1CZ4A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
185
structure length
185
Chain Sequence
b'MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VCP-LIKE ATPASE
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 24
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz4A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz4A02
1TWGA 3DMRA 1G8KA 2JIOA 3PLXB 2NAPA 1WCMA 1TWCA 1H5NA 1IW7D 3QC8A 4KDIA 1PT1A 2WB1A 1G8JA 1CZ4A 5DYIA 1EU1A 3H0GA 4GA6A 1PQEA 1UHEA 1FDOA 5C1BA 3GTKA 1Y1VA 3GTQA 4CRZA 2R7ZA 5B6CA 2VPZA 2C45A 1QCSA 5GLFA 5DYGA 2VPYA 2VPWA 3GTPA 2VUMA 1CR5A 1QDNA 1Y1WA 2R93A 1S3SA 2NVYA 2EEOB 4CS0A 1YLEA 4RV0A 1AW8B 1DMRA 3GTJA 2JIRA 4AZDA 1VC3B 4D7ZB 1PPYA 5EPPA 1TWHA 4KO8A 2KI8A 3TM7B 3IR6A 2NVXA 1AA6A 2JIQA 2V45A 4AYBA 3IR5A 1E18A 4C2MA 3O5AA 3HU1A 2Y0SA 1E60A 1E5VA 2PMZA 2E2IA 4KODA 4CRYG 3FKIA 3QQ8A 2JA6A 2VPXA 5C18A 3HU2A 1E32A 3CF2A 1TMOA 5FTJA 4GA5A 1Q16A 3TIWA 3CQZA 3GTMA 4AAYA 2YU9A 1CZ5A 2JIPA 1OGYA 2WAQA 2PJHB 4KDLA 4QIWA 1H0HA 1Y5IA 5FTKA 3ML1A 2JIMA 1SIWA 3QQ7A 1PYUB 2IV2X 4AOKB 1R7RA 2E7ZA 5FTNA 1UHDA 5T5ID 3HU3A 3GTOA 2V3VA 1I3QA 3HKZA 1DMSA 3GTGA 2R92A 1PQFA 1E61A 3OUGA 1Y4ZA 1SFOA 1I50A 2B63A 1KQFA 4KLNA 2NYAA 1R9TA 1R27A 1K83A 1FDIA 1PT0A 1PQHA 2E2HA 3GTLA 4DMRA 5FTLA 3IR7A 2JA5A 2YUJA 1TWAA 1TWFA 1WLFA 4AONB 2DMRA 2JA7A 5T5MD 5FTMA 1PYQA 1KQGA 2JV2A 1ZC1A 3QWZA
chains in the Genus database with same CATH superfamily
1TWGA 2KY9A 3DMRA 2GAEA 1BW3A 4ARIA 1G8KA 2JIOA 2Q1DX 2HCZX 3PLXB 2NAPA 4FG4A 4FG2A 1WCMA 3ENGA 2QQRA 1TWCA 1H5NA 4JS7A 1IW7D 3QC8A 3CZBA 4KDIA 1PT1A 2CW0D 2AE0X 2WB1A 2B25A 1G8JA 3ZJUA 1CZ4A 4CQNA 4FERA 5DYIA 1EU1A 2KQAA 4AVRA 3MB5A 3H0GA 4GA6A 1PQEA 1UHEA 4JP6A 1FDOA 5C1BA 3GTKA 1Y1VA 3GTQA 1WC2A 4CRZA 2A6HD 2R7ZA 3X2KA 5B6CA 2VPZA 2PWYA 2C45A 1QCSA 5GLFA 3SUJA 3X2NA 5DYGA 2VPWA 2VPYA 2BH0A 3GTPA 2YVLA 2VUMA 1CR5A 1QDNA 1Y1WA 2R93A 5CD1A 1S3SA 2NVYA 2LW6A 2EEOB 4CS0A 1YLEA 4RV0A 3FPTA 1YNND 1AW8B 1ZYRD 1DMRA 1BW4A 3GTJA 1SMYD 4JJOA 2O5JD 2BE5D 3X2IA 4AS1A 2JIRA 4AZDA 2MM0A 5D6XA 3FPUA 2PNWA 1VC3B 2A69D 3ZJVA 4D7ZB 1PPYA 5EPPA 2QQSA 1TWHA 4KO8A 2KI8A 3TM7B 3IR6A 2NVXA 4ENGA 1AA6A 2JIQA 2Q19X 4FIBA 2V45A 5D6WA 5ERGB 4AYBA 3IR5A 1E18A 2A68D 4L48A 5H4UA 4C2MA 3O5AA 3M3GA 3HU1A 2Y0SA 1E60A 3X2GA 4ZM7A 1E5VA 3ZGZA 2PMZA 2XDPA 4NOHA 2E2IA 4KODA 4CRYG 3FKIA 3QQ8A 2JA6A 3LGAA 3LHDA 2VPXA 5C18A 4UC4A 4ARCA 2Q1AX 3HU2A 1E32A 3CF2A 1TMOA 5FTJA 4GA5A 5GLYA 3BQBA 1Q16A 3TIWA 2PJJA 3CQZA 3GTMA 3SULA 2G6GA 4AAYA 2YU9A 1CZ5A 4JCWA 2JIPA 1OGYA 2WAQA 2PJHB 1HD5A 4KDLA 1H0HA 1Y5IA 4QIWA 3ML1A 5FTKA 2JIMA 1SIWA 3QQ7A 1PYUB 2IV2X 4AOKB 1R7RA 3X2LA 2E7ZA 1OA7A 5FTNA 1UHDA 5T5ID 3X2PA 3HU3A 2A6ED 3GTOA 2V3VA 1I3QA 5D6YA 5EQJB 3HKZA 1DMSA 3GTGA 2R92A 5GLXA 1PQFA 1E61A 3X2JA 3FPRA 3D30A 5GM9A 1L8FA 3OUGA 2MM2A 5CCXA 1Y4ZA 1SFOA 1I50A 2B63A 1KQFA 1N10A 4KLNA 3X2MA 3SUMA 2NYAA 1R9TA 1R27A 2G5DA 1K83A 2GFAA 1FDIA 4AQ7A 3X2OA 4FFTA 1O54A 1I9GA 1PT0A 1PQHA 2E2HA 3GTLA 5CCBA 3SUKA 4DMRA 5FTLA 2YUJA 1YNJD 3IR7A 1TWAA 2JA5A 1TWFA 1WLFA 3ZJTA 3X2HA 4AONB 2DMRA 2JA7A 5T5MD 5FTMA 1PYQA 2Q1CX 2PICA 2Q18X 1KQGA 2ENGA 2PI8A 2JV2A 1ZC1A 4JP7A 3QWZA 1OA9A 2GF7A
chains in the Genus database with same CATH topology
1TWGA 2KY9A 3DMRA 2GAEA 4ARIA 1G8KA 2JIOA 2Q1DX 3PLXB 2NAPA 1WCMA 2QQRA 1TWCA 1H5NA 1IW7D 3QC8A 3CZBA 4KDIA 1PT1A 2CW0D 2AE0X 2WB1A 2B25A 1G8JA 3ZJUA 1CZ4A 4CQNA 5DYIA 1EU1A 3MB5A 3H0GA 4GA6A 1PQEA 1UHEA 1FDOA 5C1BA 3GTKA 1Y1VA 3GTQA 4CRZA 2A6HD 2R7ZA 5B6CA 2VPZA 2PWYA 2C45A 1QCSA 5GLFA 5DYGA 2VPWA 2VPYA 3GTPA 2YVLA 2VUMA 1CR5A 1QDNA 1Y1WA 2R93A 5CD1A 1S3SA 2NVYA 2LW6A 2EEOB 4CS0A 1YLEA 4RV0A 3FPTA 1YNND 1AW8B 1ZYRD 1DMRA 3GTJA 1SMYD 2O5JD 2BE5D 4AS1A 2JIRA 4AZDA 2MM0A 5D6XA 3FPUA 2PNWA 1VC3B 2A69D 3ZJVA 4D7ZB 1PPYA 5EPPA 2QQSA 1TWHA 4KO8A 2KI8A 3TM7B 3IR6A 2NVXA 1AA6A 2JIQA 2Q19X 4FIBA 2V45A 5D6WA 5ERGB 4AYBA 3IR5A 1E18A 2A68D 4C2MA 3O5AA 3HU1A 2Y0SA 1E60A 1E5VA 3ZGZA 2PMZA 2XDPA 4NOHA 2E2IA 4KODA 4CRYG 3FKIA 3QQ8A 2JA6A 3LGAA 3LHDA 2VPXA 5C18A 4UC4A 4ARCA 2Q1AX 3HU2A 1E32A 3CF2A 1TMOA 5FTJA 4GA5A 3BQBA 1Q16A 3TIWA 2PJJA 3CQZA 3GTMA 2G6GA 4AAYA 2YU9A 1CZ5A 2JIPA 1OGYA 2WAQA 2PJHB 4KDLA 4QIWA 1H0HA 1Y5IA 5FTKA 3ML1A 2JIMA 1SIWA 3QQ7A 1PYUB 2IV2X 4AOKB 1R7RA 2E7ZA 5FTNA 1UHDA 5T5ID 3HU3A 2A6ED 3GTOA 2V3VA 1I3QA 5D6YA 5EQJB 3HKZA 1DMSA 3GTGA 2R92A 1PQFA 1E61A 3FPRA 3OUGA 2MM2A 5CCXA 1Y4ZA 1SFOA 1I50A 2B63A 1KQFA 4KLNA 2NYAA 1R9TA 1R27A 2G5DA 1K83A 2GFAA 1FDIA 4AQ7A 1O54A 1I9GA 1PT0A 1PQHA 2E2HA 3GTLA 5CCBA 4DMRA 5FTLA 2YUJA 1YNJD 3IR7A 1TWAA 2JA5A 1TWFA 1WLFA 3ZJTA 4AONB 2DMRA 2JA7A 5T5MD 5FTMA 1PYQA 2Q1CX 2PICA 2Q18X 1KQGA 2PI8A 2JV2A 1ZC1A 3QWZA 2GF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG A;  3DMR A;  1G8K A;  2JIO A;  3PLX B;  2NAP A;  1WCM A;  1TWC A;  1H5N A;  1IW7 D;  3QC8 A;  4KDI A;  1PT1 A;  2WB1 A;  1G8J A;  1CZ4 A;  5DYI A;  1EU1 A;  3H0G A;  4GA6 A;  1PQE A;  1UHE A;  1FDO A;  5C1B A;  3GTK A;  1Y1V A;  3GTQ A;  4CRZ A;  2R7Z A;  5B6C A;  2VPZ A;  2C45 A;  1QCS A;  5GLF A;  5DYG A;  2VPY A;  2VPW A;  3GTP A;  2VUM A;  1CR5 A;  1QDN A;  1Y1W A;  2R93 A;  1S3S A;  2NVY A;  2EEO B;  4CS0 A;  1YLE A;  4RV0 A;  1AW8 B;  1DMR A;  3GTJ A;  2JIR A;  4AZD A;  1VC3 B;  4D7Z B;  1PPY A;  5EPP A;  1TWH A;  4KO8 A;  2KI8 A;  3TM7 B;  3IR6 A;  2NVX A;  1AA6 A;  2JIQ A;  2V45 A;  4AYB A;  3IR5 A;  1E18 A;  4C2M A;  3O5A A;  3HU1 A;  2Y0S A;  1E60 A;  1E5V A;  2PMZ A;  2E2I A;  4KOD A;  4CRY G;  3FKI A;  3QQ8 A;  2JA6 A;  2VPX A;  5C18 A;  3HU2 A;  1E32 A;  3CF2 A;  1TMO A;  5FTJ A;  4GA5 A;  1Q16 A;  3TIW A;  3CQZ A;  3GTM A;  4AAY A;  2YU9 A;  1CZ5 A;  2JIP A;  1OGY A;  2WAQ A;  2PJH B;  4KDL A;  4QIW A;  1H0H A;  1Y5I A;  5FTK A;  3ML1 A;  2JIM A;  1SIW A;  3QQ7 A;  1PYU B;  2IV2 X;  4AOK B;  1R7R A;  2E7Z A;  5FTN A;  1UHD A;  5T5I D;  3HU3 A;  3GTO A;  2V3V A;  1I3Q A;  3HKZ A;  1DMS A;  3GTG A;  2R92 A;  1PQF A;  1E61 A;  3OUG A;  1Y4Z A;  1SFO A;  1I50 A;  2B63 A;  1KQF A;  4KLN A;  2NYA A;  1R9T A;  1R27 A;  1K83 A;  1FDI A;  1PT0 A;  1PQH A;  2E2H A;  3GTL A;  4DMR A;  5FTL A;  3IR7 A;  2JA5 A;  2YUJ A;  1TWA A;  1TWF A;  1WLF A;  4AON B;  2DMR A;  2JA7 A;  5T5M D;  5FTM A;  1PYQ A;  1KQG A;  2JV2 A;  1ZC1 A;  3QWZ A; 
#chains in the Genus database with same CATH topology
 1TWG A;  2KY9 A;  3DMR A;  2GAE A;  1BW3 A;  4ARI A;  1G8K A;  2JIO A;  2Q1D X;  2HCZ X;  3PLX B;  2NAP A;  4FG4 A;  4FG2 A;  1WCM A;  3ENG A;  2QQR A;  1TWC A;  1H5N A;  4JS7 A;  1IW7 D;  3QC8 A;  3CZB A;  4KDI A;  1PT1 A;  2CW0 D;  2AE0 X;  2WB1 A;  2B25 A;  1G8J A;  3ZJU A;  1CZ4 A;  4CQN A;  4FER A;  5DYI A;  1EU1 A;  2KQA A;  4AVR A;  3MB5 A;  3H0G A;  4GA6 A;  1PQE A;  1UHE A;  4JP6 A;  1FDO A;  5C1B A;  3GTK A;  1Y1V A;  3GTQ A;  1WC2 A;  4CRZ A;  2A6H D;  2R7Z A;  3X2K A;  5B6C A;  2VPZ A;  2PWY A;  2C45 A;  1QCS A;  5GLF A;  3SUJ A;  3X2N A;  5DYG A;  2VPW A;  2VPY A;  2BH0 A;  3GTP A;  2YVL A;  2VUM A;  1CR5 A;  1QDN A;  1Y1W A;  2R93 A;  5CD1 A;  1S3S A;  2NVY A;  2LW6 A;  2EEO B;  4CS0 A;  1YLE A;  4RV0 A;  3FPT A;  1YNN D;  1AW8 B;  1ZYR D;  1DMR A;  1BW4 A;  3GTJ A;  1SMY D;  4JJO A;  2O5J D;  2BE5 D;  3X2I A;  4AS1 A;  2JIR A;  4AZD A;  2MM0 A;  5D6X A;  3FPU A;  2PNW A;  1VC3 B;  2A69 D;  3ZJV A;  4D7Z B;  1PPY A;  5EPP A;  2QQS A;  1TWH A;  4KO8 A;  2KI8 A;  3TM7 B;  3IR6 A;  2NVX A;  4ENG A;  1AA6 A;  2JIQ A;  2Q19 X;  4FIB A;  2V45 A;  5D6W A;  5ERG B;  4AYB A;  3IR5 A;  1E18 A;  2A68 D;  4L48 A;  5H4U A;  4C2M A;  3O5A A;  3M3G A;  3HU1 A;  2Y0S A;  1E60 A;  3X2G A;  4ZM7 A;  1E5V A;  3ZGZ A;  2PMZ A;  2XDP A;  4NOH A;  2E2I A;  4KOD A;  4CRY G;  3FKI A;  3QQ8 A;  2JA6 A;  3LGA A;  3LHD A;  2VPX A;  5C18 A;  4UC4 A;  4ARC A;  2Q1A X;  3HU2 A;  1E32 A;  3CF2 A;  1TMO A;  5FTJ A;  4GA5 A;  5GLY A;  3BQB A;  1Q16 A;  3TIW A;  2PJJ A;  3CQZ A;  3GTM A;  3SUL A;  2G6G A;  4AAY A;  2YU9 A;  1CZ5 A;  4JCW A;  2JIP A;  1OGY A;  2WAQ A;  2PJH B;  1HD5 A;  4KDL A;  1H0H A;  1Y5I A;  4QIW A;  3ML1 A;  5FTK A;  2JIM A;  1SIW A;  3QQ7 A;  1PYU B;  2IV2 X;  4AOK B;  1R7R A;  3X2L A;  2E7Z A;  1OA7 A;  5FTN A;  1UHD A;  5T5I D;  3X2P A;  3HU3 A;  2A6E D;  3GTO A;  2V3V A;  1I3Q A;  5D6Y A;  5EQJ B;  3HKZ A;  1DMS A;  3GTG A;  2R92 A;  5GLX A;  1PQF A;  1E61 A;  3X2J A;  3FPR A;  3D30 A;  5GM9 A;  1L8F A;  3OUG A;  2MM2 A;  5CCX A;  1Y4Z A;  1SFO A;  1I50 A;  2B63 A;  1KQF A;  1N10 A;  4KLN A;  3X2M A;  3SUM A;  2NYA A;  1R9T A;  1R27 A;  2G5D A;  1K83 A;  2GFA A;  1FDI A;  4AQ7 A;  3X2O A;  4FFT A;  1O54 A;  1I9G A;  1PT0 A;  1PQH A;  2E2H A;  3GTL A;  5CCB A;  3SUK A;  4DMR A;  5FTL A;  2YUJ A;  1YNJ D;  3IR7 A;  1TWA A;  2JA5 A;  1TWF A;  1WLF A;  3ZJT A;  3X2H A;  4AON B;  2DMR A;  2JA7 A;  5T5M D;  5FTM A;  1PYQ A;  2Q1C X;  2PIC A;  2Q18 X;  1KQG A;  2ENG A;  2PI8 A;  2JV2 A;  1ZC1 A;  4JP7 A;  3QWZ A;  1OA9 A;  2GF7 A; 
#chains in the Genus database with same CATH homology
 1TWG A;  2KY9 A;  3DMR A;  2GAE A;  4ARI A;  1G8K A;  2JIO A;  2Q1D X;  3PLX B;  2NAP A;  1WCM A;  2QQR A;  1TWC A;  1H5N A;  1IW7 D;  3QC8 A;  3CZB A;  4KDI A;  1PT1 A;  2CW0 D;  2AE0 X;  2WB1 A;  2B25 A;  1G8J A;  3ZJU A;  1CZ4 A;  4CQN A;  5DYI A;  1EU1 A;  3MB5 A;  3H0G A;  4GA6 A;  1PQE A;  1UHE A;  1FDO A;  5C1B A;  3GTK A;  1Y1V A;  3GTQ A;  4CRZ A;  2A6H D;  2R7Z A;  5B6C A;  2VPZ A;  2PWY A;  2C45 A;  1QCS A;  5GLF A;  5DYG A;  2VPW A;  2VPY A;  3GTP A;  2YVL A;  2VUM A;  1CR5 A;  1QDN A;  1Y1W A;  2R93 A;  5CD1 A;  1S3S A;  2NVY A;  2LW6 A;  2EEO B;  4CS0 A;  1YLE A;  4RV0 A;  3FPT A;  1YNN D;  1AW8 B;  1ZYR D;  1DMR A;  3GTJ A;  1SMY D;  2O5J D;  2BE5 D;  4AS1 A;  2JIR A;  4AZD A;  2MM0 A;  5D6X A;  3FPU A;  2PNW A;  1VC3 B;  2A69 D;  3ZJV A;  4D7Z B;  1PPY A;  5EPP A;  2QQS A;  1TWH A;  4KO8 A;  2KI8 A;  3TM7 B;  3IR6 A;  2NVX A;  1AA6 A;  2JIQ A;  2Q19 X;  4FIB A;  2V45 A;  5D6W A;  5ERG B;  4AYB A;  3IR5 A;  1E18 A;  2A68 D;  4C2M A;  3O5A A;  3HU1 A;  2Y0S A;  1E60 A;  1E5V A;  3ZGZ A;  2PMZ A;  2XDP A;  4NOH A;  2E2I A;  4KOD A;  4CRY G;  3FKI A;  3QQ8 A;  2JA6 A;  3LGA A;  3LHD A;  2VPX A;  5C18 A;  4UC4 A;  4ARC A;  2Q1A X;  3HU2 A;  1E32 A;  3CF2 A;  1TMO A;  5FTJ A;  4GA5 A;  3BQB A;  1Q16 A;  3TIW A;  2PJJ A;  3CQZ A;  3GTM A;  2G6G A;  4AAY A;  2YU9 A;  1CZ5 A;  2JIP A;  1OGY A;  2WAQ A;  2PJH B;  4KDL A;  4QIW A;  1H0H A;  1Y5I A;  5FTK A;  3ML1 A;  2JIM A;  1SIW A;  3QQ7 A;  1PYU B;  2IV2 X;  4AOK B;  1R7R A;  2E7Z A;  5FTN A;  1UHD A;  5T5I D;  3HU3 A;  2A6E D;  3GTO A;  2V3V A;  1I3Q A;  5D6Y A;  5EQJ B;  3HKZ A;  1DMS A;  3GTG A;  2R92 A;  1PQF A;  1E61 A;  3FPR A;  3OUG A;  2MM2 A;  5CCX A;  1Y4Z A;  1SFO A;  1I50 A;  2B63 A;  1KQF A;  4KLN A;  2NYA A;  1R9T A;  1R27 A;  2G5D A;  1K83 A;  2GFA A;  1FDI A;  4AQ7 A;  1O54 A;  1I9G A;  1PT0 A;  1PQH A;  2E2H A;  3GTL A;  5CCB A;  4DMR A;  5FTL A;  2YUJ A;  1YNJ D;  3IR7 A;  1TWA A;  2JA5 A;  1TWF A;  1WLF A;  3ZJT A;  4AON B;  2DMR A;  2JA7 A;  5T5M D;  5FTM A;  1PYQ A;  2Q1C X;  2PIC A;  2Q18 X;  1KQG A;  2PI8 A;  2JV2 A;  1ZC1 A;  3QWZ A;  2GF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...