1CZ4A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
185
structure length
185
Chain Sequence
MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords VCP-LIKE ATPASE
total genus 24
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz4A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz4A02
1Y5IA 5GLFA 3GTQA 1Y1VA 3HU1A 2E2HA 1TWGA 4GA6A 1VC3B 5DYGA 3TIWA 4CRZA 3H0GA 2B63A 2C45A 1E61A 1PYQA 1R7RA 3CQZA 2KI8A 2JV2A 4D7ZB 2PJHB 3DMRA 2DMRA 2R93A 5FTLA 1E5VA 1Q16A 3IR5A 3O5AA 1WLFA 4AOKB 1DMRA 1TWFA 1PQEA 1PT1A 4KDIA 4RV0A 1QDNA 4KLNA 1E18A 1OGYA 1K83A 5DYIA 1AA6A 4AZDA 1IW7D 1I3QA 1PYUB 2JIPA 2VPWA 2IV2X 1TWCA 1R27A 3PLXB 3GTKA 1G8JA 1CR5A 2NVYA 1PQHA 1R9TA 1PT0A 2PMZA 5T5MD 3IR6A 3GTGA 4QIWA 1SIWA 4KDLA 5B6CA 2V3VA 2V45A 2JIMA 2JA6A 3CF2A 1SFOA 1EU1A 3GTJA 1FDIA 1DMSA 3QQ7A 5C1BA 1I50A 3QWZA 2NYAA 5FTMA 3HU3A 1AW8B 4KODA 2E7ZA 2JIQA 3QC8A 4C2MA 3GTPA 3HKZA 1YLEA 1KQGA 1UHEA 1PQFA 4AONB 2JA7A 1QCSA 1E32A 2EEOB 1G8KA 3HU2A 4KO8A 2VUMA 2VPXA 2JIRA 5T5ID 2Y0SA 2VPYA 1TMOA 2VPZA 5FTJA 1TWAA 2JA5A 1UHDA 4AYBA 1KQFA 2R92A 4CRYG 4AAYA 4GA5A 1H0HA 1CZ5A 3GTMA 1CZ4A 3QQ8A 2NVXA 3OUGA 3IR7A 2YU9A 1Y1WA 2YUJA 5FTNA 3GTOA 5C18A 2WB1A 5FTKA 1WCMA 5EPPA 1PPYA 2E2IA 1FDOA 1H5NA 1S3SA 3FKIA 4CS0A 2NAPA 2JIOA 3GTLA 2R7ZA 2WAQA 1TWHA 1ZC1A 1Y4ZA 4DMRA 1E60A 3ML1A 3TM7B
chains in the Genus database with same CATH superfamily
1Y5IA 1BW3A 5GLFA 3GTQA 3ZGZA 4JP6A 4L48A 1Y1VA 3HU1A 2E2HA 1TWGA 4GA6A 3FPRA 5CCXA 1VC3B 2PNWA 5DYGA 3TIWA 3H0GA 4CRZA 5EQJB 3M3GA 3LGAA 2B63A 2C45A 1E61A 1PYQA 1R7RA 3CQZA 2KI8A 2JV2A 1OA9A 3ENGA 4D7ZB 2PJHB 3DMRA 3X2MA 1SMYD 2DMRA 2R93A 1BW4A 5FTLA 1E5VA 1Q16A 3IR5A 3O5AA 3X2LA 1I9GA 2Q19X 1WLFA 4AOKB 3SUKA 1DMRA 1TWFA 4JCWA 1PQEA 1PT1A 2G5DA 4FG2A 4KDIA 1QDNA 4KLNA 4RV0A 4ZM7A 1E18A 1OGYA 1K83A 5DYIA 4ENGA 2A68D 1AA6A 4AVRA 1IW7D 4AZDA 3X2IA 1I3QA 2KQAA 4FERA 1PYUB 2JIPA 2VPWA 2IV2X 1TWCA 1R27A 5D6YA 3PLXB 3GTKA 1YNND 1G8JA 2CW0D 4JS7A 1CR5A 2NVYA 1PQHA 1R9TA 1PT0A 2PMZA 2KY9A 4JP7A 5T5MD 3IR6A 3X2HA 4QIWA 3GTGA 2Q1DX 1SIWA 4CQNA 4KDLA 3SUMA 2V3VA 2V45A 3X2OA 5B6CA 2JIMA 2HCZX 3CF2A 5GM9A 2JA6A 1SFOA 1EU1A 3GTJA 1FDIA 1HD5A 2PJJA 1DMSA 3QQ7A 5C1BA 1I50A 3D30A 3LHDA 3QWZA 2NYAA 5FTMA 3HU3A 1AW8B 2BE5D 4KODA 2B25A 2E7ZA 2JIQA 2ENGA 3QC8A 5GLYA 1N10A 3HKZA 4C2MA 3GTPA 2QQSA 1YLEA 4JJOA 1KQGA 1UHEA 2GFAA 1PQFA 4FG4A 1WC2A 3X2PA 4AONB 2A6HD 1QCSA 2JA7A 1E32A 2LW6A 2MM0A 2XDPA 4ARIA 2EEOB 1G8KA 3HU2A 4KO8A 3X2GA 2PI8A 2VUMA 2VPXA 2JIRA 5T5ID 2Y0SA 2VPYA 3SUJA 5ERGB 3ZJVA 4FIBA 1TMOA 2VPZA 5FTJA 2GF7A 1TWAA 2Q1CX 2JA5A 3BQBA 4AQ7A 1UHDA 3FPUA 4AYBA 5H4UA 1KQFA 2R92A 4CRYG 2O5JD 2YVLA 4AAYA 4GA5A 1H0HA 1CZ5A 3GTMA 1CZ4A 1L8FA 2PICA 3MB5A 1OA7A 3QQ8A 2NVXA 3OUGA 2MM2A 5CCBA 3IR7A 2YUJA 2YU9A 1Y1WA 3CZBA 5FTNA 3GTOA 2G6GA 2Q18X 3SULA 5C18A 2WB1A 5FTKA 5GLXA 4AS1A 1WCMA 2A69D 5EPPA 1PPYA 3X2NA 1FDOA 2E2IA 1H5NA 2BH0A 1S3SA 3FKIA 3X2JA 2NAPA 2JIOA 4CS0A 3GTLA 2Q1AX 3X2KA 4NOHA 2QQRA 2PWYA 3FPTA 2R7ZA 5D6XA 2WAQA 1TWHA 5D6WA 1ZC1A 4FFTA 2A6ED 1YNJD 1Y4ZA 4DMRA 5CD1A 1O54A 4UC4A 2GAEA 1E60A 2AE0X 1ZYRD 3ZJUA 3ML1A 3ZJTA 3TM7B 4ARCA
chains in the Genus database with same CATH topology
1Y5IA 3ZGZA 5GLFA 3GTQA 1Y1VA 3HU1A 2E2HA 1TWGA 4GA6A 3FPRA 5CCXA 1VC3B 2PNWA 5DYGA 3TIWA 3H0GA 4CRZA 5EQJB 3LGAA 2B63A 2C45A 1E61A 1PYQA 1R7RA 3CQZA 2KI8A 2JV2A 4D7ZB 2PJHB 3DMRA 1SMYD 2DMRA 2R93A 5FTLA 1E5VA 1Q16A 3IR5A 3O5AA 1I9GA 2Q19X 1WLFA 4AOKB 1DMRA 1TWFA 1PQEA 1PT1A 2G5DA 4KDIA 4RV0A 1QDNA 4KLNA 1E18A 1OGYA 1K83A 5DYIA 2A68D 1AA6A 4AZDA 1IW7D 1I3QA 1PYUB 2JIPA 2VPWA 2IV2X 1TWCA 1R27A 5D6YA 3PLXB 3GTKA 1YNND 1G8JA 2CW0D 1CR5A 2NVYA 1PQHA 1R9TA 1PT0A 2PMZA 2KY9A 5T5MD 3IR6A 3GTGA 4QIWA 2Q1DX 1SIWA 4CQNA 4KDLA 5B6CA 2V3VA 2V45A 2JIMA 2JA6A 3CF2A 1SFOA 1EU1A 3GTJA 1FDIA 2PJJA 1DMSA 3QQ7A 5C1BA 1I50A 3LHDA 3QWZA 2NYAA 5FTMA 3HU3A 1AW8B 2BE5D 4KODA 2B25A 2E7ZA 2JIQA 3QC8A 4C2MA 3GTPA 3HKZA 2QQSA 1YLEA 1KQGA 1UHEA 2GFAA 1PQFA 4AONB 2JA7A 2LW6A 2MM0A 2A6HD 1QCSA 2XDPA 1E32A 4ARIA 2EEOB 1G8KA 3HU2A 4KO8A 2PI8A 2VUMA 2VPXA 2JIRA 5T5ID 2Y0SA 2VPYA 5ERGB 3ZJVA 4FIBA 1TMOA 2VPZA 5FTJA 2GF7A 1TWAA 2Q1CX 2JA5A 3BQBA 4AQ7A 1UHDA 3FPUA 4AYBA 1KQFA 2O5JD 2R92A 4CRYG 2YVLA 4AAYA 4GA5A 1H0HA 1CZ5A 3GTMA 1CZ4A 2PICA 3MB5A 3QQ8A 2NVXA 3OUGA 2MM2A 5CCBA 3IR7A 2YUJA 2YU9A 1Y1WA 3CZBA 5FTNA 3GTOA 2G6GA 2Q18X 5C18A 2WB1A 5FTKA 4AS1A 1WCMA 2A69D 5EPPA 1PPYA 2E2IA 1FDOA 1H5NA 1S3SA 3FKIA 4CS0A 2NAPA 2JIOA 3GTLA 2Q1AX 4NOHA 2QQRA 2PWYA 3FPTA 2R7ZA 5D6XA 2WAQA 1TWHA 5D6WA 1ZC1A 2A6ED 1YNJD 1Y4ZA 4DMRA 5CD1A 1O54A 4UC4A 2GAEA 1E60A 2AE0X 1ZYRD 3ZJUA 3ML1A 3ZJTA 3TM7B 4ARCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y5I A;  5GLF A;  3GTQ A;  1Y1V A;  3HU1 A;  2E2H A;  1TWG A;  4GA6 A;  1VC3 B;  5DYG A;  3TIW A;  4CRZ A;  3H0G A;  2B63 A;  2C45 A;  1E61 A;  1PYQ A;  1R7R A;  3CQZ A;  2KI8 A;  2JV2 A;  4D7Z B;  2PJH B;  3DMR A;  2DMR A;  2R93 A;  5FTL A;  1E5V A;  1Q16 A;  3IR5 A;  3O5A A;  1WLF A;  4AOK B;  1DMR A;  1TWF A;  1PQE A;  1PT1 A;  4KDI A;  4RV0 A;  1QDN A;  4KLN A;  1E18 A;  1OGY A;  1K83 A;  5DYI A;  1AA6 A;  4AZD A;  1IW7 D;  1I3Q A;  1PYU B;  2JIP A;  2VPW A;  2IV2 X;  1TWC A;  1R27 A;  3PLX B;  3GTK A;  1G8J A;  1CR5 A;  2NVY A;  1PQH A;  1R9T A;  1PT0 A;  2PMZ A;  5T5M D;  3IR6 A;  3GTG A;  4QIW A;  1SIW A;  4KDL A;  5B6C A;  2V3V A;  2V45 A;  2JIM A;  2JA6 A;  3CF2 A;  1SFO A;  1EU1 A;  3GTJ A;  1FDI A;  1DMS A;  3QQ7 A;  5C1B A;  1I50 A;  3QWZ A;  2NYA A;  5FTM A;  3HU3 A;  1AW8 B;  4KOD A;  2E7Z A;  2JIQ A;  3QC8 A;  4C2M A;  3GTP A;  3HKZ A;  1YLE A;  1KQG A;  1UHE A;  1PQF A;  4AON B;  2JA7 A;  1QCS A;  1E32 A;  2EEO B;  1G8K A;  3HU2 A;  4KO8 A;  2VUM A;  2VPX A;  2JIR A;  5T5I D;  2Y0S A;  2VPY A;  1TMO A;  2VPZ A;  5FTJ A;  1TWA A;  2JA5 A;  1UHD A;  4AYB A;  1KQF A;  2R92 A;  4CRY G;  4AAY A;  4GA5 A;  1H0H A;  1CZ5 A;  3GTM A;  1CZ4 A;  3QQ8 A;  2NVX A;  3OUG A;  3IR7 A;  2YU9 A;  1Y1W A;  2YUJ A;  5FTN A;  3GTO A;  5C18 A;  2WB1 A;  5FTK A;  1WCM A;  5EPP A;  1PPY A;  2E2I A;  1FDO A;  1H5N A;  1S3S A;  3FKI A;  4CS0 A;  2NAP A;  2JIO A;  3GTL A;  2R7Z A;  2WAQ A;  1TWH A;  1ZC1 A;  1Y4Z A;  4DMR A;  1E60 A;  3ML1 A;  3TM7 B; 
#chains in the Genus database with same CATH topology
 1Y5I A;  1BW3 A;  5GLF A;  3GTQ A;  3ZGZ A;  4JP6 A;  4L48 A;  1Y1V A;  3HU1 A;  2E2H A;  1TWG A;  4GA6 A;  3FPR A;  5CCX A;  1VC3 B;  2PNW A;  5DYG A;  3TIW A;  3H0G A;  4CRZ A;  5EQJ B;  3M3G A;  3LGA A;  2B63 A;  2C45 A;  1E61 A;  1PYQ A;  1R7R A;  3CQZ A;  2KI8 A;  2JV2 A;  1OA9 A;  3ENG A;  4D7Z B;  2PJH B;  3DMR A;  3X2M A;  1SMY D;  2DMR A;  2R93 A;  1BW4 A;  5FTL A;  1E5V A;  1Q16 A;  3IR5 A;  3O5A A;  3X2L A;  1I9G A;  2Q19 X;  1WLF A;  4AOK B;  3SUK A;  1DMR A;  1TWF A;  4JCW A;  1PQE A;  1PT1 A;  2G5D A;  4FG2 A;  4KDI A;  1QDN A;  4KLN A;  4RV0 A;  4ZM7 A;  1E18 A;  1OGY A;  1K83 A;  5DYI A;  4ENG A;  2A68 D;  1AA6 A;  4AVR A;  1IW7 D;  4AZD A;  3X2I A;  1I3Q A;  2KQA A;  4FER A;  1PYU B;  2JIP A;  2VPW A;  2IV2 X;  1TWC A;  1R27 A;  5D6Y A;  3PLX B;  3GTK A;  1YNN D;  1G8J A;  2CW0 D;  4JS7 A;  1CR5 A;  2NVY A;  1PQH A;  1R9T A;  1PT0 A;  2PMZ A;  2KY9 A;  4JP7 A;  5T5M D;  3IR6 A;  3X2H A;  4QIW A;  3GTG A;  2Q1D X;  1SIW A;  4CQN A;  4KDL A;  3SUM A;  2V3V A;  2V45 A;  3X2O A;  5B6C A;  2JIM A;  2HCZ X;  3CF2 A;  5GM9 A;  2JA6 A;  1SFO A;  1EU1 A;  3GTJ A;  1FDI A;  1HD5 A;  2PJJ A;  1DMS A;  3QQ7 A;  5C1B A;  1I50 A;  3D30 A;  3LHD A;  3QWZ A;  2NYA A;  5FTM A;  3HU3 A;  1AW8 B;  2BE5 D;  4KOD A;  2B25 A;  2E7Z A;  2JIQ A;  2ENG A;  3QC8 A;  5GLY A;  1N10 A;  3HKZ A;  4C2M A;  3GTP A;  2QQS A;  1YLE A;  4JJO A;  1KQG A;  1UHE A;  2GFA A;  1PQF A;  4FG4 A;  1WC2 A;  3X2P A;  4AON B;  2A6H D;  1QCS A;  2JA7 A;  1E32 A;  2LW6 A;  2MM0 A;  2XDP A;  4ARI A;  2EEO B;  1G8K A;  3HU2 A;  4KO8 A;  3X2G A;  2PI8 A;  2VUM A;  2VPX A;  2JIR A;  5T5I D;  2Y0S A;  2VPY A;  3SUJ A;  5ERG B;  3ZJV A;  4FIB A;  1TMO A;  2VPZ A;  5FTJ A;  2GF7 A;  1TWA A;  2Q1C X;  2JA5 A;  3BQB A;  4AQ7 A;  1UHD A;  3FPU A;  4AYB A;  5H4U A;  1KQF A;  2R92 A;  4CRY G;  2O5J D;  2YVL A;  4AAY A;  4GA5 A;  1H0H A;  1CZ5 A;  3GTM A;  1CZ4 A;  1L8F A;  2PIC A;  3MB5 A;  1OA7 A;  3QQ8 A;  2NVX A;  3OUG A;  2MM2 A;  5CCB A;  3IR7 A;  2YUJ A;  2YU9 A;  1Y1W A;  3CZB A;  5FTN A;  3GTO A;  2G6G A;  2Q18 X;  3SUL A;  5C18 A;  2WB1 A;  5FTK A;  5GLX A;  4AS1 A;  1WCM A;  2A69 D;  5EPP A;  1PPY A;  3X2N A;  1FDO A;  2E2I A;  1H5N A;  2BH0 A;  1S3S A;  3FKI A;  3X2J A;  2NAP A;  2JIO A;  4CS0 A;  3GTL A;  2Q1A X;  3X2K A;  4NOH A;  2QQR A;  2PWY A;  3FPT A;  2R7Z A;  5D6X A;  2WAQ A;  1TWH A;  5D6W A;  1ZC1 A;  4FFT A;  2A6E D;  1YNJ D;  1Y4Z A;  4DMR A;  5CD1 A;  1O54 A;  4UC4 A;  2GAE A;  1E60 A;  2AE0 X;  1ZYR D;  3ZJU A;  3ML1 A;  3ZJT A;  3TM7 B;  4ARC A; 
#chains in the Genus database with same CATH homology
 1Y5I A;  3ZGZ A;  5GLF A;  3GTQ A;  1Y1V A;  3HU1 A;  2E2H A;  1TWG A;  4GA6 A;  3FPR A;  5CCX A;  1VC3 B;  2PNW A;  5DYG A;  3TIW A;  3H0G A;  4CRZ A;  5EQJ B;  3LGA A;  2B63 A;  2C45 A;  1E61 A;  1PYQ A;  1R7R A;  3CQZ A;  2KI8 A;  2JV2 A;  4D7Z B;  2PJH B;  3DMR A;  1SMY D;  2DMR A;  2R93 A;  5FTL A;  1E5V A;  1Q16 A;  3IR5 A;  3O5A A;  1I9G A;  2Q19 X;  1WLF A;  4AOK B;  1DMR A;  1TWF A;  1PQE A;  1PT1 A;  2G5D A;  4KDI A;  4RV0 A;  1QDN A;  4KLN A;  1E18 A;  1OGY A;  1K83 A;  5DYI A;  2A68 D;  1AA6 A;  4AZD A;  1IW7 D;  1I3Q A;  1PYU B;  2JIP A;  2VPW A;  2IV2 X;  1TWC A;  1R27 A;  5D6Y A;  3PLX B;  3GTK A;  1YNN D;  1G8J A;  2CW0 D;  1CR5 A;  2NVY A;  1PQH A;  1R9T A;  1PT0 A;  2PMZ A;  2KY9 A;  5T5M D;  3IR6 A;  3GTG A;  4QIW A;  2Q1D X;  1SIW A;  4CQN A;  4KDL A;  5B6C A;  2V3V A;  2V45 A;  2JIM A;  2JA6 A;  3CF2 A;  1SFO A;  1EU1 A;  3GTJ A;  1FDI A;  2PJJ A;  1DMS A;  3QQ7 A;  5C1B A;  1I50 A;  3LHD A;  3QWZ A;  2NYA A;  5FTM A;  3HU3 A;  1AW8 B;  2BE5 D;  4KOD A;  2B25 A;  2E7Z A;  2JIQ A;  3QC8 A;  4C2M A;  3GTP A;  3HKZ A;  2QQS A;  1YLE A;  1KQG A;  1UHE A;  2GFA A;  1PQF A;  4AON B;  2JA7 A;  2LW6 A;  2MM0 A;  2A6H D;  1QCS A;  2XDP A;  1E32 A;  4ARI A;  2EEO B;  1G8K A;  3HU2 A;  4KO8 A;  2PI8 A;  2VUM A;  2VPX A;  2JIR A;  5T5I D;  2Y0S A;  2VPY A;  5ERG B;  3ZJV A;  4FIB A;  1TMO A;  2VPZ A;  5FTJ A;  2GF7 A;  1TWA A;  2Q1C X;  2JA5 A;  3BQB A;  4AQ7 A;  1UHD A;  3FPU A;  4AYB A;  1KQF A;  2O5J D;  2R92 A;  4CRY G;  2YVL A;  4AAY A;  4GA5 A;  1H0H A;  1CZ5 A;  3GTM A;  1CZ4 A;  2PIC A;  3MB5 A;  3QQ8 A;  2NVX A;  3OUG A;  2MM2 A;  5CCB A;  3IR7 A;  2YUJ A;  2YU9 A;  1Y1W A;  3CZB A;  5FTN A;  3GTO A;  2G6G A;  2Q18 X;  5C18 A;  2WB1 A;  5FTK A;  4AS1 A;  1WCM A;  2A69 D;  5EPP A;  1PPY A;  2E2I A;  1FDO A;  1H5N A;  1S3S A;  3FKI A;  4CS0 A;  2NAP A;  2JIO A;  3GTL A;  2Q1A X;  4NOH A;  2QQR A;  2PWY A;  3FPT A;  2R7Z A;  5D6X A;  2WAQ A;  1TWH A;  5D6W A;  1ZC1 A;  2A6E D;  1YNJ D;  1Y4Z A;  4DMR A;  5CD1 A;  1O54 A;  4UC4 A;  2GAE A;  1E60 A;  2AE0 X;  1ZYR D;  3ZJU A;  3ML1 A;  3ZJT A;  3TM7 B;  4ARC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...