1CZ4A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
185
structure length
185
Chain Sequence
MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords VCP-LIKE ATPASE
total genus 24
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz4A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz4A02
4KDIA 1PYUB 3GTGA 2PJHB 2YUJA 1TWHA 4KDLA 5FTJA 1Y1VA 2NVXA 1TWCA 2DMRA 1SIWA 2V45A 2V3VA 2R92A 3QWZA 5FTKA 1I50A 1IW7D 1QDNA 1R27A 1PYQA 1CZ5A 1EU1A 1PQFA 3DMRA 1PPYA 1S3SA 1CZ4A 2JIMA 5GLFA 1E5VA 1E60A 1DMRA 1PT0A 3GTMA 2R7ZA 3HU1A 1QCSA 3IR5A 2VPWA 1FDIA 5FTNA 3HU2A 3FKIA 3QQ8A 3TIWA 1H5NA 3GTOA 3CQZA 2JIPA 2JV2A 4KODA 4AZDA 5T5ID 4KLNA 4C2MA 3CF2A 3HKZA 1UHEA 2KI8A 2VPXA 5T5MD 3H0GA 3OUGA 1Y1WA 3QQ7A 2WB1A 3QC8A 1TWGA 4CRYG 1H0HA 1WCMA 1TWAA 1YLEA 3IR7A 4CS0A 4D7ZB 5DYIA 1DMSA 2JA7A 1E61A 1R7RA 2VPYA 5DYGA 3GTKA 2E2IA 5B6CA 1TWFA 1AA6A 4GA6A 3O5AA 1OGYA 4AOKB 3PLXB 5FTLA 1Y4ZA 3GTQA 4DMRA 2WAQA 1FDOA 3IR6A 5C18A 1PT1A 5FTMA 1Y5IA 5C1BA 1ZC1A 1K83A 2JIQA 3HU3A 1R9TA 2YU9A 2JA6A 1WLFA 3TM7B 1KQFA 1G8JA 2C45A 1G8KA 2Y0SA 4GA5A 2B63A 2NVYA 1SFOA 2VPZA 1E32A 2JA5A 5EPPA 3GTPA 1UHDA 2R93A 2EEOB 4AYBA 2E2HA 1PQHA 1KQGA 1Q16A 2E7ZA 3GTJA 2NYAA 1PQEA 2JIRA 3GTLA 3ML1A 1E18A 1VC3B 1CR5A 2PMZA 2IV2X 4RV0A 4KO8A 1AW8B 2VUMA 1I3QA 4AAYA 2JIOA 4QIWA 4CRZA 2NAPA 4AONB 1TMOA
chains in the Genus database with same CATH superfamily
4KDIA 4JS7A 1PYUB 2YUJA 2PJHB 3GTGA 5CCXA 2ENGA 1O54A 3LGAA 1WC2A 1TWHA 2PI8A 4KDLA 5FTJA 3FPTA 1Y1VA 2NVXA 2KQAA 1TWCA 2DMRA 1SIWA 2PNWA 2V45A 2V3VA 2R92A 3QWZA 5FTKA 1I50A 1IW7D 3X2IA 1OA7A 1QDNA 1R27A 2A69D 3M3GA 1PYQA 4AVRA 4JJOA 4FERA 4FIBA 1CZ5A 3ZJVA 3ENGA 1EU1A 1PQFA 3X2HA 3DMRA 3SUKA 1PPYA 1S3SA 1CZ4A 2JIMA 5GLFA 1ZYRD 2PJJA 1E5VA 1E60A 1DMRA 1PT0A 3GTMA 2R7ZA 2Q19X 3FPRA 5D6WA 3HU1A 1QCSA 3BQBA 3SUMA 1YNND 2Q1CX 4AS1A 3IR5A 2VPWA 2PICA 1FDIA 5FTNA 4UC4A 3HU2A 3FKIA 3QQ8A 3TIWA 1L8FA 2XDPA 3LHDA 1H5NA 2BE5D 3X2MA 3GTOA 3CQZA 2JIPA 2CW0D 4KODA 3SUJA 2JV2A 3FPUA 4AZDA 2GF7A 2A6HD 5T5ID 4ARCA 2O5JD 4KLNA 4C2MA 3CF2A 3HKZA 1OA9A 1UHEA 4FFTA 3SULA 2MM2A 2KI8A 2Q18X 2VPXA 5T5MD 3H0GA 3OUGA 1Y1WA 3QQ7A 2WB1A 3QC8A 5GLXA 1TWGA 4CRYG 1H0HA 1WCMA 1TWAA 2AE0X 1YLEA 5GLYA 2Q1AX 2BH0A 3IR7A 4ARIA 4CS0A 4D7ZB 2HCZX 5DYIA 1YNJD 2GAEA 1DMSA 4JCWA 1E61A 1R7RA 2JA7A 4JP7A 1HD5A 2VPYA 2B25A 5DYGA 3GTKA 2E2IA 5B6CA 1TWFA 2A6ED 4GA6A 1AA6A 3O5AA 1OGYA 4JP6A 4AOKB 3D30A 3X2LA 3PLXB 5CD1A 5FTLA 1Y4ZA 3GTQA 3ZJUA 3ZGZA 4DMRA 2WAQA 1FDOA 3IR6A 5C18A 4FG4A 1PT1A 5FTMA 1Y5IA 5C1BA 1ZC1A 1K83A 2JIQA 3MB5A 1BW4A 3HU3A 2LW6A 1R9TA 2YU9A 1I9GA 5H4UA 2JA6A 2QQSA 1WLFA 4FG2A 3TM7B 3X2KA 1KQFA 1BW3A 5EQJB 1G8JA 2C45A 2G5DA 1G8KA 2Y0SA 2G6GA 4GA5A 2B63A 2PWYA 2NVYA 1SFOA 4NOHA 2Q1DX 1SMYD 2VPZA 1E32A 2JA5A 5CCBA 5EPPA 3GTPA 1UHDA 4ZM7A 2EEOB 2R93A 4AYBA 2A68D 2MM0A 2E2HA 4CQNA 1PQHA 1KQGA 1Q16A 2E7ZA 2GFAA 3ZJTA 2YVLA 3GTJA 2NYAA 4L48A 3X2NA 2KY9A 5ERGB 2JIRA 1PQEA 5GM9A 3X2GA 3GTLA 3ML1A 4ENGA 1E18A 1VC3B 1CR5A 2PMZA 3X2PA 5D6YA 2IV2X 4RV0A 4KO8A 4AQ7A 1AW8B 5D6XA 2VUMA 3CZBA 1I3QA 4AAYA 2JIOA 4QIWA 3X2OA 2NAPA 4CRZA 2QQRA 3X2JA 1N10A 4AONB 1TMOA
chains in the Genus database with same CATH topology
4KDIA 1PYUB 2YUJA 2PJHB 3GTGA 5CCXA 1O54A 3LGAA 2PI8A 1TWHA 4KDLA 3FPTA 5FTJA 1Y1VA 2NVXA 1TWCA 2DMRA 1SIWA 2PNWA 2V45A 2V3VA 2R92A 3QWZA 5FTKA 1I50A 1IW7D 1QDNA 1R27A 2A69D 1PYQA 4FIBA 1CZ5A 3ZJVA 1EU1A 1PQFA 3DMRA 1PPYA 1S3SA 1CZ4A 2JIMA 5GLFA 2PJJA 1ZYRD 1E5VA 1E60A 1DMRA 1PT0A 3GTMA 2R7ZA 2Q19X 3FPRA 5D6WA 3HU1A 1QCSA 3BQBA 1YNND 2Q1CX 4AS1A 3IR5A 2VPWA 2PICA 1FDIA 5FTNA 4UC4A 3HU2A 3FKIA 3QQ8A 3TIWA 2XDPA 3LHDA 1H5NA 2BE5D 3GTOA 3CQZA 2JIPA 2CW0D 4KODA 2JV2A 3FPUA 4AZDA 2GF7A 2A6HD 5T5ID 4ARCA 2O5JD 4KLNA 4C2MA 3CF2A 3HKZA 1UHEA 2MM2A 2KI8A 2Q18X 2VPXA 5T5MD 3H0GA 3OUGA 1Y1WA 3QQ7A 2WB1A 3QC8A 1TWGA 4CRYG 1H0HA 1WCMA 1TWAA 2AE0X 1YLEA 2Q1AX 3IR7A 4ARIA 4CS0A 4D7ZB 5DYIA 1YNJD 2GAEA 1DMSA 2JA7A 1E61A 1R7RA 2B25A 2QQRA 2VPYA 5DYGA 3GTKA 2E2IA 5B6CA 1TWFA 2A6ED 4GA6A 1AA6A 3O5AA 1OGYA 4AOKB 3PLXB 5CD1A 5FTLA 1Y4ZA 3GTQA 3ZJUA 3ZGZA 4DMRA 2WAQA 1FDOA 3IR6A 5C18A 1PT1A 5FTMA 1Y5IA 5C1BA 1ZC1A 1K83A 2JIQA 3MB5A 3HU3A 2LW6A 1R9TA 2YU9A 1I9GA 2JA6A 2QQSA 1WLFA 3TM7B 1KQFA 5EQJB 1G8JA 2C45A 2G5DA 1G8KA 2Y0SA 2G6GA 4GA5A 2B63A 2PWYA 2NVYA 1SFOA 4NOHA 2Q1DX 1SMYD 2VPZA 1E32A 2JA5A 5CCBA 5EPPA 3GTPA 1UHDA 2R93A 2EEOB 4AYBA 2A68D 2MM0A 2E2HA 4CQNA 1PQHA 1KQGA 1Q16A 2E7ZA 2GFAA 3ZJTA 2YVLA 3GTJA 2NYAA 2KY9A 5ERGB 2JIRA 1PQEA 3GTLA 3ML1A 1E18A 1VC3B 1CR5A 2PMZA 5D6YA 2IV2X 4RV0A 4KO8A 4AQ7A 1AW8B 5D6XA 2VUMA 3CZBA 1I3QA 4AAYA 2JIOA 4QIWA 4CRZA 2NAPA 4AONB 1TMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDI A;  1PYU B;  3GTG A;  2PJH B;  2YUJ A;  1TWH A;  4KDL A;  5FTJ A;  1Y1V A;  2NVX A;  1TWC A;  2DMR A;  1SIW A;  2V45 A;  2V3V A;  2R92 A;  3QWZ A;  5FTK A;  1I50 A;  1IW7 D;  1QDN A;  1R27 A;  1PYQ A;  1CZ5 A;  1EU1 A;  1PQF A;  3DMR A;  1PPY A;  1S3S A;  1CZ4 A;  2JIM A;  5GLF A;  1E5V A;  1E60 A;  1DMR A;  1PT0 A;  3GTM A;  2R7Z A;  3HU1 A;  1QCS A;  3IR5 A;  2VPW A;  1FDI A;  5FTN A;  3HU2 A;  3FKI A;  3QQ8 A;  3TIW A;  1H5N A;  3GTO A;  3CQZ A;  2JIP A;  2JV2 A;  4KOD A;  4AZD A;  5T5I D;  4KLN A;  4C2M A;  3CF2 A;  3HKZ A;  1UHE A;  2KI8 A;  2VPX A;  5T5M D;  3H0G A;  3OUG A;  1Y1W A;  3QQ7 A;  2WB1 A;  3QC8 A;  1TWG A;  4CRY G;  1H0H A;  1WCM A;  1TWA A;  1YLE A;  3IR7 A;  4CS0 A;  4D7Z B;  5DYI A;  1DMS A;  2JA7 A;  1E61 A;  1R7R A;  2VPY A;  5DYG A;  3GTK A;  2E2I A;  5B6C A;  1TWF A;  1AA6 A;  4GA6 A;  3O5A A;  1OGY A;  4AOK B;  3PLX B;  5FTL A;  1Y4Z A;  3GTQ A;  4DMR A;  2WAQ A;  1FDO A;  3IR6 A;  5C18 A;  1PT1 A;  5FTM A;  1Y5I A;  5C1B A;  1ZC1 A;  1K83 A;  2JIQ A;  3HU3 A;  1R9T A;  2YU9 A;  2JA6 A;  1WLF A;  3TM7 B;  1KQF A;  1G8J A;  2C45 A;  1G8K A;  2Y0S A;  4GA5 A;  2B63 A;  2NVY A;  1SFO A;  2VPZ A;  1E32 A;  2JA5 A;  5EPP A;  3GTP A;  1UHD A;  2R93 A;  2EEO B;  4AYB A;  2E2H A;  1PQH A;  1KQG A;  1Q16 A;  2E7Z A;  3GTJ A;  2NYA A;  1PQE A;  2JIR A;  3GTL A;  3ML1 A;  1E18 A;  1VC3 B;  1CR5 A;  2PMZ A;  2IV2 X;  4RV0 A;  4KO8 A;  1AW8 B;  2VUM A;  1I3Q A;  4AAY A;  2JIO A;  4QIW A;  4CRZ A;  2NAP A;  4AON B;  1TMO A; 
#chains in the Genus database with same CATH topology
 4KDI A;  4JS7 A;  1PYU B;  2YUJ A;  2PJH B;  3GTG A;  5CCX A;  2ENG A;  1O54 A;  3LGA A;  1WC2 A;  1TWH A;  2PI8 A;  4KDL A;  5FTJ A;  3FPT A;  1Y1V A;  2NVX A;  2KQA A;  1TWC A;  2DMR A;  1SIW A;  2PNW A;  2V45 A;  2V3V A;  2R92 A;  3QWZ A;  5FTK A;  1I50 A;  1IW7 D;  3X2I A;  1OA7 A;  1QDN A;  1R27 A;  2A69 D;  3M3G A;  1PYQ A;  4AVR A;  4JJO A;  4FER A;  4FIB A;  1CZ5 A;  3ZJV A;  3ENG A;  1EU1 A;  1PQF A;  3X2H A;  3DMR A;  3SUK A;  1PPY A;  1S3S A;  1CZ4 A;  2JIM A;  5GLF A;  1ZYR D;  2PJJ A;  1E5V A;  1E60 A;  1DMR A;  1PT0 A;  3GTM A;  2R7Z A;  2Q19 X;  3FPR A;  5D6W A;  3HU1 A;  1QCS A;  3BQB A;  3SUM A;  1YNN D;  2Q1C X;  4AS1 A;  3IR5 A;  2VPW A;  2PIC A;  1FDI A;  5FTN A;  4UC4 A;  3HU2 A;  3FKI A;  3QQ8 A;  3TIW A;  1L8F A;  2XDP A;  3LHD A;  1H5N A;  2BE5 D;  3X2M A;  3GTO A;  3CQZ A;  2JIP A;  2CW0 D;  4KOD A;  3SUJ A;  2JV2 A;  3FPU A;  4AZD A;  2GF7 A;  2A6H D;  5T5I D;  4ARC A;  2O5J D;  4KLN A;  4C2M A;  3CF2 A;  3HKZ A;  1OA9 A;  1UHE A;  4FFT A;  3SUL A;  2MM2 A;  2KI8 A;  2Q18 X;  2VPX A;  5T5M D;  3H0G A;  3OUG A;  1Y1W A;  3QQ7 A;  2WB1 A;  3QC8 A;  5GLX A;  1TWG A;  4CRY G;  1H0H A;  1WCM A;  1TWA A;  2AE0 X;  1YLE A;  5GLY A;  2Q1A X;  2BH0 A;  3IR7 A;  4ARI A;  4CS0 A;  4D7Z B;  2HCZ X;  5DYI A;  1YNJ D;  2GAE A;  1DMS A;  4JCW A;  1E61 A;  1R7R A;  2JA7 A;  4JP7 A;  1HD5 A;  2VPY A;  2B25 A;  5DYG A;  3GTK A;  2E2I A;  5B6C A;  1TWF A;  2A6E D;  4GA6 A;  1AA6 A;  3O5A A;  1OGY A;  4JP6 A;  4AOK B;  3D30 A;  3X2L A;  3PLX B;  5CD1 A;  5FTL A;  1Y4Z A;  3GTQ A;  3ZJU A;  3ZGZ A;  4DMR A;  2WAQ A;  1FDO A;  3IR6 A;  5C18 A;  4FG4 A;  1PT1 A;  5FTM A;  1Y5I A;  5C1B A;  1ZC1 A;  1K83 A;  2JIQ A;  3MB5 A;  1BW4 A;  3HU3 A;  2LW6 A;  1R9T A;  2YU9 A;  1I9G A;  5H4U A;  2JA6 A;  2QQS A;  1WLF A;  4FG2 A;  3TM7 B;  3X2K A;  1KQF A;  1BW3 A;  5EQJ B;  1G8J A;  2C45 A;  2G5D A;  1G8K A;  2Y0S A;  2G6G A;  4GA5 A;  2B63 A;  2PWY A;  2NVY A;  1SFO A;  4NOH A;  2Q1D X;  1SMY D;  2VPZ A;  1E32 A;  2JA5 A;  5CCB A;  5EPP A;  3GTP A;  1UHD A;  4ZM7 A;  2EEO B;  2R93 A;  4AYB A;  2A68 D;  2MM0 A;  2E2H A;  4CQN A;  1PQH A;  1KQG A;  1Q16 A;  2E7Z A;  2GFA A;  3ZJT A;  2YVL A;  3GTJ A;  2NYA A;  4L48 A;  3X2N A;  2KY9 A;  5ERG B;  2JIR A;  1PQE A;  5GM9 A;  3X2G A;  3GTL A;  3ML1 A;  4ENG A;  1E18 A;  1VC3 B;  1CR5 A;  2PMZ A;  3X2P A;  5D6Y A;  2IV2 X;  4RV0 A;  4KO8 A;  4AQ7 A;  1AW8 B;  5D6X A;  2VUM A;  3CZB A;  1I3Q A;  4AAY A;  2JIO A;  4QIW A;  3X2O A;  2NAP A;  4CRZ A;  2QQR A;  3X2J A;  1N10 A;  4AON B;  1TMO A; 
#chains in the Genus database with same CATH homology
 4KDI A;  1PYU B;  2YUJ A;  2PJH B;  3GTG A;  5CCX A;  1O54 A;  3LGA A;  2PI8 A;  1TWH A;  4KDL A;  3FPT A;  5FTJ A;  1Y1V A;  2NVX A;  1TWC A;  2DMR A;  1SIW A;  2PNW A;  2V45 A;  2V3V A;  2R92 A;  3QWZ A;  5FTK A;  1I50 A;  1IW7 D;  1QDN A;  1R27 A;  2A69 D;  1PYQ A;  4FIB A;  1CZ5 A;  3ZJV A;  1EU1 A;  1PQF A;  3DMR A;  1PPY A;  1S3S A;  1CZ4 A;  2JIM A;  5GLF A;  2PJJ A;  1ZYR D;  1E5V A;  1E60 A;  1DMR A;  1PT0 A;  3GTM A;  2R7Z A;  2Q19 X;  3FPR A;  5D6W A;  3HU1 A;  1QCS A;  3BQB A;  1YNN D;  2Q1C X;  4AS1 A;  3IR5 A;  2VPW A;  2PIC A;  1FDI A;  5FTN A;  4UC4 A;  3HU2 A;  3FKI A;  3QQ8 A;  3TIW A;  2XDP A;  3LHD A;  1H5N A;  2BE5 D;  3GTO A;  3CQZ A;  2JIP A;  2CW0 D;  4KOD A;  2JV2 A;  3FPU A;  4AZD A;  2GF7 A;  2A6H D;  5T5I D;  4ARC A;  2O5J D;  4KLN A;  4C2M A;  3CF2 A;  3HKZ A;  1UHE A;  2MM2 A;  2KI8 A;  2Q18 X;  2VPX A;  5T5M D;  3H0G A;  3OUG A;  1Y1W A;  3QQ7 A;  2WB1 A;  3QC8 A;  1TWG A;  4CRY G;  1H0H A;  1WCM A;  1TWA A;  2AE0 X;  1YLE A;  2Q1A X;  3IR7 A;  4ARI A;  4CS0 A;  4D7Z B;  5DYI A;  1YNJ D;  2GAE A;  1DMS A;  2JA7 A;  1E61 A;  1R7R A;  2B25 A;  2QQR A;  2VPY A;  5DYG A;  3GTK A;  2E2I A;  5B6C A;  1TWF A;  2A6E D;  4GA6 A;  1AA6 A;  3O5A A;  1OGY A;  4AOK B;  3PLX B;  5CD1 A;  5FTL A;  1Y4Z A;  3GTQ A;  3ZJU A;  3ZGZ A;  4DMR A;  2WAQ A;  1FDO A;  3IR6 A;  5C18 A;  1PT1 A;  5FTM A;  1Y5I A;  5C1B A;  1ZC1 A;  1K83 A;  2JIQ A;  3MB5 A;  3HU3 A;  2LW6 A;  1R9T A;  2YU9 A;  1I9G A;  2JA6 A;  2QQS A;  1WLF A;  3TM7 B;  1KQF A;  5EQJ B;  1G8J A;  2C45 A;  2G5D A;  1G8K A;  2Y0S A;  2G6G A;  4GA5 A;  2B63 A;  2PWY A;  2NVY A;  1SFO A;  4NOH A;  2Q1D X;  1SMY D;  2VPZ A;  1E32 A;  2JA5 A;  5CCB A;  5EPP A;  3GTP A;  1UHD A;  2R93 A;  2EEO B;  4AYB A;  2A68 D;  2MM0 A;  2E2H A;  4CQN A;  1PQH A;  1KQG A;  1Q16 A;  2E7Z A;  2GFA A;  3ZJT A;  2YVL A;  3GTJ A;  2NYA A;  2KY9 A;  5ERG B;  2JIR A;  1PQE A;  3GTL A;  3ML1 A;  1E18 A;  1VC3 B;  1CR5 A;  2PMZ A;  5D6Y A;  2IV2 X;  4RV0 A;  4KO8 A;  4AQ7 A;  1AW8 B;  5D6X A;  2VUM A;  3CZB A;  1I3Q A;  4AAY A;  2JIO A;  4QIW A;  4CRZ A;  2NAP A;  4AON B;  1TMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...