1CYXA

Quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
158
structure length
158
Chain Sequence
KPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMHSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGICAEICGPGHSGMKFKAIATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane-exposed domain from a respiratory quinol oxidase complex with an engineered dinuclear copper center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords CYOA
total genus 41
structure length 158
sequence length 158
ec nomenclature ec 1.10.3.-:
pdb deposition date 1995-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF06481 COX_ARM COX Aromatic Rich Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1cyxA00
2DYSB 1PLBA 3FU7B 3IE9A 2JXMA 4FA7B 2Q5BA 3CVCA 3CVBA 2PP8A 1PAZA 4YSTA 1J9QA 5I26A 6PAZA 1RZQA 2DWTA 4G7RB 4KO9A 1IBZA 4P5SA 3GYRA 1V10A 4G7QB 2QPDB 1ASPA 1F56A 3AG4B 5ANHA 4A67A 1PMYA 3JT2A 4GY4A 2HX9A 1XB3A 3L45A 2FNWA 2QT6A 1J9RA 2AFNA 2EIJB 2I85A 3QJSB 4KOCA 4KNTA 4Q89A 2GI0A 2YAOA 3CVDA 1ADWA 1PZAA 4A2FA 3FSVA 5D4JA 2IDUA 5B7MA 2VN3A 3H4HA 4M4RB 3NJFA 1BYPA 1ILUA 2XV3A 1KBVA 3N2JA 1TEFA 1KDIA 5I6OA 2NRDA 4DP6X 1KYAA 1WS8A 4E9YA 1HFUA 2XV0A 3IN0A 4EF3A 2FTAA 3NJNA 3PXLA 2BO0A 3ZDWA 1A8ZA 1E30A 1AANA 1A4AA 1L9OA 2X87A 3NP3A 5A7EA 4BXSV 1N68A 4ENZA 1YLBB 4UANA 2VM3A 1SHXA 3OD3A 3NP4A 1PCSA 1JZFA 1ET8A 2ZWNA 1GS6X 1XMEB 5B1JC 1X9UA 1NWPA 1KBWA 2XLLA 3H56A 4N4YB 2FJSA 4HCGA 4E9XA 3S3DB 1ILSA 2VM4A 4E9TA 4JKNA 3G5WA 1X9RA 2GIMA 4PCYA 2IH9A 3WI9A 2Q9OA 3FSZA 4BWTA 2P80D 3U25A 2B3IA 3NSCA 2FT8A 1NPNA 2N0MA 2AVFA 4AKOA 1KV7A 4A2DA 4DPCX 3S8GB 1AZUA 5LDUA 1AAJA 5TK2A 1JZHA 3TBCA 2CBPA 3OMAB 1SDDB 2XX1A 3EH3B 3SBQA 3OMIB 1CYWA 1ET5A 3AG3B 4P5RA 3NSYA 4HZ1A 5F7BA 2VW7A 2IDQA 5B7FA 1HAUA 3UAEA 2VW6A 3ABKB 3AY2A 1TU2A 3QQXA 3FU7A 1NICA 3FQYA 2IWKA 1M57B 2W88A 2FT6A 5D4IA 1DZ0A 1ETJA 1OF0A 4CSPA 1VLXA 2HLEB 2Y1AA 4DP5X 2QDVA 4YSPA 3WKPA 3QJTB 1SJMA 2UXFA 4X4KA 3FYEB 4CSZA 2FQGA 3QJVB 1FA4A 2IH8A 3FU9A 3X1NA 3SBRA 2AZAA 1SF3A 3T9WA 2XU9A 4F7KA 1ID2A 1NWOA 4BDVA 4HCIA 4AX3A 1BXVA 3HB3B 4UF7C 1PNCA 1MZZA 2HRHA 4E9WA 2BP8B 2YQBA 2YAPA 2VMJA 2YARA 1AACA 3CZUB 4HHGA 1NIFA 2WO3B 4GP4B 2IDTA 1JXFA 1HAWA 1E5YA 4PAZA 1R1CA 1AZRA 3NSFA 4YSDA 1OV8A 7PCYA 2IDSA 2QDWA 1AS8A 2YAHA 3IN2A 2PLTA 1RKRA 3AW5A 1PNDA 1JVLA 1AZBA 1OE2A 2TSBA 3TBBA 3FPYA 3TA4D 1NIAA 3ABMB 1XB8A 1B3IA 1A65A 1ZV2A 5I6MA 6PCYA 3FQ2A 4E9QA 2WO2B 4DP8X 2R7EB 3NJIA 5B1AB 2GBAA 1EZLA 2GC4C 1ASOA 1JXDA 2GB2A 3TU6A 4KOBA 1NDTA 2PPCA 4F2EA 1N70A 1CUOA 3EH5B 3PPSA 5I5MA 1WAEA 2BWIA 4DPAX 1E65A 5IY5B 3WIAA 2FT7A 1WA0X 2FWLB 2FQDA 3D12B 2MRYA 5I6LA 3ABLB 2GSMB 4DPBX 3UGEA 1PZCA 1OCCB 3KW8A 2B08A 1RZPA 3WNJA 1ZIAA 1I53A 4GXFA 1JZGA 1J5DA 1M56B 4KO5A 1L9QA 1FWXA 1PZBA 4A68A 2VSKB 1AQ8A 2LLNA 3FSAA 1JVOA 5PAZA 5B3SB 2DYRB 1A3ZA 1A4CA 2ZOOA 4YSAA 3NJKA 3WKQA 3ASNB 2RACA 4HAKA 2PPEA 1JZJA 1BAWA 2XX0A 1RCYA 2JFCA 1PF3A 5PCYA 2A3TA 1IUZA 1AIZA 1WS7A 2WSDA 4HALA 2OV0A 3MBWB 4BXVA 3S8FB 1OE1A 2IWEA 1OE3A 4HIPA 3T6WA 3ABGA 1BQRA 1J9TA 5EHFA 4A2GA 2BP0A 1A4BA 4AKPA 1JXGA 1ZDSA 5AZUA 1ZIBA 4BWUA 1E5ZA 1V54B 2BP0B 2GC7C 1W6WA 2I7OA 3PCYA 5D4HA 4JHUA 3FSWA 1W6LA 1URIA 3UAAA 2W8CA 3SQRA 2MTAA 2BZCA 3FQ1A 1L9TA 4ZK8A 4NAJA 2AZUA 4YSRA 1ASQA 3KW7A 3X1GA 3RYMA 3ZX1A 2PCYA 4YSEA 2J56A 4HCFA 1L9SA 3EH4B 1CURA 1JOIA 2BW5A 1SFHA 5B1BB 1EHKB 1ZPUA 3PAZA 2J5WA 5I6NA 1SHWA 3OQRA 7PAZA 2EIMB 2YXWA 2BW4A 4A66A 1AR1B 3NJLA 1QNIA 1E67A 1AZNA 1QLEB 1GY1A 5F7AA 2VW4A 5I5JA 4GP5B 1CYXA 3V9EA 3QJRB 3DKHA 3AZUA 3AG2B 5I6PA 3QPKA 4RH4A 2YAMA 3S3CB 1NPJA 1AS6A 4W9ZA 3NJHA 1AG0A 2UX6A 3C75A 4YSQA 3ZBMA 3NJMA 4L0PB 3PAVA 2XXGA 4G7SB 3H4FA 2PCFA 4YSOA 2XUWA 3ERXA 1T5KA 3EHBB 8PAZA 1M9WA 4AZUA 1TEGA 2BP8A 4JHVA 1JERA 4DP0X 3CG8A 4TXVB 3BQVA 2XV2A 4KNUA 3OMNB 2HRGA 1MZYA 3T6XA 4K9JA 2HX7A 2CUAA 5B1JA 1AZCA 4QKTA 2DWSA 1BEXA 3NSDA 3SBPA 4KNSA 3ASOB 1IKOP 2H3XC 4YSUA 2XVBA 2EILB 2UXTA 1MDAA 5B7EA 3T71A 2PP7A 4GYBA 2X88A 1GS8A 3EF4A 3FYIB 3UADA 4BK5C 4QLWA 5E9NA 3GDCA 3JTBA 4KO7A 1SDDA 2H47C 4A2EA 4AI7A 1BYOA 1NZRA 2IAAC 5I5IA 3QJQB 1V55B 2JKWA 1XB6A 4YVUA 4DP2X 2BWDA 3X2QB 2YAQA 1JZIA 2R7EA 2HX8A 1NIDA 2DV6A 4DP4X 2QPEB 3GXUB 4G72B 2XWZA 2Y69B 4MFHA 4E9RA 2CJ3A 2ZONA 1AG6A 3OM3B 1IC0A 1ZDQA 2CAKA 1AS7A 3ZIYA 1JZEA 3TASA 1DYZA 1SF5A 1BXUA 1SNRA 1PY0A 3T6VA 2BZ7A 2I7SA 3FT0A 1W8EA 5TK4A 2IDFA 1KCWA 4W1TA 1SFDA 2XYBA 4BDVB 3HEIB 2FQEA 3UACA 1MG2C 1BQKA 3X1BA 1OOWA 2E86A 4DP1X 2J57A 3CDZA 2DY2A 1NINA 2ZXWB 2GHZA 4WTQA 3X1FA 1NIBA 1QHQA 2PPAA 5I6KA 4F2FA 1CC3A 2HZHA 1KGYE 2BHFA 2UX7A 2P80A 4GP8B 5AKRA 4AKQA 1L9RA 1WA2X 1BQ5A 2YAFA 4FAAB 3UABA 3PAUA 4M3HA 4N8UA 2CALA 4E9SA 1IBYA 4YL4A 3X1EA 1L9PA 4G71B 1KCBA 4YSCA 1J5CA 1OCZB 3NYKA 1BXAA 1GS7A 2YAEA 1PLAA 4UAHA 4WKXA 4Q8BA 1OCOB 3FU8A 2TSAA 9PCYA 4A2HA 4E9VA 3T6ZA 1GY2A 1NIEA 1GSKA 1UATA 1GW0A 3NJGA 1ET7A 2YXVA 1J9SA 1TKWA 2EIKB 2PPDA 4KO6A 3PLYA 4G70B 4YVNA 3WNIA 3QJUB 2VSMB 2UXVA 1AOZA 1MG3C 3V9CA 1OCRB 2UXGA 2H5UA 3WG7B 2HXAA 2PP9A 3IEAA 2EINB 1KDJA 4DP7X 1GR7A 3DIVA 5AFAA 4YSSA 2IWFA 1GYCA 1NTDA 2AANA 2OCCB 2XXFA 3CDZB 1FFTB 5FC9A 5I28A 2OJ1A 3MX0B 3NT0A 4DP9X 4HHWA 3S3BB 3DTUB 3N55A 1WA1X 2CCWA 3IBOA 2J55A 3FPXA 1PLCA 3NJJA 3BVDB 3AG1B 5B1KA 2FQFA 2PPFA 4BWWA 3FS9A 4NB7A 4NERA
chains in the Genus database with same CATH superfamily
2GITA 2E46A 2ZKHL 4YDKL 1OEZW 2R2EB 2H26A 3V4LA 4XNMB 1N6QL 1J9QA 1AGDA 2GHWB 4MNGE 1MPAL 1EEZA 4LPWA 5KUKA 5GISL 4JDZB 3ABZA 2WMPA 1E8WA 2R2HA 1V8HA 4OQTL 2VISB 4PJ7E 2VR7A 3AG4B 2C3HA 4KMTL 1KYOJ 4IOIB 2HX9A 4A7GA 3GHEL 1AH1A 3JWDL 3ZDXE 4QRRA 2CKBL 1DR9A 2DYPD 4H0HB 4M7KL 3EZJB 4HJTA 1SHSA 2HN7B 4A2FA 2KHAA 2C3XA 3AY4C 2X4UB 3QG7H 1HOCB 2VZOA 1QA9B 4GKZB 1B4TA 2O4EA 1ANUA 1JTPA 4JZOA 5DJZB 2W0FB 3MFGB 2C1PA 2NUPA 4KK8C 1HFUA 2AJVH 3NJNA 3RI5F 4U1GB 1CL7L 1E30A 4KVCH 3BDYH 4K4KA 2R0LH 5C07B 3RWDB 3TEXA 3OPZL 3IWUA 4FG6C 4ENZA 3AM8C 1U6AL 2N1KA 5TDPB 4A04A 5E2VL 3VXUE 4ZTPH 3LMJL 1UXMA 1BZ9B 5GS2H 3RJOA 3FT1A 2IH3B 3BP7B 4XMZA 1NGPH 2JKSA 4Y5VB 1QNZL 1MW0A 1KBWA 1LP9F 1H8OA 2FJSA 4NAQA 1RIHH 3JWNC 5AZ2L 4GXUM 2NY6C 3MJ7B 4OGAD 3KDMB 4M8UA 2GIMA 4M5SA 1I1AD 2ODHA 2JCCA 4KZEH 4LCUB 1A3RL 2C9XA 2W07A 4KH2A 3RHWK 1E4KC 2ZUXA 4LP5A 2BVPB 1EQWA 4DGUA 2R2HB 1MI5D 2FEJA 4N90E 4A6YB 2WXRA 5JW4M 4BFIB 1I7RB 3MLUH 1EEYB 4BUGA 2Q86A 4DPCX 5LDUA 1JGUH 2QFRA 4PGZA 1HSBB 1IT9L 4Z76B 5IJBC 3O3BB 4PJFA 5I8KH 3AQZA 4HW6A 4IGBA 4N6RB 3ALPA 2P5WE 2NYZA 2UUDH 5T1KD 3MROB 3LEVH 4AL8L 1Q1JL 5TH2B 1DCEA 2NY5L 3GSNL 5DRNA 4GBXD 1CXEA 3G6DH 3H8NA 2JIXB 2TAAA 3OX8B 1ZA6B 5CKAA 1NICA 2BVEA 3BAKA 2IWKA 1M57B 2Y7MA 5AVRB 3KGSA 1QRNA 5DJAA 2PYED 1OGPA 2R39A 4U6TA 5CLXA 4ZUWA 2HG5A 4NBYB 2ZX6A 3L3KA 4WTZA 1MQ8A 3KYOB 1DQDL 2X70B 2P8LB 4WSJA 2QDVA 3WKPA 3X13B 4HCRA 2DWXA 4HIHA 3AUVA 1NGQH 3L9BA 4TNWK 5T1LB 5TE4L 1WDAA 2X0WA 1SDYA 4QHNB 2XFGB 4PJBE 5ABZA 2FJHA 1WQVT 3K6NA 1FE8L 3T9WA 4HCIA 5B21A 3SD5A 3P30L 2AK4D 4UF7C 1DBAL 4LEEA 5CJQH 2HRHA 4L1TA 4LSPH 4QHUB 4QTIL 1IU1A 3D87B 4EUPG 1VESA 1ZWIB 2FYVA 1DBMH 3DO4A 3FUMA 4ONGH 5E2WL 5C3IA 1A7RL 1LD9A 1NKOA 1NIFA 4YLBA 1FV1B 2WKLA 3MLSL 4MQXC 2VR4A 1ZVNA 2HLFD 3MRHA 4M7LH 3EAKA 2ZXCA 3UP1A 2CJSA 2NT0A 2XI9A 4JKKA 4XCCL 5FA4A 3TN0B 2OR7A 5IFHL 4XPAH 3C2AH 2W81C 1TJXA 4LLVA 2Q8AH 3TA4D 4YE4H 4KZDH 3HG1D 1ECYA 4IW4C 2XACC 3RVXD 1SYVA 2XIIA 5ACLA 4XCYB 2B0SH 3EJQA 5GS3A 4JRWA 2QJDA 3FZUC 3CZFB 3FMGH 1QRKA 3LVTA 1U36A 1K3ZA 3V4UH 1UTDA 1U8OA 1P4LB 3TWCH 1D5BA 4RIRB 3VRIB 3L4UA 3QA3B 1ZHLB 1BD2E 3U1QA 3DETD 1T21A 5DMYA 5ANME 2CKBA 4PJHF 1GYUA 5CAYB 3AACA 1XH3B 3CFTA 3FN0H 4L29B 5F89A 2A1WL 3PWNA 4PJ7B 1UEMA 3VFRA 1OB1B 5D7SH 3KW8A 1RZPA 5JQ6H 4N2DA 4B7IA 1KEGL 4P07A 1GGCL 5GSRA 3U1SH 3ULVD 1I53A 1YEJH 1BVNT 4OCNC 3P9LB 4DEWA 1NC2B 3R7RA 4XCNA 1UWFA 4JHZA 4G6ML 5H94B 3FUHA 1ZVHA 3SKMB 1SLWA 2BOCA 3DMMB 3HPLB 4J12A 4A37A 4WUUD 3WKQA 4KKBC 5KS9E 2AQRA 1E2WA 2VDLL 5I1DB 5ENWA 3RZCB 3SQBA 1F02I 1WUNT 1QATA 3N1FC 1RCYA 1SJVA 3SPVA 4RGOL 2IAMC 5T1LD 4LLDA 3JQOB 4NX0A 5TF0A 3FTXA 3GSXA 2XETA 1OAYL 4RGNB 2FIKB 2D9QB 2ESVA 4Z7OE 2EKSB 4JVWA 4M03A 2H2PC 1J9TA 3BH8A 4G1EB 2XWCA 4YUEH 3KHQA 3LSOA 4R4BB 1IC4L 5DEFB 3WIHH 2X6UA 1KACB 2EEDA 2A0LD 2D03H 5ESVA 1PZ5B 1AGCA 4M5YH 4NP4H 4JFWA 3HE6C 4YXHL 5LCVL 4NKIH 4X4MA 3O9WA 4P59H 4PYHA 2FCBA 1FIGH 1NOAA 4LPVA 3RY5A 4YAQA 3GRWA 2DDQH 2YHGA 4G9DB 5HD8C 4Q14A 5I71C 2AZUA 3F7YB 1JAEA 1ZA3B 5C70A 1VFUA 3IWVA 4HX1B 2FB4H 4JQIH 4LK4A 1U8HB 4W9LC 4WEUD 4XPBH 3SE3C 1ZGLM 2AJSL 2CBTA 1E42A 4BA8A 1EXUB 4WO0A 5F93C 1RFDH 1CURA 3VCLB 2UWEE 1EHLH 4WHYG 5L4JA 1M05A 4TSAH 4UILH 2C4XA 5J9PA 2VN4A 4NPJA 3FFCE 2XTLA 3K6IA 3ZE2B 4EQ3A 4XMTA 2P5EB 5EIIB 1F6AA 3FUDA 2XA3A 3VXUD 3VTMA 5ENWB 2FJHB 3BSZH 3PV7A 3MJGX 3W82A 2ID5A 4CSTA 5FHAH 5I74B 4V2BA 3OKOB 3VE0A 4PJ9D 3N5AA 2WLYA 2DS4A 4M7JH 5C0EA 3KLLA 4Y1AB 1QSFE 4B3VA 4K9EC 4MKMA 4JFPB 4YFEA 4TVPD 3WNPA 5MENB 1LD9B 5MENE 2WYTA 4NZ8A 2ZCLL 1AS6A 2W9DH 3FBKA 2C9QA 3K2MC 2GTWA 3WSQH 4UM8B 2HG5B 4O00A 4DEPB 4APQD 1FNGA 4MNQB 4KFZC 1IQWH 2V2XB 2XT1B 3MBXL 3NJMA 5DFWH 2G4GA 1W72H 1LK3H 4LLMB 2Q7YB 1LQSR 2BCKB 5EU4B 1BZ7B 3QUYC 4ELKA 2NZ9D 2E27H 3UDWC 2FX8H 4H88L 2X1QA 4Z7QE 2IQAB 1JERA 1N6QH 1DVFC 3FFDA 3APNA 2NSMA 4XBEL 4F57L 4FFTA 2EZ0D 4DCQA 1G1KA 1E2VA 5CJBA 5IROC 4E36A 4YHPB 5C97A 5LXGH 3ULUD 4JM2D 1DBBH 3TWYA 2H0JA 2J12B 4HHAA 1AGBB 3GHEH 2R56L 1G9HA 3ASOB 3BXNA 5DQJA 5K9JL 2H3XC 4LNVA 1E4WH 3MCLH 1BV8A 4AT6A 2AMGA 3FQXB 4O58L 1S7QA 2HKFH 3D85D 5F7UA 2IBGA 3DIDA 5GXBB 4ADJA 1AHWB 4E41B 1BA9A 1Z9SA 2B1HL 4KDTC 2ICEB 3E1ZA 3KPRE 2H3NA 4OCWL 3B2UC 1F6AB 3BP6A 2EVJA 2XA8L 3SPGA 1EDHA 1D9KC 2J8UA 4ZOAA 3DX9B 3GJFK 4UT7L 3VH8G 1RZ7L 3GB7A 1CZ8L 2GUOA 2L7EA 4Y9EA 2DWYA 2NX5B 2J72A 5FGBA 1LO4L 4N0UB 3QEQB 5LGKA 3VI3A 3LRKA 1JNNH 2BSBA 1GSMA 2ESVB 2V3EA 1RZIB 3ATBA 2AQ1A 2FYYB 1ZA3A 2L7JA 3LN4A 3FTUA 3TVMC 4PJHB 1JZEA 5I71B 4ZTPL 2D3NA 3SDDA 3HW7A 3QDGB 1CS6A 3UC0L 4Q56A 2ZAHA 4I2XA 2P7TA 1KTBA 3ZHKA 1RZFL 3N1MC 4GAFB 2VLMD 4R7NB 1SM3H 3G3LA 2DKUA 3SN6N 1QHPA 4EXPX 2P8MB 5KWYC 2XKNA 1DUZB 2P5ED 4KKBD 4L3ED 4DP1X 4KZEL 2J57A 4WNSA 4I48B 3UIZA 1OM9A 1PDKB 2AJZB 5I6KA 2YXFA 5FUOH 2J73A 3US1A 2UX7A 3P9LA 4B27A 4UTBH 2CQVA 5DTFB 3RNQA 3ZT7A 1KZYA 2ESVE 5H2BA 5D7LA 2WSKA 1K8IA 2NY0B 4M29A 4HA1A 4PJIE 5F44A 1IT9H 1XH2A 4TVPE 2QR0A 4NI6A 2JJSC 3M46A 1MUJB 5E6YA 2E9GA 1KCBA 1YJDH 2B1AL 3PWNB 1HH6B 3QNXA 3IAGC 4R4NC 3NYKA 4L8BB 4D0BB 2NYYC 3LEVL 4AL8H 3H9HB 4WKXA 1OCOB 3EOBB 4KKLC 4M8QA 1OALA 1UASA 4NQVB 4NUQA 1ZHLA 3W5NA 4GUQA 3T6ZA 1NIEA 2XWEA 3QCUL 4LOUC 1EZVY 1EAQA 2IFFL 4RWYH 1HHKA 4F58L 4QHLB 1HZHH 2DQFB 2VISA 5EO1B 1S7SA 5IHUH 1CXHA 1SVCP 4ZX3A 2WBKA 3DUUB 2IXQB 1HQ4A 4IBVA 1GGYA 2WZ6A 1YDPA 3KGTA 1SOXA 4WFHE 2H5UA 3WG7B 1Z9NA 1VGKA 3QWRD 5GGTA 2EINB 1ZKAA 3U0TB 3BSGA 3CX2A 1XGTB 1YUHA 2OCCB 3TS8A 1NGZA 3HS8A 1FFTB 1J0YA 3G5XB 3RVWD 1LK2B 1QUNB 2HFFA 4ERSL 4QNPE 4Q4IA 1P7QA 3U1PA 3D6GA 4BE5A 4PG9B 3DTUB 4ZS6C 5FYJL 5DJCB 5ES4B 5INDA 2CCWA 4KTEH 3T77A 2HLFC 3ETBF 4AIEA 1ZT4A 4TOYL 1KEML 3PE9A 4G1MA 2A9BA 5EWIH 5GIRA 3ARBA 5DS2A 5LNDA 5D2LB 4LE8A 2D0GA 4AQEB 1TVHA 1WJ3A 3K2KA 1BF5A 4K55A 1NCUA 4XAWH 3X3FL 5KOMC 4JDTL 1J8HA 1JI2A 4JFTA 5J6HB 4LQ1A 3P0YH 5DCCA 1E4JA 2OP4H 2VAAB 1FCGA 4D9QD 3CVCA 2D7NA 3CDCA 6PAZA 4G7RB 2ESVD 2WB1A 4WW2C 5CSBA 4M1DL 1TTBA 3Q44A 5L7XL 3SO3B 1MVFA 2QBWA 4B95C 1X5YA 4KTGA 2K8QA 1KTRL 1PMYA 3DBSA 1DJYA 1KZQA 3I3EA 1LDSA 1Q0XH 4NQQA 4CBZA 3P4NB 3CSPA 4P3DB 5HGBB 3X13A 2WIIB 2EIJB 3DX6A 3L48A 3CVDA 3SDAC 4JDZA 1UYWL 1AHMA 1NM9A 1CFVL 3NA9L 4JGMA 2CH8A 2OMYB 3IF1A 1K5WA 4M4RB 2XTJE 5FM5O 4OVUA 1KBVA 1G7HB 1KDIA 2FGZA 4IDJL 2AQNA 4LCCC 5AUMB 4Q6IB 3ELAT 2GY5A 3K74B 4HJJL 3DNKA 5T8IA 5BZWB 4NJAH 3TOPA 4EF3A 2A73A 4XNDA 1BQHA 1GA2A 1JV2A 5IWLA 2ED7A 3G5YB 1P5UC 3EJCA 3QZOA 4NZFA 2EIZA 4XC1L 3V0GA 3H7BB 5FGSA 2LVEA 3ML8A 2WLNA 3OKLA 3ECVA 4S2SB 1YEJL 3JV6A 2PWHA 2Z8SA 2OYLA 4JEGB 2IMMA 2D4DA 1HWWA 5DYFA 4CSSA 5GS1A 3CSBA 2R51A 3TYFB 1K8DB 1MHCB 1NBCA 1X9UA 5CSZA 4OCRL 2BP5M 3L2NA 1JBJA 1UT1A 1LNUB 1N0LA 3NCBB 4DESA 3U2IA 2NY6D 2BOLA 3G5WA 1L7TH 1JVKA 1AFVL 1ZE3C 4UIMA 2VE6A 3B9KD 2R1XA 2EUVA 3BP7A 1DO5A 3KCPB 3FSZA 1CGTA 3U25A 1U93B 2B3IA 4UZUA 4BFIA 3EHBC 1U8MB 4FI7A 1WZ1H 4QTFA 3NCJL 3FT3B 4A2DA 4IMLB 3C5ZA 4WK0B 2CR3A 1W91A 2VOTA 2QKSA 2HPTA 5KTEL 1J8SA 2WIIA 5D1ZI 5C07A 3RWDA 5LGHL 3K81A 4LZKA 3WNMA 3FB5A 3L16A 5D93C 5JIDA 1NCDL 4KK8D 3BFWA 3AGVA 1UKSA 3MODH 3PNWA 1HAUA 2VAJA 2GJ6B 3F3HA 3O2DH 3Q2LA 1P1ZB 4KJPC 5FM5M 3CFNA 4APXB 3ZQXA 3F04A 5D4IA 5J6HA 3GJFB 4FKEA 4B9KC 1KIRA 5H2BB 1LP9B 1JN6A 3ATFA 3LRGA 1LP9E 3F6JA 1QSFD 2VT0A 3MRDB 5EN2B 3VH8B 4ALAC 4RAUB 2QQLH 3TN0D 4KBPA 1RZIA 1Q38A 2Z31B 3GRGA 1H15A 4IBWA 5E4AA 5ILTL 2BIQA 1JUFB 3P2BA 5T3ZD 1LO0L 1FNAA 1JPTH 3IJEB 5IK3A 1TQBB 1BXVA 5IROA 1MH5A 4NWUH 5FCSH 1QW8A 1QEXA 2IGTA 4MNHA 1CJYA 3DI2B 5F9JB 4O02L 1EH9A 2IVFC 1IBBA 1K3IA 4JPQA 1UM4H 2D0HA 5CD5C 4U6YB 3LNIA 4MXWL 4JM0A 2EKJA 5ECJE 3JV0A 4H44C 1UM5L 2YWZA 2Z7ZA 3B43A 3ZKMD 2RCSL 1T7VA 4NP9A 2VDLB 1EBAA 3IMUA 1BFSA 4ODHL 4JFHD 1MF2L 1I9EA 1A9VA 5KVFE 1KXVC 1Q0YL 4HPHA 5JHLL 1W72L 3TBBA 1N64L 1ZAGA 1VGEL 1EANA 1OK8A 4I18B 3EUDA 1OGAD 4YJZL 2VLRA 2IGLA 1FZMA 2WUBL 3BWSA 3ZGIA 4YC2B 4ODTL 4OZFA 5E1AB 4NWTL 2DQIH 5A2BA 1K72A 3DMMD 4EN3A 4XBEH 5I82A 4ELME 4F57H 1ZVSA 5T1MA 1BZEA 3RKDC 2FL5B 3DUSB 5JW5A 3QC6X 4FLSA 1FRGL 3SEPA 2VLJB 4URTB 1SXCA 4ZNCD 4MMXC 3REVA 3IMTA 1OP4A 1XGZA 4GT0A 2AABL 3ILQD 4LSSL 4OZHA 1WA0X 2X9WA 3CFEB 4U3XA 2G2RA 3Q1SH 4YO0B 1ZANH 3CFBB 1FVEB 4K5OA 1YEGL 5C0EB 5HYJE 4MMXA 1S9YA 2YUVA 3V95A 4YQXL 1DVQA 3U48A 4LLMA 5E8NB 5IBUB 2ZUVA 1CFTB 5EO0B 2FO4A 2KZWA 1PZBA 3FRPG 4UZSA 1AQ8A 2B59A 2IIJA 4XE5B 3L13A 2VDMH 4MKTA 1T22B 1J5IA 1E5BA 5EBMB 3QXDA 4HD9A 3NJKA 4YZFF 2PTVA 5C6TH 1JZ8A 2Q10A 3NQIA 4P2QD 2NY2B 4WWKA 2PWGA 4LARL 4LU5H 2XOTA 2VMDA 5GS1C 3VWJC 4MQ7A 2ADJB 2F1BA 3I2CL 1JTTA 5T1KB 2IMNA 3DPBA 1X9LA 3TO4B 2UWEA 4HIIA 5FF6B 3GHBH 4EI0A 4N8PA 5CFHA 1U8QB 5DDHA 4WO4C 1XO8A 1FH5L 4ZW6A 1TMCB 43CAA 1ZTXH 4KHTH 4E41A 1MRCH 3DTXA 2H1PH 3OR6A 4HS6B 4XN5A 1DEEB 4IK7A 3TF7C 1DFXA 3QDMD 4GRLA 3SBWA 3VGBA 2B5IB 1WRFA 3ABGA 2LQRA 4YHOH 3VFVA 1LE5B 2E8YA 1IQDA 1UZ8B 5JUEH 1NMCB 3NFSH 1S8DB 3NK4A 1U0QA 4DGVH 3LHPH 4R9HA 3WXWH 5IROD 3Q6GL 3D0VB 5GJSH 1DVFD 2EKSA 2A9NL 1HL4A 4JREC 5KSVB 4HP5A 1G9NL 1ACZA 3WGVB 5ANMB 3WEAA 5AVXB 2W8CA 5L4IA 3SKJH 2X4RA 3DIFB 2CGZA 2QTVA 3RAJH 5ECGA 5FFOA 5JYMA 1BOGB 1FFRA 4MA1C 1ASQA 1YVLA 3UPRA 1ZS2A 2ZCHH 2AV1B 4JFEB 3H0TA 4JFEE 3H54A 3JWNG 4Y4KB 1WD8A 5D96B 1SFHA 3GGWA 4K8RH 5DLLA 1MAJA 2ICWJ 3BH8B 4G1EA 5K39B 4UQEA 1GRWA 2YD7A 3Q2CA 5B39G 1BM3H 2Y6SC 1DSFL 4QXGL 2OZ4H 4ZW8A 4M48H 1N0XL 2NZ1A 2YXWA 4EDXA 1LEIB 4OQTA 4B9PA 2KUTA 1A6PA 1EAPA 4JL1A 3QPXL 4S0HA 1TJIL 4JFDB 2CRMA 3AG2B 3KCPA 1JZ2A 3SQBB 4OZGF 1NMBH 2JJWA 4BFNA 2YMOA 4ERSH 4O2FA 3BX7C 3V52H 4KRMB 4M6NH 4V33A 1UVQA 1TO5A 4NN7B 3VSUA 3ARGD 2IWGA 1NLBL 2EE2A 4EVNB 2K0RA 5DJDB 2X9YA 1WZLA 1MJ7H 4BSVA 4OD2A 3QEQA 3D0VA 4P23C 2C3GA 3RWCB 1F97A 1RPQA 2QV2A 2R1YA 4PJAB 4PJEA 4QOKB 3O6KL 1BLIA 1M9WA 4KXCA 2H8PB 4AENB 4PGEA 1B4RA 2NCEA 1TEGA 3LN5A 5CZKA 3MCKA 4JHWL 5JW4N 2JJTA 2FO8A 4P48A 1XTLA 3WY3A 3ZTJG 5HXMA 4I3GA 2OMXB 3QEUB 2HRGA 4POZC 4XXCA 5ACZA 1DQJB 2A9MH 3CHQA 1QFWM 4BV1A 3CU7A 3RX8A 1KBGL 1DZBA 5DJ2B 4DTGL 1HHGA 12E8L 4AIXA 5FHBH 1GZHC 5E0FA 2UXTA 2IJ0C 1XGQA 4Y4FC 4MZRA 3SKNB 3PGDA 5SX5K 4GI8A 1HESA 1JHKH 3FTVA 3V2AR 4JCMA 2HTLD 4JM4L 3WLBA 4QHUA 4Y1TA 5JHDE 4FXGB 5CWSA 1V55B 3MRFA 5I1EL 1XB6A 4XP5L 1N4XL 4PLNC 3A24A 1DVFB 3TLRA 2YA2A 1OQXA 2VDQH 5AWNL 1YY9D 4PRDA 1A5FL 1AI1L 1PSKL 4UIKL 1YYML 4WU5A 5D2NE 3BZ5A 2ZKWA 2ETWA 4FNLH 3SIKA 5F7KC 4JRFA 4WW2A 1ZPLA 2J8HA 3HFMH 3IXAB 1X5AA 1YN7B 4Z7WA 4NO5B 4G59C 4GEJA 2DL9A 3D34A 5C0CE 1B2WL 2Y06L 1RJCA 4I4WB 4ODBD 5E00A 3CVHL 1BQKA 5DZJA 1MCQA 4PHXA 1AFVH 1HHIA 2R0ZL 4X9GA 2EDOA 4BFGA 2R4SL 4ONOA 4ZS7H 5CD3B 2DY2A 1KIPA 4PV9A 4EI5A 4DKEH 4IBUA 4DUWA 4I77L 4I1NB 2NR6C 3T1FA 3VFUA 35C8L 1KGYE 3BUQA 1QSEB 1S9WA 3QUGA 3VXNA 1TU2B 3QCVL 4NZTH 4L5FH 1SHMA 4G8GD 4AKQA 4UYQA 4HEPG 4FXKB 3UO1H 3DURB 4JFQA 4PB9L 4PJ7F 2OYMA 4RDQF 4Q9RH 1KPRA 5AKTA 3S36H 3DK0A 4G7VL 1IBYA 3AC0A 4YL4A 1CF8H 1PKQA 1S2EA 3H6AA 4HWEH 1U2YA 4GG8B 3T65A 3RFZC 3RWIA 2IOMA 3KYMA 5LBSL 2O5YH 4PWHA 2JLLA 3ZE2E 4LOFA 4N24A 5BUPA 1U41A 3WS3B 5FO8B 5ACMA 1C7SA 2VLLB 1WCBB 5FDYA 5AENA 1S9VA 3AQDA 3PRZA 1GW0A 3EBGA 3HG5A 1HH6A 3MO1B 1ONQA 3QNXB 4Y5VA 1I7ZA 2WGXA 3L5JA 2OMTB 1OSZB 4LL9A 2W92A 1TSHA 1I7RA 3CVIH 4JLRA 4JREB 3RGBA 1OTTC 2X2JA 1JV5B 4FJZA 3ARYA 3V9CA 4PJXB 5IBTL 2UXGA 3IFOB 5B1CA 3VXOB 1T4WA 3I02A 1WFTA 2PP9A 3IEAA 3GUTA 1JN6B 2Q3AA 1NTDA 2CO6A 2YD5A 4WFFD 2FATL 4K3HA 1IAIL 2GTZB 1ACYL 2RHEA 3KPRB 4HHWA 1BMWA 2OXGB 1RZJL 5CZXD 1N26A 1YY9C 2CHZA 3RIAK 4NRZB 3SB3A 8CGTA 4I2XB 4GEIA 4WCYH 2CCLA 1UACH 3QXTA 2EUXA 1Q1JH 1GPOL 3VM7A 2N4IA 2EP6A 1QI5A 3QFDA 1T0NA 2ZX9A 3KBFA 4LEOB 4UDUA 1A7QH 4Z7IA 4O5LL 1KGIA 4MD5A 4X4YB 3T6QC 4HV8B 3CVBA 2VN5A 3HZKA 4X6CA 4ZDHA 4ZOBA 4I3SL 5DD5H 1ZY9A 3H55A 3HNSL 4JM2F 3FT3A 3IJ9A 3ULUF 3GJFA 1WPCA 4OZGB 1T80A 1IC1A 4JFHE 1RIVL 3ARDA 1A6AA 1JP5A 4ZO8A 2YPVH 4FI8A 4JO4H 3TV3L 1DQQB 4HXAL 4KKAC 5E2UH 2CDEA 3VFTB 4D9RD 5A2FA 5IFJB 4UIMB 5F6IC 4Z3GA 4YC2C 2ATAA 4U7KA 4N5UA 1T1XA 5A43C 2XQYA 1OT4A 1IAKA 5DC0A 4QRRB 4JFOA 4HIXL 4OAWA 1VEOA 2K4AA 3GTVA 3MDJA 5E4EB 3LH2L 4KKNA 3T8XB 2P8PB 2B4CL 2NRDA 4K94C 4I5BB 4P46D 5EZJA 5J3HD 1NGWA 5T3ZE 3DC0A 1YN7A 4LQFH 1FNEA 5K9OA 1BPLB 4U05A 4RMBA 2PTTB 1IGTB 1SEBA 1UEYA 3D3VD 4X6DA 4ZW7A 3B3BA 1AANA 2YFNA 4NO2A 4TV3A 2X87A 2YRBA 4PP2A 2OXGA 1KB5L 4ODXB 1YLBB 2Q7AA 4UANA 3VG9B 3K6SA 3CC5B 2XWBA 2GCYB 2NR6A 2V2TB 3C60A 3QQNA 1TJHL 3GUFA 2VC2B 3OQ3B 4YBQC 3UTZA 1K8DA 1MHCA 1HHJA 1WLHA 2RTTA 1YY8B 4ZFGH 3HI5H 4V1DD 4XHJC 3UPCA 3HC0A 3D09A 2MSPA 4NCC1 2JKXA 4YPGA 2GJ6D 4NO5A 1VCBC 4FNTA 5D7JB 3ZZQA 1AIFB 4E0RA 4DKDC 1TT6A 3LNFA 3PXJA 2ZP0T 2W94A 4DUVA 3U7AA 1I3VA 2VR3A 2LLGA 1G7LB 2Q9OA 5L4MA 4XWGH 3IU4H 1KCRL 3HE7B 4QJ4B 1CR9L 2BSTB 2CUIA 1F3DJ 2N0MA 3MX0A 1KV7A 3VGDA 1XF1A 5DSCB 4ZX4A 1GGUA 4JFXB 4HH8A 5KYYB 2Y2TA 3S4SG 4LCCA 3CZEA 2NR6D 4ATWA 2OMYA 2VZUA 1KEGH 5FOJA 1G7MA 3LEXA 5JUEL 2I9TA 1YCSA 5H35B 4PS4L 1F8TL 3CGTA 4PGEB 2C7FA 2YGNA 3IFPB 4OFYA 3SBQA 4AENA 3ESOA 5DGQA 3MUUA 4BKLA 1R5IA 4HZ1A 4G7YL 2A9NH 2P28B 1EXUA 4NOFA 4Z7QF 5JZ7D 2E6PA 3L1OL 3LKQA 2H26B 2V7HB 3QZNA 4MCMA 3T1FB 1JIBA 5HDOA 1HHGB 3OAZH 3QPQC 3GSWA 5I75C 3DVGB 3HC4L 4PB0L 2E8ZA 2EUZA 4DP5X 5T5FH 3EFOB 4NLHA 3QR1A 1DTUA 4HJ1A 1S7XA 4X6EA 1U3HB 1ZSHA 1DQLH 2JB5L 4G8GA 3GO1H 3QJVB 4KY1H 4GRWH 5KBPA 4PLJD 2WLIB 1WAAE 4IOSD 5IOPA 3I75B 4PTUB 3I6KA 1H5BB 1QEWB 3KJ4B 5HYSB 5I8OH 3OSVA 1PJWA 2WLJA 4QXGH 4OFIA 4G8IB 3QUXD 1UCBL 4ZMPA 3D30A 1IAKB 2QMKA 3W39B 1IZKA 1G4RA 1UB6B 3FTGA 5D5MB 2BXZA 5FECB 4MAYC 1JPGB 4P2OA 4KY2A 1U30A 3OG4B 2QQKL 5GS0D 4NQCE 2ZG3A 2AHIA 2O5ZL 3LXAA 1TJIH 4P23B 1VGKB 2ENPA 2F7IA 4FXTA 5A2AA 4Q9QL 1Y0LA 3SDAB 4MXQC 2OTWA 1VZIA 2Y5EA 5C92A 2H1XA 4M6NL 1K8IB 4P3CL 3C08L 2J2ZB 2OX5A 1QOKA 3U0WH 4FYRA 4X0NA 4MXVE 4BZYA 2J3SA 1FDLH 2IANB 4PJDF 4G8GE 3CMGA 1K9TA 3N91A 4X4XA 2AJZA 4B9GA 4N9GB 4HISA 4WZ9A 4YBLB 5CGYC 4ZO9A 4JZNA 4UILL 5FA3A 5CP7B 5I6MA 4RFOH 4HVBA 2J1ZA 4HKBA 1TFPA 1BVKB 2GJ6E 1RUPH 3ME0B 5B1AB 1USQA 5HJ3B 3VXME 4X8GA 1EZLA 4ZX6A 1KYFA 1XF4A 4DNLA 3B3IA 3T0ED 5EUKA 3MLZL 4JS7A 1DEEA 1UD6A 4B97A 2E7LC 1F86A 3EH5B 1NQBA 1WIUA 1T2XA 3AQYA 3L5IA 3QRGH 4N8CH 3KWTA 2DQTH 4LAQL 4PJXA 3D12B 1FBIL 3ZE0E 1EXGA 2GSMB 4J1UB 3UBHA 1FZOA 3MUZ1 3S5LG 1C08B 2EAEA 5E8OA 2OMUB 5IV2B 3WEBA 2K6WA 4FQJH 3NGBB 1HZLA 1UOKA 2VQ4A 4GXFA 1I7ZB 5J06A 4JGNA 5E4OA 5I1EH 1DLHB 1IEBA 2R1WB 2DLEA 3KYKL 1W0VB 1Z9PA 1TETL 5E8PB 5HGDA 3V0WL 4B60A 3S5LA 4TQ8A 2NY1D 2P42B 5F1KC 2P8PA 5E8NA 5EZJB 2D0FA 4X5XB 2IPKB 2JCCF 4XNYH 3EYVB 3PPEA 4X5WB 1JZJA 1QAWA 2DTMH 5CIPB 4NO0B 1Y6KR 1OTUD 3CK0H 2NY4B 4WI2A 4QY8A 4R7DA 5TGBB 1NUFA 1HK6A 3WMSA 3ZOAA 2F7OA 1P0SE 4NRYB 2R56H 3N1GC 5K9JH 2HJKA 4GQPH 1WS7A 4J27A 5FGBC 2OV0A 2WCPA 4O58H 4Y4KD 4BXVA 3VFUB 2R27A 2CPUA 3ARDB 4OIAA 4P9HH 4EIGB 3T6WA 2VDRB 4H5SB 1M7IB 1GTNA 2BP0A 3BT0A 3GRBA 4NN5C 4OCWH 3E38A 4PBWD 2A6DB 1PZ2A 3Q48A 1IC7H 1FAIL 4PRAA 3BN3B 4ZDHB 4Q6KA 4EE2A 5KSVA 1E3ZA 1XCQA 4WHTB 5EUOA 4F9LA 3CDGA 4RAVA 3V4PH 2JWYA 3L7FB 3TA3D 4L2YA 4R0LA 2UYLB 1OAQL 3KAAA 1X4YA 1YEKL 2RGSA 1QPXA 3VMOA 4HOWA 3TNNA 1QFHA 3QUZB 4I1PA 1K4CB 5FWQA 4FZEH 1EJOH 1Z9LA 2NDFA 4LASH 4CW1B 3G9AB 3NABH 4I8DA 4HMDA 3C12A 4K8RD 4YSEA 1CF1A 3HKFA 2YD0A 3R06A 1U3JA 1RD6A 4HD5A 3DXAA 3WFZA 1S7RA 4KXZH 4ODSL 3IDUA 2ICWA 4LGPB 4IGBB 3T5WA 3IFOA 1T0MB 3VXOA 3TYGH 4XCEB 2MQ0A 4QOKD 3E3QE 3VD4A 1JTOA 2EH8L 4OF0A 1GC1C 2G2PA 1MIML 3EDDA 2GI7A 3ZKQD 2H2SC 1VADB 3POCA 1P7KA 1AMXA 4CMMA 1N5AA 1NCAL 1TTFA 2WOYA 2VUOA 2W65A 4W9GC 5DHMC 1WBYB 5FYLE 1YECL 1NOLA 2HVKA 2H6OA 2ZWLT 4K3GA 2XHNA 4YK4C 3QIUA 1E3XA 4M62L 2WQVA 3WJJA 4J5VA 1E4XH 4S11A 1EK3A 1CK0L 2JIXD 3K46A 5HVWA 3AVEA 3NJHA 1MCOH 2XXMB 3TBSA 1YJDL 2B1AH 4JANB 5HHPA 1O6VA 4HZLA 4Z8FH 5I0XA 4Y88A 2PUQT 3UOAB 3TF4A 2A6KA 3EO9L 5KVFH 2XKUA 5KSBB 1UH4A 1TNNA 8PAZA 5ELIA 5FPIA 2F08A 3ARQA 1U42A 4Q74A 3ARFC 2ADYA 2ZPKL 1X5LA 5J89A 4X9FA 5A2KH 3L5WB 2HT4C 2NY7H 1AC6A 4WIQA 1AZCA 4JRXE 4K15A 3FONB 1BEXA 1RIVH 3B4NA 4I4WA 2OI9C 4OJYA 1WHPA 4NDMA 4MJ4A 4UQCA 5IW1B 5B7EA 5AW7B 3T3PF 3QW9A 3UL4A 4MJJA 3QJZA 3UADA 1LTXA 1CLYL 5EC1B 2WNWA 5ETUA 2D7PA 1JRHH 2AERT 4Y2DB 3BGAA 3LZOA 5LXVA 3ULVF 3S96B 4OV5A 4HULB 3TEZA 4LEXL 1OTTD 1YEEH 1MFDL 1URLA 4XMPL 3W9EB 4NO0A 1F42A 3N43F 3WJLC 2B4CH 3MNWB 3OC5A 3SDXA 1H8SA 4OF8A 3KPSE 4FJYA 3DYPA 1I8MB 3D2UA 2HT3D 5C6WH 4HUUB 5F9WB 2WWMC 1TLMA 1W0VA 3HUJA 4R8WH 1O6SA 4P2RB 1AO7D 1A22B 3C5ZC 5F3HB 4MQXD 2NUTA 4ZXBD 3ZIYA 4F3FB 4HS8L 4LSQL 3ZE0B 1RJLA 3AABA 1U91B 3GSUB 1UKQA 4JO5A 3QO1A 3WO3B 3FTGB 1Q0XL 1VACA 3FT0A 3HI5L 2HCZX 3WTXA 3EGSA 1XAUA 1MEXH 2KZKA 4Y2NA 2VL5B 1XIWA 2XYBA 2EEBA 5JYLA 4CMHC 3LZNA 4JG0L 5FFLA 5ID1B 5SWSD 1HS6A 4N2AA 2AEIT 3FC8A 1KG0B 1MWAH 1YEIL 4LLVB 4U0RB 1CR9H 3BSZA 4JG9A 2H8PA 4U4BA 3BVXA 5E1GA 2Z7WA 4JY5L 1M7DA 4HU2A 1NC2D 1XFPA 4RGNC 4P5KA 5IWLC 4KX9A 4JO1L 4Q9BA 1NBVH 2E3VA 3LKQB 1PG7H 2DQCH 5F9OH 2AJYH 5JOPD 5JW3L 1F3JB 4XT1C 3ZDZB 4ACPA 1ZXKA 3D50A 1H3PL 1R19A 4IKLA 2YPKB 1CLCA 1I85C 1FN4A 1ZWIA 1WV7T 2TSAA 2XZCH 3CFKB 5SWZE 2VDRL 3GMQB 2CDGA 4HU8A 1EFQA 3UPAA 4OCRH 4WAFA 3DO7B 2X1XR 1VENA 3ARGB 4FFZL 1BW8A 4RDQG 1CGWA 2W60B 3NGBC 3KGRA 4X8XA 4YVNA 5IQOA 1S9YB 2JQZA 3Q43A 4J4PA 4N8VA 3L5XL 3RDTB 2UXVA 1XGTA 1YUHB 5DZ9A 3HR5A 5AVTB 1VRSA 4HGWA 5GHWH 3WIHA 4G8AC 4G6KH 1WFJA 3G04A 3ARVA 2ODIA 2FWOA 1WO2A 1WZ1L 3P1VA 3O8XC 4MDJA 4KNQA 3QWOA 4Y4FD 5E9DA 3VFGL 4EEEA 1QFWL 1ZRUA 3HZVA 1DVTA 2IWFA 3B8YA 4YSSA 4OLYH 5FC9A 2H32H 4AJ0A 1UWEL 4P2AA 2YS4A 5KW9L 2OJZH 2OCJA 5J1AA 4B0MM 3S3BB 2EADA 2PWDA 3A6OA 2CXGA 1DQMH 2WZAA 2EIZB 4GSRA 2A83A 3BVDB 3CHPA 3LZLA 3MJWA 4M9OA 4TNEA 1D9KA 5D72H 3T04D 4W9CC 4QHNA 3CN0A 3FS9A 4EXKA 1MY7A 1I8IB 5C0AA 5HI5D 4NN6B 5L2KB 4GRMB 4FA7B 5JDJA 3F6IA 2EDMA 3U0WL 1FIEA 1GYWA 1FL6B 1L0XA 4YN3A 1ASPA 4GW5B 3QRBA 3SJVA 2X2UA 4F33B 5I30L 4LDEB 3IETA 4LESA 3F5WB 2DWDA 4YBHA 4G3YL 4GY4A 2XWRA 1LE9B 1IJ9A 1T5WA 5A2LH 4DKTA 3UGUA 2YPLE 2BNUB 1J9RA 1UUSA 1HNYA 3PNRB 1P9MA 3EJYC 4KRNA 5DHDA 3SD2A 1AKJA 4JFYA 2MQ3A 4ONFH 4XP4L 2CHDA 3KLKA 4EOWL 4Z3FA 1HCVA 2FEDD 3BAEH 3ARGA 4OLUL 3PWPE 4MCYB 4M61A 2XQYG 5SWSB 2AQPA 5DZNA 3V6FB 1FO0H 1NUGA 1IV8A 4KV5E 3DRQA 4JDVB 2XTSA 4MQSB 1WS8A 3NCYS 2CO6B 1JGDA 3H2PA 4PJFE 1D2PA 4FTVE 1FNHA 3C6EA 2K78A 1YHPA 3MNMA 1MF2H 3FL7A 3OB0H 5KUMA 5BXFA 3FF7A 1HXMB 1XSIA 4YR6B 4I3RH 1Q0YH 2GCYA 4JG5A 4C4BA 1CFNA 1VKXB 3GB7B 3ZVVA 1MAMH 4TTDC 2H32B 3SGEI 5ICUA 3MUY1 4UUJA 4HCGA 4ZQKA 5GZNC 3FQNB 3WTSA 1U8LB 5DHEA 2J8UE 3LKNA 3MV7D 3KYMB 1ZEAH 5EZLB 1FRGH 3OXRB 4DZ8B 5HHQA 2CM5A 4ABWA 1IBGL 2NT1A 1NPNA 4NHUA 2X4SB 2AABH 2WUCL 3F58L 4XPGH 5DRXB 1V3KA 3MV8E 5I1AA 1I8KB 5T5NF 4ZPVA 3SJVD 2NX5D 3ZQWA 1UZ6F 1KENH 5F0PB 4YNYB 3HUJB 3E9UA 4ZMWA 4NHUB 2VYRE 2D31A 5LNEA 1MRFL 1SZNA 1T89C 1TVDA 3KMDA 2IDQA 4DUXA 3MRIB 4ICXA 5KSAA 4NUJA 1S7QB 4PJAF 2VDML 4KI1A 2GTQA 1G0DA 4ZZKA 5BRPA 4OLWL 2W88A 2UWEF 4H8HA 1SOKA 3GJFH 5L9DL 1OF0A 3U30C 1YEFH 4LARH 3P73B 2ZXEB 4JN1L 5EUOE 4AJYV 3WUWB 3W81A 3HUJF 2XWJA 1WFMA 3HLKA 2XZZA 5F7EL 1HYSD 1JPFA 1NDGB 1BXXA 2OJEA 5K9QI 1H6FA 4GNKB 3PHSA 1M1XB 4RNRA 3RDTA 2IALB 3L4WA 1D9KB 1MRCL 2QGDA 1CXKA 4P5TD 1KUMA 1H3GA 3IDMB 5FO7A 2JELH 1DVFA 1QWUA 3INUH 4QRRE 3LN4B 4YHOL 4MQTB 4NM8H 4L9LB 2VJXA 2V2XA 1BIHA 2KPNA 2YBRB 5TQ2L 2BP8B 1MVUB 1E4HA 4FQHB 3VG0H 2YGQA 3LKPA 3CZUB 5F6IB 1QFWI 2X2IA 5AW0B 4LP4A 2XQYK 4L5FE 2I69A 2ATKA 3HR5B 3TT1H 2YKKA 5LUMA 3ARPA 1PW3A 2BSSB 3BLPX 3ZUCA 3NQKA 3BMWA 3RAJL 3C5XA 3ZYOA 2ICEA 4HBCH 1MPAH 4UCFA 4WK2B 4AV5A 2XDHA 1RY7B 2EECA 2N0KA 3BGFB 3QEUA 4PTTA 2DIBA 4IIQA 2V3FA 4D7BA 2VZVA 2DICA 3UTOA 1NIAA 3RG1C 3M6DA 1GKOA 2B16A 5ESVB 2LW3A 2WXKA 2ZZUT 4E9QA 1VADA 4DP8X 4G1MB 3N42F 2XG5B 4HS3A 2IQ9L 4PBVC 2R1XB 2GC4C 2PYEA 5ITBL 4Y7OC 2BK8A 3WDIA 1T0MA 1LM8V 4QXWA 3IKCB 4H0GA 4MJ2A 1LXMA 2ORBH 1HX0A 4NQDD 3FCSB 1E65A 5IY5B 3QB7C 2FT7A 4I9WD 2YOCA 3LTVA 1HEHC 4AQ1B 1XF4B 3ABLB 4JRLA 4OCYL 2ZCZA 3DX7B 1OCCB 3K8LA 1OO2A 3KNBA 4PJEE 4PJEB 4QOKA 4ZG1A 3RVWC 3CZNA 3LSOB 1IEHA 4YDJA 5C08A 1J5DA 3R18A 1AD9A 1EZSA 4QRUA 4YHYC 3L7FA 2CR6A 2QVIA 5DJDA 1I1CA 1THCA 4YDLB 2LLNA 1IGCH 2VXTL 3ML9A 1JVOA 1NC2A 1J0IA 2EE6A 1BG9A 3JYCA 3OKOA 3VTTA 1CQYA 1QHOA 4MZ2A 3DHPA 1XEUA 2V2WA 4J3BA 1F13A 5AW3B 3SGDI 5I23A 5I6XB 4KGJA 4FQ2L 1EIBA 3QDME 3KXFD 4KROB 5FWRA 5I1GH 4NKDA 2A9ML 4K5MA 2MNWA 1NH6A 1PF3A 2E74C 4UOQA 1KCVH 4DTGH 2ICES 4Y16C 1AIZA 3F05A 3PL6C 2I32A 1CDUA 1KJ3L 3HS9A 4HALA 5ADPH 2R8SH 4Y4HA 1UB5A 3MLUL 2P5WB 4PUBH 3HE6D 4J4PC 5IB2A 1BQRA 1S46A 2RB8A 3CIAA 3GSOA 4K7PL 5GRYA 3MLVL 4ZI8A 1KWKA 4IGBD 3RWFB 4U33A 1ZLWK 2HUHA 1E5ZA 3LDBC 1UXWA 3GFUA 3KD4A 1LE5A 1CFSA 1NM4A 2AKRA 4B96A 1W6WA 4NOBA 1MXDA 2VN6A 2NY5H 3LNHA 2OI9B 4U1IB 3TBSB 5DEZA 3EO1B 3QUXB 5BVJB 2BZCA 4JAMB 1L9TA 5HDBE 5SX4I 4N5ED 2FR4B 4FNLL 3BPLB 4AGPA 3IGFA 2DQGL 2NY3D 3OKEB 5DJCA 5GRVL 1FVCB 1KN4H 2WXGA 3EGSB 4PJBB 4PRIA 3MYJA 3QIWB 2PCYA 4TRPL 2J56A 1NGQL 3B9KB 4UTCA 3CZFA 3QWRA 3NJVA 3HUJE 1R5IB 2XZCL 3CN2A 4GQ9H 1U91A 3EJJX 3BI9X 2RFXB 3EO1A 5FK9A 4K73A 3SPVB 3LD8C 1DJIA 2A74B 4RX4D 1S78D 2J5WA 4ZUVB 5JHDD 1JPST 3WY2A 1NA8A 1WEJH 1BVLB 3E8UL 5JXAH 2VUYA 1SYSA 1E67A 4UBDC 3D39B 4S0TD 3RX7A 1DN0A 2HVKB 3D08A 4Q6IC 3DKHA 4FFZA 3CFEA 3BXNB 4OLEA 2Y2WA 3OR7A 4OLYL 1K2DB 2ICCA 3QPKA 4Z7NF 15C8L 2X3BA 4C57C 2E47A 4Y16D 2UY7B 4ONHB 4PWIA 2OJZL 5C0BB 1KY7A 3N85H 1A1MA 2WXFA 4OGYL 3S7GA 1DVXA 1DQML 4EIUA 1GJWA 3KPPB 1OB1A 1RUMH 3FH5A 4JL2A 1B4JH 2CO7B 4XHQA 4WHCA 4KI5F 5AYUH 2VSCA 3UROR 2PCFA 2K9UA 2RD0A 5DUMH 4F7EA 1F4XL 3FCSA 2XUWA 4KK9C 1T89A 2P5EE 1R17A 4P4RA 1AHWC 2JV6A 3REWB 2Q7NA 3EYQD 3CMOL 3QH3A 1U3ZA 3WY4A 1AC0A 2NSQA 4CKQA 5EEXA 1AO7B 2CUAA 3CPLA 4PJFF 5D93B 2Z91A 3T8XA 5I66A 3T4AC 4LLWA 5FYKU 3NESA 4JO8A 3QFGA 1ZMYA 1S5IH 4PJCF 3BKYL 4L4TE 1C9SA 1MIEH 1MDTA 2E7BA 3QJFA 1IAIH 3I9AA 4LHUD 3HC3L 1CLVA 4UNTA 4PI0A 1G84A 5I17B 3A6BH 3FU6A 1NBYA 2XFXA 3KPNA 1CT8B 5EU5A 2V17H 1ID5I 3NCYP 1FNLA 4KTYA 4X50A 1KXHA 1OHQA 1N3NA 5EFIA 5HYSG 5CEZH 2WJ5A 4G6MH 1NIDA 3WL9A 2LT9A 1YNTF 4M1GL 2FX9H 2GUYA 2J43A 2MNJB 5C0IA 2LU4A 2G30A 1AG6A 5GGUA 1IC0A 1L5GA 3VH8A 4H0LC 3SPCA 4LLUA 4M56A 4P49A 1UADC 1L4IA 2CIIB 4XN9A 3FQNA 5E7FA 2GQHA 4HLZG 4HJ0C 3T6VA 1BFVH 5TK4A 5JNYB 1BVZA 4LLWB 4JFZH 5DXWA 4FD0A 5FYKL 1WTLA 1AGBA 2G2NA 1XXFC 1ZTXE 3TNNB 1CLZL 5IV2A 4XGZA 4LPYA 5HD8D 5L8LB 5GJTL 5EU3B 3WIHL 5FLVA 1QHQA 4WKZB 4WRLA 5CBAA 3VA2C 1IBGH 1IB5A 3A3YB 5C86A 2GSGB 5ITFA 3BWAB 3RIKA 2P80A 2WBJA 1JD9A 3PGCB 3R4RA 3RFZA 2IBZY 4OZFB 3AT9A 4J3OH 3C60B 5E1AA 4EQ2A 3HG1E 5IMOA 1T6BX 5F2FA 4YHNB 1FIGL 1L0YA 5D1ZB 3DJSA 5CILL 1TQVA 2AXHA 4Y16B 2LFEA 1KJMB 2XIDA 1R3LB 3IKKA 5IB5B 2V0AA 3ME0A 4PY8I 1G1YA 4LSRH 4XPBL 1WIPA 2OYPA 2CGYA 3I9GH 3UMTA 3S88H 3SZKC 5LCVA 1MHPH 9PCYA 2OL3B 3QG6A 5CR1A 3MRCA 4IU2A 2XTJD 4CDHA 2GW5A 2J1XA 4Q0XH 4IRZL 1QEWA 4JN1H 5GS2D 3P4LA 1TQTA 4JPSA 4YHYB 2VSMB 1KYDA 4ZUVA 2OKMA 4PJ7A 3H42L 4WTXA 1DFBH 1HXYB 5IMLA 4EIBA 3UJTL 4EI6A 1DLHA 3HZYB 1GOFA 3ZYJA 3NEOA 2F58H 3EBIA 2YZ8A 4LPUA 3VACA 3U9UA 1HT6A 3NDZE 4GXVL 2Y23A 1U8IB 1P4LA 1IILE 4OCSH 2V7HA 4FNRA 3ZZ1A 5I75B 5T33H 3BWUC 2HVJB 3SOBL 4G82A 2J1WA 1KC5H 3AG1B 4F8TA 4G5ZL 4ZMOA 2BIIA 4RVBA 5JORA 5SWQB 3L4YA 3C8HA 2G75B 4LLAA 3VXRE 2WC7A 3IVKB 5I74C 1M4KA 1OF2B 4PJ8B 1F18A 1OW0A 2XG4B 2IGFL 2YLKA 1BQHB 1CYGA 1AJ7L 3AB0C 4JFDE 4D3CH 3L2MA 5DO2D 3G08B 4P5SA 3KLQA 1UJTA 3VXSA 2X1PA 2XQ0A 1F56A 3TCLB 4ZAKB 3VD9A 2BNUA 1WG3A 3TZVA 2E4TA 4E42B 5CMAA 1CB4A 3RL1B 1ML0A 4Y8DC 4OLXH 5AOMA 1JV5A 4ZUUA 4P2RD 1LEGA 2Y5TA 3AAZA 4ZYKA 2IDUA 1EEZB 2WWMD 2EDRA 2V37A 4L1HA 1MFAH 3L7EA 1QO3A 3W5MA 4F7CB 2P4AB 3HN8A 2HG0A 3ILPB 1ILUA 3UERA 4XE0A 2GK2A 1CXFA 4U0QB 4NPKA 5MEPB 2C9RA 1YNKL 3BHBA 1BWMA 2GFBA 3ULVE 1CZ8H 1SLXA 3PF2A 5DMGD 4NO2B 1T5XB 3BP5B 3C60D 4PJ8A 2Z92B 3TYFA 3H9YA 1GJUA 4AYSA 1T04B 2CCVA 2WW8A 1F58H 1V3MA 4K0OA 4YHIB 4F33A 3U4AA 2WGNB 2XWTA 4PWEA 1JMXA 3V4VH 2MEJB 1MHEB 2HVJA 4I7ZC 3RWEB 1BOYA 3T77B 1ET8A 3BN9C 3HMXH 1G4MA 3ARBD 1N8ZA 1FSKB 4N4YB 1X7SA 2XRAH 2XTJB 1PD0A 1T6WA 3P4OB 1N67A 4LDOB 4HWBH 5FUCE 3VFNB 4Z95L 3VRIA 3CBRA 3VFTA 2NUTB 1LDPH 5JDSA 1IAMA 1XF2A 2DD8H 4MA8H 3KZ8A 1OM3L 2X12A 4RGMC 2C4FU 5DRXA 2IXQA 3HS0A 1KJ3H 3RWHA 5ADPL 1I8MA 1QLRA 3FJTA 2CRZA 3GI8H 4Y7MA 4YLQT 2I9TB 3KVPA 3KLHD 1NANI 4HCRL 3MLRH 4PTTB 1ZLVH 1AOHA 1W15A 4PVNA 3KPQA 1G1CA 3DVNB 3MVSA 4FQJL 2BNRE 4PFEA 3MYZA 2OTPA 1P69B 3QIBC 5H4ZA 2X7LA 3WEOA 3LPGA 2YK1H 1G5AA 2UVFA 3LNDA 1J8HD 5D2LF 3KYKH 1QKZL 5KBMA 4XB7A 3UH8A 1F6LL 1UD5A 1P5UB 3GSRB 1FZJA 1F6FB 3MGTB 4X80L 4RMQA 3TFKD 4YR6A 4DN3H 1NGYA 4ZO7A 3WKNA 2E0PA 4P57B 5I8EA 1FZKA 3BPNB 3RX9A 1XSJA 4Y1AE 1KN4L 4YSPA 4PVLA 3ZE0F 3ULVC 5D7LD 1KLUA 5CEYA 4KXZI 3S9DB 2O6DA 5D71L 2B77A 4OI9A 2DWEB 3FTSA 4ZAKA 1HTYA 4ZAKD 2XSKA 1LO5B 4MX7A 2NQCA 1QSED 2FUQA 2OMTA 1ID2A 2MCMA 4KI5E 4AX3A 3QQ9C 2DLIA 2RH0A 3L3DA 4IS6A 4KC3B 4N1HB 5KVGL 4E9WA 3DK2A 4QRBA 4FNUA 3TA3C 3LN9A 2WLKA 3M1BB 4ELMF 3B7YA 2VRKA 4OLZL 5AW6B 3VXPA 4WNJA 2GG1A 3C6LA 3PJSA 2R1YB 3IPEA 4PJAA 3PWLB 1MCEA 1FYTA 1AHKA 2DI9A 2X89D 4UINL 4B5EA 3GXDA 1OL0A 1Y6MR 2EDJA 2IV9A 1HEZA 1M2VB 3W2DL 3ZZSA 1JFQL 1R4XA 1FAKT 4U3SB 4KVCL 3IN2A 4PV8A 2CWRA 4OGYH 3APDA 5B22A 1HINH 2YD3A 2QSCL 4MS8D 3RIFF 1CQKA 4RA0C 3GXFA 1RUML 4GKSB 4BFJA 2HFGH 5C6PB 5L7XH 1QSEA 1S9WB 5C0ND 3V4VB 2H0PA 2PTUA 4D9QE 4P2CG 3RVTD 1XB8A 4N0RA 3P3SA 1NGPL 1A65A 2AXFA 5E9DD 3R8BB 4FULA 4FLOA 4W9EC 3DXAB 2YC1B 3UTPD 5SWSE 3WENA 3C6SA 3KEHA 5HVHC 4FQXB 2ADIB 5DQJB 3ES6B 4G6FB 2X6CA 1PBYA 1T0NB 4NZRL 1WAAF 4WI4A 5E94B 1QSZA 2IPTH 4EPSA 4IDJH 2BWIA 3OKMA 4S0SD 5KYWB 4LMQE 3B9KC 1UD2A 3DGDA 1S5IL 3AXLB 5DUPL 1TG8A 5H8DA 3TJHC 1EO7A 2MRYA 4JJ5B 3KYAA 4K71B 1B2YA 4XC1H 1JK8B 1PZCA 3UGEA 3MV7B 1U8JB 4PIBA 2WQAA 3W1ZA 3QQDB 3E6FB 4A68A 1KPVA 3SQOH 1KY6A 2K45A 3G6DL 3MCYA 1F4YL 3GMNB 2Q2EB 4S1DD 4U1NA 3TCTA 5AW8B 3TJPA 4MXVF 2AMUA 5DJZA 3N50A 4K94H 1R3JA 5TF1H 5IW3A 1ECZA 2EDKA 2FBJL 3L4TA 1TEYA 3BIKA 4D0CA 2P44B 2IPKA 2PN5A 2NY3B 4NRXA 1A7OL 2W0KA 5JIIA 4XO8A 3QIWD 2FSEB 2CJTA 43CAB 3K2UL 5AB2A 1L5GB 2GSIB 3BC9A 4TNWF 3Q0HA 1AD0B 1OE3A 3FFCA 4JJHA 5LGHH 1WBYA 4WHDA 5I66B 5CGBA 1J05B 4X6BB 1A3LH 3KL5A 2BFGA 2QSQA 5AB0A 3CCHB 3CLEH 5CZXC 4L23A 5IHZB 2WVUA 4PJEF 2BDNH 4JPKH 5IQLA 2BZDA 1G7JB 2PW1B 4NC0B 1MFCH 4G6AD 3GSXB 5CU9A 3O3UN 2GY7B 1URIA 1UD4A 4J7RA 4HSCX 2LAAA 3OKKA 4NYLA 5EOCH 3L3JB 3SQRA 3G7TA 4ZK8A 1FG2B 1NC4B 2ZT9C 4HMCA 4K3EL 3WHE1 2BVYA 3OJVC 4ZMZA 4X7TA 1O6SB 1FZJB 4JW3A 2GBVA 1X4XA 4HS8H 4LSQH 2B9AA 4XPAL 4NNPH 3RYMA 4XNXL 1PZ5A 3VD5A 4ZOEA 1KPUA 4KZDL 3S88L 2VL4A 4KJWD 5AVZB 5F7NC 4ZW3A 4FFWD 1L6PA 4BFEA 2VH5H 5LQBH 3GSOB 4Y5XC 1MCLA 2FIKA 4OZ4B 5GRJH 2ARJQ 3RY6C 7PAZA 4Z3EA 4FQXA 4FQXD 2BW4A 1RUQH 4O2FB 4U1SA 1CFBA 1U3HC 2OMZB 3S97C 3OVUB 1SDAB 3ISWA 5CJOL 4H5SA 3CFDB 4AZ8B 3QJRB 4HJEA 3RPBA 3GWJA 2EXSA 3B7SA 1IE4A 2NNXA 2NY0D 1XH3A 5F89B 4UAOC 3S3CB 2GABA 2W91A 4N2EA 1BYNA 4L8DB 5ANMA 4CC4C 1IFGA 2R9HC 3DUHA 2C9SA 3P40A 2WWOA 4P2QE 4IEFB 4JUTA 3FCUB 2EVGA 1N64H 3ZIMA 1F11A 1O9VA 4N0CC 2Q2LA 3GKWL 2NY1C 1WSST 4MS6A 5EU7E 3RILA 1T4KB 5CSGA 2FEEI 4QLRA 1NCCL 4FA6A 5F1NB 2VDQB 2NDGA 5DQ9A 4KNUA 1NC4A 3M8OL 1BZOA 3L5XH 4IRSA 2B5IC 2YA0A 3BVNA 2Z7YA 4N87A 4RIRA 4A7VA 3DVIA 3SPJA 3UYRL 2BSEA 4R84A 4JR9L 4AMWA 4CN4A 2VTFA 25C8H 3GDBA 5EN2A 5FUCC 2OSYA 4W9HC 4CMMB 5IB1B 2BIMA 5DT1H 1ZLUH 1DBJL 1ORQB 3KXFB 3LAFA 2WM0A 1HNFA 4KROD 3WLWC 1J05A 4C83A 4PS8A 3DX0A 3D2UD 3ZO9A 2DLGA 4E42A 3WBDA 1FPTL 3A4EA 2J6EA 4YPJA 3ZLQC 3BUDA 4BFFA 4KTDL 4MAUL 1F11B 1J1XH 2DV6A 3R0NA 4J8RB 4GMTL 4N2CA 2VLKA 1CD9B 3MNWA 5AZEH 2DDQL 1PQZB 2D7TH 3HLAB 3W39A 1DUYB 4S1QL 3B5GA 2K6YA 4XI5D 4KGLA 4OKVB 5EG6C 5LNGA 3GHBL 3P02A 3OJ2C 1DCLA 3BUBA 4UT9A 1KPUB 3EXJA 2ZUYA 1PIGA 4FYQA 4ONFL 2FQEA 3O8XD 3LHAA 1NDMA 4B50A 2BFVH 4MA3A 2FHFA 1RULH 4JCLA 3X1FA 2DMGA 4K23H 3IMSA 5ICYB 5D7IE 4J3SA 2ZE0A 3GZQA 5AKRA 2YIHA 2O30A 4R4FL 1EXHA 2CSPA 4RCAA 5DHYA 4NIKB 1HI6B 4X7FC 4FAAB 1XGUB 4CGTA 2VXSH 4IKKA 5JW4R 2ZJSH 4S2SA 2BVPA 3U2JA 1IFHL 2JIXA 1QWNA 3TIDA 4R97C 4JKPL 1FVDA 3D5OF 2YEVB 3J2PA 3D39D 5GS0L 1ORSB 3BAJA 4BZ2H 3ZRCC 3CZJA 2R2CA 3GBMH 1Q1PA 1XIWC 5BPPA 3VNYA 2WPGA 1QKZH 4FKHA 2AP2A 3RJQB 3TBWA 3HR6A 3JTTB 4ODUB 5AKSA 4GAJH 1ET7A 4KO6A 3N42B 4MSWB 2VJ8A 1BM3L 4DEPC 3IF1B 4QXUL 5A3IC 2A77L 3IRCA 4HLZH 4UM9A 1N0XH 5D7IB 4A6YA 4X6BA 4H8WH 4RSYA 1YYLH 2N1TE 4MDRA 4CC4A 4NZUH 1DBBL 4D0DA 2E76C 1II4E 3IB4A 3RL1A 5C0GB 3RFZB 3LQAL 1TMQA 4KPHH 2NXYB 3DSFL 4ZUSA 4WO4A 4G9FB 4ZPTA 5E5MB 4UTAL 1DANT 3ECUA 4A7TA 2AXWA 5I28A 2VR8A 3STZB 1K4DA 3UBXI 1Q90A 3SDCA 1WA1X 3F6LA 1DEDA 2IH3A 4L3EA 2OR9L 2J55A 1ED3B 1W0YT 5IESL 3L9YA 2Z35B 1IKFH 3LZQA 3PUUA 3WUWA 3GLZA 4Y5XA 1OAKL 4UT7H 1CGSL 4JY4A 4FS0A 4FXKC 4G9FA 3C5SB 4ZPTB 2EE3A 4WJ5B 5JW5B 5DVLA 2HRPH 2Z34A 5DMIH 3CLFL 3O2WH 1L3WA 4HFUL 3FO0H 5GGVL 5C0FA 5A6IA 1OLZA 3EKCA 3IDMA 4KO9A 5FO7B 3GYRA 2AEWA 3FT2B 5CBEA 3OWEA 4N20A 1U93A 3QK0A 3T2NL 2R23A 5E6RB 5EOCJ 3VM5A 4ZZFA 2FNWA 3PFQA 1PY9A 2O26U 4KNTA 1K6QH 5E94A 3MRRA 3MOAH 1CDJA 1PZAA 3CU1A 2C3VA 3I6GB 4QCIA 3F8UB 2G9KA 4KKZA 1O6TA 1TQWA 2ZF9A 3OJMB 2KERA 3WXVH 4MD0B 3GRWH 2WBWB 3MRCB 4IU2B 5I73B 4Z77A 1LO3H 1LL1A 4DP6X 4JY4B 1JYXA 5C0JB 4Z7NB 3ZXAC 1E8ZA 1D6VL 1D5IH 3JVGA 4LRNH 4NKOA 1KLGB 4AGLA 3F65A 4BGLA 2IQAA 3D3VE 4O9HL 2QR0B 4RAHA 1FYTE 4EMZA 3G9VA 2GTZA 4FNPA 4LCYA 5LN8A 2EYRA 5BXFB 2KLSA 4X5LA 3VA6A 5B8CB 3HHSA 4XVJL 3KPOA 3LKNB 3FHEA 2E5EA 3QE5A 4H1LA 4FTVA 2XN1A 4ZSOE 4R7VA 1JHLH 1ZLUK 3QNYA 1CD0A 2X09A 5D70L 4OY9A 5C0CA 1QR1B 3KHOA 4KMQA 4R7NA 4UQ9A 3TPKA 4HGWB 1WBXA 4PY7B 1RK0A 3V5DA 3ZPDA 2NX5E 3OWRA 2B39A 3RU8H 5BZDA 4ZMTA 2EIEA 4DGYH 2BSTA 2CO4A 3OKNB 3S8GB 1WP6A 2FNBA 3UGXA 3ORJA 1NKGA 4GH7B 4DFIA 3DV4B 7FABH 2A9DA 4FERA 3O9WC 4KTEL 3CLEL 3RVXC 3TBTA 2XZQL 3I6LE 3IU3B 5D7IA 5DFTA 4XAKD 5CMAB 2ADGB 3P69A 3LOWA 4JLRB 5E70A 1FSKC 3SKNA 2GJZA 3AREB 4BM7A 5DURB 2NXZC 4FQCH 2VM9A 4WY7H 3QQXA 4GRMA 2QSVA 3P0YL 4P46A 1IO4C 3ULVH 1V3LA 2ATPB 3B1TA 3G5XA 5F3FA 3QULA 1SBSL 4TTGA 2OQJB 4FC3E 4UQ3A 4JVUA 1IGTA 1SEBB 4L0YA 4ZX5A 1LE9A 1FFPB 3WTYA 1IZJA 2YD6A 2ZCKL 3STBA 4CL7A 4EUPA 3ZW3A 4IRZA 3WU1A 1E27B 3UJIH 1JCKA 4Z7UE 3X1NA 3ZE1B 1IGML 3WAKA 3ZE1E 2NY4C 4RGNE 4PN6A 4F7KA 2JTYA 2ZOKB 1HDMA 1ZLDA 4G42A 4LFHG 2WSPA 1QUNA 2HFFB 3REWA 1H6TA 2EDDA 5BQ7A 4PJDB 2A6JA 4DGIL 4DAGH 2EICA 5E8EA 4KITB 1G7HA 4J6RH 4R4ND 3AB0B 4QT5A 1GCYA 3BISA 5MHSD 4O5LH 4PAZA 5J1AB 5IUSA 3B2MA 3S35L 2IDSA 4TSBH 3HNSH 3N9GL 1S78C 4PGJA 1HJBC 1AZZC 1XGQB 2MWCA 5D2NC 4OZFG 3RDTD 4GRWE 3BVVA 4WO4D 5I19L 3GKWH 3NIGF 1ZV2A 3BKJL 3CD4A 3PHQB 4FXGC 1JPEA 3K2IA 4M7KH 1Q9WB 1IVTA 3D69B 5CJXA 4Y16A 3CHSA 5ISZE 7CGTA 3TTSA 4BUQA 1KG0A 4KOBA 3QNZB 2JVUA 4NT6A 2PPCA 3ZK0A 1AIFA 3DBXA 4GRLC 3SBWC 5LN4A 5CINL 4NYLB 1ACCA 1FCCA 1SEQL 3ARBB 3NCJH 4PJ9A 3D0LB 3PHAA 3NIGB 5CEZD 1DHKA 2FQDA 2B8OT 4GMSH 3UTZB 5CS7A 1AXSA 4MB5A 5IHZA 4NQDE 2DB8A 4DVBA 2NX5A 2R0LL 5LKNA 1NGZB 4G83A 3L4VA 3QO1B 1U6AH 3R1GH 1QTPA 4K5PA 2ZF8A 1TJHH 4OQ1A 2PYFB 1AGEA 3O2DL 5DUML 3ARED 1JGVH 1JFHA 4HK0A 2H3NB 1QNZH 3ARBC 3DTXB 3OLEA 3VGHA 2CO3A 2EYSA 3ASNB 3TN0A 3QZWB 4OZIF 1ZGLA 4HUVA 2UZIH 4S1QH 3FQUA 3O3EB 1EFXB 2FZ3A 2ZTBA 4GJTB 1BPVA 5IVXF 1YMMA 2YEZB 5IQ7L 3ZYIA 4Y4HB 1WZKA 1DVSA 3QCTL 5EIQA 2WSDA 3N04A 5EBMA 1JPSH 3D8MA 1BQHG 4PCKA 3I9IA 1G7QA 1OCWL 3BKYH 3A0OA 1DVZA 4QHKJ 3NTCL 1BFTA 1NCWH 4YDVB 4KI5C 2WBJC 5FDWA 5ICZA 4BCXA 4F80A 1Q9WA 3F7RA 2WZPA 5JXED 5D7LB 3PS6A 2BCKA 1LEIA 4ANWA 1TTAA 2DEXX 5AG9A 3W57A 1URZA 3BRGC 4NQXA 2V17L 2GC7C 4Z0BH 1ICTA 5EOQL 1GYVA 4MXWH 4AK1A 4ELMA 4MB3A 4R4FH 2CZNA 3PABA 4K07A 4NQEA 4PD4J 5FO9A 3BZFB 3OGCA 5KSBA 3GNML 3UJJL 2UYLA 4F7PA 4QMEA 3VW3L 4QRQB 2JKRM 3IFLL 3MRMA 3LKOA 4PMFA 4KU1A 1NPUA 4ELKB 3P0GB 5KSAB 3OAYH 2VMEA 3FB7B 1E4KA 2P49B 5E8EB 1HOEA 4G8FB 3QHFL 4KY1L 1TQBC 1G6RA 1WWAX 3ALXA 1UWGH 3WFHB 3DXAE 4KKLD 1JK9A 4JFFE 3O6ML 3RUGE 1UCBH 3UFIA 1YUKB 4GKOA 2QSTA 1AR1B 4NZUL 5GZOC 4KH9A 4MD4A 5HYQA 2E9WA 5DZVA 4NN6C 1K2DA 1NAMB 4AYDC 1EAJA 4GAAA 1A66A 4HZLB 3CWGA 3KPNB 2JK5A 2GSIA 4PY8J 4N2KA 5I6PA 1R5WB 4RH4A 2YAMA 3BP6B 2PXYD 4UV7H 1Z2KA 4FHKA 5J57B 3TIEB 4QF1B 4YBQD 1X6LA 1P7QD 3GPSA 1DSWA 3BEVB 5AAWA 5F70A 5IESH 2MKLC 4XX1G 3BD4A 1KCUH 5TDOA 3I9GL 3N6YA 1MKFA 1F1GA 4NPYA 1SUHA 3EO0B 1I1FA 4XBGB 4ZMXA 3KE0A 3MREA 1WGOA 4MJ5B 3CLFH 1FVCA 2BP8A 4XC3L 5AAWC 3C09C 3GHPA 4DP0X 4LU5L 1GVIA 1RU9L 5BV7H 2BERA 3NPZB 2ICWB 5A1AA 4KQ3L 2GJRA 3WHE0 4P57A 5I8EB 2QZQA 2GEEA 1YQVH 2YD4A 2IAMD 3NSDA 4Y4HD 2XZAL 4YSUA 1HXKA 2H1PL 5HDLA 4CW1A 4Z7WF 1U92B 3QDGD 2DQTL 3T71A 3VVWA 1IVLA 5FO2A 3BZ4B 1G7QB 3CN1A 3NAAH 1FJ1A 3CXHJ 2GTWB 4NUGL 3RZCD 3OLDA 2EXYD 1VFAB 3K72B 5IR1B 3ILEA 1GGCH 3NFSL 5T33L 1UFGA 5F6HI 1NZRA 2NNAB 3EFDL 1BBJA 1AXTH 3JXAA 4Y1AA 5T1MB 2BWDA 4NUJB 1F2XK 2DWDB 4YEEA 4K3DL 4EDWH 2QPFA 2A6DA 4HJGA 3PWLA 5GRXG 2YC1A 2MOQA 4LCYB 1WT5C 3WTUA 2XWZA 1E8YA 4AYBA 2GAZB 2F2HA 4R3SA 4WLCA 3F7VA 3S2AA 1RSYA 4O9HH 4XNMA 1B9ZA 2GK0A 4YHLL 1FO0B 4LNRA 5BVPL 5GRUL 2RQ8A 5C0JA 4GO6B 1X7QB 4PMEA 4JE0A 3GIVA 1G6RL 4KAQH 5D55A 2WINA 4QXTB 2NZ9C 4WI9A 1E6JH 1RZKC 1ZK5A 3ZKMC 2CKBH 4GFTB 4W1TA 2ZWSA 3PV6B 3US0A 4OLVL 1U2CA 3OAWA 3F7YA 1HNGA 4P9HL 1BAFL 2KKQA 3C8DA 4U6YA 4XN8A 5GPRA 3UACA 2BM3A 4MCNA 3WNOA 3DVFA 3ULAB 5IEHA 2X4NA 1V7MH 2WVSA 3MRRB 4LDCA 3MTXA 2V5TA 2PNDA 2RR3A 1FAIH 4RFNB 1SXSA 3Q2NA 4OJEH 3D69A 2BS9A 3RU8L 1AR1C 5LCVH 5DQDL 4RBPH 3UTSE 5CBEB 5INCB 4KRPC 1GZQA 1C16B 4TL4A 2O72A 3TN0C 3OPZH 4RMRA 3DO7A 1ZE3H 1BXAA 3MLXH 4HXBH 1FZKB 1GS7A 4HC1L 1CE6A 3LIZH 2NXZB 1UGNA 2IBZX 3HRZC 4A2HA 3HMXL 3DV4A 4ESKA 1OY3B 1GSKA 2FO4B 3WMQA 3VI4F 1PZDA 4KJPD 1OGTB 2AQ3A 2MNUA 2O6PA 2X4QA 1J5OH 3P3RA 4G70B 1HE7A 2P5WD 5ID0A 3THML 3QJUB 5BZDB 4GRWF 3SKUD 2G5RA 3VSQA 2LU7A 3HE7A 5E4EC 3T0WA 1OM3H 2GYSA 3LNEA 2IDCA 2WIMA 2MOGA 2COVD 3MGOB 5E95B 5J1SC 5CJXC 1U8MA 2ZCLH 4Q6YA 2H1LM 4LGRB 1PLGL 3OX8A 3Q5OA 4XOEA 4BIKA 4YOKA 1XIWB 4X6EB 3UAJA 1BOGA 3ASWA 1I85A 1X3DA 2DH2A 3FPXA 2RIKA 2EVFA 1U8IA 1KJVB 4PBXA 3RPIA 4AGMA 2ZYRA 3MROA 2IF7A 3EJRA 1LK3L 5CO1A 4XP1L 1NANH 5F9AC 4AOFA 3TGXA 1PIFA 4RRPM 5CKGA 2ADFH 2WNKA 5IIEA 1RZQA 1YDPB 5HSFA 3L3KB 3KYNA 4J3TA 1DDHB 1V10A 4D8PB 2APXA 2NY7L 3WD5H 4P4KD 1UFUA 3NOIA 4GXUN 5FKAB 4U3HA 2JXMB 4KXBA 1TVBA 2APSA 3UTTE 5CP3A 2QVTA 4AMKL 5KYYA 3VXRA 4Q89A 4IRJB 1UT9A 3BRDA 5F9JA 1AMYA 5FXCH 3LH8A 5DEJA 2OMVB 2R0ZH 1TF4A 2IOIA 3CNKA 5CJQL 4DKEL 4FNQA 1X5XA 3OG6B 5AW9B 4K9EL 5FOBA 3MRQA 1YC7A 1SEQH 1DJSA 2I26N 5T3ZH 2QZ5A 4XP9L 4E9YA 3AMKA 3CZGA 1MFVA 3RB7A 1SJEA 3FB8B 1FL5B 1S7UB 2VXUL 2LU5A 2F54B 2X41A 3QORD 5DD0L 5CCJA 2VZ3A 1C16A 4I48A 5JPMC 5KJRL 1AP2B 1TZAA 2E7HA 4HWNA 5FR3A 1RLBA 1JZFA 4FFVD 2X4PA 3DSNB 4G8EB 2E7CA 2Q6WA 4EZKA 1NWPA 4AUJA 1ZOXA 3IPFA 2CLZB 4XVOA 5DURD 2M26A 3KJ4C 4WHYH 1FFQA 3NN8B 2AK1H 2JJUA 2ZXDA 1NEUA 1PVHA 5CHNA 2BNQD 2ZP8A 4KDTA 5FM8A 2FYYA 3MNVA 2GBUA 3P2TA 4EN3B 1VHPA 1TYEB 4R26L 3II3A 2APTA 3C5ZB 2HMIC 1MLBB 4QXVA 3FRPB 1M1XA 4RNRB 3ZKXB 2A1WH 4DKAA 4MSWA 3D48R 5J12C 1KLGA 4R7XA 3CQQA 4BK4A 4Y5YC 3MO1A 4ZD3H 3SKOA 2PTTA 4NN5B 1JZHA 1R9FA 2Y0SA 3E0GA 5F1NA 1RVFH 5LHDA 2DQCL 4JBSA 2Q86B 3GLDA 4Z7OB 1EO5A 2K7PA 3HN3A 1SOSA 3AG3B 1ET5A 2ZG2A 2XIBA 3NSYA 1CFQA 3QUYA 4FG2A 4GG8A 1XF3B 1PPIA 3GSQA 3FQTB 4G9FD 1Q0EA 3MV11 3MRIA 2DQHL 1BBJB 4JB9L 1OKEA 4OR1A 4OM1H 4ZTEA 3VRLF 1RJYA 4BKTC 3DURA 1ZJBA 1XGYL 5DI8B 2Z35A 2D8KA 1FJ1B 3ETBJ 3HKZA 4Y2OA 4KJQC 1EX0A 2GITB 3C9NB 4IBLT 3FYEB 4P4KB 2GIXA 5G5DA 4L1SA 5K1NA 1LILA 2ZUQB 3GXNA 1CFNB 3BQUB 4FKKA 4CN6A 3KLDA 5C0FB 2CE6A 3Q8CA 4PGCB 1UWEH 4MD5B 4YUEL 3VI3E 1MXGA 1SUJA 3NJXA 4QHPA 1A3LL 1MZZA 5D1ZD 4YS4A 5F72S 5AAPA 5JHMA 2Y22A 4HSAC 3ULUL 2YQBA 3FF8A 4UU9A 4OKVA 3IGUA 1A8JH 5F96L 4JFFA 3T3PB 2PR9A 5JPMB 4OT1L 4J3VA 3X3FH 5DK2A 4UV7L 3KWXA 4DW2L 3LRSA 4R0LC 2F5BL 7PCYA 4X8JA 2YPVA 5B39B 4OF3A 4YXLL