1CZ4A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
185
structure length
185
Chain Sequence
MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VCP-LIKE ATPASE
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 24
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz4A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz4A02
3IR6A 5FTNA 5FTKA 5T5MD 3GTKA 1E18A 1CZ5A 1CZ4A 2B63A 3H0GA 1DMSA 2VPZA 4KO8A 4CS0A 2V45A 1S3SA 2JA5A 3GTGA 1AW8B 4CRYG 2R93A 4AZDA 2KI8A 4GA5A 5DYIA 4DMRA 1Y4ZA 1WLFA 2VPXA 1EU1A 1KQGA 5C1BA 5FTMA 3OUGA 3PLXB 3HU3A 2WAQA 2VPWA 1R9TA 5B6CA 3TIWA 3IR7A 4RV0A 2JIMA 1UHEA 1FDOA 1TWCA 2Y0SA 5EPPA 2DMRA 2JA6A 1E5VA 1TMOA 3CF2A 1E32A 1Y5IA 3GTPA 2JA7A 2NAPA 3HU2A 1WCMA 1AA6A 1I50A 2NVYA 4D7ZB 1G8JA 1TWFA 3ML1A 3FKIA 3GTOA 2C45A 1PPYA 5FTLA 2YUJA 5FTJA 2E2IA 1PYQA 3IR5A 3QWZA 1TWHA 4KDIA 2R92A 1IW7D 2JIPA 4AONB 3HU1A 5GLFA 1I3QA 2PMZA 1SIWA 2NYAA 3HKZA 4QIWA 4KDLA 2JV2A 3GTQA 2VUMA 2WB1A 4CRZA 2JIQA 2VPYA 1DMRA 1Y1VA 4AOKB 1PT1A 1E61A 2V3VA 3QQ7A 1YLEA 2IV2X 1OGYA 1H0HA 1Y1WA 2E7ZA 3TM7B 1K83A 1PQEA 3GTMA 1TWAA 1TWGA 1PQHA 4KODA 3QC8A 1PYUB 2PJHB 1H5NA 3DMRA 2NVXA 4AYBA 2JIRA 1ZC1A 1QDNA 2EEOB 1QCSA 3CQZA 4C2MA 4AAYA 3GTLA 1E60A 3GTJA 1PQFA 1R7RA 1PT0A 3O5AA 1SFOA 1FDIA 4GA6A 5C18A 2YU9A 4KLNA 3QQ8A 1R27A 2R7ZA 1G8KA 1Q16A 1VC3B 2JIOA 1KQFA 5T5ID 1CR5A 2E2HA 1UHDA 5DYGA
chains in the Genus database with same CATH superfamily
3ZJVA 3IR6A 3M3GA 4AQ7A 5FTNA 5FTKA 2CW0D 5T5MD 4ENGA 1OA7A 1E18A 3SUKA 3GTKA 1CZ5A 1CZ4A 1OA9A 2A6HD 2B63A 2PWYA 3ZJUA 5EQJB 3H0GA 1DMSA 2VPZA 4FFTA 2Q1CX 2A6ED 3X2HA 1O54A 3FPRA 4KO8A 4CS0A 4JS7A 2V45A 3X2OA 4AS1A 1S3SA 2JA5A 3GTGA 1AW8B 4CRYG 2R93A 4AZDA 5D6YA 2KI8A 4GA5A 5DYIA 4DMRA 2HCZX 4ARIA 1Y4ZA 1WLFA 2VPXA 1EU1A 4CQNA 1KQGA 5C1BA 5FTMA 3OUGA 5CCXA 4FG4A 4FERA 3PLXB 3HU3A 2WAQA 4L48A 2VPWA 1R9TA 5B6CA 3X2PA 3TIWA 3IR7A 4RV0A 2JIMA 3LGAA 1UHEA 2G6GA 1FDOA 1TWCA 2Y0SA 5EPPA 2DMRA 2JA6A 1E5VA 1TMOA 4JJOA 1HD5A 3CF2A 2MM0A 1E32A 1Y5IA 3GTPA 2JA7A 4UC4A 2NAPA 4ARCA 3HU2A 1WCMA 4NOHA 1AA6A 3SUJA 5CCBA 1I50A 4ZM7A 2NVYA 3CZBA 1G8JA 4D7ZB 1WC2A 1TWFA 3ML1A 2A68D 3FKIA 3GTOA 5D6XA 2C45A 1PPYA 2O5JD 2YUJA 5FTLA 5FTJA 2E2IA 1PYQA 3IR5A 3QWZA 2GFAA 1TWHA 2QQRA 3FPUA 3X2IA 4KDIA 2Q1DX 2Q18X 2R92A 1IW7D 2JIPA 4AONB 2Q19X 3HU1A 2YVLA 5GLFA 3SUMA 1I3QA 2PMZA 3X2JA 3ZJTA 1SIWA 2NYAA 3HKZA 4QIWA 3LHDA 2PNWA 4KDLA 2JV2A 2Q1AX 3GTQA 4FG2A 2VUMA 2PI8A 3X2NA 5GLXA 2G5DA 2WB1A 2JIQA 2VPYA 3X2KA 1DMRA 4CRZA 5CD1A 2B25A 1Y1VA 4AOKB 1PT1A 2GF7A 1E61A 2V3VA 2KY9A 3QQ7A 1L8FA 5GM9A 5ERGB 1YLEA 2QQSA 2IV2X 1OGYA 1H0HA 4JP7A 3FPTA 3ZGZA 3X2GA 1N10A 1Y1WA 2LW6A 2MM2A 2E7ZA 2GAEA 2ENGA 1YNND 3TM7B 1K83A 1PQEA 2PJJA 1BW3A 3GTMA 1BW4A 2A69D 1TWAA 1TWGA 1PQHA 4KODA 3QC8A 1PYUB 2PJHB 1H5NA 3DMRA 2NVXA 4AYBA 2AE0X 2KQAA 1ZC1A 2JIRA 4FIBA 1QDNA 2EEOB 3ENGA 1QCSA 3X2MA 4AVRA 3CQZA 4C2MA 4AAYA 3GTLA 3D30A 1E60A 1ZYRD 2PICA 3GTJA 1PQFA 1R7RA 2XDPA 1PT0A 3O5AA 1SFOA 1FDIA 4GA6A 5C18A 2YU9A 4KLNA 1I9GA 3MB5A 3QQ8A 1R27A 5GLYA 1G8KA 4JCWA 2R7ZA 1Q16A 4JP6A 1YNJD 1VC3B 2BE5D 2JIOA 1KQFA 3BQBA 5T5ID 1CR5A 5D6WA 2BH0A 3SULA 5H4UA 2E2HA 1UHDA 1SMYD 3X2LA 5DYGA
chains in the Genus database with same CATH topology
3ZJVA 3IR6A 4AQ7A 5FTNA 5FTKA 2CW0D 5T5MD 3GTKA 1E18A 1CZ5A 1CZ4A 3ZJUA 2A6HD 2B63A 2PWYA 5EQJB 3H0GA 1DMSA 2VPZA 2Q1CX 2A6ED 1O54A 3FPRA 4KO8A 4CS0A 2V45A 4AS1A 1S3SA 2JA5A 3GTGA 1AW8B 4CRYG 2R93A 4AZDA 5D6YA 2KI8A 4GA5A 5DYIA 4DMRA 4ARIA 4CQNA 1Y4ZA 1WLFA 2VPXA 1EU1A 1KQGA 5C1BA 5FTMA 3OUGA 5CCXA 3PLXB 3HU3A 2WAQA 2VPWA 1R9TA 5B6CA 3TIWA 3IR7A 4RV0A 2JIMA 3LGAA 1UHEA 2G6GA 1FDOA 1TWCA 2Y0SA 5EPPA 2DMRA 2JA6A 1E5VA 1TMOA 3CF2A 2MM0A 1E32A 1Y5IA 3GTPA 2JA7A 4UC4A 2NAPA 3HU2A 1WCMA 4NOHA 1AA6A 5CCBA 1I50A 2NVYA 3CZBA 1G8JA 4D7ZB 1TWFA 3ML1A 2A68D 3FKIA 3GTOA 5D6XA 2C45A 1PPYA 2O5JD 2YUJA 5FTLA 5FTJA 2E2IA 1PYQA 3IR5A 3QWZA 2GFAA 1TWHA 2QQRA 3FPUA 4KDIA 2Q1DX 2Q18X 2R92A 1IW7D 2JIPA 4AONB 2Q19X 3HU1A 2YVLA 5GLFA 1I3QA 2PMZA 3ZJTA 1SIWA 2NYAA 3HKZA 4QIWA 3LHDA 2PNWA 4KDLA 2JV2A 2Q1AX 3GTQA 2VUMA 2PI8A 4ARCA 2G5DA 2WB1A 2JIQA 2VPYA 4CRZA 1DMRA 5CD1A 2B25A 1Y1VA 4AOKB 1PT1A 2GF7A 1E61A 2V3VA 2KY9A 3QQ7A 5ERGB 1YLEA 2QQSA 2IV2X 1OGYA 1H0HA 3FPTA 3ZGZA 1Y1WA 2LW6A 2MM2A 2E7ZA 2GAEA 3TM7B 1YNND 1K83A 1PQEA 2PJJA 3GTMA 2A69D 1TWAA 1TWGA 1PQHA 4KODA 3QC8A 1PYUB 2PJHB 1H5NA 3DMRA 2NVXA 4AYBA 2AE0X 2JIRA 1ZC1A 4FIBA 1QDNA 2EEOB 1QCSA 3CQZA 4C2MA 4AAYA 3GTLA 2PICA 1E60A 1ZYRD 3GTJA 1PQFA 1R7RA 2XDPA 1PT0A 3O5AA 1SFOA 1FDIA 4GA6A 5C18A 2YU9A 4KLNA 1I9GA 3MB5A 3QQ8A 1R27A 2R7ZA 1G8KA 1Q16A 1YNJD 1VC3B 2BE5D 2JIOA 1KQFA 3BQBA 5T5ID 1CR5A 5D6WA 2E2HA 1UHDA 1SMYD 5DYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IR6 A;  5FTN A;  5FTK A;  5T5M D;  3GTK A;  1E18 A;  1CZ5 A;  1CZ4 A;  2B63 A;  3H0G A;  1DMS A;  2VPZ A;  4KO8 A;  4CS0 A;  2V45 A;  1S3S A;  2JA5 A;  3GTG A;  1AW8 B;  4CRY G;  2R93 A;  4AZD A;  2KI8 A;  4GA5 A;  5DYI A;  4DMR A;  1Y4Z A;  1WLF A;  2VPX A;  1EU1 A;  1KQG A;  5C1B A;  5FTM A;  3OUG A;  3PLX B;  3HU3 A;  2WAQ A;  2VPW A;  1R9T A;  5B6C A;  3TIW A;  3IR7 A;  4RV0 A;  2JIM A;  1UHE A;  1FDO A;  1TWC A;  2Y0S A;  5EPP A;  2DMR A;  2JA6 A;  1E5V A;  1TMO A;  3CF2 A;  1E32 A;  1Y5I A;  3GTP A;  2JA7 A;  2NAP A;  3HU2 A;  1WCM A;  1AA6 A;  1I50 A;  2NVY A;  4D7Z B;  1G8J A;  1TWF A;  3ML1 A;  3FKI A;  3GTO A;  2C45 A;  1PPY A;  5FTL A;  2YUJ A;  5FTJ A;  2E2I A;  1PYQ A;  3IR5 A;  3QWZ A;  1TWH A;  4KDI A;  2R92 A;  1IW7 D;  2JIP A;  4AON B;  3HU1 A;  5GLF A;  1I3Q A;  2PMZ A;  1SIW A;  2NYA A;  3HKZ A;  4QIW A;  4KDL A;  2JV2 A;  3GTQ A;  2VUM A;  2WB1 A;  4CRZ A;  2JIQ A;  2VPY A;  1DMR A;  1Y1V A;  4AOK B;  1PT1 A;  1E61 A;  2V3V A;  3QQ7 A;  1YLE A;  2IV2 X;  1OGY A;  1H0H A;  1Y1W A;  2E7Z A;  3TM7 B;  1K83 A;  1PQE A;  3GTM A;  1TWA A;  1TWG A;  1PQH A;  4KOD A;  3QC8 A;  1PYU B;  2PJH B;  1H5N A;  3DMR A;  2NVX A;  4AYB A;  2JIR A;  1ZC1 A;  1QDN A;  2EEO B;  1QCS A;  3CQZ A;  4C2M A;  4AAY A;  3GTL A;  1E60 A;  3GTJ A;  1PQF A;  1R7R A;  1PT0 A;  3O5A A;  1SFO A;  1FDI A;  4GA6 A;  5C18 A;  2YU9 A;  4KLN A;  3QQ8 A;  1R27 A;  2R7Z A;  1G8K A;  1Q16 A;  1VC3 B;  2JIO A;  1KQF A;  5T5I D;  1CR5 A;  2E2H A;  1UHD A;  5DYG A; 
#chains in the Genus database with same CATH topology
 3ZJV A;  3IR6 A;  3M3G A;  4AQ7 A;  5FTN A;  5FTK A;  2CW0 D;  5T5M D;  4ENG A;  1OA7 A;  1E18 A;  3SUK A;  3GTK A;  1CZ5 A;  1CZ4 A;  1OA9 A;  2A6H D;  2B63 A;  2PWY A;  3ZJU A;  5EQJ B;  3H0G A;  1DMS A;  2VPZ A;  4FFT A;  2Q1C X;  2A6E D;  3X2H A;  1O54 A;  3FPR A;  4KO8 A;  4CS0 A;  4JS7 A;  2V45 A;  3X2O A;  4AS1 A;  1S3S A;  2JA5 A;  3GTG A;  1AW8 B;  4CRY G;  2R93 A;  4AZD A;  5D6Y A;  2KI8 A;  4GA5 A;  5DYI A;  4DMR A;  2HCZ X;  4ARI A;  1Y4Z A;  1WLF A;  2VPX A;  1EU1 A;  4CQN A;  1KQG A;  5C1B A;  5FTM A;  3OUG A;  5CCX A;  4FG4 A;  4FER A;  3PLX B;  3HU3 A;  2WAQ A;  4L48 A;  2VPW A;  1R9T A;  5B6C A;  3X2P A;  3TIW A;  3IR7 A;  4RV0 A;  2JIM A;  3LGA A;  1UHE A;  2G6G A;  1FDO A;  1TWC A;  2Y0S A;  5EPP A;  2DMR A;  2JA6 A;  1E5V A;  1TMO A;  4JJO A;  1HD5 A;  3CF2 A;  2MM0 A;  1E32 A;  1Y5I A;  3GTP A;  2JA7 A;  4UC4 A;  2NAP A;  4ARC A;  3HU2 A;  1WCM A;  4NOH A;  1AA6 A;  3SUJ A;  5CCB A;  1I50 A;  4ZM7 A;  2NVY A;  3CZB A;  1G8J A;  4D7Z B;  1WC2 A;  1TWF A;  3ML1 A;  2A68 D;  3FKI A;  3GTO A;  5D6X A;  2C45 A;  1PPY A;  2O5J D;  2YUJ A;  5FTL A;  5FTJ A;  2E2I A;  1PYQ A;  3IR5 A;  3QWZ A;  2GFA A;  1TWH A;  2QQR A;  3FPU A;  3X2I A;  4KDI A;  2Q1D X;  2Q18 X;  2R92 A;  1IW7 D;  2JIP A;  4AON B;  2Q19 X;  3HU1 A;  2YVL A;  5GLF A;  3SUM A;  1I3Q A;  2PMZ A;  3X2J A;  3ZJT A;  1SIW A;  2NYA A;  3HKZ A;  4QIW A;  3LHD A;  2PNW A;  4KDL A;  2JV2 A;  2Q1A X;  3GTQ A;  4FG2 A;  2VUM A;  2PI8 A;  3X2N A;  5GLX A;  2G5D A;  2WB1 A;  2JIQ A;  2VPY A;  3X2K A;  1DMR A;  4CRZ A;  5CD1 A;  2B25 A;  1Y1V A;  4AOK B;  1PT1 A;  2GF7 A;  1E61 A;  2V3V A;  2KY9 A;  3QQ7 A;  1L8F A;  5GM9 A;  5ERG B;  1YLE A;  2QQS A;  2IV2 X;  1OGY A;  1H0H A;  4JP7 A;  3FPT A;  3ZGZ A;  3X2G A;  1N10 A;  1Y1W A;  2LW6 A;  2MM2 A;  2E7Z A;  2GAE A;  2ENG A;  1YNN D;  3TM7 B;  1K83 A;  1PQE A;  2PJJ A;  1BW3 A;  3GTM A;  1BW4 A;  2A69 D;  1TWA A;  1TWG A;  1PQH A;  4KOD A;  3QC8 A;  1PYU B;  2PJH B;  1H5N A;  3DMR A;  2NVX A;  4AYB A;  2AE0 X;  2KQA A;  1ZC1 A;  2JIR A;  4FIB A;  1QDN A;  2EEO B;  3ENG A;  1QCS A;  3X2M A;  4AVR A;  3CQZ A;  4C2M A;  4AAY A;  3GTL A;  3D30 A;  1E60 A;  1ZYR D;  2PIC A;  3GTJ A;  1PQF A;  1R7R A;  2XDP A;  1PT0 A;  3O5A A;  1SFO A;  1FDI A;  4GA6 A;  5C18 A;  2YU9 A;  4KLN A;  1I9G A;  3MB5 A;  3QQ8 A;  1R27 A;  5GLY A;  1G8K A;  4JCW A;  2R7Z A;  1Q16 A;  4JP6 A;  1YNJ D;  1VC3 B;  2BE5 D;  2JIO A;  1KQF A;  3BQB A;  5T5I D;  1CR5 A;  5D6W A;  2BH0 A;  3SUL A;  5H4U A;  2E2H A;  1UHD A;  1SMY D;  3X2L A;  5DYG A; 
#chains in the Genus database with same CATH homology
 3ZJV A;  3IR6 A;  4AQ7 A;  5FTN A;  5FTK A;  2CW0 D;  5T5M D;  3GTK A;  1E18 A;  1CZ5 A;  1CZ4 A;  3ZJU A;  2A6H D;  2B63 A;  2PWY A;  5EQJ B;  3H0G A;  1DMS A;  2VPZ A;  2Q1C X;  2A6E D;  1O54 A;  3FPR A;  4KO8 A;  4CS0 A;  2V45 A;  4AS1 A;  1S3S A;  2JA5 A;  3GTG A;  1AW8 B;  4CRY G;  2R93 A;  4AZD A;  5D6Y A;  2KI8 A;  4GA5 A;  5DYI A;  4DMR A;  4ARI A;  4CQN A;  1Y4Z A;  1WLF A;  2VPX A;  1EU1 A;  1KQG A;  5C1B A;  5FTM A;  3OUG A;  5CCX A;  3PLX B;  3HU3 A;  2WAQ A;  2VPW A;  1R9T A;  5B6C A;  3TIW A;  3IR7 A;  4RV0 A;  2JIM A;  3LGA A;  1UHE A;  2G6G A;  1FDO A;  1TWC A;  2Y0S A;  5EPP A;  2DMR A;  2JA6 A;  1E5V A;  1TMO A;  3CF2 A;  2MM0 A;  1E32 A;  1Y5I A;  3GTP A;  2JA7 A;  4UC4 A;  2NAP A;  3HU2 A;  1WCM A;  4NOH A;  1AA6 A;  5CCB A;  1I50 A;  2NVY A;  3CZB A;  1G8J A;  4D7Z B;  1TWF A;  3ML1 A;  2A68 D;  3FKI A;  3GTO A;  5D6X A;  2C45 A;  1PPY A;  2O5J D;  2YUJ A;  5FTL A;  5FTJ A;  2E2I A;  1PYQ A;  3IR5 A;  3QWZ A;  2GFA A;  1TWH A;  2QQR A;  3FPU A;  4KDI A;  2Q1D X;  2Q18 X;  2R92 A;  1IW7 D;  2JIP A;  4AON B;  2Q19 X;  3HU1 A;  2YVL A;  5GLF A;  1I3Q A;  2PMZ A;  3ZJT A;  1SIW A;  2NYA A;  3HKZ A;  4QIW A;  3LHD A;  2PNW A;  4KDL A;  2JV2 A;  2Q1A X;  3GTQ A;  2VUM A;  2PI8 A;  4ARC A;  2G5D A;  2WB1 A;  2JIQ A;  2VPY A;  4CRZ A;  1DMR A;  5CD1 A;  2B25 A;  1Y1V A;  4AOK B;  1PT1 A;  2GF7 A;  1E61 A;  2V3V A;  2KY9 A;  3QQ7 A;  5ERG B;  1YLE A;  2QQS A;  2IV2 X;  1OGY A;  1H0H A;  3FPT A;  3ZGZ A;  1Y1W A;  2LW6 A;  2MM2 A;  2E7Z A;  2GAE A;  3TM7 B;  1YNN D;  1K83 A;  1PQE A;  2PJJ A;  3GTM A;  2A69 D;  1TWA A;  1TWG A;  1PQH A;  4KOD A;  3QC8 A;  1PYU B;  2PJH B;  1H5N A;  3DMR A;  2NVX A;  4AYB A;  2AE0 X;  2JIR A;  1ZC1 A;  4FIB A;  1QDN A;  2EEO B;  1QCS A;  3CQZ A;  4C2M A;  4AAY A;  3GTL A;  2PIC A;  1E60 A;  1ZYR D;  3GTJ A;  1PQF A;  1R7R A;  2XDP A;  1PT0 A;  3O5A A;  1SFO A;  1FDI A;  4GA6 A;  5C18 A;  2YU9 A;  4KLN A;  1I9G A;  3MB5 A;  3QQ8 A;  1R27 A;  2R7Z A;  1G8K A;  1Q16 A;  1YNJ D;  1VC3 B;  2BE5 D;  2JIO A;  1KQF A;  3BQB A;  5T5I D;  1CR5 A;  5D6W A;  2E2H A;  1UHD A;  1SMY D;  5DYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...