3I84A 5JO5A 1J1PH 3ZVVA 5IJBC 1ZLVH 5TE7L 3HHSA 2ZSVB 1ES0A 1X6NA 3RYMA 4CBZA 2LHAA 1IM9D 4L2YA 1XGQA 4UNUA 5E56A 5IMLA 3CTTA 3ALWA 2VDOL 3LHPL 4K7PH 5ESAA 3M7OA 3VDAA 4IDJL 3Q8EA 4XBEL 5C0BE 2IG2L 1MLBA 4AZUA 1I3RB 4LF3B 3U6RA 3L5WB 1SVBA 4LPCA 3MV8B 2EIZA 1HH9A 5KBDA 3TV8A 1AGDB 4EN3C 5ICZB 4HQQH 3TJPA 4Y19B 1BF2A 5C0AE 4XPFL 4MB1A 4P23D 2V9QA 3IF1B 5AFAA 4GRWH 5KAQG 3TT1H 4QRBA 4FXGC 5AW6B 1FVEB 4KJPC 4MJ2A 2P80D 3CVHL 3L3JB 3MA9H 2E6PA 2X3CA 3RFZB 2G5BA 1OY3B 5IQ9B 4PD4K 4R4FH 2R4RH 3QORC 1PZDA 1OCRB 4HD9A 3ZSSA 4QYOA 3D52A 2BOBB 3QSKB 2EADA 3FQNB 5TQ2H 2DQGL 2J71A 2WVUA 3G5YA 1RLWA 1S7QA 3GJEA 1MJ8H 1T6BX 5JIHA 3SOBH 3QIBA 4A7SA 3W5NA 1IQWL 1OKEA 1UCBH 3FB6B 2GUYA 3AG1B 1U8MA 2E74C 2EDLA 2MFNA 2ZWLT 3QHFH 1CJYA 4LL1A 3OJMB 4AW7A 2CQVA 4FQJL 4G6JL 3ZGIA 5FYKE 2VLJE 5EEUA 3FQWA 3DJTA 3MA7B 1I1RA 2ZXBA 5FX3A 2DKSA 4E0RB 2RH0A 1SDYA 5CD3A 1KPRB 2YAMA 3IJ8A 4Z7VA 4ODSH 1KFAL 4B9IA 1WIOA 2DAVA 2LU4A 2EVGA 2OR8A 3HE7C 2FVNA 4EZJA 3K91A 5LJYH 3O81A 4MHHI 1N0LB 2AQ1A 1RIUL 1Z32X 2FX9L 1CFNA 4KKCC 3QWOA 4BINA 1FNHA 1K8IB 2QVFB 4O9HL 5HPMA 1A6ZB 4PS4H 3ATAA 4PJ7A 1SHXA 2PW1B 1SJMA 2BCKB 4QLRA 1V7NH 2ZD0A 1NIFA 4FLHA 4L18A 4W93A 2E7BA 1KBVA 2XI9A 5D1XA 2Z93B 3RIAK 5IHLB 1DUZB 1SEBA 4ZFOL 5JHDA 1BYPA 3KL3A 3QZWB 4PQXA 3IGFA 1CXEA 2VH5L 1PLAA 4PJ8D 2WWKO 3GO1L 5EZJB 4DT2A 4OTXL 1KTKE 4Y5VC 3Q05A 3NZ8B 4YK4C 3OKMB 3NFPA 3OPZH 2HLAB 4DESA 4JHAL 5JQ6L 3DBSA 1IE5A 1J5DA 3FN9A 3RHWK 2F0CA 3KMDA 5J5EA 4WGWB 3VXUB 2IPKA 4O2EB 2Y2YA 5IF0B 1CQKA 2X89D 1HESA 4BKLA 3QZNA 3I6LE 1IGFL 1FRGH 1MVYA 2X4OA 2Y06H 1YAZA 1ZPLA 3MACL 4WFHD 5TTRA 3GLZA 4DNLA 1MRDH 4XGZB 1HL4A 5E1HB 1WS7A 3UTSA 2WMPA 5CLTA 4UTAL 1W72A 3RVTD 5KYWB 3S8WA 4WTWA 3IJEB 5FUZL 3GBML 5FECA 3WKMH 2IIJA 4XO3A 3GSNL 4KO7A 1TVBB 2Q86A 3AROA 4Q9RH 1MCRA 4HETA 5F6HJ 2EYSA 2ZX6A 1Z9SB 3HPJB 3MFFB 3ZK0A 3MJWA 2YN5A 4I85A 4AKPA 4HEPA 3QJHA 3N1PC 1UCTA 3CFMA 3C5XA 1NANI 5B38G 4AZ8B 4TL5A 1CG9B 2HJLB 4PJHE 3QZLA 4JUTA 5D2NE 1KEGL 3N55A 5ERWA 2VR6A 1F4HA 4QRRB 5LQBL 3MFGB 2O6PA 2QFPA 3DUSA 1JYVA 4M6AA 1UEMA 4RQQA 2BSSB 3LQAC 5IT2L 4KTYA 5MENE 3B9KA 3LEXA 3MRFA 4XAWL 3HC3L 4NOFA 3FQTA 5DD3H 4XXWA 1IGJB 3FU6A 1B3JA 2FWSA 3VSTA 2R0KH 1AKJD 3ZKMD 5DVPA 1CURA 3IWVA 2A74A 1PKQB 3MOAL 1AP2B 3FUHA 5D1ZD 3W38A 2A4ZA 2ZJSH 5IEKA 2JLLA 4GXVL 1C7SA 5DJ0A 4WWNA 3QNFA 1YEWA 4G1EA 2X5PA 4M6OH 4NBZB 3I9IA 4M93C 5E6RB 2JMRA 5T3XH 3C60B 3TX4A 3V6BR 1FGNH 1IJ9A 2IFFL 4APQD 2IWGA 5SWZB 4LGSB 1GC1C 4WUKH 2YC1A 5EPMB 5BJTA 2GFBA 5G4OA 3RX5A 3HIZA 3ESVF 4FQXC 1T3FB 1U2CA 2A9MH 2Z7ZA 5DDHA 1B0RA 1E4WH 2CLZA 5BOZG 1L7IH 5KANI 3ME0B 1A6AB 3V0DA 1MXDA 3WEMA 2NY2B 2R8SH 4CKQA 1DBKL 6PCYA 4F2FA 4H1LH 1KV3A 4MS6A 1UWEL 4NUQA 5D72L 3VVWA 1AQHA 4XCEA 5EEZA 2X40A 3EBAA 1SM3H 4WTZA 5DJ8B 4XNMB 3EYFB 1KLFA 5SWQA 2WANA 4KQ0A 5K9OB 3BP5B 3NPSC 2QMJA 2C4FU 2NY1D 1XO8A 1U8LA 2NR6C 2YXMA 5J1TC 2IOOA 1KMGA 4LVNC 3GHPA 5F1IB 1OAQL 4OKDA 3B2PA 3CFCL 4HWBA 4O2FA 4F80A 1DJXA 1KXVA 3GB7B 1QSFD 3FF7A 3BIKA 1TQBC 3A67L 3GC3A 3U9WA 2R1WB 4PJAA 4JFZH 3UZQB 1Z9MA 2FJGA 1EV2E 2CHZA 4FG4A 3VUAA 1Z5LB 4X6DF 1HE8A 5BW7C 1IVLA 3UJTL 5HVFB 1LDSA 2NW2A 1U95B 3UZVB 1CFTA 3CSBA 4WWPA 4NQDD 3C2AH 2W07B 5L7XL 2YGPA 3P3YA 2HPOA 5AVYB 1RIVH 2Z92A 2NUPA 4S1RH 4W9LC 2VL4A 4X6DB 4FFZA 1EH9A 4OZFA 1MFEH 3FCBA 4DP0X 3FUFA 4MJID 4AYGA 4NM4H 4I89A 2I32A 3OMZA 4IS6B 4AE0A 4FYRA 3ROOB 2J8UF 2GABA 3GSRA 4HJ0D 4P2RA 3UZEC 4TNEA 2MPAH 2EIEA 2WQVA 4PRHD 2HMIC 1MI5D 3MLWL 4DJMA 3IE9A 3P77A 2YD0A 2YMXH 2B4CC 1PYWB 2J8UB 3P54A 1NCWL 2R56L 2P7TB 3CZKA 5C0CB 2WUCH 1ACCA 3KPSD 2O30A 5LNEA 3BUPA 4S0HA 3MO1B 3WY3A 1IGML 3VX1A 1GY2A 2A6IB 3GMQB 2FK9A 3DV4A 5CJXC 5FUCC 2WZ6A 3DMMA 4DQOH 4PIBA 1S5HA 2H8PB 3RZCB 3DSFL 2GAZA 1DVQA 4QRPB 1AXSA 5EEVA 2ICEA 4OM1H 1I7ZA 4P4KB 4PJBE 5C7XH 3RGBA 2CHNA 3IMVA 3ALXA 5C0BA 5IJDC 4OLEA 4D0CA 4NI3A 3WKQA 3BSHA 1SBSH 1BAFH 2R69H 2Z35A 5CBEA 2Y7LA 4RGNE 5DLLA 5J6GA 1S5IL 2PR9A 3O6FD 4G80B 5C0AA 5TD4A 2WNWA 3Q1SH 3V0EA 5AVZB 4J5VA 2CO6B 5F88A 1RURH 1PW3A 2P8MA 2R51A 3UO8B 1A7QL 5ILTL 4D7BA 2GJRA 1E7UA 3ARWA 1QAWA 2WQXA 1CR9H 3S3PA 1FZOA 4LNRB 3ET9F 2VMEA 3VA2C 3SPIA 2YBRA 1JJUA 2DQEH 2WV3A 3JZ7A 2CJ3A 2E56A 3NAAH 3SJVE 4FXKC 1FZKB 2O6FA 3JYBA 3TPUA 4F7CB 3RP1A 3UPCA 4UIMA 1ZANL 2O5XH 4ZMTA 5GISL 5CN1A 2QQNH 2VJ8A 1ONQA 2P9RA 3QG6B 1M71B 3UG3A 5ISZD 4GSDH 1ZOXA 5DSCB 5G4MA 1NIEA 4XH2B 4FNPA 5GGRA 1T04B 1F1AA 5I8CA 1E5CA 1J0KA 3IGAB 5HVHB 4X98A 4MAYB 2HFEB 1YNLH 2DTML 2NYYD 4FI6A 4AY0A 3GSVB 4OV5B 4HIXH 2D7QA 1WZLA 1YEGH 3ISYA 4N8UA 2VLJA 4FQLL 4YAQB 4GJTB 3QNZB 3KXFD 4NNXB 3H3KA 4K94H 4QDGA 1U8IB 4XX1E 4Z7NE 1VGKB 2L3BA 2V33A 3VGEA 1F4WL 4GH7B 1K4DA 5EZPA 1AAJA 5BXFA 5E9DA 3FQRB 1S7SA 3VXQB 2J8OA 4GQRA 4LSTL 2DQMA 3TWCL 2APSA 3N1MC 1KZQA 3QCVL 2XY2A 4B50A 4ELMF 2VDRH 3LZOA 3Q2NA 5F8RC 5F72S 5DWUH 2WWOA 3U30C 3RTQD 5JLZB 3DHPA 2IOIA 4IOSA 4B53A 3WTWA 5TFSH 3SDDC 3T65B 4Y19D 1KIQA 3MLXH 3M8OH 4ELMB 4ONGL 4Z76A 5K59E 1NCUA 1BBJA 1P5VB 1FAIH 3EYUH 2B9AA 5CIPH 2DQTH 4WFGD 2EAEA 4NJ9L 4EXPX 3P4LA 3FH7A 3CX5K 4HV8A 4PWHA 5LAXA 4PJDE 5J8OA 1TEYA 3NFNB 3LDBC 4PUBH 1N4XL 2ADIA 2A1WH 3HRZC 3P0VH 1U8CB 1FNAA 2VWEE 1BXXA 4JS7A 4XCNA 4YDKH 2C1OB 1AQDA 2PABA 1AC6A 2WNGA 5J56B 1CE1L 4PP2B 4YHZH 3SQRA 1E2WA 2Y2TA 3QXUA 2XJKA 3HNSH 2OR9L 4A7VA 5INDA 1LK3H 1CC3A 2M8XA 2VB5A 5JPNA 1K72A 3WSQH 4U6HB 1RMFL 3Q5YA 2YSSB 5DJCB 1EJFA 3LN5B 3FRUB 4OZ4B 4PJFE 1SY6H 3BZDA 2WN3A 3L1GA 3MUJA 2A3TA 3G5WA 4WO0A 2P5WB 3EFOB 5GRJH 2PO6A 2PXYB 4IDLA 1KGWA 3L81A 1RZIB 4H88L 3K71B 2JIXB 4PJHA 1TU2B 5B3SB 1ORSB 1UG9A 3QIWB 1HZKA 5D2NA 1KBWA 5JW5B 5I1DA 2A9BA 3U9PH 3PGDA 5DQDL 1I75A 1YG9A 3KPQA 2ETWA 5MENA 2NNCA 4HCRH 3CZFB 1HWWA 4PS3A 2DWEA 3SQBB 4N8CL 1UUSA 4PRBA 3BWZA 1HOEA 1A7BA 3NPZB 3O45B 1BD2E 1DO6A 1G7QB 2BVOB 1A7RL 4OLUL 1P9MA 2PPAA 4E9QA 5H35A 2VC2L 3VXUD 3DX3A 3U7AA 2DLIA 3FCGA 4W9HC 3CVCA 2VSKB 5D1QD 5F1KC 2AXFB 3LZPA 3CE1A 4JFEE 5H37A 4Q6IC 2VDMB 1IC4L 3FRPG 2ZX8A 1OAXL 4ETYA 5JHLH 1BM3L 2CZNA 3BFWA 4QXVA 2I27N 2EE9A 2NZ9D 3C87A 3F05A 2QVKA 3TVMD 2ZXQA 4NB7A 3VFUA 2E9WA 3HMWL 2D9QB 2HKHL 4PLJD 1J5OL 4AQ1C 1F41A 5KOVC 1LWHA 1B0WA 1Q94B 3O6KH 3VFPB 1QFOA 1YY8B 4QHNB 1JRHH 2PWEA 4P59H 4LRIC 2QKIA 1IMHC 2X88A 5L6YL 4LCWB 2PKDA 4JREC 5C2BH 5E99H 3ARPA 1WICA 2Z0BA 3HG1E 5HGBB 4ZFZB 3BDXA 3R0MA 5IW1B 2FZ3B 3N44F 5F96L 5AW0B 3GT6A 1BG1A 2ILLA 3PHAA 4QRRD 4ZOCA 1F97A 1NPNA 5EU6E 2ZCHH 5I15L 1T1YB 4KY1L 4S1DD 4PS7A 2IALA 5FM8A 5AYUL 2DI9A 3VH8G 2DMCA 1J5IA 3MNMA 3N44B 3B2DC 4M6MH 5IVNA 4JBSA 4Y2LA 5I1GH 3VFRA 1S9YA 4MCMA 4NQSA 4UBDC 5LGKA 1W72L 2EEFA 3O2VL 2ZXGA 1D7BA 2XWJB 2QADC 1BZDA 4LL4A 4WIQA 3RU8L 2MNJB 4LVOC 4X7SL 2HAZA 2WZAA 4UIKL 1ZLUK 1L6ZA 1BMWA 4BKSC 3EH2A 1AO7D 5CSBA 1YUKB 4YUEL 5EBWB 5SWZD 2ZT9C 3UTPE 4KNSA 4YMPA 1D5BA 4KI5F 1XCWA 4JKMA 5E4AA 5K59F 5JW4R 4POYA 2EYTA 4XWOD 2NY2D 5IUSA 4XTRC 2GSMB 3TO4A 2ZWZA 2ZUSA 5AENA 2XWRA 1U6AH 1ZT4A 3QFGA 1OE3A 2F1BA 3PV7A 1LO0L 3PABA 3TCLB 2E7MA 4V1DB 1W6WA 4HKJA 2B0SL 2X4PA 3T09A 2V17L 4XPTH 3T2NL 4RIRB 4UDUB 5LBGA 1JFQL 2APVA 5GS3A 1MFDL 2K6ZA 3H0TA 5BZZA 3VGDA 2Y07L 4BZ2H 4PJBA 1KTJA 4L8DA 4FDWA 5TPWH 3GS7A 5E6IB 3GHEH 3PJLA 2ID5A 4F8PA 5GGSY 1HCFX 1PGRB 4DOHE 3PRZA 1MAMH 4NO5A 2Z4QA 1IVTA 4KRPB 4G8IB 4RETB 5LO7A 1IC5H 4PTTA 1A6TA 3POHA 3ZTJH 1FE8H 2OMZA 4IOFC 4OJFH 4OCYL 2BHFA 4JRXD 3AWGA 2AK1L 4MMXC 4G6FD 4TULH 5ABZA 2GTZB 4L3EB 2LQRA 4WI0B 3IDNA 1P84K 1B9ZA 2ZUXA 2Q7NA 3V79C 1RLBA 5EZIL 3F84A 4J1UA 5CZXD 4PV8A 2VISB 3AMLA 4NNYB 3RY4A 3SJVA 1MCFA 5C9JA 4RDBA 5EO9B 1T03H 1JMXA 4HOMA 3AQDA 3HG4A 3WG7B 3L5IA 5DEFA 4MKTA 4GEIA 1IKOP 1L0XA 3BLKA 2UWEE 2MNUA 1EFXA 2X1QA 1J5CA 4EN3B 2K8QA 4HWBL 3FO0H 4K2UH 2OCCB 1JDAA 1W0VB 1YYMH 4LESA 2AQRA 2P1YA 4ZW7A 4CMHC 4H26B 2VXQA 4LSSH 4NNPH 1KBGL 4FXGB 3QUKA 3KPPB 4DP9X 5I66A 4OUOA 3ES6B 4QRPD 2V3EA 2UZIH 1OT1A 3RFRA 2Z31A 1IAOB 4OZHB 3K8KA 1NCDL 3QORB 4XNAA 4G8FA 1FH5L 1U93A 4NQXB 3T5WA 3HZMA 4FFZL 1NDGA 1KGIA 4XP9H 1HHJB 4LQFL 3TF7C 1A4JB 1XFPA 1U41A 2WNXA 3HFMH 4OSUL 5ID0B 1EZVY 4JHBA 3MJ6A 4HULB 2R2HB 4HZAA 4V11A 1CYWA 2FQFA 1ZRUA 3QXTA 3H56A 3HN5A 2CKBH 3LKRB 5C0NC 3UJIH 4YHLL 4PSRA 2CRYA 4XXWC 1DFXA 1LO5B 4N2KA 1TR7A 4F37K 3UX9B 1KCVH 5HJBA 2D7MA 4Y1SA 1MCKA 3PGCA 2VSDA 4K3GA 4PJDA 1CDIA 2E86A 5DHVB 3RVVD 3HS0A 2LLNA 3DX6A 3DHUA 3L5JA 3VE0B 2VDKL 1CGVA 4K94C 1YNKH 1DLFH 3MNWB 4CNIA 3BAEL 1T2JA 2IWFA 3HE7B 3VSVA 5D6CB 1E6OH 2VNCA 3ZZQA 5L2JA 2ZX5A 1RZKH 2BLFA 3V9CA 4R26L 2AXWA 1Y6KR 3A21A 3LZFL 1YEEL 2ZAIA 4NO2B 1DEEB 2ADGB 3VCLB 1QRKA 4MAYD 1TZIA 2WXKA 1A1NA 1EGJA 4PGCA 1WFMA 4R4BB 4X2UA 4CDGC 4P57A 4HK3N 5JXAL 1SXCA 3L8QA 2NY7L 4QXUL 1SDAB 5BUAA 4PJFA 1RZJL 2H0PA 2QSCL 4PGJA 1R3KA 2J2ZA 5AOMA 3AB0C 1JZGA 1TZOA 2NY4D 4PJCF 4Y5VB 3U1SH 1CBVL 3MYJB 4YK4B 3D4GA 1DE4B 4XVSL 1CB4A 1BQHG 1N3NA 1YEJL 1ZLDA 2XETA 1J9SA 2QGBA 3B7UX 4PRDA 3SKMB 4ZODA 5JW4M 4QO1A 3WXWH 2Y7QA 2WQAA 1YDPA 4PJCB 4XWGH 4MD0B 2PN5A 4DGVH 1L9NA 1QVOA 3QIUA 1NSNL 4LCIL 3MROB 1Y6MR 3QRGL 4FFVC 3CQPA 4U6YA 3U0WL 1WAAA 2QZ5A 1VFBA 5DMGD 3FCUB 4WSKA 5INCA 1S9WB 3UROR 1U3YA 4EZLA 4KMQA 4P5KB 4RA0C 1BD2A 4FQIH 1ZA3B 1Y0LB 2CBQA 1P1VA 3MAWA 1BFVH 1YN6A 2E7HA 1ADQA 2IGLA 2FYVA 4R7LA 5IMOB 5ADPL 2DQDH 3BP6B 3RDTC 4QGYA 3QQNA 4G5AA 3QWRD 4TVUA 5LGHH 3RRQA 3NQIA 2AXGA 5K9JH 3BO8B 4JFEA 5A16B 1DQTA 2BIQA 2DD8L 3S97C 3Q6FA 3KR3L 4YDZA 2NNAA 4AC4A 3QXVA 4JFPA 1E6JL 3RWHA 1BZ7A 5EZOH 1AR2A 5GQBA 4GG6E 1RUML 2LVEA 2B9BA 5KN5B 3K7UA 1PLBA 1K2DB 5F1NA 2ZOLA 3UBHA 4NFCA 4GW1B 1FPTL 2X7LB 3SOTA 1KN4H 3D33A 1YEHL 4X6EA 4CVWA 1D6EA 1VGEH 1MJUH 3LB6C 1XH0A 1GR7A 4Y7OC 2OMWA 1DCEA 2KDGA 1NBVH 5IOKA 4CA4A 2FL5B 3KYKL 4OD2B 4O2CA 3S2CA 3F85A 1CXKA 2JIXD 4JGUA 1HYSD 2WY3B 4M4RA 4QXGL 4U6XA 3ZN6A 1YEKH 3L9YA 4GPVA 2XQBL 2Y69B 1QRNB 3PJSA 4YIQB 4XBPA 4M93B 4R97C 2GSIB 2CPCA 3MLRH 1H3XA 4S1SL 3K74B 2YRBA 1AY1H 2X44D 4OFKA 4IBLT 4FQXB 4G6MH 4N0CD 1WTGT 3EXLA 1LE5A 3BAYA 3R1GH 2XZAH 4R8WL 5DEJA 4DWHA 4WFEE 2X4RB 4J3WA 4RRPA 3IGKA 2Z34A 4WCYH 1G9EA 1ZHNA 2BP5M 3P3RA 1U3HD 4LEXL 5K69A 4JHUA 1UOLA 4U1HB 3NJNA 4HSQA 2W0LA 5GZNC 1X9RA 4L0PB 4Y16D 4XZ4A 2GIMA 4V33A 1F2QA 5FDWA 5I1KH 2XZQL 4G7QB 2J44A 4C54A 3NPSB 2R1XB 2WXFA 2WIIB 5CMAA 3SB3A 1KTCA 4LLVA 4LVNB 4F7MA 1KC5L 1W91A 2Y7SA 3TJEL 2OS7A 4MMYB 3EO1B 5F2FA 1AMYA 1TQBB 3EUUA 4MXQC 4PJ5B 1MHCB 4DKFH 1FHGA 1H19A 5BRPA 4YE0A 4KITB 5DD5L 2BVTA 4ACTA 3L1OL 3L4ZA 1KT2A 2C9QA 3BN3B 1RHHA 3RY6C 2G3XA 4U1NA 2FO1A 4FERA 1BBDL 2V3FA 2C9SA 4JX0A 4LCWD 4GO6B 1S7RA 2CGRH 3BIBX 4K3DH 1IBBA 2IMNA 5CUSL 2F08A 4MJ5B 3H4FA 3BCDA 2BSED 3F62A 1TLMA 4RMBA 5FYJU 4QRQB 1F6AB 2JB6B 1Z3GH 2OA9A 1CFSB 1NLBH 1TCMA 1MJ7H 3BUIA 3FB5B 4TSBL 2QDWA 1XGPB 1UENA 1ZE3C 2QR0B 2BO0A 4Q9CA 4YSEA 3Q0HA 4WK0B 5AVVB 3EJZD 4EVNB 1JZ8A 2PW2B 4ZFFA 3D06A 4QWWD 2D7PA 2JJSA 4FABH 3NESA 3WTSA 4ISVB 2K70A 3H3PL 4MRBA 4ZS7L 4FTDA 3LSOB 3GPEA 2NSXA 3X12A 1VEMA 3B43A 4JN2A 3TONA 3F12B 3PQYB 5IVXF 1JXJA 1Q9LA 1N18A 2VUOA 5PCYA 5PAZA 1ZHKA 3KHQA 2D0GA 3EFDL 4X7CC 5CZVH 2A99A 4LHJB 2UWEA 4P8QA 1YMMB 1U33A 3TF4A 3L6FB 4LLUA 4KI5D 3WTYA 5IVXB 2NXYD 2LE9A 1OB1B 3SGEI 4A66A 2RR3A 3F6IA 4GKNB 1BVNT 2DMBA 2RIKA 2DQ6A 5JPNC 4V1DD 1XGYL 4IU2A 3BSGA 3T8XA 2JXMB 4XI5D 3FCSA 1MQKL 3GS0A 4AYEC 3FYIB 3ZUCA 3KDMA 3RWIA 4XPAL 1N0XH 4HAGA 3AG2B 4UM9B 2CBMA 3M1BB 4C4UA 2F61A 2UZXB 3MKKA 3EGXA 4ERSH 2ARWA 4OVVA 4FXKB 4ZUWA 2X1PA 4KRPD 1TZ8A 3D1MC 4QIRA 2VR7A 5T3XE 2VQTA 1QSZA 1MCEA 3S2AA 1ZGLM 5GGQH 5FYJE 4HIHA 2XIIA 1KIUB 3BUBA 5A2IH 1KGYE 3GMMB 4Z3FA 1T22B 1E4JA 5GJTL 2ZYRA 4L3ED 4L29B 2C3VA 2Q7YB 1IKFH 4GRWF 4WI6A 5B3JE 1HSAA 4MLSA 4GY4A 5C07E 2HFTA 4M00A 1XL4A 3D2UA 3AUWB 4F7PB 2KZ1B 4N22A 5FA3A 2ZCKL 2VLME 4HYTB 1MH5A 3WLBB 3VD0A 3QWQB 1VEOA 5T1MA 2O93L 1KUMA 4YH6A 1JZDC 1PLGH 4M5SA 1FL6A 2W38A 5E2JA 1SEQL 12E8L 1QSEB 1YRKA 3D39B 1E4XL 1QPXA 2DQCL 2N7AA 4CSTA 1F4XH 1H6TA 3SDDB 1NAKL 3KJ6L 1RJCA 4Y88A 4XAKE 4NO3B 1OCWH 1SJXA 2ZOKA 4OFVA 2FX8L 4XHQA 3TZVC 3FTYA 3MBEA 1IM3B 5C0GB 3F7YA 3D09A 1PFOA 5FOBB 3TC9A 2H32B 2HKAA 1QTYT 4X8CA 2E9IA 2Y9RT 4G3YH 2VDQL 3JTBA 4FYTA 3L4YA 4XN9A 3WTTA 3PWNB 1ML0A 3QORD 1FL3A 4OB5L 1H15B 3LDBB 2HKFH 4FJ6A 3HRZB 3T6VA 1T5WA 4PB0H 2X6UA 1FNEB 4NWTL 3X1BA 35C8H 1TT6A 3VMPA 4XN2A 5CR1A 3DXAE 4UQ3B 4XNUL 2CMRL 2DL9A 4FS0A 1RZFH 4LSRH 3G7TA 1KWKA 4RGOL 2EVFA 2VOTA 1E4XI 3HAEA 5CU5A 2B7DT 1P2CB 4RMQA 3VQ1C 4R90L 3ZR5A 1KCRL 1T4KB 5ELIA 3VG0H 2OPCA 5EZLB 2X3AA 5IVZA 3L9RA 4NQUA 5SWSE 4RAVA 5F7UA 2EUZA 1NCJA 4B9ZA 3IDUA 2CUHA 5K5YA 1MFBL 5EULV 1MW2A 3LNFA 2VXQL 2F5AL 1CDJA 1BREA 2CXKA 3HE7D 4A55A 4YXLL 5GS0C 4YXHL 1DBJL 2YPKA 5AOKA 3RJOA 4IBWA 2QELA 4KKCD 1I8MA 5I18H 4LL9A 4GUOA 3KG5A 1S7XA 1MFCL 4GG6A 2ZCLH 2B20A 3BVDB 1EZSA 4HS8H 4E41A 3LS4L 1ANUA 4PREB 1BAGA 3LPWA 3S96A 1JYWA 4NKOA 1QASA 1DVFC 5F9WC 2Y36L 1W8OA 2OW7A 1PQZA 5CP7B 5I1LB 3SE9H 3V9FA 1VF5C 2PTUA 5IW6A 2AGJH 5DHEA 2BZ7A 3V52L 3RWGA 1IT9H 2A6DB 1NBZB 3PV6B 4FC3E 2IAND 5E2VL 2C9PA 5K9QI 2CRIA 2UXTA 3RWDB 1IFHH 1RJZA 4Q6IB 2IDFA 2ZKMX 3HR5A 4H8WL 4OFYA 1CT8B 4RX4A 5DLML 4DZBA 2AJVL 1WEJH 1EHAA 1Q72L 2C1PA 5FGRA 1KB5H 3ZTNL 3FT4A 4LSVL 3IKCB 1ED3A 1FFPB 4BM7A 3N42F 3HCVA 1G0YR 2ZTBA 3DGCR 2BFGA 1OPOA 5AW9B 1JYXA 4AQ1B 1EGJL 2P26A 1T0OA 2DLTA 4D8PB 4PRNB 3NJGA 1IC1A 3N43F 1E27A 3IBOA 3PS6A 5GRXG 1U8NA 2GJ6E 2OV0A 3BEWA 4BE5A 2CA3A 3N42B 1ZLUH 4Y4HD 4DQAA 4EOWH 5KSBF 1RFDH 4BZ1A 4KAQL 4JREB 4L4TE 4ZTPL 3GRGA 4RAHA 4AG4L 2CLRB 4OLYH 3P0YL 4FJZA 4OQTL 3P40A 3X3FH 3N43B 4B7IA 3O4LE 2CHWA 4HMCA 2B14A 1KXQA 1NGQH 4NAMA 4ADGA 5KSBB 1A0QH 1V3JA 5FKPA 4P0DA 3GJFA 1S9XA 3DX9B 5D7JD 1PG7X 2AC0A 4U1MB 3SCMC 3VNYA 1HH9B 3NP4A 4JG5A 1CLZL 1ECZA 3QUXA 3APFA 1PX4A 4M1GL 4QOKE 1S8DB 3SO3C 3T1FA 2FIRT 3OGCA 1UM6H 5A3ID 4BGDA 1YQVH 4M8VA 4LQ1A 2QADB 3ILPA 1KDJA 4JJ5A 1GMIA 1JE6A 4LVOB 4KZEL 1NZRA 3O2DH 1QRND 1FN4B 2H3XC 4A2HA 3DBXA 4H1LB 3RL1A 1ADQL 1AZZC 1C9SA 2CDGA 1SMOA 5KZCB 1EERB 2NXZC 1YSOA 4JM2A 1IBGL 3GSXB 2AJZB 3MNDA 2PP9A 3Q13A 4FQXD 1YYCA 3PXJA 3WFHA 2X70A 1YPZF 4YSQA 4BXSV 1S7QB 3RG1C 2VSMB 1T4WA 3UTQA 4N1CA 3KVQA 5DJ2B 3KH3A 4JY6B 1ZHLA 4YSRA 3WUWB 3RL2A 1U8MB 3FK3A 4YWGL 1YPZB 4U49A 5DRXB 1X5LA 4QHUA 4PYHA 3T77B 3VW3H 1G1CA 3UDWA 3I50L 2J5LC 4FNLH 4XVUC 3QAQA 5E00B 3U1QA 2Q3ZA 3H1ZA 5IFJB 2NR6D 3KBHE 1O7VA 2DQUH 4ENEC 3IWUA 5D8JH 2YBGA 4ZQKB 4GP4B 3KM2A 1SN2A 4NYLB 1TJHH 3VXOA 5B1BB 1PG7H 4DVRH 3PHOB 4G8EB 1DLHA 5E8NA 4B95C 1KTBA 4N0YL 4PJXE 2XG5B 3VRLE 4GQ9H 1MEXL 2Y6SC 5EWIH 4KVPA 3GSWA 2F7QA 4MCZA 1JI2A 2FEJA 4Z77B 1PZUB 4MMXB 2GTWB 4K23L 5SV3A 3C8KB 1PZ2A 5A6IA 1E43A 3X1FA 2MQCA 3CXFA 3HUJE 3K80A 4PJIE 3PY9A 4UOQA 2UY7A 4ICWA 4OY9A 3KJ4C 2NY5L 3V5DB 1KJMA 3F58L 2VMJA 3MLSH 4TLUA 4YGVA 3MX0A 1JPSL 3ARZA 4X7FC 3SPHA 4E42A 1J8KA 1UJ3A 5A40E 5JNYA 2EE6A 3QO0A 2HX9A 3ETBJ 4JM0A 3SYOA 3NIDF 3ZDXF 2HMID 2OXHA 3GRBA 4RMRA 3HLAA 2F18A 2CK0L 4DHLA 3S3SA 1EEUA 5GGUB 4TTGA 3BVUA 3WJMB 3NIDB 2A38A 4HSAC 2DI8A 3ZDXB 5C07A 4Z0BL 4MX7A 2CO4A 4CMHB 2W9DH 3S5LA 2FATL 2BW4A 3GUFA 3K2KA 2VO8A 1CLVA 1EHKB 1WBZA 2XPYA 1NEZA 2Y5TA 5F7WC 1FYHB 1DQJA 3QA3A 1UXWA 1D7DA 3IMRA 3BVWA 2FWUA 2BERA 1G0DA 4ZMLA 2BIPA 3ZL2A 1YMMD 5ESQB 3CD4A 2DLHA 4LARL 4NKQB 3FSAA 1EHXA 5ERWB 1ZAGA 3U46B 2C7FA 3RNKA 5DUPH 1K4CA 4AYMC 5AW4B 1AQ8A 1JGUL 2HT3D 1ACYH 3NSJA 4EI6A 4HUMB 4AM0Q 2B1HL 3K1DA 3DO4A 5CCKH 1YC8A 3DK2A 4KFZC 1NAMA 1G7IB 4G9DA 3TFBA 2ADJA 4OGZA 5EU4B 2E46A 4JB9H 3H42H 4AJVA 2NY3C 4OJYA 5AWNL 1MLCB 3QUYA 4HUWA 3Q01A 2V9UA 3SE3C 4HBCL 4R7DA 4I3SH 1IIIA 3VX0A 3WN5A 3QHZH 1PX8A 3C6SA 1J0JA 3QRBA 4Z7UE 5DRNA 4CADA 3KPOB 3PL6C 3DXAA 4ZMZA 1A1OA 4OGAC 3UYRH 3A4FA 2GCYA 5IBUG 3CZLA 4GS7C 1DN0A 4JRYB 4G6AC 5I8KH 5AZ2L 1INQA 2UVEA 3U4AA 3IDJA 4HT1H 1S4IA 2P5EB 5SWSA 1IGIH 1TVHA 4YQXH 4AQOA 1IIKA 2X6CA 1NUGA 4JM4L 3AB0B 1EAPA 2XG4B 3GM0A 4XCEB 3WFBL 1IX2A 1P4IL 3VFOB 43CAA 5CIPB 3MLYL 3OXSA 3T3PF 3GI8L 5ETUA 1NCCL 3IXTB 3MGOA 3X14A 2WLNA 4MWFA 3VFWA 1FJ1A 1IGYA 3AY4A 3GXUB 4QJ4B 2KI6A 2I85A 1MHHA 4NZFA 1C5CH 1N12A 3SDDD 1M2VA 4D3CL 3G5VA 2PR4L 3T3PB 2LLGA 3AU1B 1SYVB 4O4YL 3V8CA 1KPUA 2R69A 3BIKB 3KPLA 2G75A 4GO9A 2IWEA 1KEMH 4G7YL 4PJAB 4ZUUB 2OYKA 2JI2A 5MI0C 4KWUA 4RNRA 3GMLB 4KMTH 5I16B 1M7IB 1KNOB 3X1GA 3CDYA 3WIIH 1OGAD 4HIEA 1DFBH 4PCSA 3BJLA 5DVKA 3GSOA 3TJHD 1H6FA 3RDTB 2QEJA 3TIEA 4IRJA 1P4BL 2B59B 4JPIB 3BKCH 2FLMA 3NACH 5J9PA 3FQUB 2J6WA 4OZFB 3BGMA 5D7SH 3ZQWA 3PAZA 5ADOL 1G9MH 5BO1L 4PJXF 1D9KD 1Z5HA 3JYCA 4QAWA 5IFHH 3WGUB 1IBDA 1RUAL 2QTEA 4H44C 1EHNA 5BV7H 3ZDZE 3RZWA 2ITFA 3OLEA 3SQOL 2PTTB 1G4RA 4R4NC 4TS6A 3K0YA 4FQCL 1DUYA 3PWLB 1T0MB 3MOBH 4PGBA 1XGRA 2ZNWA 2IXQA 4R0LC 3ZMNA 4KDWA 5GS2H 4NT6B 2V5MA 3MRHB 5KYYA 5D70L 5JHBA 4NQCD 2GJ6A 4NZJA 4JFQA 3D3VB 1Q0XL 2XJLA 3GMOA 4F8QA 1XF4A 3JTTA 3CBJB 1T21A 3QR2A 4L4TA 4NO0B 5HGAB 3ZYOA 3DV4B 5IR1B 1KWGA 1KTDA 5KS9F 3OXRB 4WF7A 1TZHB 4F24A 3O4LA 4WO4A 2GI7A 4R97B 2CO3A 3CN3A 2IBBA 1GPOL 3LKSA 2YPVH 4QCIA 4XZUA 1O0VA 5L2KE 3WTUA 5EO1B 1BEXA 5KS9B 3V0AC 2IPUG 4ZPVA 1NQBA 2DZEA 4ELDA 4F92B 1GKEA 2CBOA 3DTUB 4WV1C 3IM1A 5EBGA 4P3WA 4EUPA 1ACZA 4QOKA 2OZNA 1HCZA 4LKXB 3HN8A 1I1FB 3NA4A 2AI0H 2R1YB 5FHAL 3IDYC 4R2GC 5DC9B 1HVXA 2I9LB 3KWWA 4OT1L 4PRAA 4Y8DC 1OAYL 4BFOA 1YUHA 1I3VA 1QHQA 1MDTA 3SN6N 2O6EA 4KI1A 4X7TB 1I4FB 3ILQC 7PAZA 4IU3B 4KDVA 4A39A 3II2A 2W65A 2XTJC 4LIQE 4KXZI 3JWOL 2B3IA 4DKEL 1HHKB 3ETTA 1G6RA 2H2PC 1UD2A 4AEHH 3UYOD 1QYGH 3O3AB 3OPUA 3OKKB 5HYSA 2JI1A 3AWFA 1MAKA 1ONQB 3ARFA 3NYKA 3L3DA 4PWEA 4UB0H 2X09A 3IMBA 2HG0A 2EZ0C 3G08A 4M8UA 2MH4A 1R5WB 3GKZA 2JKRM 3ZL4L 5DURB 1KPVA 1QFWI 2W80C 3Q3GB 5JXEA 5E1IA 2BVYA 5CJOL 3BZEA 1MPAL 2X1WL 2D73A 4UNTA 4HQQL 4Z7UF 4ETQA 1A1MB 3X3GH 4WJKB 4YHOL 5BXFB 2F54E 5E9DB 4BUHA 4DK3A 2HG5B 5EOQL 3K6IA 3S48A 4JKPL 3TT1L 5DI8B 5E8EA 3PJNA 4HDIA 1KOAA 4UMGA 3CFQA 4HUXB 3DECA 3S3DB 4DN3L 1GZQB 3NJVA 1NWOA 3E6HA 2YHGA 3N85H 2VXSH 1WFUA 3DRQB 2NOYA 2J25A 4I48A 3EH3B 3HFFA 4R83A 5J06A 2FR4A 1KACB 3MR9B 3KL5A 2R29H 5TQ2L 2QADD 4PJGF 2CGYA 3BEVB 4K5NA 3SOBL 5LB1A 2H26A 2HA1A 3HUJA 1LEKB 4PJIA 3RDJA 1UCBL 4O02H 1SJHB 5HY9A 3QHFL 4PJGB 4F27A 3Q1EA 2IPUK 3U36A 5BS0B 5KZCD 3SDYH 1NC2A 4NGHH 3MN8A 4Y1AB 3KPMA 4BZ1L 5I30H 5BVJB 3UTTE 5KSAA 2WCSA 5IROA 4TRPL 1U8KA 3B2UC 3BMWA 5DR5H 3VXSE 3ULVH 3QIBD 4XTRD 1UWXK 2CCVA 5CGTA 3LRSB 4D9RD 3SYPA 2NTFA 1HH6A 2HTLC 5HHOB 1EAJA 3P9MA 1X5GA 2DWXA 4C57C 3EJUA 4LPXA 4UOW1 1JNNH 5JPNB 3PF2A 4JZOB 2IVFC 4PV9B 2NT0A 1KY7A 1RUKH 4F9LA 1WSST 1NGZA 3GK8H 2PP8A 2CPUA 3WFCL 2Q9OA 3B34A 4KK8C 3CHOA 1HHHA 2PO6B 3MZGB 4KJQC 1MF2L 4R7NA 4XX5A 3DTXA 1I9IH 3GIZL 4OIIL 4JQIH 3MOQA 1EEZB 2GJZB 1JHLH 1TXKA 1ZLEA 3OPZL 4FLSA 5HI3C 4O5LL 4YFLI 3SKJL 4ZUTA 2O61A 3LH8A 5EBMB 3A4EA 4HISA 4UTBA 1SHMA 5JHDD 5AW8B 1XXDC 4FXLA 2P24B 2VL5B 5A2BA 2YD2A 4RMWA 5FFGA 2Y06L 5IBLC 5CSZA 5DS1A 1MRDL 3L3OA 1OCOB 5DUBA 4XN1A 2W0PA 4WJG3 5HI5C 5J1SC 4W70A 2ZG3A 3COOA 4X5WA 1U91A 4U1JA 3HZKA 1X4YA 1HU8A 2GVYA 1LQBC 1WS8A 4KK9C 4HGWA 3KPRB 1A3RL 1EZLA 1I85A 3FMGL 4P9ML 3U0TB 1I9EA 1UKQA 5F7EH 4NC2B 2KH2B 2OMVA 4M5ZL 1HK6A 2J1KA 4PR5A 1HXMB 4QF1B 2XTSA 1N59B 4G8AC 3WELA 1A2YA 3H9SE 3VFUB 1CLOH 3TZVB 4YDJA 1T5XB 4GFTB 4I77H 3OKEB 3TCTA 3AACA 1EZVX 1DQVA 1EJ8A 2J88L 4UV4H 4X4KA 4P46C 4Z7WF 3RHWF 5KVFH 1LWJA 4OGYH 4ZYKA 1JHTB 5CS7A 3FT9A 1OK0A 3A22A 2EYRA 2BP8B 3VWJA 1Q1PA 1T7ZA 5T33H 5KAQF 2QSQA 4GAGH 5DTFA 4Z7WB 1KF9B 4EEEA 1LE9B 1MVUB 2NNRA 1JZ6A 4G43A 3JV0A 2CDFA 1CVSC 3QUGA 3JUYA 3BKYH 3OKOB 4M6OL 5T3XL 3B9KD 3DX2A 4G8GE 5C0ND 3QJRB 1RSYA 5FYJL 4CAGA 3T2LA 3FTUA 4WUKL 1JWUB 1E67A 3BFQG 1HN1A 2YXWA 1JK8A 4JO1L 1OT2A 2XV3A 1E4WL 2Y1ZA 3CDFA 1P1ZA 1FUNA 2WTOA 3L2MA 1FNGA 4N1HB 4ZAKA 2W9EL 2WO3B 4B3EA 5IESL 2X12A 4G83A 4H40A 4H20H 3V55A 4ENZA 1HWGB 4NHUB 4JFTA 4AGOA 3CN4A 3F64A 1R3IH 3CSFA 3EW3B 4WDIA 4A67A 1ZIAA 4J8RA 5F3BA 3H7BB 4DPRA 2XX1A 5KYUA 4M7JH 2J56A 5C2UB 3WS6A 1OO2A 3EOBA 4JM2C 4Y2OA 5G55A 4AMKL 1BYOA 3ZE2E 1HHGA 2MSPA 2OMTB 4KHTH 3FUJA 5TH2B 5JORA 5C8JB 1DVFB 4BQBA 3P4MB 5F9WB 4ABVA 2VMDA 4WU7A 3WIFB 1ZT4B 2N56A 2G2RA 4G2AA 4RFNC 1OLZA 2FECL 1XGTA 1NTDA 1ZA6B 3IRPX 3KLAB 4JFZL 4GBXC 1BOYA 2C3HA 4QUOA 1VERA 4Y4KB 1NAML 3APDA 3JV5A 2HVJB 4HK0A 3CX2A 2FSEA 3HI6L 3SBWA 5ICXA 5J3HC 3C2AL 2IGFH 5IB2B 5L2KA 4N28A 2MPVA 4FFVD 4S1RL 4MDRA 1G94A 5IMMA 2BS8A 3MSPA 3UJJL 4NO5B 3LPOA 1G9MC 3FQYA 2N3JA 1A6TB 2VDPH 2VZ3A 3MRQA 4NM4L 1N67A 2JQZA 4LPVA 5DJYB 5TF0A 5I17A 1BVZA 1TKWB 1SLUA 2LTQC 3IDIA 3IK2A 4FULA 4J3OG 4K9EH 1NICA 2RQEA 4GQPH 1NFAA 3W0WB 2KPWA 2NY6C 3WV0A 1PPIA 2VDNL 1RK7A 4OFQA 4JFOA 4JRLA 1M1SA 3SDAC 2X4NA 2YLHA 2FECI 2YMXL 3AM8A 3L13A 4HH8A 1U8QA 1IAKB 1F45A 1BCIA 4N3TA 2QQKH 3UACA 4B27A 2UZYA 2NDGA 2WUCL 4AYBA 1QLEL 2D4FA 3RILA 2BDNH 5AB0A 4QHLA 1FIEA 3OLIA 4GP5B 4MNQB 1BVKA 4M6NL 1G1KA 4XMKH 4DQOL 3E1F1 3WI9A 4MMZC 1FL5A 5DJZA 3GMPB 4DW2L 1WFNA 2J5WA 25C8L 5IJKC 5C7XL 3ZE0E 3LB6D 5SX4H 3WD5H 3SCMB 5TGBB 4WHYG 1EXGA 1UADC 4RRPM 2ZYSA 1BAFL 3D3VD 2XKNB 4NENA 3SO3B 2R69L 2HCZX 4AL8L 1E5UI 3MCLH 3CFKB 4X9FA 3AY2A 1BF5A 2TRYA 4OVUA 3EKCA 3RGHA 4NO0D 3QJVB 1KLUA 1UACH 3DMMD 3QUKB 4L1TA 2F54A 5B38B 5DD0L 2PYEB 4RFEA 4LLQB 5HYQB 1RURL 3B9EA 3SO5A 5JDSB 3L3KB 4MNGE 3FB8A 3OVUB 3LEVL 4PMFA 5HDBF 4F93B 2RAMA 4FNSA 5C0BD 2DDQH 4NRZB 3LZNA 4TN9A 3S8GB 1C5BH 2NXZB 1OM9A 4RH4A 3QO1A 2Q6WA 4LHUA 2H9GB 3CVIL 4MXWL 2GT9A 3C5SB 3EJSA 5HHVH 2DQEL 1F8TH 3NAAL 1NL0H 3QDJE 5CZXC 4JPKH 4Y0GA 1BJ8A 5HDBB 1MCWW 3M17B 5HHNA 3S3JA 4E5XA 2XZCH 4DN4L 4L23A 3FO2A 4BSJA 3IMTA 3MNZB 3OV6A 2ITDB 3VFMA 3TH4T 5DYOA 5GZND 3UPRA 4K3JL 4FADA 5I76A 2E7DA 2ZCZA 4AE1A 1OGPA 1YNLL 2J5LB 1YY9D 2FJFB 3BWAB 3MKGA 4FP8H 4HIXL 4QD2E 1YEGL 5AKSA 5IK3A 3K6SB 1WBXA 1KBBA 3DX6B 4EE2A 4F9PA 1JUFA 2YAEA 4HCIA 5J12C 3UTTA 4F2EA 4GSUA 1BEYL 2RA1A 4YDNA 5B39B 2FD6H 1J8SA 2DH3A 2EACA 3NJKA 4ZPTA 5BZWB 3FO9A 5KW9L 3ZDYE 2AKRB 3VXSA 5L2JB 3VXPA 2W60A 1XF3B 2EDXA 4MXQD 4R84A 4JR9H 2DTSA 4Z0XA 3QI9C 1IEHA 1MFVA 5DURD 1JD7A 4BFIB 1TZIB 2GK0B 2VDRL 4GRLC 5FO7A 2WWNA 2D31A 4AGLA 3WEXB 1I1CA 3MRDB 4H8QA 2OMBA 3EYOA 4S0SD 5TFSL 1H3PL 3KPTA 4F7EB 4WWOA 1FFOA 1CVRA 2E59A 3NSDA 1EXUB 2Q8AH 5E9DD 1GZPB 1QLRB 4N0RA 2WC7A 5IKCA 1JXDA 3BW9A 1MWAB 4UQCA 1LO4L 3KJ4B 3RPIA 3ZTEA 3SKOA 4JDZA 2XRAH 2YMTA 2DQTL 1AZCA 1HXKA 2EC9T 3P69A 2X0VA 3P4OA 43C9A 3I6KA 3MJ8B 1JDCA 1U58B 1ZHBA 2EDHA 3VJ6B 2WYZA 4IOSD 2N7BA 3UGEA 5J1AB 4OIBA 3V4UH 1ZK9A 4B97A 1OZUA 4QXTB 1UA6H 1QVOB 4ZX6A 3KLHC 4OD1L 2ZNXA 1G6RL 5DD1L 4A7GA 4PUBL 3ZT7A 1CGWA 1G7LB 3QJXA 3P0VL 1NUNB 5TJWK 4EAEA 4HUUA 1MFMA 4LK4A 3ARSA 3IJYA 5B7MA 4S11A 4YDKL 3RNQB 1ZVSA 3ULVC 3PWJA 1ETZA 3DURA 1GGIH 2DQIH 2XVKA 3E8VA 5DXWA 1JERA 2IV8A 2QHRL 1P7QB 1HC1A 2VZVA 1RHFA 3F7LA 4YXKH 3OF6A 2MMXA 3BUYA 3WSQL 4G11A 3U6XS 1F5WA 4OUUB 2Y72A 4IGBC 5LCVH 4KKLC 1T83C 4Y1AD 1WA2X 5J0BA 3BZFB 5J57B 3V0JA 4ZTOL 4QR7A 1E28B 3CZNA 3W2DL 4NCDA 3UEZA 5BQ7A 4EZKA 1B4JH 1M05A 2JCCE 3KW8A 3IYLW 4I0PC 1BZ7B 4RMSA 5HHOD 3V7AE 3FQXA 3QH3B 2ZOLB 3INOA 3H9SA 1H8OA 1KJVA 4JDVA 5H2BB 3HS8A 2V9TA 5DO2C 1B2WL 3FF8A 3U9PL 3W56A 4DCQA 3B9AA 2EDEA 3STBA 1CGUA 1H3UA 3ZZ1A 3T2PA 3TBTA 2NY3B 3ATDA 1OB0A 2HN7A 2PO6D 4P9HH 4CC4A 3PHQA 2VO5A 2XNAB 4HJGB 3QPQC 2HX7A 1FSKC 2G60L 3PL6B 3EBHA 3ASWA 2VERN 1JMZA 2OTPA 1UZ8A 3QW9A 3RVXC 3K6NA 4GS7B 2H1LM 3I6GA 4Z18A 3UP6A 4D0BB 5MEND 1SVCP 3SSGA 3KL0A 4LLAA 4JZJA 3PXHA 1QP1A 3OKDB 4ABWA 3BRDA 3SPJA 1SXAA 4DH2A 1J8HE 5A7EA 1T7YA 3K81A 4M1DL 2JQMA 3HE6A 2OMNA 4TQHA 1G7PB 3FUIA 3T0DA 1UD5A 1AS8A 3KPRD 1L7TH 1L5GA 4R6UA 1V3LA 1AZUA 1JRHL 3JTSB 4P59L 3LH2H 3M7FB 5B4MD 2W81C 1QFWM 3ZO0A 5C2BL 5E99L 3GXFA 5LDUA 3CC5B 3OX8A 5HYEA 3TZVD 2ITCA 2VXVL 3NJJA 4ZOAA 5DVOA 5MI0B 2W8CA 3RAJH 3K1KC 3AG3B 1MAJA 1T6WA 2PWDA 3QWNA 3H53A 2BSTA 5GSRA 3CZSA 1P7KA 2H3KA 4UTBL 1HHIA 1Z9OA 4I1RA 1ET7A 5J6HA 2AABH 4M6ML 2OLDA 3O6LH 1F00I 5I1GL 3WNOA 2HFFA 2EUWA 4L4VE 5BZDA 1AMXA 4IBZA 3LZLA 4LPTA 3VI4F 1BPLB 3FT3B 1KG0A 1N64H 3OAUH 5E8PA 1N6VA 1J0YA 2EIDA 5EEWA 5DUMH 3GIVB 5EO0B 3WFDH 2PMZA 2A77L 4HCFA 4RGMC 1JRHI 2AERT 1DBBH 4TPRH 3ZRCC 3VI4B 4AJWA 4OF8A 1RVFH 2I24N 1UZ6E 1JXKA 1KDIA 2H3NB 4R0LB 2MQGA 1TZAA 5E5UB 5EN2B 1FFNA 3CBRA 5F7NC 5F97E 4OI9A 4JPSA 1FYTB 3ZE1E 5FDYA 5KOMC 5DMKB 2VM4A 5IJVB 2VRQA 1V05A 5GS0D 2XT1B 1HQRA 1IFGA 5DFVD 3VD5A 1U6AL 4MQ7B 5KVGH 2OYMA 1O6SA 1A3LH 1AG6A 4WLCA 3HI1B 4IHOB 1WK0A 3OM3B 4NQVA 5JOEA 3GMRA 3F7QA 3UGUA 3N1QC 1X5AA 2G2NA 4D8OA 4ZXBA 2WXIA 4IJTA 5FA4B 2OP4H 5IMKB 1GW0A 1ZHKB 1JS4A 2NSMA 4PJ9A 1DVFD 1MFUA 5FM5M 3FUKA 2E9JA 1OW0A 3GZOA 4LBAA 3DC0A 1OGTB 2OL3B 3LN4B 2XA8L 5TPWL 2A73A 1X7QB 3MXWL 4Q14A 4WV1B 5AW2B 3ESOA 2Z91B 1HS6A 1GW6A 4P4RB 2XOTA 3IDYB 4R2GB 3T8XB 1EEQA 1FE8L 4F9LC 1O75A 3MLUH 4OJFL 4RAUA 2XV2A 2WW8A 3OZ9L 4X99B 4MNGA 2XTJB 3ULAB 4UF7C 4JDEA 2XY1A 4L1SA 2FRGP 4BFEA 2JCCF 3VGGA 1NBYB 1GGYA 2A6KA 1B0IA 4UOW0 5I73C 2NNFA 1F1GA 4G42B 3TT3L 3IU3A 3FL7A 4HIPA 4XB8A 2IDUA 4E9WA 1S7UB 2A83A 4UQ9A 4KZCA 2KBGA 1U8HB 2YA2A 3W9EA 2VN7A 2BNUA 3GBNH 3IRZA 4CVUA 1DQDL 2LAGB 4XP4H 5T5NG 4U6TA 3R0NA 4U7SA 2C3VB 3VRIB 3LMJH 1BQ5A 4EIUA 3LRGA 4YEFA 3Q43A 1MW1A 1EXHA 3HVNA 3D2UB 1JN6B 3AC0A 4BEIA 3FO0L 4P2QE 4K2UL 5I74C 5JIKA 2QGCA 2Y7NA 3ZBMA 4PVNA 2M2DA 5EU5A 1R5IA 3FRPB 1P6FA 4ZK8A 2YPLB 4LSSL 1AIFA 4E9SA 5M7QA 3FZUC 5T1MB 4K7PY 3R7RA 4GT7A 5BNXD 3CH1B 5FKAB 2UZIL 3FSZA 4PJEF 1UWXH 2XTLA 1EFXD 2R15A 5I5MA 1F3JA 3S4SA 1T0NA 1GHFL 3Q2WA 3MNVB 3ORJA 4IIQA 5EC2A 4BYHA 4XP9L 2IDTA 3BAXA 3MRCA 5MEOA 4RZKA 2ZX7A 4PJEB 2WJ7A 3VD9A 3CQFA 3EG9B 4EIBA 2V0AA 4W6WB 4F1SA 1WZ1H 3I9GL 1JZFA 3FU8A 3HFML 1F11A 3P73A 5CILH 2APWA 4C4KT 2Z6FA 2DQFB 4HEME 1FG9C 4FFYH 2F8VA 4N2DA 4B9GA 3UJIL 2WSPA 2GC7C 3AGWA 1P5UA 2V37A 1E4KA 1FL3B 2NXZD 2LFEA 5EN3A 4OJDH 1CDGA 1JGVL 1KCVL 3G3LA 1JZ3A 4LIQL 5H8DA 2D2OA 3BPLC 3NVQA 1RU9H 2MQ0A 4HS6A 4KPHH 2AXJA 4W9KC 3QK0A 5C0JB 2ZXEB 2MKLC 3FS9A 2FYYB 3AG4B 3VXMB 5JQHC 5DJXA 1KB5A 3V6FA 5DWPA 4N2EA 4X50A 2A5UA 3ZHNA 4FI7A 2UVFA 4FTVB 3M46A 1QG3A 2AQ2A 1JPTL 3LKNA 3P2BA 3V4PH 2IV9A 2NZ1A 4RAVB 5I82A 4XVUD 2A6JB 4P23C 3JWNH 3V5KA 1GGCH 1QPKA 2V4LA 3ENEA 2ZOWA 1CU4H 3VQLA 3CC1A 5CLXA 2LFGA 3U1SL 1UZ6F 2GYSA 1S7XB 1UXMA 2R0LH 3WS6C 2DIJA 4KNTA 3WE6A 3D4CA 2WO4A 3S0PA 2Y6SD 4E41B 2UX7A 3LZQA 4OLXL 1RZPA 2WXQA 4F33A 1LGVA 1JF1B 4Y9FA 3WL9B 4P2OA 4DGVL 3SGJC 2V3DA 1S3RA 2CJUH 5HJGA 2D3JA 2DYPB 2CUIA 2EH8L 2F53B 3DSNB 1Q9KA 1GYCA 2K78A 3WO4C 4JFDB 2XN9B 3G6AB 2H0FA 2R7EB 4JUSA 4QKTA 4OZIF 3MV9B 3TGXA 1U4FA 1UB6A 1TJIH 5JYLA 5IWLC 4FQIL 3VDBA 3ARUA 3TO4D 5JPMA 1CIUA 2X9XA 1IBZA 1TQVA 3JWDH 5B1JA 4PG2A 3QIUD 2DQDL 4HW6A 3GBLA 1RJZB 1KCSL 3ML9A 3O6MH 4M4PA 4OIFA 4OZIB 4HKZB 2WCPA 4BIKA 4A04A 4LSQL 5LGHL 2L0DA 4UUJA 3WHXB 2Z1KA 3LV3B 1MKFA 5K9JL 2ED9A 1URZA 1VFOA 2YGOA 3AT0A 3FH5A 1FIGH 3D2TA 3L7EA 4X6FA 2E47A 4G7VL 1ED3B 1P7QD 1ORQA 3ROLA 5EZOL 1MCOL 2MTAA 1WAPA 2VIRA 3FDWA 4NKIH 8PAZA 4Z1PA 4PRPE 1FZMB 3R8BB 2WZPA 4A7TA 1A9BA 4P46B 4X7DC 2ZUWA 1KN4L 3U0PB 1SOKA 3BEWB 4Q4IA 3VI3F 4AXWB 5ICYA 2VUYA 1MJUL 2IQ9L 3OR7B 5LUMA 4JFED 4XP1L 3UP1A 2OXGA 3ARGC 3L3IB 4MZRA 1Z1WA 2D03H 4PI2A 3T2QA 3BKMH 3OZLA 1MRFL 3VI3B 3HNVL 4UAHA 1IKNA 2BY2A 4N9OB 4BFFA 3BH8B 4W9FC 2ZWSA 3WY1A 5AAMA 3O3EA 4G9FE 1I1AA 5L4JA 2D4DA 2DJ4A 3CDGB 4TQEL 1AY1L 1KBPA 2YEZA 2PLTA 4PRIB 2NY3D 4UAOC 5IBTL 3TCXA 5MHSE 3R1GL 3O11A 1WIPA 5HDLA 4L8CA 1F6LL 3ILPB 3I3DA 4UT9H 5FF6B 4UM8B 5AB9A 4L4VA 1FG2B 1PAZA 3H6JA 1F90H 3PL6D 1HT6A 1EMTH 1I8LA 2EKJA 4EDWL 1KFGA 1CF8H 1U42A 2P44B 4OGAD 3SODB 4CW1B 2SEBB 2BMKA 1IGTA 1W8EA 3EYVB 4QKXB 1T2QL 4G6AD 4JM2B 4KXDA 4CGUB 5I1KL 1KELL 4UYQA 1XSKA 4BDVB 1BGXL 1A47A 2X70B 1BF8A 3CV5A 2WINA 1OM3L 2JSFA 2YWYA 1XIWA 4FEMA 5CWSA 3JV4A 1CD0A 3VFGL 4ZX4A 1ZHLB 4JKWA 4RFNB 3U4KA 5CEXB 1QMUA 4GT0A 1TG8A 4DKFL 2VN4A 2MHAA 4GBXB 2WB7A 4QHUB 1V3MA 6TAAA 5I6OA 3VU2A 3MRBA 3PNWA 3NK4A 4XXDA 1RJYA 4HU8A 1F58L 4Z7OE 1ITCA 3W9DA 1BOGA 1XMEB 2PPCA 3P02A 2VAJA 4P3CH 5MP6L 5EUKA 1NOLA 1V55B 4M7LL 5DJAA 1U8PA 3BDYL 2BNQE 1LXMA 4N8VG 4MD5A 4MBRA 1L0QA 3T4YA 2ZUQC 3EJYD 3FFOA 5TDPA 1OAKH 3M86A 1YC7A 3OJ2C 4YR6A 1B6DA 4IMKA 4APQC 1A02N 4AEEA 3AQZA 1J1OL 1FFRA 1GJUA 2E5EA 4I2XB 1NLBL 2LTQB 4AQAA 4N0UE 3GSWB 1MJ7L 3E3QE 4JY4B 3SGKC 2NY6B 3IVKA 4M43L 5E24E 4Z8FL 1BQHB 3K0WA 1NCAH 1U21A 1ILUA 2AV7A 3SDAB 1IAIH 1HTYA 4P5TC 2P8PA 4Q0XH 1VKXB 2CG9X 2OSLA 1AGFB 4FJYA 3D05A 2K8MA 5BRZE 1GYUA 4FABL 4AUYA 3MX0B 4ANWA 5I0YA 4DP4X 4R4ND 3QO0B 3D25B 2DQJL 4JG1H 5GGTA 3PFQA 3QUZC 4MMZB 2VN6A 1IJNA 1MREH 4M03A 3KCWA 4TSCH 3T08A 3KEDA 2R83A 4IRSA 1WWCA 2NY1C 1BVLB 5CR8A 5KANG 1N8ZA 5CZVL 5F1OB 1HXYA 3OAWA 1P4LA 4GFXA 1S9VA 2QPSA 2Y5EA 3BT0A 4KUZH 2AQNA 4JFUA 4M61B 4Y4KA 1SDDB 2OX5B 4H25B 4P2QA 5H4ZA 4N9GB 4XNXH 3RBGA 2BZDA 4J3SA 4EBQL 1AFVL 4AQ8A 4PH8A 4GQZA 1XV8A 1QI5A 1CZ8H 1UXWB 4D9LL 3PDOA 5KVFE 4JZNB 3CGTA 3TNMB 4I0CC 2NW3A 2BFVL 4ODVH 5CAYB 1QWHA 4Q6KA 3WS3B 3DETC 5E70A 3MTRA 3UC0L 4ERSL 1JZEA 2R2EB 4MTMA 4JQXA 3RNKB 4UI2A 1CN4A 3FSWA 1TTBA 4HJ0C 3N91A 3HI5L 1ICTA 1XH2A 1MCPH 5GGQL 1E9QB 3IDGB 3IBEA 4JY5H 1C5DA 2ADJB 5TE4L 4HEMA 4HPHA 5L4FA 4NSKA 3ULUE 4XMUA 1IKFL 3NIFE 5A2KH 4IBYA 2OULB 3MRNA 4JLRA 1H0DB 1HKFA 4H8HA 4WHYH 5D5ME 5J12B 1JTPA 3O41A 2IQAB 1Q9WB 4L9LA 2K3TA 4PP1C 5EOTA 2ARJQ 3C75A 1QTPA 2FIKB 5H94A 3T0EE 3QQ4A 4QHMB 3QI9B 4W9EC 2YN3A 5DRWB 1VZHA 3ZXAC 3O0RH 4GRLB 2BSDA 1KB3A 2Z4TA 2WBJA 2BSBA 5CINL 3HPLB 4LBEA 4S2SA 1HQ4B 3GXTA 2VDNB 4MA3A 2WO2B 1IL1B 3D2UD 3DO7A 1XR9B 5F9JB 1L9MA 2XA3A 1LNUB 2KZKA 5FGBC 3O6FC 5FM5O 3OB0K 4QRSB 4Z5RA 5I0XA 3D50A 1JWSA 3HE6C 1GS8A 2Y0SA 2ZP0T 2YPLD 1J1XL 4LU5L 2G2PA 1SMAA 5TDNA 4AENB 3OXSB 2APXA 1RZGA 1IAMA 4ALAH 4MA8H 1A6UL 4L8BB 4G3YL 1AGEA 4O02B 5LAPA 1WTLA 3DX8A 5TE6H 2AK4B 1NINA 2A7BA 2AV1A 3ULVF 1SF5A 2K1MA 3ZX1A 1MHHB 4BFRA 1HNYA 2FGZA 2WKOF 2HKFL 2YA1A 4A2LA 1GY1A 4MDJA 35C8L 3MBED 4OLWL 1E30A 2G75B 5C0IA 1HKLH 1T20A 2X87A 4QGTA 1BQKA 1AGBA 1FLRH 5JOFB 5L4MA 4Z9KB 3LHAA 1R3JA 5HXMA 1PJ9A 4X83A 5IFAH 5EORL 2X41A 3F01A 2NYYC 4R96A 3RJQB 4MZ3A 4X0KA 3L1EA 1QZNA 4IGBB 2YRPA 4JO3H 4PGDB 2NMSA 3QEHA 4OCNC 3TIEB 3O9WC 4P05A 5T1KA 1A65A 4BXVA 1AE6H