1CZBA

Atomic resolution asv integrase core domain from hepes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
147
structure length
141
Chain Sequence
GRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
total genus 55
structure length 141
sequence length 147
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1czbA00
3HL8A 5HROA 5HRPA 3MEGA 1B92A 3E01A 2YNFA 3AVMA 4CEAA 3AO1A 1C0TA 1T03A 3THVA 4Z4FA 3OS0A 2G8KA 2R7YA 1TL1A 5CYMA 4LD0A 2W42A 1ZYQA 4HCBA 3SUNA 4FJMA 4Z4GA 4B9NA 2E6LA 1TVRA 4IG3A 4CF0A 4CK3A 3TAGA 1U4BA 1SKWA 4FJJA 4PY5A 4CFCA 3HXMA 3S3MA 4I7FA 1CXUA 3KLHA 4KV8A 4KTWA 5CZ2A 3B6OA 2E4LA 4ELUA 1GOAA 4GMJB 1J54A 2FBYA 4G1QA 4DTJA 3V81A 3LAMA 4N56A 1TK5A 1D9FA 4CGDA 5J1EA 1JXEA 1C0MA 3K57A 3SNNA 2P5GA 4KO0A 2YNHA 4CGJA 1ZBFA 3CM6A 1NJZA 4M3RA 1JLFA 1SL1A 1WSIA 4B3OA 1CZ9A 4DTSA 5E41A 4AHUA 4EP5A 3VN5A 1HRHA 1UAXA 2VWJA 3RR8A 2BANA 1HNVA 4DSJA 3IS9A 3TAMA 3QNNA 1D8YA 3P1GA 4DTOA 2HHXA 4J2DA 1LWFA 1NKEA 4H8KA 3QNOA 1U47A 2G8WA 3LZIA 3L8BA 4L8RB 3NFAA 4M41A 3VQEA 2HB5A 2VG7A 3RMAA 5HRNA 3QIOA 3D0PA 1S1TA 1ZBHA 1Y97A 4DU3A 1BHLA 4GW6A 3ZT4A 1FXXA 4CJFA 1TL3A 3KKRA 2XHBA 4AHTA 1DTQA 4CHQA 1XHZA 2QXFA 3OYMA 3AVLA 1KFDA 2KTQA 4HVJA 3LP3A 3QESA 1RDAA 5J2QA 2Z1HA 1XWLA 2X78A 1S9GA 2GV9A 4CHPA 4FCYA 2ZE2A 4PWDA 4BDPA 1QQCA 4BDYA 2IOCA 1L5UA 4ZHRA 4I2PA 4DTNA 4DFMA 3H08A 1S5JA 5HBMA 2G8FA 1C1CA 3CG7A 2KW4A 3LALA 4CGIA 5FRNA 3HPGA 4ID1A 4B8CA 4CESA 1WSJA 4HHTA 1HYVA 3OS2A 3F9KA 1N5YA 2Y1IA 1RTIA 1C0UA 4CFDA 3WNEA 3OYCA 1LV5A 1T7PA 1BCOA 4IBNA 1Q8IA 2EHGA 4AILC 3M8SA 4O0JA 3TR8A 3EZ5A 2P1JA 4CIGA 4KHUA 3M8RA 3EYZA 3I0SA 1KVCA 4CJPA 3L3UA 3ZSQA 4IKFA 4M3ZA 1JL2A 2JLEA 3I8DA 3PO5A 3HM9A 3FFIA 2F8TA 4E1MA 3LAKA 2F96A 3L2WA 3SZ2A 1TAUA 1W9HA 3U3YA 5FRMA 3S3NA 5KTQA 3AVGA 3SV3A 3MECA 3NGZA 3JSMA 1EX4A 3NAEA 4M3WA 1RILA 5J2MA 4DU4A 3DMJA 1A5WA 3ZT2A 3HPHA 4CFAA 4CIEA 1IKVA 4IFYA 3ULDA 1LAWA 4PQUA 3TAQA 4W5OA 4FM2A 3DLGA 2OZMA 4Z4IA 5C25A 2HHVA 4FJLA 4AHSA 2HW3A 4FJXA 1EKEA 3TABA 3TARA 4F3TA 2RKIA 1LW2A 1QE1A 4CF8A 3T3FA 4DSFA 1S6PA 5HRRA 4FLXA 2O4IA 2YKMA 3VQBA 4YFUA 5KRTA 3LANA 3AV9A 3AVAA 4HUGA 1U49A 2PZSA 1CLQA 4DS5A 2ETJA 3A2FA 4C8NA 1T05A 1VRUA 3MXIA 5I42A 4DSLA 2HVHA 1RBRA 3HSTB 1HQEA 3LZJA 2QK9A 4E19A 4KAZA 4E0DA 1JKHA 4BACA 3KTQA 4NCAA 4KREA 4FJGA 4O5BA 3ZSRA 2HHTA 3O4QA 4LSLA 1EETA 3SYZA 3RRHA 3NH1A 1FK9A 2VG5A 3DI6A 3SCXA 1RDCA 1FKOA 1VSEA 1WNSA 4CERA 2D0CA 1U48A 2WONA 4Q0BA 1RT6A 2P51A 1XHXA 3DLEA 1Q9XA 4N76A 4C8OA 3OYJA 2F8SA 2YKNA 1ASUA 4KPYA 4CCHA 3V1OA 2PYJA 3V4IA 5KRSA 4M3UA 3KK1A 1EP4A 4NCGA 2BDPA 4CJUA 3IG1A 3ZSZA 3IAYA 4Z4HA 4BE1A 4CJ4A 1VSHA 3AVIA 4F3OA 4M3YA 1RTJA 4IG0A 3AVBA 4DU1A 4Z0UA 3U6FA 4B9UA 4CHZA 3OYIA 4DQPA 3RR7A 4CF2A 3P5JA 1D5AA 4Z4CA 4DQQA 3T1AA 2IGIA 1NK9A 1JLAA 4CJTA 3DLBA 4QCLA 2KFNA 3OJUA 4KHWA 3V9UA 1LWCA 4DF8A 3AA3A 4FLTA 1Z26A 4KHYA 1KTQA 1LWEA 3K5LA 3NF8A 2HHWA 3VQ4A 1DTTA 3VQ9A 1LAVA 1QS4A 1S1WA 3VA0A 4OGEA 1NK0A 4DQSA 2ZQBA 4JLHA 3VQ8A 3KK2A 4FW2A 2YNIA 4XIUA 3SQ2A 3KD5E 2HHQA 1RT7A 3SQ0A 4UQGA 3RMDA 1J53A 4JS5A 3NH0A 2D5RA 3ALYA 4E1NA 3OYBA 3MXJA 4FXDA 4KI4A 4CJ3A 4HUEA 3MXMA 1IH7A 2FBTA 4BE2A 2A1RA 3VQDA 4CJWA 4DSIA 1WAJA 4FW1A 3BGRA 4IDKA 3O3FA 4DFPA 1NJWA 1LW0A 3K2PA 3U3GA 4KTQA 3QEWA 4RW7A 4DFKA 1N6QA 3DRSA 4JRQA 2A1SA 2OZSA 2HNZA 4RW6A 2GUIA 1ASWA 1I39A 1TKZA 5FDLA 1VSFA 3KKSA 1GOBA 4CGHA 3VQPA 3LDSA 1WLJA 2OPSA 4LH5A 5DMRA 3V9ZA 1BL3A 4OLBA 2B6AA 4DMNA 3HT3A 4CEQA 4CJLA 1KLMA 4CJRA 3C95A 4CHYA 4DTPA 4OPKA 2IS3A 4CF9A 1RDDA 4CJSA 1UWBA 3V9XA 4DQIA 3O3HA 4J2BA 1IO2A 1RNHA 1C1BA 3OY9A 5HLFA 1R0AA 4ELVA 3IRXA 3UIQA 3PY8A 1ZBIA 3ZT3A 1L3VA 3HP6A 3HVRA 3LPTA 1ASVA 4DS4A 4O44A 4DF4A 4OKKA 2XO7A 1C1AA 3K58A 2AJQA 1IKYA 1S1VA 4BE0A 4E7HA 1IG9A 4E3SA 2IDOA 1Z25A 3ZSWA 4CJ5A 1SKRA 1BQNA 3QERA 1BI4B 2G8UA 4C8LA 3KLIA 4NYFA 4B9SA 4KRFA 1SL0A 1JXBA 4EZ6A 3AVKA 4KFBA 1XC9A 3ZCMA 2NUBA 1VSMA 3K5NA 1JLQA 4FLVA 4DTXA 3VQQA 3QIPA 1VK0A 4OPJA 4WE1A 3OYGA 3V9WA 3WNGA 3CFPA 2FBXA 1NKCA 1HYSA 4NCBA 4CF1A 3F73A 1JLCA 2OPRA 2XRIA 3AVCA 1TKTA 1RBVA 3NHGA 4CK1A 4F2RA 4Q5VA 1FKPA 4BDZA 1Q9YA 5EU7A 3DOKA 5FROA 1KLNA 3RTVA 1J9AA 4OKJA 4OGCA 3ZT0A 2Y1JA 2E6MA 4O0IA 1TAQA 3AVHA 4HUFA 5CY4A 3AO2A 3OYFA 1TK0A 1RT5A 3OS1A 2KZMA 1TKXA 2HHSA 3L3VA 2FBVA 3PX0A 4DSKA 4KHQA 1BISA 3LWMA 5T7BA 3OYNA 3SUOA 3AO3A 3M8PA 1NK4A 3LWLA 3ASMA 1S9EA 2VG6A 3DLRA 4JRPA 3SQ4A 4ELTA 1T8EA 1IKXA 1S6QA 4IFVA 3AVFA 3OYEA 4HTUA 4JS4A 3QEPA 1L3UA 1NOYA 2DTUA 3QINA 1WN7A 3C94A 4DG1A 4FYDA 2GBZA 2RF2A 3OJSA 2WOMA 3S3OA 2G8HA 1UA0A 2QKKA 4EZ9A 1D9DA 4CK2A 4FM1A 1NK7A 1UA1A 1SL2A 4KI6A 3HJFA 3AO4A 4CEBA 4KHNA 1ITGA 4PA1A 4FJ8A 3NGIA 2B4JA 4H4MA 4RG8A 3NCIA 4CJQA 4DTMA 4KB1A 4CEOA 2XY5A 3MAQA 4FM0A 4C8KA 4RW9A 3L2RA 1QHTA 4FZXC 4W5NA 3ZSVA 3OYHA 1BI4A 5C24A 3VQAA 3JYTA 4N5SA 1X9WA 4AHRA 1TK8A 2PY5A 1BQMA 1JLGA 4TSXA 1CZBA 4CJEA 4FJ7A 3LP1A 1XI1A 1X1PA 1HMVA 4CEZA 4B9LA 3ZSYA 4CHOA 1BIUA 3V6DA 4M3XA 1DLOA 4O55A 4LY7A 3BDPA 2X6SA 3D45A 3DLKA 3MEDA 4KTZA 4CEFA 3OYAA 4FJ5A 2I5JA 2Z1JA 1HPZA 5KI6A 4B9MA 1YT3A 3NF6A 3PX4A 2P5OA 4HCCA 3DOLA 2OPQA 3TAPA 1IKWA 1A5VA 4O4GA 3HO1A 3AO5A 4FLUA 1WSEA 3KLFA 4E7JA 3QEXA 2XY6A 4OJRA 4I2QA 1RT1A 4CJKA 3PUFA 1JLEA 3S9HA 1VSKA 2ATQA 3OYKA 4CHNA 4DLGA 4CIFA 2LSNA 3PO4A 5DK5A 2KFZA 3DYAA 1YTAA 1B9FA 1QSLA 4J2EA 1RBUA 1UOCA 3ITHA 3C6UA 4CJVA 1SKSA 4KHSA 4FK4A 1KVBA 2IAJA 5JS2A 1VSDA 4ZTFA 1RTHA 3V1RA 3K5OA 2YNGA 4Y1DA 3SI6A 3QETA 2KZZA 4AHVA 4FJHA 3NE6A 3NF7A 4CE9A 1REVA 1X9SA 2D0AA 4DLEA 3ZT1A 3RRGA 1VSLA 4DWIA 1F21A 4MQ3A 1I3AA 3O3GA 3KK3A 3RWUA 2HHUA 1QSSA 3HVTA 4QAGA 2DY4A 4FK0A 4AH9A 3K5MA 4N41A 2G8IA 2XY7A 4QOZB 1BGXT 4DQRA 2HNDA 4RW8A 3EY1A 2X74A 4CGGA 2HVIA 3WNFA 1NK8A 1U04A 3RMBA 2PYLA 1K6YA 3M8QA 1RT3A 4DTUA 1L3TA 3MEEA 2OYQA 4F4KA 3SUPA 1QSYA 3L2QA 1U45A 1KSPA 4FK2A 2DFEA 4FZZA 4FZYA 1TKDA 2HMIA 2KQ2A 4GVMA 4CGFA 1RBSA 4DFJA 3QEIA 2OA8A 4I9LA 4OVLA 1C6VA 4FLWA 4LH4A 4BWJA 3SUQA 3KLGA 3TWHA 1HYZA 4E7IA 1ZBUA 2VWKA 3SPYA 3CYMA 2B5JA 3P83D 2FC0A 1TGOA 2BE2A 3I0RA 3ZSXA 3VA3A 3HK2A 3AA4A 3TAFA 3AVJA 1EXQA 1YVUA 3NBPA 1JLBA 4MFBA 5SWMA 1KCFA 4H4OA 3RMCA 3DLHA 1SV5A 3C6TA 4KKOA 4AHCA 3KD1E 4KB0A 3PV8A 1HJRA 2OPPA 1WAFA 3HYFA 3VQ6A 4RW4A 4YNQA 1X9MA 4E7LA 1KFSA 4FJIA 1RT2A 2DFFA 1NKBA 4I9QA 4FJNA 5KGXA 1VSJA 1KRPA 3CFRA 1A5XA 4DSEA 2Q3SA 3NF9A 5I3UA 3PX6A 4B08A 1QTMA 4W5RA 5HRSA 1JL1A 3B6PA 3QEVA 3DRPA 2YHBA 5CZ1A 1G15A 2YV0X 3AA5X 3L2VA 4N47A 1ZBLA 4EP4A 4Y1CA 3ISNC 1YTUA 2X6NA 3HP9A 5KGWA 3O4NA 3V9SA 2D0BA 4FJKA 4ZTJA 4PUOA 2DFHA 3VQ7A 3VQCA 5K14A 3SJJA 3CM5A 3CQ8A 4FLZA 3ZSOA 1WSFA 3SQ1A 3DRRA 1TV6A 1CXQA 3K59A 2QKBA 1RBTA 1RDBA 1WSHA 3KIOA 4CEEA 4B8AB 5CYQA 3OYDA 3SPZA 4K8XA 1MU2A 5C42A 3NH2A 3KLEA 3G0ZA 4FLYA 1NK5A 1NJYA 3LP0A 3T19A 1S1XA 4NYNA 1NJXA 5SZTA 3LP2A 4K8ZA 4F8RA 1L3SA 3SV4A 4E7KA 4M3TA 4FJ9A 1GOCA 3L2UA 3QO9A 2BGGA 3TANA 1BIZA 1O1WA 4B9VA 3DM2A 2G8VA 2JGUA 2YHAA 1BCMA 2XY8A 3TI0A 4M42A 2Z1IA 3OVNA 3CFOA 3NGYA 4ID5A 2ZD1A 5D3GA 2EX3A 3AVNA 4OKEA 2IC3A 4CEDA 3OYLA 2O4GA 5J2PA 1B9DA 4OLAA 2RN2A 4R5PA 3TAEA 4F2SA 1WSGA 3HPOA 4M45A 4B9TA 1HQUA 4CECA 2RPIA 4FVMA 3WNHA 5JS1A 1W0HA 4LSNA 1NOZA 2Z1GA 3LPUA 4C8MA 3VQ5A 3KJVA 2ITGA 4DTRA 1RT4A 1RTDA 1S1UA 5J2NA 3NDKA 1RCHA 4W5TA 2HNYA 1HNIA 1SUQA 3AA2A 4Z4EA 4ICLA 4E89A 1VSIA 1NK6A 4BWMA 1VRTA 1J5OA 4W5QA 4CFBA 3QLHA 5HP1A 3G10A 3V1QA 1KVAA 4J2AA
chains in the Genus database with same CATH superfamily
5JVHL 3HL8A 5HRPA 3AVMA 1T03A 3OBWA 2E2OA 5CYMA 1QVGM 4FJMA 3QMLA 4CK3A 4IG3A 1SKWA 4B9NA 4IFEA 4X66K 3KLHA 4KV8A 5JICA 1N32K 3B6OA 4GMJB 4WFBL 1D9FA 5FPMA 3WT0A 1C0MA 4U7BA 2YNHA 1GLEG 5EXWA 4CGJA 1ZBFA 2JWKA 4KBOA 1SL1A 4LF6K 3TTDA 3VTIA 1CZ9A 1TUUA 2O8EB 3L4QA 2VWJA 3RR8A 4B1XB 1HNVA 2Q0UA 3SMPA 1D8YA 4GV9A 1JJ2M 3DXKB 1VQ4N 3Q7CA 3H3NO 2AA4A 2RHKA 4L8RB 2HB5A 2HMPA 1HNWK 1ZBHA 3VESA 3D0PA 4GW6A 3CJAA 3ID8A 4AM6A 1TL3A 2XHBA 4JI5K 3MWTA 1XHZA 4LF8K 3LP3A 3QESA 2WBNA 2OTLN 3MK6A 2ZE2A 2CGJA 3W0LA 3P39A 4DR5K 1QQCA 5HBMA 4H03B 1C1CA 1Q86O 1YJ9N 5FRNA 4CESA 1J6ZA 2FLOA 4HHTA 3OS2A 3F9KA 1N5YA 3WNEA 1Q8IA 1U6ZA 1X3MA 2ZJPL 4DHYA 4X65K 3M8RA 1KVCA 3ZSQA 1NGGA 2ZGYA 4M3ZA 1JL2A 3J7ZO 2ZM6K 3E9PA 1D4XA 3LAKA 3T7ZA 3L2WA 2O8EA 2E2NA 4YHHK 1W9HA 3U3YA 3AVGA 4QS8A 3MECA 3NGZA 3JSMA 4M3WA 1R59O 3DMJA 1A5WA 3DXKA 3ZT2A 4FL9A 4CIEA 2O8DA 2F7TA 4DR4K 4PQUA 3TAQA 4W5OA 3CJ9A 3O1BA 3J80O 3Q7BA 2HW3A 2HF4A 1BUPA 2YX6A 3T3FA 4FLXA 2O4IA 2FSNA 2IVOA 4BRHA 2YKMA 3O5BA 3LANA 5LMNK 3AVAA 4A5AA 4H0TB 5I42A 4BGBA 1JKHA 3KTQA 3U8XA 4NCAA 3KWIA 4FJGA 4KREA 3ZSRA 4LSLA 3CCSN 1RDCA 2P9SB 2HBLA 3NVKA 5AQQA 3MN6A 2E2QA 1Q9XA 4MDBA 3OYJA 2I7PA 3TSPA 2YKNA 5AQMA 5JVGL 5KRSA 5M1OA 4NCGA 3QBXA 4Z4HA 1VSHA 4DU1A 3VF6A 3U6FA 4B3TK 4OX9K 2P9UB 4CHZA 4DQPA 4CZEA 4Z4CA 2QWOA 5BR9A 4DF8A 4KHYA 4FLTA 3JS6A 3NF8A 1KAYA 4FSVA 3VA0A 4O5FA 4DQSA 4JLHA 2HHHK 4XIUA 3W3DA 1VQ8N 2HHQA 3SQ0A 4E1NA 3OYBA 1J5EK 4KI4A 4CJ3A 4DSIA 3VQDA 4XH1A 3E9LA 3BGRA 5F0XA 3SAHA 3O3FA 2QI2A 2VCPA 5AQVA 5AQXA 2OZSA 4E1JA 4BRMA 1GOBA 4CGHA 4AF1A 2P9SA 5DMRA 1BL3A 2B6AA 4DMNA 4CEQA 5TKYA 4CJRA 3C95A 4CHYA 2IS3A 5AQSA 1UWBA 4FO0A 4DQIA 2E20A 4EIAA 5KPZA 4J2BA 4WF9L 4GY2B 3PY8A 1ZBIA 2E1YA 2FF3B 5AQYA 2GWKA 2AJQA 2IDOA 4ISGA 3VTHA 3ZSWA 1OH8A 1ILYA 4A5BA 3QERA 1BI4B 1OH6A 3KLIA 4NYFA 2UXCK 4EZ6A 1MWKA 3H1VX 4YY3K 2NUBA 3CJBA 4A62A 5KQDA 1WB9A 5CHIA 2V7YA 5I9EB 3NHGA 1TKTA 3FZFA 1FKPA 4BDZA 4IXCA 4JK8A 3SK3A 1Q9YA 3DOKA 1J9AA 4OKJA 4OGCA 3R8EA 2E6MA 4HUFA 1BWFO 5CY4A 3AAQA 1TK0A 1XNRK 2KZMA 1TKXA 3L3VA 1BISA 3QICA 3LWMA 1Z6RA 3AO3A 3C0BA 3ASMA 1S9EA 2VG6A 4JRPA 1M1KO 3EE9A 1S6QA 3OYEA 2DTUA 3QEPA 2J4RA 1WN7A 3OJSA 4K42A 3S3OA 2QW9A 1NGIA 1UA0A 2QA4N 4B1WB 4FM1A 1UA1A 1SL2A 3HJFA 4JI3K 1ITGA 4DR6K 5FPEA 4RW9A 3G71N 4W5NA 1BI4A 4H5NA 5C24A 1BQMA 3ATVA 4TSXA 5AQHA 1X1PA 4BRQA 3JXUA 4CEZA 4J8FA 4CHOA 1BIUA 4YOXA 3V6DA 2UUCK 3HSCA 5BPMA 4O55A 5BRFA 2X6SA 3CIPA 3D45A 3DLKA 3MEDA 3THXB 5BPNA 5GAHP 2OPQA 3THWA 1IKWA 1A5VA 3AO5A 4FLUA 1RDUA 1WSEA 2GELA 4K41A 3VEXA 4NLBA 2KFZA 2LSNA 5DK5A 4AM7A 3SBGA 1SKSA 1KVBA 2IAJA 3I8BA 1Y64A 3J7AP 3V1RA 4DV7K 2ZWHA 3VETA 1SAZA 2QEXN 3ZETB 5EY4A 3CCQN 3NE6A 4CE9A 2RE2A 3RRGA 5B8HA 2PFUA 1T6DA 1F21A 3QDKA 2WTUA 2G8IA 2XY7A 3CCLN 1YAGA 4A59A 4CGGA 1NK8A 1U04A 4K0KK 3EZWA 1NU0A 4DTUA 3CQXA 3A8YA 2KQ2A 1QHAA 1BDGA 1NGEA 3THXA 1U2VB 2VWKA 3MCPA 3SPYA 3O8MA 3CYMA 3P83D 2FC0A 4Y0WA 5C15A 3I0RA 2E8AA 4PKIA 3NBPA 5SWMA 3C6TA 3WXJA 4IO8A 4DV3K 3CC2N 4FJNA 3MWPA 4PKGA 2NZTA 4BREA 3SMSA 5KGXA 3CFRA 3L6QA 1KRPA 4WQ4A 4W5RA 3DRPA 3R1XA 1YJWN 1G15A 3AA5X 4N47A 1ZBLA 3ZETA 5KGWA 3O1WA 3V9SA 2D0BA 3SJHA 4FJKA 2QM1A 3TTCA 5GIPA 3VQ7A 4PUOA 3VQCA 3SJJA 1WBBA 3CM5A 4GV3A 4FLZA 1TV6A 1RBTA 1YJNN 1KAXA 1WSHA 1OH7A 4M3YA 2O8BB 3LP0A 4JKGB 4NYNA 4AQYK 1OVQA 1KQSM 4K8ZA 4F8RA 4CW7B 1L3SA 5IWAK 1JCGA 3L2UA 5C2FA 2BGGA 1BIZA 2G8VA 2FF6A 5JMVA 2XY8A 3NGYA 2V7ZA 1DKGD 1NLVA 3F9MA 4JKBA 4NXNK 4R5PA 4B9TA 4FVMA 5GAEP 3BP8A 2HBMA 3WXKA 3THYB 5AQTA 1BU6O 3MDQA 3CJ7A 4ICLA 4BWMA 1VRTA 3LM2A 3CPWM 1K8KB 4B3SK 3VEYA 4F4KA 3MEGA 3K0SA 4CEAA 1C0TA 3MN5A 3OS0A 2G8KA 4JK7A 4LD0A 2W42A 4HCBA 3SUNA 1X3NA 3VOVA 2E6LA 1TVRA 2HVHA 3TAGA 4FJJA 4I7FA 3TTFA 5FPDA 1N33K 4BRIA 5CZ2A 4BR0A 4ELUA 4DR2K 2ASMA 1EWRA 4NB4A 1TK5A 4N56A 4DKWA 1I94K 1HNXK 2UU9K 2O8BA 1JXEA 5AFUH 4JKGA 3LDOA 4KO0A 1NJZA 3CM6A 1JLFA 2NRHA 3VN5A 1HRHA 2O8FB 3I33A 2BANA 3LZIA 3VQEA 3RMAA 5HRNA 3QIOA 1S1TA 1BHLA 4BRAA 3C7NB 4BVOA 3ZT4A 4M63C 4CHQA 4B1UB 2QXFA 4H0OA 1XMOK 4HVJA 1Q82O 1K8KA 1MWMA 5J2QA 4JHDB 4JI2K 3U9DA 1XWLA 5GINA 4FCYA 1S9GA 4C1NK 4CHPA 1SS6A 4BDYA 1WUAA 3CETA 4Z94A 1S5JA 5AZIB 4IOXA 3D6RA 2Q1NA 1N34K 1WSJA 1XUPO 4CFDA 4GNIA 2WUSA 3TR8A 2P1JA 4IDHA 4DR1K 4GV6A 4CJPA 2HSTA 1IJJA 3DAWA 2A41A 3HM9A 4BRKA 2F8TA 3N4PA 1TAUA 5KTQA 1EX4A 1DEJA 3ZX0A 4A61A 4WQ5A 4OO1J 5C25A 2HHVA 4AHSA 4FJXA 1EKEA 3C6AA 3TABA 3TARA 4F3TA 2RKIA 1LW2A 5HRRA 2E88A 4JHDA 5KRTA 3AV9A 3ZX3A 4DS5A 5AQPA 5AZIA 3LZJA 1GLAG 3MN9A 4O5BA 4GKJK 3NH1A 1FK9A 2VG5A 3SCXA 2BUPA 3WEEB 1N8RO 4KHPK 1YVNA 3F5TA 2WONA 3VF2A 4Q0BA 3CCRN 3DLEA 1YXQA 3O9SA 3RSEB 4B9QA 3G6EN 3ENHA 4CCHA 2YHWA 3V4IA 5KQ8A 3KK1A 2BDPA 4CJUA 3H6EA 1LCUA 4CJ4A 3GL1A 1RTJA 3ZEUB 4FPBA 3OYIA 3CF5L 3P5JA 4DQQA 1NK9A 3DLBA 4QCLA 4CJTA 1OH5A 3OJUA 2E5LK 1XNQK 3FE1A 2DPNA 3VQ4A 3VQ9A 1NK0A 2ZQBA 4FW2A 1OVYA 4JKDA 5AFUA 5F2RA 3RMDA 2O8DB 3ALYA 3MXJA 3MXMA 2FBTA 2NRVA 2PAVA 3AGRA 4CJWA 1WAJA 3GOIA 4DFPA 1HYSA 3U3GA 3EL2A 4RW7A 1VQPN 1V4TA 2A1SA 4DV0K 2GUIA 1ASWA 5BPLA 3KKSA 3WEEA 2FSKA 3G25A 1YF5L 1WLJA 3EEQA 3VGMA 2P9KB 3HT3A 1KLMA 3RSEA 4OPKA 4CF9A 1RDDA 4CJSA 3SAFA 1IO2A 1RNHA 5HLFA 4ELVA 3IRXA 4WFNL 1T44A 3HVRA 3LPTA 1C1AA 4BE0A 4E7HA 3ZEUA 3CD6N 4MLEA 1HJOA 2G8UA 1MA9B 3MCAB 1EO1A 2OTJN 4FWPA 3AVKA 1XC9A 4JI8K 3CC4N 1VSMA 5HOOA 5LL6Z 3H3OB 4A2BA 3OYGA 1NGFA 2F9WA 1E3MA 1BG3A 4CF1A 3F73A 3IKMA 2NRXA 2XRIA 3AVCA 3M6GA 4Q5VA 4IWVA 1NMDA 5FROA 3RTVA 4O0IA 3AVHA 3L0QA 3OYFA 1RT5A 3QB0A 1ATRA 2HHSA 3H46O 5ADXH 5T7BA 3FFKB 1NK4A 4CZIA 3LWLA 4O8UA 4JAXA 2P9KA 1QZ5A 3VERA 2P9PB 4HTUA 1NOYA 1VQLN 1G99A 3QINA 2UUAK 4BRCA 3CJ1A 4PL8A 2QKKA 4CK2A 1NK7A 3UKRB 4KHNA 4CEBA 4FJ8A 3NGIA 3QBWA 4CJQA 4KB1A 4CEOA 2XY5A 2P9NB 4FM0A 4C8KA 3L2RA 3VENA 2QWPA 3VQAA 1X9WA 1TK8A 1YITN 4CJEA 4FJ7A 3LP1A 4B9LA 4U67L 3BZCA 2D0PA 1NGAA 4KTZA 3OYAA 2I5JA 2Z1JA 4GKKK 3PX4A 3PIPL 4JI4K 3TAPA 3HO1A 1RT1A 4CJKA 4NCBA 1VSKA 2ATQA 3OYKA 4CHNA 4DLGA 1E4FT 3FR0A 4J2EA 4KHSA 3C6UA 1VSDA 4QS7A 5BN8A 3B8AX 5AQZA 2P9PA 2KZZA 1P8ZA 3NF7A 1REVA 2D0AA 2W41A 3ZT1A 3UKRA 2IVPA 1I3AA 3O3GA 3KK3A 1EQYA 1QSSA 4QAGA 3K9JA 4AH9A 3VEVA 2P9NA 4FK0A 4PHTX 1RGIA 4DQRA 2HNDA 2P9LB 4IOCL 4RW8A 2X74A 2HVIA 4G9ZA 2AP1A 1K6YA 3M8QA 1RT3A 1L3TA 3MEEA 1QSYA 1W97L 4FK2A 2DFEA 4K25A 4GVMA 1RBSA 4DV4K 2VQEK 2OA8A 3HRGA 4FLWA 3KLGA 2NRWA 1HYZA 3VEOA 4JI1K 2B5JA 5E26A 4H0VB 3ZSXA 3VA3A 5F1XA 3O08A 1EWQA 2QWLA 4KKOA 4AHCA 3PV8A 1HJRA 2CGLA 4YNQA 3IUCA 4FJIA 1RT2A 3DXMB 4CVNE 4FJ5A 4DSEA 2Q3SA 3NF9A 4H0YB 1QTMA 3QEVA 1JL1A 3B6PA 1Q7YO 3THWB 3LDNA 1YTUA 3EO3A 4FWLA 1KD1O 3BUZB 1BO5O 4NO7A 4BC2A 2ZGZA 3M5RA 3CQ8A 4JNEA 1T6CA 2P9LA 3DRRA 4LF7K 1RDBA 1O13A 3SPZA 3C6HA 1MU2A 5C42A 3NH2A 4FLYA 1NK5A 4O8KA 1NJYA 4CZLA 3CHWA 2KHOA 1Q81O 1O1WA 2VQFK 3H45C 4ILJA 2YHAA 4QS9A 2Z1IA 3OVNA 4CJ7A 1XQSC 3AVNA 4OKEA 3TAEA 4ILHA 3I55N 3HPOA 1HQUA 3KZBA 4CECA 2RPIA 4HWIA 3HZ6A 4LSNA 2Z1GA 4FWSA 3DXMA 1IBKK 4W5TA 1NGHA 1HNIA 1SUQA 4Z4EA 3HOTA 3CQYA 4CBUA 1J5OA 4W5QA 3GE1A 4H5TA 3G10A 3V1QA 1KVAA 4FWQA 5AQLA 4JI0K 3AO1A 2R7YA 3EE8A 1TL1A 1ZYQA 1GLJO 4Z4GA 1P90A 1CXUA 4FWRA 4KTWA 3EKUA 1GOAA 1J54A 3LDQA 4G1QA 3V81A 3LAMA 1RFQA 4CGDA 5J1EA 4DR3K 3K57A 2P5GA 3SNNA 2YJFA 4NLCA 4M3RA 5E41A 4AHUA 4EP5A 1UAXA 2A6AA 4DSJA 4XEIA 4DTOA 2UUBK 4J2DA 1LWFA 4H8KA 2G8WA 1U47A 3NFAA 4M41A 2VG7A 4DU3A 3GDQA 1YIJN 3MX2A 2QWNA 4JI6K 1VQ6N 1ESVA 3P31A 5BRDA 2KTQA 1FW6A 3CPEA 4YDUA 4BRNA 4B3MK 1RDAA 3O9RA 4PWDA 2IOCA 1L5UA 4ZHRA 4DTNA 3DJCA 5GAGP 2KW4A 3LALA 4CGIA 4ID1A 4B8CA 4X64K 2Q0RA 1RTIA 1C0UA 2GX9A 1T7PA 1BCOA 3TPQA 1YHQN 4AILC 3M8SA 4JYAK 2OCEA 2P9IB 2UYTA 4O0JA 3EZ5A 4UY8O 4CIGA 3PSFA 4FWNA 3EYZA 3I0SA 4IKFA 2JLEA 3I8DA 5M1FA 1W7AA 3PO5A 3FFIA 4V19S 4BRFA 3S3NA 5HL7L 1BA1A 4FOIA 2ASPA 1NG9A 4DU4A 3IFRA 3HPHA 2I7NA 4IFYA 3ULDA 1LAWA 3P38A 4YOVA 4IJNA 3TSUA 3DLGA 2OZMA 2E1ZA 4F9OA 2Q36A 4DUYK 1BA0A 1JCEA 4DSFA 4I6MA 3CMAN 3VQBA 5GADP 1QZ6A 1U49A 3FZMA 3A2FA 4DSLA 3MXIA 4WCEL 1RBRA 3HSTB 5IT9O 2W6LA 4HTLA 1XMQK 2QK9A 4KAZA 4BACA 4PL7A 2HHTA 3PSIA 1EETA 3SYZA 1IBLK 4KH4A 3DI6A 5E84A 1FKOA 2P9IA 1VSEA 1WNSA 3ZYYX 4BGAA 2D0CA 1U48A 5KPRA 5M1KA 1RT6A 1NBWA 1WBDA 4C8OA 3V1OA 4IO9L 1FJGK 4BR2A 4M3UA 1EP4A 1DT9A 3IG1A 3ZSZA 3IAYA 3HBTA 4BE1A 4M7YA 4F3OA 4Z0UA 3CI5A 4NXMK 4CF2A 2IGIA 5H1SQ 4KHWA 1TUYA 5MLCQ 3V9UA 1LWCA 3AA3A 3K5LA 2A3ZA 1DTTA 1LAVA 1S1WA 3PIOL 4OGEA 5A2QO 4WFAL 3VQ8A 2WFBA 2IIRA 2YNIA 3SQ2A 3ATUA 3KD5E 5AQWA 3TU5A 4UQGA 3NH0A 2D5RA 3A5LC 4FXDA 4XH4A 3QFPA 5LY3A 3SAGA 2A5XA 4FW1A 4IDKA 4DV6K 1LW0A 2VWBA 4BC5A 4DFKA 3QEWA 1N6QA 4JRQA 3CCJN 2HNZA 4RW6A 1TKZA 1I39A 1HUXA 3LDSA 3ULEB 2OPSA 3V9ZA 4R79A 2UXDK 4CJLA 4DTPA 2YI1A 3V9XA 4B1ZA 3O3HA 1R0AA 2A42A 3ZT3A 1L3VA 4B1VA 3HP6A 4DS4A 1ASVA 1OKJA 2XO7A 1IKYA 1S72N 4RCHA 1IG9A 4E3SA 4CJ5A 1SKRA 4C8LA 1IBMK 4B9SA 2HOEA 4KRFA 1SL0A 1JXBA 4A2AA 4KFBA 3ZCMA 3K5NA 3VQQA 1VK0A 4OPJA 4WE1A 3V9WA 5JLFA 3OTOK 2FBXA 4OPHA 3SLCA 1JLCA 1GLFO 4F2RA 2FXUA 3SBTA 5M1NA 4WQ4C 4IEIA 5EU7A 4EHTA 3VMFB 4BG8A 5ELZA 4BRGA 1IG8A 1ZC6A 3VEZA 3EN9A 5AQJA 1VQKN 4CBWA 4DSKA 2BH1A 3ULEA 3ZX2A 4GVEA 4ELTA 1T8EA 1IKXA 4JS4A 4LC9B 2QTDA 3M3ZA 4DG1A 4C23A 2RF2A 2WOMA 1YUWA 2G8HA 4EZ9A 1D9DA 4YOWA 4PA1A 4BRDA 1NGBA 3O9TA 4H4MA 4CD1A 3MAQA 2ITMA 3KVGA 4YOUA 3ZSVA 2V52B 3D2EB 3JYTA 2PY5A 1SZ2A 4CZKA 1VQ5N 1XI1A 1HMVA 3ZSYA 1X9JA 2ZJRL 2F4VK 5TKWA 4M3XA 4LY7A 3BDPA 5EVZA 4CEFA 3O6WA 5FLXO 1HPZA 5KI6A 1YT3A 3O80A 4HCCA 4DR7K 1ZXOA 4O4GA 3QEXA 3KLFA 2BTFA 4OJRA 2HBJA 4I2QA 4YORA 3PUFA 3S9HA 2YHXA 4WYBA 1ATNA 1HR0K 3NVMA 1YTAA 3LDPA 3L4IA 1RBUA 1UOCA 1H1VA 1GLBG 2EWSA 3ITHA 1NWKA 4ILGB 4CJVA 1N36K 5JS2A 4BQZA 1RTHA 4DCHA 3CJCA 4FVUA 4ISFA 3MN7A 3QETA 3WXLA 3CERA 4AHVA 4FJHA 3FZLA 4DLEA 3QFUA 4DWIA 4MQ3A 2JWLA 1YI2N 3RWUA 2HHUA 3DWLA 2F9TA 3HVTA 1VQ9N 2DY4A 3K5MA 4QOZB 1BGXT 5AQFA 3D2EA 3EY1A 1HKBA 3WNFA 3RMBA 4BVPA 2HBKA 2NRTA 3SUPA 3L2QA 4FZYA 1TKDA 2UXBK 4XH5A 1T3VA 3CCVN 4OVLA 3E9OA 1C6VA 4LH4A 3SUQA 4LF4K 4FWMA 3TWHA 4E7IA 1ZBUA 3J81O 1TGOA 2BE2A 1IV0A 3HK2A 3AA4A 1HX1A 1YVUA 1JLBA 1RDWX 3RMCA 4BRLA 3DLHA 1SV5A 2OPPA 1WAFA 3HYFA 1X9MA 4E7LA 3FGUA 4C1NI 1NNEA 1NKBA 3A5MC 4I9QA 3LDLA 3AGKA 3VEWA 5I3UA 4CI6A 2QWQA 3WXIA 2YHBA 5CZ1A 2VGMA 3L2VA 5BRHA 4EP4A 4Y1CA 3ISNC 1NGJA 3O4NA 1Z05A 1TYQB 3HM8A 4ZTJA 5EOYA 4BY9C 2DFHA 4DB3A 4BR9A 3FZKA 3CC7N 3R9PA 3OYDA 5CYQA 3IMXA 1M90O 4WQ5C 3KLEA 3G0ZA 1KLNA 1NJXA 3T19A 3LP2A 3D2FB 1VHXA 3O4WA 3SV4A 4E7KA 4FJ9A 3QO9A 1S3XA 3OA9A 4B9VA 3DM2A 1BCMA 3TI0A 4M42A 2ZD1A 2EX3A 3KHYA 3OYLA 4DV2K 5J2PA 2O4GA 1B9DA 5AR0A 2RN2A 2Q2RA 3WNHA 5JS1A 3WXMB 3BF1A 3LPUA 3VQ5A 3KJVA 4DTRA 1RTDA 1S1UA 5J2NA 2V51B 3NDKA 3CXCM 3NMUA 3AA2A 4E89A 1NK6A 4CFBA 1LOTB 5HP1A 4J2AA 3ZLJA 5HROA 3T1HK 3UB5A 5M1PA 1B92A 3E01A 2YNFA 4Z4FA 2Q31A 5AZJB 3THVA 1TYQA 3VF4A 4KH5A 4CF0A 1U4BA 4PY5A 3H1QA 2WC9A 4CFCA 3HXMA 3S3MA 3FLCO 5KPTA 5C2DA 4MO4A 1K8AO 4X62K 2E4LA 2FBYA 4DTJA 2GTDA 2W40A 3D2FA 4JKFA 1WSIA 4B3OA 1S22A 5LJVA 4JEPA 4DTSA 3S41A 4KH6A 4EHUA 3IS9A 3TAMA 4B1YB 3QNNA 5FPNA 3P1GA 2HHXA 2CH5A 1XC3A 1NKEA 3QNOA 3L8BA 2KLAA 2ZJQL 1Y97A 1VQ7N 2FSJA 1FXXA 4BROA 4CJFA 3KKRA 4AHTA 1DTQA 3OYMA 3AVLA 4EFHA 1KFDA 4LF5K 2Z1HA 2X78A 2GV9A 1MDUB 2GWJA 3I56N 3E66A 5AQRA 4BDPA 5AQNA 3HTVA 4I2PA 5AZJA 4DFMA 3H08A 2G8FA 4FPAA 3CG7A 3HPGA 1HYVA 2NRZA 2Y1IA 3OYCA 1LV5A 3BF3A 2O8CB 4IBNA 2EHGA 1HLUA 2P9UA 5DM6L 4BC4A 4KHUA 3UKUB 3L3UA 2ZF5O 3C65A 4E1MA 2F96A 3SZ2A 1GLCG 5FRMA 1CZAN 3SV3A 3NAEA 1RILA 5J2MA 3J7YP 4A57A 4CFAA 1IKVA 2YJEA 3CMEN 4FM2A 3F2KA 4BRPA 4Z4IA 5ADXA 4FJLA 1V4SA 1QE1A 4CF8A 5AQGA 4FOEA 1S6PA 2QXLA 3GBTA 3RVCA 4YFUA 2GUPA 3BEXA 4HUGA 4JKCA 2PZSA 1CLQA 3BY5A 2ETJA 4C8NA 4JV5K 1T05A 1VRUA 1HQEA 3OBYA 1BOTO 1QQNA 4E19A 4E0DA 2NLXA 3O4QA 5LMUK 3KK7A 4FWKA 3RRHA 2O8CA 3KWGA 4CERA 3UKUA 2P51A 4CZMA 1XHXA 2H3GX 2F8SA 4N76A 1ASUA 4KPYA 1HKCA 2PYJA 5CE3A 5EX5A 3EKSA 1NGDA 2QWRA 5AQIA 2Q97A 3AVIA 4IG0A 3AVBA 4L3QA 4LF9K 4B9UA 3RR7A 1D5AA 4MLHA 3T1AA 1JLAA 2KFNA 4YOTA 4DV5K 3MX5A 1Z26A 1KTQA 1LWEA 4JN4A 2HHWA 1QS4A 2D0OA 5DM7L 4EAHD 3KK2A 3O9QA 1SQKA 4BR5A 1RT7A 1J53A 4JS5A 1VQNN 4HUEA 1IH7A 4BE2A 2A1RA 3U9ZA 3MMVA 4KTQA 1NJWA 3K2PA 3T69A 3DRSA 4IOAL 3WUHA 5FDLA 1VSFA 4I6MB 3FZHA 2NNWA 3VQPA 4LH5A 4OLBA 4DUZK 1ATSA 2GEMA 3AAPA 3BZKA 1NGCA 1HPMA 2VYPA 3OY9A 1C1BA 3UIQA 2YHYA 4CZHA 4LFAK 4O44A 4DF4A 4OKKA 3K58A 4YOYA 1S1VA 1Z25A 5CR4A 1BQNA 4CD3A 1QVFM 2QWMA 4H5RA 4JKEA 4PKHA 1JLQA 4FLVA 4DTXA 3QIPA 3M1FA 4LFCK 3WNGA 3CFPA 1NKCA 2OPRA 4BQLA 1RBVA 4CK1A 3AARA 5D3GA 3VGKA 3ZT0A 2Y1JA 1TAQA 3AO2A 3OS1A 2A40A 2ASOA 2D1KA 2FBVA 3PX0A 3AY9A 4IEEA 4KHQA 3CCMN 1K73O 3SUOA 3OYNA 3M8PA 3J8AA 3SQ4A 3DLRA 5C0YA 4IFVA 3AVFA 1ZBSA 1L3UA 3E1YA 3PLAA 5GIOA 2D4WA 3C94A 3UE5A 5AQUA 4FYDA 2GBZA 3N4QA 1QQOA 4JI7K 4KI6A 3A0IX 2PBDA 2E2PA 3AO4A 2B4JA 4RG8A 3NCIA 4DTMA 1U2VA 3CCEN 4FZXC 1QHTA 3OYHA 4N5SA 4AHRA 1JLGA 1CZBA 1QQMA 5C12A 2W6KA 1DLOA 1W2BM 2CGKA 4B9MA 3NF6A 4BC3A 2P5OA 3JAMO 3ID6A 3DOLA 2XY6A 4E7JA 3LL3A 3VGLA 4K43A 4JKAA 1JLEA 3PO4A 4CIFA 3DYAA 1B9FA 1QSLA 5JLHA 4FK4A 3LM9A 2HF3A 2IVNA 3D7EO 4ZTFA 1HNZK 3K5OA 2YNGA 1NM1A 3G4SN 4Y1DA 3SI6A 4H5VA 3A5OC 1WOQA 1X9SA 1VSLA 2OANA 4ISEA 4CBXA 1GLDG 4N41A 3WQUA 1DGKN 1KC8O 4CZFA 4JD2B 1E4GT 1KXPA 2PYLA 3ENOA 2OYQA 4FZZA 1U45A 1KSPA 2HMIA 4M7XA 4CGFA 1GLLO 4DFJA 3QEIA 4OPAA 4I9LA 3THYA 4BWJA 3HOSA 1JCFA 1NJIO 2YCHA 4RTFD 4YDUC 3TAFA 3AVJA 1EXQA 4MFBA 1KCFA 3HI0A 4H4OA 1C0GA 3KD1E 4KB0A 2VGNA 3VQ6A 4RW4A 1KFSA 4JK9A 2DFFA 3OHRA 3ENBA 1VSJA 1A5XA 1Q18A 4MO5A 4B08A 3DLLL 3PX6A 3A5NC 5M1QA 1VAZA 2NRRA 2YV0X 5BN9A 4BR7A 2KKZA 2X6NA 3HP9A 3O9UA 5BREA 4LFBK 3T1YK 4B3RK 5K14A 2O8FA 1C0FA 1KAZA 1VQON 3ZSOA 1WSFA 4JD2A 3SQ1A 1CXQA 4FWOA 4CZJA 3K59A 2QKBA 3KIOA 4IZ9A 4CEEA 4B8AB 4CZGA 5AQKA 4DV1K 4K8XA 4BR4A 2CH6A 3K9KA 4H0XB 1S1XA 5SZTA 3VPZA 3TSQA 3C7NA 4JKHA 5C10A 4RWTA 4M3TA 4MDAA 5AQOA 1GOCA 4H5WA 3TANA 1VQMN 3R6MA 3P4IA 2JGUA 4IJAA 5AJ3K 3OW2M 4ID5A 3CFOA 3U4LA 4CEDA 3IDHA 2IC3A 5BR8K 3R3LA 4OLAA 1NMNA 4H0PA 4F2SA 1WSGA 4M45A 3GG4A 1W0HA 1NOZA 4C8MA 4DQ8A 1HKGA 2ITGA 1RT4A 1RCHA 2HNYA 5LJWA 3WQTA 4BG9A 1VSIA 3CCUN 5HRSA 3QLHA 1K9MO
chains in the Genus database with same CATH topology
3HL8A 5HROA 5HRPA 3MEGA 1B92A 3E01A 2YNFA 3AVMA 4CEAA 3AO1A 1C0TA 1T03A 3THVA 4Z4FA 3OS0A 2G8KA 2R7YA 1TL1A 5CYMA 4LD0A 2W42A 1ZYQA 4HCBA 3SUNA 4FJMA 4Z4GA 4B9NA 2E6LA 1TVRA 4IG3A 4CF0A 4CK3A 3TAGA 1U4BA 1SKWA 4FJJA 4PY5A 4CFCA 3HXMA 3S3MA 4I7FA 1CXUA 3KLHA 4KV8A 4KTWA 5CZ2A 3B6OA 2E4LA 4ELUA 1GOAA 4GMJB 1J54A 2FBYA 4G1QA 4DTJA 3V81A 3LAMA 4N56A 1TK5A 1D9FA 4CGDA 5J1EA 1JXEA 1C0MA 3K57A 3SNNA 2P5GA 4KO0A 2YNHA 4CGJA 1ZBFA 3CM6A 1NJZA 4M3RA 1JLFA 1SL1A 1WSIA 4B3OA 1CZ9A 4DTSA 5E41A 4AHUA 4EP5A 3VN5A 1HRHA 1UAXA 2VWJA 3RR8A 2BANA 1HNVA 4DSJA 3IS9A 3TAMA 3QNNA 1D8YA 3P1GA 4DTOA 2HHXA 4J2DA 1LWFA 1NKEA 4H8KA 3QNOA 1U47A 2G8WA 3LZIA 3L8BA 4L8RB 3NFAA 4M41A 3VQEA 2HB5A 2VG7A 3RMAA 5HRNA 3QIOA 3D0PA 1S1TA 1ZBHA 1Y97A 4DU3A 1BHLA 4GW6A 3ZT4A 1FXXA 4CJFA 1TL3A 3KKRA 2XHBA 4AHTA 1DTQA 4CHQA 1XHZA 2QXFA 3OYMA 3AVLA 1KFDA 2KTQA 4HVJA 3LP3A 3QESA 1RDAA 5J2QA 2Z1HA 1XWLA 2X78A 1S9GA 2GV9A 4CHPA 4FCYA 2ZE2A 4PWDA 4BDPA 1QQCA 4BDYA 2IOCA 1L5UA 4ZHRA 4I2PA 4DTNA 4DFMA 3H08A 1S5JA 5HBMA 2G8FA 1C1CA 3CG7A 2KW4A 3LALA 4CGIA 5FRNA 3HPGA 4ID1A 4B8CA 4CESA 1WSJA 4HHTA 1HYVA 3OS2A 3F9KA 1N5YA 2Y1IA 1RTIA 1C0UA 4CFDA 3WNEA 3OYCA 1LV5A 1T7PA 1BCOA 4IBNA 1Q8IA 2EHGA 4AILC 3M8SA 4O0JA 3TR8A 3EZ5A 2P1JA 4CIGA 4KHUA 3M8RA 3EYZA 3I0SA 1KVCA 4CJPA 3L3UA 3ZSQA 4IKFA 4M3ZA 1JL2A 2JLEA 3I8DA 3PO5A 3HM9A 3FFIA 2F8TA 4E1MA 3LAKA 2F96A 3L2WA 3SZ2A 1TAUA 1W9HA 3U3YA 5FRMA 3S3NA 5KTQA 3AVGA 3SV3A 3MECA 3NGZA 3JSMA 1EX4A 3NAEA 4M3WA 1RILA 5J2MA 4DU4A 3DMJA 1A5WA 3ZT2A 3HPHA 4CFAA 4CIEA 1IKVA 4IFYA 3ULDA 1LAWA 4PQUA 3TAQA 4W5OA 4FM2A 3DLGA 2OZMA 4Z4IA 5C25A 2HHVA 4FJLA 4AHSA 2HW3A 4FJXA 1EKEA 3TABA 3TARA 4F3TA 2RKIA 1LW2A 1QE1A 4CF8A 3T3FA 4DSFA 1S6PA 5HRRA 4FLXA 2O4IA 2YKMA 3VQBA 4YFUA 5KRTA 3LANA 3AV9A 3AVAA 4HUGA 1U49A 2PZSA 1CLQA 4DS5A 2ETJA 3A2FA 4C8NA 1T05A 1VRUA 3MXIA 5I42A 4DSLA 2HVHA 1RBRA 3HSTB 1HQEA 3LZJA 2QK9A 4E19A 4KAZA 4E0DA 1JKHA 4BACA 3KTQA 4NCAA 4KREA 4FJGA 4O5BA 3ZSRA 2HHTA 3O4QA 4LSLA 1EETA 3SYZA 3RRHA 3NH1A 1FK9A 2VG5A 3DI6A 3SCXA 1RDCA 1FKOA 1VSEA 1WNSA 4CERA 2D0CA 1U48A 2WONA 4Q0BA 1RT6A 2P51A 1XHXA 3DLEA 1Q9XA 4N76A 4C8OA 3OYJA 2F8SA 2YKNA 1ASUA 4KPYA 4CCHA 3V1OA 2PYJA 3V4IA 5KRSA 4M3UA 3KK1A 1EP4A 4NCGA 2BDPA 4CJUA 3IG1A 3ZSZA 3IAYA 4Z4HA 4BE1A 4CJ4A 1VSHA 3AVIA 4F3OA 4M3YA 1RTJA 4IG0A 3AVBA 4DU1A 4Z0UA 3U6FA 4B9UA 4CHZA 3OYIA 4DQPA 3RR7A 4CF2A 3P5JA 1D5AA 4Z4CA 4DQQA 3T1AA 2IGIA 1NK9A 1JLAA 4CJTA 3DLBA 4QCLA 2KFNA 3OJUA 4KHWA 3V9UA 1LWCA 4DF8A 3AA3A 4FLTA 1Z26A 4KHYA 1KTQA 1LWEA 3K5LA 3NF8A 2HHWA 3VQ4A 1DTTA 3VQ9A 1LAVA 1QS4A 1S1WA 3VA0A 4OGEA 1NK0A 4DQSA 2ZQBA 4JLHA 3VQ8A 3KK2A 4FW2A 2YNIA 4XIUA 3SQ2A 3KD5E 2HHQA 1RT7A 3SQ0A 4UQGA 3RMDA 1J53A 4JS5A 3NH0A 2D5RA 3ALYA 4E1NA 3OYBA 3MXJA 4FXDA 4KI4A 4CJ3A 4HUEA 3MXMA 1IH7A 2FBTA 4BE2A 2A1RA 3VQDA 4CJWA 4DSIA 1WAJA 4FW1A 3BGRA 4IDKA 3O3FA 4DFPA 1NJWA 1LW0A 3K2PA 3U3GA 4KTQA 3QEWA 4RW7A 4DFKA 1N6QA 3DRSA 4JRQA 2A1SA 2OZSA 2HNZA 4RW6A 2GUIA 1ASWA 1I39A 1TKZA 5FDLA 1VSFA 3KKSA 1GOBA 4CGHA 3VQPA 3LDSA 1WLJA 2OPSA 4LH5A 5DMRA 3V9ZA 1BL3A 4OLBA 2B6AA 4DMNA 3HT3A 4CEQA 4CJLA 1KLMA 4CJRA 3C95A 4CHYA 4DTPA 4OPKA 2IS3A 4CF9A 1RDDA 4CJSA 1UWBA 3V9XA 4DQIA 3O3HA 4J2BA 1IO2A 1RNHA 1C1BA 3OY9A 5HLFA 1R0AA 4ELVA 3IRXA 3UIQA 3PY8A 1ZBIA 3ZT3A 1L3VA 3HP6A 3HVRA 3LPTA 1ASVA 4DS4A 4O44A 4DF4A 4OKKA 2XO7A 1C1AA 3K58A 2AJQA 1IKYA 1S1VA 4BE0A 4E7HA 1IG9A 4E3SA 2IDOA 1Z25A 3ZSWA 4CJ5A 1SKRA 1BQNA 3QERA 1BI4B 2G8UA 4C8LA 3KLIA 4NYFA 4B9SA 4KRFA 1SL0A 1JXBA 4EZ6A 3AVKA 4KFBA 1XC9A 3ZCMA 2NUBA 1VSMA 3K5NA 1JLQA 4FLVA 4DTXA 3VQQA 3QIPA 1VK0A 4OPJA 4WE1A 3OYGA 3V9WA 3WNGA 3CFPA 2FBXA 1NKCA 1HYSA 4NCBA 4CF1A 3F73A 1JLCA 2OPRA 2XRIA 3AVCA 1TKTA 1RBVA 3NHGA 4CK1A 4F2RA 4Q5VA 1FKPA 4BDZA 1Q9YA 5EU7A 3DOKA 5FROA 1KLNA 3RTVA 1J9AA 4OKJA 4OGCA 3ZT0A 2Y1JA 2E6MA 4O0IA 1TAQA 3AVHA 4HUFA 5CY4A 3AO2A 3OYFA 1TK0A 1RT5A 3OS1A 2KZMA 1TKXA 2HHSA 3L3VA 2FBVA 3PX0A 4DSKA 4KHQA 1BISA 3LWMA 5T7BA 3OYNA 3SUOA 3AO3A 3M8PA 1NK4A 3LWLA 3ASMA 1S9EA 2VG6A 3DLRA 4JRPA 3SQ4A 4ELTA 1T8EA 1IKXA 1S6QA 4IFVA 3AVFA 3OYEA 4HTUA 4JS4A 3QEPA 1L3UA 1NOYA 2DTUA 3QINA 1WN7A 3C94A 4DG1A 4FYDA 2GBZA 2RF2A 3OJSA 2WOMA 3S3OA 2G8HA 1UA0A 2QKKA 4EZ9A 1D9DA 4CK2A 4FM1A 1NK7A 1UA1A 1SL2A 4KI6A 3HJFA 3AO4A 4CEBA 4KHNA 1ITGA 4PA1A 4FJ8A 3NGIA 2B4JA 4H4MA 4RG8A 3NCIA 4CJQA 4DTMA 4KB1A 4CEOA 2XY5A 3MAQA 4FM0A 4C8KA 4RW9A 3L2RA 1QHTA 4FZXC 4W5NA 3ZSVA 3OYHA 1BI4A 5C24A 3VQAA 3JYTA 4N5SA 1X9WA 4AHRA 1TK8A 2PY5A 1BQMA 1JLGA 4TSXA 1CZBA 4CJEA 4FJ7A 3LP1A 1XI1A 1X1PA 1HMVA 4CEZA 4B9LA 3ZSYA 4CHOA 1BIUA 3V6DA 4M3XA 1DLOA 4O55A 4LY7A 3BDPA 2X6SA 3D45A 3DLKA 3MEDA 4KTZA 4CEFA 3OYAA 4FJ5A 2I5JA 2Z1JA 1HPZA 5KI6A 4B9MA 1YT3A 3NF6A 3PX4A 2P5OA 4HCCA 3DOLA 2OPQA 3TAPA 1IKWA 1A5VA 4O4GA 3HO1A 3AO5A 4FLUA 1WSEA 3KLFA 4E7JA 3QEXA 2XY6A 4OJRA 4I2QA 1RT1A 4CJKA 3PUFA 1JLEA 3S9HA 1VSKA 2ATQA 3OYKA 4CHNA 4DLGA 4CIFA 2LSNA 3PO4A 5DK5A 2KFZA 3DYAA 1YTAA 1B9FA 1QSLA 4J2EA 1RBUA 1UOCA 3ITHA 3C6UA 4CJVA 1SKSA 4KHSA 4FK4A 1KVBA 2IAJA 5JS2A 1VSDA 4ZTFA 1RTHA 3V1RA 3K5OA 2YNGA 4Y1DA 3SI6A 3QETA 2KZZA 4AHVA 4FJHA 3NE6A 3NF7A 4CE9A 1REVA 1X9SA 2D0AA 4DLEA 3ZT1A 3RRGA 1VSLA 4DWIA 1F21A 4MQ3A 1I3AA 3O3GA 3KK3A 3RWUA 2HHUA 1QSSA 3HVTA 4QAGA 2DY4A 4FK0A 4AH9A 3K5MA 4N41A 2G8IA 2XY7A 4QOZB 1BGXT 4DQRA 2HNDA 4RW8A 3EY1A 2X74A 4CGGA 2HVIA 3WNFA 1NK8A 1U04A 3RMBA 2PYLA 1K6YA 3M8QA 1RT3A 4DTUA 1L3TA 3MEEA 2OYQA 4F4KA 3SUPA 1QSYA 3L2QA 1U45A 1KSPA 4FK2A 2DFEA 4FZZA 4FZYA 1TKDA 2HMIA 2KQ2A 4GVMA 4CGFA 1RBSA 4DFJA 3QEIA 2OA8A 4I9LA 4OVLA 1C6VA 4FLWA 4LH4A 4BWJA 3SUQA 3KLGA 3TWHA 1HYZA 4E7IA 1ZBUA 2VWKA 3SPYA 3CYMA 2B5JA 3P83D 2FC0A 1TGOA 2BE2A 3I0RA 3ZSXA 3VA3A 3HK2A 3AA4A 3TAFA 3AVJA 1EXQA 1YVUA 3NBPA 1JLBA 4MFBA 5SWMA 1KCFA 4H4OA 3RMCA 3DLHA 1SV5A 3C6TA 4KKOA 4AHCA 3KD1E 4KB0A 3PV8A 1HJRA 2OPPA 1WAFA 3HYFA 3VQ6A 4RW4A 4YNQA 1X9MA 4E7LA 1KFSA 4FJIA 1RT2A 2DFFA 1NKBA 4I9QA 4FJNA 5KGXA 1VSJA 1KRPA 3CFRA 1A5XA 4DSEA 2Q3SA 3NF9A 5I3UA 3PX6A 4B08A 1QTMA 4W5RA 5HRSA 1JL1A 3B6PA 3QEVA 3DRPA 2YHBA 5CZ1A 1G15A 2YV0X 3AA5X 3L2VA 4N47A 1ZBLA 4EP4A 4Y1CA 3ISNC 1YTUA 2X6NA 3HP9A 5KGWA 3O4NA 3V9SA 2D0BA 4FJKA 4ZTJA 4PUOA 2DFHA 3VQ7A 3VQCA 5K14A 3SJJA 3CM5A 3CQ8A 4FLZA 3ZSOA 1WSFA 3SQ1A 3DRRA 1TV6A 1CXQA 3K59A 2QKBA 1RBTA 1RDBA 1WSHA 3KIOA 4CEEA 4B8AB 5CYQA 3OYDA 3SPZA 4K8XA 1MU2A 5C42A 3NH2A 3KLEA 3G0ZA 4FLYA 1NK5A 1NJYA 3LP0A 3T19A 1S1XA 4NYNA 1NJXA 5SZTA 3LP2A 4K8ZA 4F8RA 1L3SA 3SV4A 4E7KA 4M3TA 4FJ9A 1GOCA 3L2UA 3QO9A 2BGGA 3TANA 1BIZA 1O1WA 4B9VA 3DM2A 2G8VA 2JGUA 2YHAA 1BCMA 2XY8A 3TI0A 4M42A 2Z1IA 3OVNA 3CFOA 3NGYA 4ID5A 2ZD1A 5D3GA 2EX3A 3AVNA 4OKEA 2IC3A 4CEDA 3OYLA 2O4GA 5J2PA 1B9DA 4OLAA 2RN2A 4R5PA 3TAEA 4F2SA 1WSGA 3HPOA 4M45A 4B9TA 1HQUA 4CECA 2RPIA 4FVMA 3WNHA 5JS1A 1W0HA 4LSNA 1NOZA 2Z1GA 3LPUA 4C8MA 3VQ5A 3KJVA 2ITGA 4DTRA 1RT4A 1RTDA 1S1UA 5J2NA 3NDKA 1RCHA 4W5TA 2HNYA 1HNIA 1SUQA 3AA2A 4Z4EA 4ICLA 4E89A 1VSIA 1NK6A 4BWMA 1VRTA 1J5OA 4W5QA 4CFBA 3QLHA 5HP1A 3G10A 3V1QA 1KVAA 4J2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL8 A;  5HRO A;  5HRP A;  3MEG A;  1B92 A;  3E01 A;  2YNF A;  3AVM A;  4CEA A;  3AO1 A;  1C0T A;  1T03 A;  3THV A;  4Z4F A;  3OS0 A;  2G8K A;  2R7Y A;  1TL1 A;  5CYM A;  4LD0 A;  2W42 A;  1ZYQ A;  4HCB A;  3SUN A;  4FJM A;  4Z4G A;  4B9N A;  2E6L A;  1TVR A;  4IG3 A;  4CF0 A;  4CK3 A;  3TAG A;  1U4B A;  1SKW A;  4FJJ A;  4PY5 A;  4CFC A;  3HXM A;  3S3M A;  4I7F A;  1CXU A;  3KLH A;  4KV8 A;  4KTW A;  5CZ2 A;  3B6O A;  2E4L A;  4ELU A;  1GOA A;  4GMJ B;  1J54 A;  2FBY A;  4G1Q A;  4DTJ A;  3V81 A;  3LAM A;  4N56 A;  1TK5 A;  1D9F A;  4CGD A;  5J1E A;  1JXE A;  1C0M A;  3K57 A;  3SNN A;  2P5G A;  4KO0 A;  2YNH A;  4CGJ A;  1ZBF A;  3CM6 A;  1NJZ A;  4M3R A;  1JLF A;  1SL1 A;  1WSI A;  4B3O A;  1CZ9 A;  4DTS A;  5E41 A;  4AHU A;  4EP5 A;  3VN5 A;  1HRH A;  1UAX A;  2VWJ A;  3RR8 A;  2BAN A;  1HNV A;  4DSJ A;  3IS9 A;  3TAM A;  3QNN A;  1D8Y A;  3P1G A;  4DTO A;  2HHX A;  4J2D A;  1LWF A;  1NKE A;  4H8K A;  3QNO A;  1U47 A;  2G8W A;  3LZI A;  3L8B A;  4L8R B;  3NFA A;  4M41 A;  3VQE A;  2HB5 A;  2VG7 A;  3RMA A;  5HRN A;  3QIO A;  3D0P A;  1S1T A;  1ZBH A;  1Y97 A;  4DU3 A;  1BHL A;  4GW6 A;  3ZT4 A;  1FXX A;  4CJF A;  1TL3 A;  3KKR A;  2XHB A;  4AHT A;  1DTQ A;  4CHQ A;  1XHZ A;  2QXF A;  3OYM A;  3AVL A;  1KFD A;  2KTQ A;  4HVJ A;  3LP3 A;  3QES A;  1RDA A;  5J2Q A;  2Z1H A;  1XWL A;  2X78 A;  1S9G A;  2GV9 A;  4CHP A;  4FCY A;  2ZE2 A;  4PWD A;  4BDP A;  1QQC A;  4BDY A;  2IOC A;  1L5U A;  4ZHR A;  4I2P A;  4DTN A;  4DFM A;  3H08 A;  1S5J A;  5HBM A;  2G8F A;  1C1C A;  3CG7 A;  2KW4 A;  3LAL A;  4CGI A;  5FRN A;  3HPG A;  4ID1 A;  4B8C A;  4CES A;  1WSJ A;  4HHT A;  1HYV A;  3OS2 A;  3F9K A;  1N5Y A;  2Y1I A;  1RTI A;  1C0U A;  4CFD A;  3WNE A;  3OYC A;  1LV5 A;  1T7P A;  1BCO A;  4IBN A;  1Q8I A;  2EHG A;  4AIL C;  3M8S A;  4O0J A;  3TR8 A;  3EZ5 A;  2P1J A;  4CIG A;  4KHU A;  3M8R A;  3EYZ A;  3I0S A;  1KVC A;  4CJP A;  3L3U A;  3ZSQ A;  4IKF A;  4M3Z A;  1JL2 A;  2JLE A;  3I8D A;  3PO5 A;  3HM9 A;  3FFI A;  2F8T A;  4E1M A;  3LAK A;  2F96 A;  3L2W A;  3SZ2 A;  1TAU A;  1W9H A;  3U3Y A;  5FRM A;  3S3N A;  5KTQ A;  3AVG A;  3SV3 A;  3MEC A;  3NGZ A;  3JSM A;  1EX4 A;  3NAE A;  4M3W A;  1RIL A;  5J2M A;  4DU4 A;  3DMJ A;  1A5W A;  3ZT2 A;  3HPH A;  4CFA A;  4CIE A;  1IKV A;  4IFY A;  3ULD A;  1LAW A;  4PQU A;  3TAQ A;  4W5O A;  4FM2 A;  3DLG A;  2OZM A;  4Z4I A;  5C25 A;  2HHV A;  4FJL A;  4AHS A;  2HW3 A;  4FJX A;  1EKE A;  3TAB A;  3TAR A;  4F3T A;  2RKI A;  1LW2 A;  1QE1 A;  4CF8 A;  3T3F A;  4DSF A;  1S6P A;  5HRR A;  4FLX A;  2O4I A;  2YKM A;  3VQB A;  4YFU A;  5KRT A;  3LAN A;  3AV9 A;  3AVA A;  4HUG A;  1U49 A;  2PZS A;  1CLQ A;  4DS5 A;  2ETJ A;  3A2F A;  4C8N A;  1T05 A;  1VRU A;  3MXI A;  5I42 A;  4DSL A;  2HVH A;  1RBR A;  3HST B;  1HQE A;  3LZJ A;  2QK9 A;  4E19 A;  4KAZ A;  4E0D A;  1JKH A;  4BAC A;  3KTQ A;  4NCA A;  4KRE A;  4FJG A;  4O5B A;  3ZSR A;  2HHT A;  3O4Q A;  4LSL A;  1EET A;  3SYZ A;  3RRH A;  3NH1 A;  1FK9 A;  2VG5 A;  3DI6 A;  3SCX A;  1RDC A;  1FKO A;  1VSE A;  1WNS A;  4CER A;  2D0C A;  1U48 A;  2WON A;  4Q0B A;  1RT6 A;  2P51 A;  1XHX A;  3DLE A;  1Q9X A;  4N76 A;  4C8O A;  3OYJ A;  2F8S A;  2YKN A;  1ASU A;  4KPY A;  4CCH A;  3V1O A;  2PYJ A;  3V4I A;  5KRS A;  4M3U A;  3KK1 A;  1EP4 A;  4NCG A;  2BDP A;  4CJU A;  3IG1 A;  3ZSZ A;  3IAY A;  4Z4H A;  4BE1 A;  4CJ4 A;  1VSH A;  3AVI A;  4F3O A;  4M3Y A;  1RTJ A;  4IG0 A;  3AVB A;  4DU1 A;  4Z0U A;  3U6F A;  4B9U A;  4CHZ A;  3OYI A;  4DQP A;  3RR7 A;  4CF2 A;  3P5J A;  1D5A A;  4Z4C A;  4DQQ A;  3T1A A;  2IGI A;  1NK9 A;  1JLA A;  4CJT A;  3DLB A;  4QCL A;  2KFN A;  3OJU A;  4KHW A;  3V9U A;  1LWC A;  4DF8 A;  3AA3 A;  4FLT A;  1Z26 A;  4KHY A;  1KTQ A;  1LWE A;  3K5L A;  3NF8 A;  2HHW A;  3VQ4 A;  1DTT A;  3VQ9 A;  1LAV A;  1QS4 A;  1S1W A;  3VA0 A;  4OGE A;  1NK0 A;  4DQS A;  2ZQB A;  4JLH A;  3VQ8 A;  3KK2 A;  4FW2 A;  2YNI A;  4XIU A;  3SQ2 A;  3KD5 E;  2HHQ A;  1RT7 A;  3SQ0 A;  4UQG A;  3RMD A;  1J53 A;  4JS5 A;  3NH0 A;  2D5R A;  3ALY A;  4E1N A;  3OYB A;  3MXJ A;  4FXD A;  4KI4 A;  4CJ3 A;  4HUE A;  3MXM A;  1IH7 A;  2FBT A;  4BE2 A;  2A1R A;  3VQD A;  4CJW A;  4DSI A;  1WAJ A;  4FW1 A;  3BGR A;  4IDK A;  3O3F A;  4DFP A;  1NJW A;  1LW0 A;  3K2P A;  3U3G A;  4KTQ A;  3QEW A;  4RW7 A;  4DFK A;  1N6Q A;  3DRS A;  4JRQ A;  2A1S A;  2OZS A;  2HNZ A;  4RW6 A;  2GUI A;  1ASW A;  1I39 A;  1TKZ A;  5FDL A;  1VSF A;  3KKS A;  1GOB A;  4CGH A;  3VQP A;  3LDS A;  1WLJ A;  2OPS A;  4LH5 A;  5DMR A;  3V9Z A;  1BL3 A;  4OLB A;  2B6A A;  4DMN A;  3HT3 A;  4CEQ A;  4CJL A;  1KLM A;  4CJR A;  3C95 A;  4CHY A;  4DTP A;  4OPK A;  2IS3 A;  4CF9 A;  1RDD A;  4CJS A;  1UWB A;  3V9X A;  4DQI A;  3O3H A;  4J2B A;  1IO2 A;  1RNH A;  1C1B A;  3OY9 A;  5HLF A;  1R0A A;  4ELV A;  3IRX A;  3UIQ A;  3PY8 A;  1ZBI A;  3ZT3 A;  1L3V A;  3HP6 A;  3HVR A;  3LPT A;  1ASV A;  4DS4 A;  4O44 A;  4DF4 A;  4OKK A;  2XO7 A;  1C1A A;  3K58 A;  2AJQ A;  1IKY A;  1S1V A;  4BE0 A;  4E7H A;  1IG9 A;  4E3S A;  2IDO A;  1Z25 A;  3ZSW A;  4CJ5 A;  1SKR A;  1BQN A;  3QER A;  1BI4 B;  2G8U A;  4C8L A;  3KLI A;  4NYF A;  4B9S A;  4KRF A;  1SL0 A;  1JXB A;  4EZ6 A;  3AVK A;  4KFB A;  1XC9 A;  3ZCM A;  2NUB A;  1VSM A;  3K5N A;  1JLQ A;  4FLV A;  4DTX A;  3VQQ A;  3QIP A;  1VK0 A;  4OPJ A;  4WE1 A;  3OYG A;  3V9W A;  3WNG A;  3CFP A;  2FBX A;  1NKC A;  1HYS A;  4NCB A;  4CF1 A;  3F73 A;  1JLC A;  2OPR A;  2XRI A;  3AVC A;  1TKT A;  1RBV A;  3NHG A;  4CK1 A;  4F2R A;  4Q5V A;  1FKP A;  4BDZ A;  1Q9Y A;  5EU7 A;  3DOK A;  5FRO A;  1KLN A;  3RTV A;  1J9A A;  4OKJ A;  4OGC A;  3ZT0 A;  2Y1J A;  2E6M A;  4O0I A;  1TAQ A;  3AVH A;  4HUF A;  5CY4 A;  3AO2 A;  3OYF A;  1TK0 A;  1RT5 A;  3OS1 A;  2KZM A;  1TKX A;  2HHS A;  3L3V A;  2FBV A;  3PX0 A;  4DSK A;  4KHQ A;  1BIS A;  3LWM A;  5T7B A;  3OYN A;  3SUO A;  3AO3 A;  3M8P A;  1NK4 A;  3LWL A;  3ASM A;  1S9E A;  2VG6 A;  3DLR A;  4JRP A;  3SQ4 A;  4ELT A;  1T8E A;  1IKX A;  1S6Q A;  4IFV A;  3AVF A;  3OYE A;  4HTU A;  4JS4 A;  3QEP A;  1L3U A;  1NOY A;  2DTU A;  3QIN A;  1WN7 A;  3C94 A;  4DG1 A;  4FYD A;  2GBZ A;  2RF2 A;  3OJS A;  2WOM A;  3S3O A;  2G8H A;  1UA0 A;  2QKK A;  4EZ9 A;  1D9D A;  4CK2 A;  4FM1 A;  1NK7 A;  1UA1 A;  1SL2 A;  4KI6 A;  3HJF A;  3AO4 A;  4CEB A;  4KHN A;  1ITG A;  4PA1 A;  4FJ8 A;  3NGI A;  2B4J A;  4H4M A;  4RG8 A;  3NCI A;  4CJQ A;  4DTM A;  4KB1 A;  4CEO A;  2XY5 A;  3MAQ A;  4FM0 A;  4C8K A;  4RW9 A;  3L2R A;  1QHT A;  4FZX C;  4W5N A;  3ZSV A;  3OYH A;  1BI4 A;  5C24 A;  3VQA A;  3JYT A;  4N5S A;  1X9W A;  4AHR A;  1TK8 A;  2PY5 A;  1BQM A;  1JLG A;  4TSX A;  1CZB A;  4CJE A;  4FJ7 A;  3LP1 A;  1XI1 A;  1X1P A;  1HMV A;  4CEZ A;  4B9L A;  3ZSY A;  4CHO A;  1BIU A;  3V6D A;  4M3X A;  1DLO A;  4O55 A;  4LY7 A;  3BDP A;  2X6S A;  3D45 A;  3DLK A;  3MED A;  4KTZ A;  4CEF A;  3OYA A;  4FJ5 A;  2I5J A;  2Z1J A;  1HPZ A;  5KI6 A;  4B9M A;  1YT3 A;  3NF6 A;  3PX4 A;  2P5O A;  4HCC A;  3DOL A;  2OPQ A;  3TAP A;  1IKW A;  1A5V A;  4O4G A;  3HO1 A;  3AO5 A;  4FLU A;  1WSE A;  3KLF A;  4E7J A;  3QEX A;  2XY6 A;  4OJR A;  4I2Q A;  1RT1 A;  4CJK A;  3PUF A;  1JLE A;  3S9H A;  1VSK A;  2ATQ A;  3OYK A;  4CHN A;  4DLG A;  4CIF A;  2LSN A;  3PO4 A;  5DK5 A;  2KFZ A;  3DYA A;  1YTA A;  1B9F A;  1QSL A;  4J2E A;  1RBU A;  1UOC A;  3ITH A;  3C6U A;  4CJV A;  1SKS A;  4KHS A;  4FK4 A;  1KVB A;  2IAJ A;  5JS2 A;  1VSD A;  4ZTF A;  1RTH A;  3V1R A;  3K5O A;  2YNG A;  4Y1D A;  3SI6 A;  3QET A;  2KZZ A;  4AHV A;  4FJH A;  3NE6 A;  3NF7 A;  4CE9 A;  1REV A;  1X9S A;  2D0A A;  4DLE A;  3ZT1 A;  3RRG A;  1VSL A;  4DWI A;  1F21 A;  4MQ3 A;  1I3A A;  3O3G A;  3KK3 A;  3RWU A;  2HHU A;  1QSS A;  3HVT A;  4QAG A;  2DY4 A;  4FK0 A;  4AH9 A;  3K5M A;  4N41 A;  2G8I A;  2XY7 A;  4QOZ B;  1BGX T;  4DQR A;  2HND A;  4RW8 A;  3EY1 A;  2X74 A;  4CGG A;  2HVI A;  3WNF A;  1NK8 A;  1U04 A;  3RMB A;  2PYL A;  1K6Y A;  3M8Q A;  1RT3 A;  4DTU A;  1L3T A;  3MEE A;  2OYQ A;  4F4K A;  3SUP A;  1QSY A;  3L2Q A;  1U45 A;  1KSP A;  4FK2 A;  2DFE A;  4FZZ A;  4FZY A;  1TKD A;  2HMI A;  2KQ2 A;  4GVM A;  4CGF A;  1RBS A;  4DFJ A;  3QEI A;  2OA8 A;  4I9L A;  4OVL A;  1C6V A;  4FLW A;  4LH4 A;  4BWJ A;  3SUQ A;  3KLG A;  3TWH A;  1HYZ A;  4E7I A;  1ZBU A;  2VWK A;  3SPY A;  3CYM A;  2B5J A;  3P83 D;  2FC0 A;  1TGO A;  2BE2 A;  3I0R A;  3ZSX A;  3VA3 A;  3HK2 A;  3AA4 A;  3TAF A;  3AVJ A;  1EXQ A;  1YVU A;  3NBP A;  1JLB A;  4MFB A;  5SWM A;  1KCF A;  4H4O A;  3RMC A;  3DLH A;  1SV5 A;  3C6T A;  4KKO A;  4AHC A;  3KD1 E;  4KB0 A;  3PV8 A;  1HJR A;  2OPP A;  1WAF A;  3HYF A;  3VQ6 A;  4RW4 A;  4YNQ A;  1X9M A;  4E7L A;  1KFS A;  4FJI A;  1RT2 A;  2DFF A;  1NKB A;  4I9Q A;  4FJN A;  5KGX A;  1VSJ A;  1KRP A;  3CFR A;  1A5X A;  4DSE A;  2Q3S A;  3NF9 A;  5I3U A;  3PX6 A;  4B08 A;  1QTM A;  4W5R A;  5HRS A;  1JL1 A;  3B6P A;  3QEV A;  3DRP A;  2YHB A;  5CZ1 A;  1G15 A;  2YV0 X;  3AA5 X;  3L2V A;  4N47 A;  1ZBL A;  4EP4 A;  4Y1C A;  3ISN C;  1YTU A;  2X6N A;  3HP9 A;  5KGW A;  3O4N A;  3V9S A;  2D0B A;  4FJK A;  4ZTJ A;  4PUO A;  2DFH A;  3VQ7 A;  3VQC A;  5K14 A;  3SJJ A;  3CM5 A;  3CQ8 A;  4FLZ A;  3ZSO A;  1WSF A;  3SQ1 A;  3DRR A;  1TV6 A;  1CXQ A;  3K59 A;  2QKB A;  1RBT A;  1RDB A;  1WSH A;  3KIO A;  4CEE A;  4B8A B;  5CYQ A;  3OYD A;  3SPZ A;  4K8X A;  1MU2 A;  5C42 A;  3NH2 A;  3KLE A;  3G0Z A;  4FLY A;  1NK5 A;  1NJY A;  3LP0 A;  3T19 A;  1S1X A;  4NYN A;  1NJX A;  5SZT A;  3LP2 A;  4K8Z A;  4F8R A;  1L3S A;  3SV4 A;  4E7K A;  4M3T A;  4FJ9 A;  1GOC A;  3L2U A;  3QO9 A;  2BGG A;  3TAN A;  1BIZ A;  1O1W A;  4B9V A;  3DM2 A;  2G8V A;  2JGU A;  2YHA A;  1BCM A;  2XY8 A;  3TI0 A;  4M42 A;  2Z1I A;  3OVN A;  3CFO A;  3NGY A;  4ID5 A;  2ZD1 A;  5D3G A;  2EX3 A;  3AVN A;  4OKE A;  2IC3 A;  4CED A;  3OYL A;  2O4G A;  5J2P A;  1B9D A;  4OLA A;  2RN2 A;  4R5P A;  3TAE A;  4F2S A;  1WSG A;  3HPO A;  4M45 A;  4B9T A;  1HQU A;  4CEC A;  2RPI A;  4FVM A;  3WNH A;  5JS1 A;  1W0H A;  4LSN A;  1NOZ A;  2Z1G A;  3LPU A;  4C8M A;  3VQ5 A;  3KJV A;  2ITG A;  4DTR A;  1RT4 A;  1RTD A;  1S1U A;  5J2N A;  3NDK A;  1RCH A;  4W5T A;  2HNY A;  1HNI A;  1SUQ A;  3AA2 A;  4Z4E A;  4ICL A;  4E89 A;  1VSI A;  1NK6 A;  4BWM A;  1VRT A;  1J5O A;  4W5Q A;  4CFB A;  3QLH A;  5HP1 A;  3G10 A;  3V1Q A;  1KVA A;  4J2A A; 
#chains in the Genus database with same CATH topology
 5JVH L;  3HL8 A;  5HRP A;  3AVM A;  1T03 A;  3OBW A;  2E2O A;  5CYM A;  1QVG M;  4FJM A;  3QML A;  4CK3 A;  4IG3 A;  1SKW A;  4B9N A;  4IFE A;  4X66 K;  3KLH A;  4KV8 A;  5JIC A;  1N32 K;  3B6O A;  4GMJ B;  4WFB L;  1D9F A;  5FPM A;  3WT0 A;  1C0M A;  4U7B A;  2YNH A;  1GLE G;  5EXW A;  4CGJ A;  1ZBF A;  2JWK A;  4KBO A;  1SL1 A;  4LF6 K;  3TTD A;  3VTI A;  1CZ9 A;  1TUU A;  2O8E B;  3L4Q A;  2VWJ A;  3RR8 A;  4B1X B;  1HNV A;  2Q0U A;  3SMP A;  1D8Y A;  4GV9 A;  1JJ2 M;  3DXK B;  1VQ4 N;  3Q7C A;  3H3N O;  2AA4 A;  2RHK A;  4L8R B;  2HB5 A;  2HMP A;  1HNW K;  1ZBH A;  3VES A;  3D0P A;  4GW6 A;  3CJA A;  3ID8 A;  4AM6 A;  1TL3 A;  2XHB A;  4JI5 K;  3MWT A;  1XHZ A;  4LF8 K;  3LP3 A;  3QES A;  2WBN A;  2OTL N;  3MK6 A;  2ZE2 A;  2CGJ A;  3W0L A;  3P39 A;  4DR5 K;  1QQC A;  5HBM A;  4H03 B;  1C1C A;  1Q86 O;  1YJ9 N;  5FRN A;  4CES A;  1J6Z A;  2FLO A;  4HHT A;  3OS2 A;  3F9K A;  1N5Y A;  3WNE A;  1Q8I A;  1U6Z A;  1X3M A;  2ZJP L;  4DHY A;  4X65 K;  3M8R A;  1KVC A;  3ZSQ A;  1NGG A;  2ZGY A;  4M3Z A;  1JL2 A;  3J7Z O;  2ZM6 K;  3E9P A;  1D4X A;  3LAK A;  3T7Z A;  3L2W A;  2O8E A;  2E2N A;  4YHH K;  1W9H A;  3U3Y A;  3AVG A;  4QS8 A;  3MEC A;  3NGZ A;  3JSM A;  4M3W A;  1R59 O;  3DMJ A;  1A5W A;  3DXK A;  3ZT2 A;  4FL9 A;  4CIE A;  2O8D A;  2F7T A;  4DR4 K;  4PQU A;  3TAQ A;  4W5O A;  3CJ9 A;  3O1B A;  3J80 O;  3Q7B A;  2HW3 A;  2HF4 A;  1BUP A;  2YX6 A;  3T3F A;  4FLX A;  2O4I A;  2FSN A;  2IVO A;  4BRH A;  2YKM A;  3O5B A;  3LAN A;  5LMN K;  3AVA A;  4A5A A;  4H0T B;  5I42 A;  4BGB A;  1JKH A;  3KTQ A;  3U8X A;  4NCA A;  3KWI A;  4FJG A;  4KRE A;  3ZSR A;  4LSL A;  3CCS N;  1RDC A;  2P9S B;  2HBL A;  3NVK A;  5AQQ A;  3MN6 A;  2E2Q A;  1Q9X A;  4MDB A;  3OYJ A;  2I7P A;  3TSP A;  2YKN A;  5AQM A;  5JVG L;  5KRS A;  5M1O A;  4NCG A;  3QBX A;  4Z4H A;  1VSH A;  4DU1 A;  3VF6 A;  3U6F A;  4B3T K;  4OX9 K;  2P9U B;  4CHZ A;  4DQP A;  4CZE A;  4Z4C A;  2QWO A;  5BR9 A;  4DF8 A;  4KHY A;  4FLT A;  3JS6 A;  3NF8 A;  1KAY A;  4FSV A;  3VA0 A;  4O5F A;  4DQS A;  4JLH A;  2HHH K;  4XIU A;  3W3D A;  1VQ8 N;  2HHQ A;  3SQ0 A;  4E1N A;  3OYB A;  1J5E K;  4KI4 A;  4CJ3 A;  4DSI A;  3VQD A;  4XH1 A;  3E9L A;  3BGR A;  5F0X A;  3SAH A;  3O3F A;  2QI2 A;  2VCP A;  5AQV A;  5AQX A;  2OZS A;  4E1J A;  4BRM A;  1GOB A;  4CGH A;  4AF1 A;  2P9S A;  5DMR A;  1BL3 A;  2B6A A;  4DMN A;  4CEQ A;  5TKY A;  4CJR A;  3C95 A;  4CHY A;  2IS3 A;  5AQS A;  1UWB A;  4FO0 A;  4DQI A;  2E20 A;  4EIA A;  5KPZ A;  4J2B A;  4WF9 L;  4GY2 B;  3PY8 A;  1ZBI A;  2E1Y A;  2FF3 B;  5AQY A;  2GWK A;  2AJQ A;  2IDO A;  4ISG A;  3VTH A;  3ZSW A;  1OH8 A;  1ILY A;  4A5B A;  3QER A;  1BI4 B;  1OH6 A;  3KLI A;  4NYF A;  2UXC K;  4EZ6 A;  1MWK A;  3H1V X;  4YY3 K;  2NUB A;  3CJB A;  4A62 A;  5KQD A;  1WB9 A;  5CHI A;  2V7Y A;  5I9E B;  3NHG A;  1TKT A;  3FZF A;  1FKP A;  4BDZ A;  4IXC A;  4JK8 A;  3SK3 A;  1Q9Y A;  3DOK A;  1J9A A;  4OKJ A;  4OGC A;  3R8E A;  2E6M A;  4HUF A;  1BWF O;  5CY4 A;  3AAQ A;  1TK0 A;  1XNR K;  2KZM A;  1TKX A;  3L3V A;  1BIS A;  3QIC A;  3LWM A;  1Z6R A;  3AO3 A;  3C0B A;  3ASM A;  1S9E A;  2VG6 A;  4JRP A;  1M1K O;  3EE9 A;  1S6Q A;  3OYE A;  2DTU A;  3QEP A;  2J4R A;  1WN7 A;  3OJS A;  4K42 A;  3S3O A;  2QW9 A;  1NGI A;  1UA0 A;  2QA4 N;  4B1W B;  4FM1 A;  1UA1 A;  1SL2 A;  3HJF A;  4JI3 K;  1ITG A;  4DR6 K;  5FPE A;  4RW9 A;  3G71 N;  4W5N A;  1BI4 A;  4H5N A;  5C24 A;  1BQM A;  3ATV A;  4TSX A;  5AQH A;  1X1P A;  4BRQ A;  3JXU A;  4CEZ A;  4J8F A;  4CHO A;  1BIU A;  4YOX A;  3V6D A;  2UUC K;  3HSC A;  5BPM A;  4O55 A;  5BRF A;  2X6S A;  3CIP A;  3D45 A;  3DLK A;  3MED A;  3THX B;  5BPN A;  5GAH P;  2OPQ A;  3THW A;  1IKW A;  1A5V A;  3AO5 A;  4FLU A;  1RDU A;  1WSE A;  2GEL A;  4K41 A;  3VEX A;  4NLB A;  2KFZ A;  2LSN A;  5DK5 A;  4AM7 A;  3SBG A;  1SKS A;  1KVB A;  2IAJ A;  3I8B A;  1Y64 A;  3J7A P;  3V1R A;  4DV7 K;  2ZWH A;  3VET A;  1SAZ A;  2QEX N;  3ZET B;  5EY4 A;  3CCQ N;  3NE6 A;  4CE9 A;  2RE2 A;  3RRG A;  5B8H A;  2PFU A;  1T6D A;  1F21 A;  3QDK A;  2WTU A;  2G8I A;  2XY7 A;  3CCL N;  1YAG A;  4A59 A;  4CGG A;  1NK8 A;  1U04 A;  4K0K K;  3EZW A;  1NU0 A;  4DTU A;  3CQX A;  3A8Y A;  2KQ2 A;  1QHA A;  1BDG A;  1NGE A;  3THX A;  1U2V B;  2VWK A;  3MCP A;  3SPY A;  3O8M A;  3CYM A;  3P83 D;  2FC0 A;  4Y0W A;  5C15 A;  3I0R A;  2E8A A;  4PKI A;  3NBP A;  5SWM A;  3C6T A;  3WXJ A;  4IO8 A;  4DV3 K;  3CC2 N;  4FJN A;  3MWP A;  4PKG A;  2NZT A;  4BRE A;  3SMS A;  5KGX A;  3CFR A;  3L6Q A;  1KRP A;  4WQ4 A;  4W5R A;  3DRP A;  3R1X A;  1YJW N;  1G15 A;  3AA5 X;  4N47 A;  1ZBL A;  3ZET A;  5KGW A;  3O1W A;  3V9S A;  2D0B A;  3SJH A;  4FJK A;  2QM1 A;  3TTC A;  5GIP A;  3VQ7 A;  4PUO A;  3VQC A;  3SJJ A;  1WBB A;  3CM5 A;  4GV3 A;  4FLZ A;  1TV6 A;  1RBT A;  1YJN N;  1KAX A;  1WSH A;  1OH7 A;  4M3Y A;  2O8B B;  3LP0 A;  4JKG B;  4NYN A;  4AQY K;  1OVQ A;  1KQS M;  4K8Z A;  4F8R A;  4CW7 B;  1L3S A;  5IWA K;  1JCG A;  3L2U A;  5C2F A;  2BGG A;  1BIZ A;  2G8V A;  2FF6 A;  5JMV A;  2XY8 A;  3NGY A;  2V7Z A;  1DKG D;  1NLV A;  3F9M A;  4JKB A;  4NXN K;  4R5P A;  4B9T A;  4FVM A;  5GAE P;  3BP8 A;  2HBM A;  3WXK A;  3THY B;  5AQT A;  1BU6 O;  3MDQ A;  3CJ7 A;  4ICL A;  4BWM A;  1VRT A;  3LM2 A;  3CPW M;  1K8K B;  4B3S K;  3VEY A;  4F4K A;  3MEG A;  3K0S A;  4CEA A;  1C0T A;  3MN5 A;  3OS0 A;  2G8K A;  4JK7 A;  4LD0 A;  2W42 A;  4HCB A;  3SUN A;  1X3N A;  3VOV A;  2E6L A;  1TVR A;  2HVH A;  3TAG A;  4FJJ A;  4I7F A;  3TTF A;  5FPD A;  1N33 K;  4BRI A;  5CZ2 A;  4BR0 A;  4ELU A;  4DR2 K;  2ASM A;  1EWR A;  4NB4 A;  1TK5 A;  4N56 A;  4DKW A;  1I94 K;  1HNX K;  2UU9 K;  2O8B A;  1JXE A;  5AFU H;  4JKG A;  3LDO A;  4KO0 A;  1NJZ A;  3CM6 A;  1JLF A;  2NRH A;  3VN5 A;  1HRH A;  2O8F B;  3I33 A;  2BAN A;  3LZI A;  3VQE A;  3RMA A;  5HRN A;  3QIO A;  1S1T A;  1BHL A;  4BRA A;  3C7N B;  4BVO A;  3ZT4 A;  4M63 C;  4CHQ A;  4B1U B;  2QXF A;  4H0O A;  1XMO K;  4HVJ A;  1Q82 O;  1K8K A;  1MWM A;  5J2Q A;  4JHD B;  4JI2 K;  3U9D A;  1XWL A;  5GIN A;  4FCY A;  1S9G A;  4C1N K;  4CHP A;  1SS6 A;  4BDY A;  1WUA A;  3CET A;  4Z94 A;  1S5J A;  5AZI B;  4IOX A;  3D6R A;  2Q1N A;  1N34 K;  1WSJ A;  1XUP O;  4CFD A;  4GNI A;  2WUS A;  3TR8 A;  2P1J A;  4IDH A;  4DR1 K;  4GV6 A;  4CJP A;  2HST A;  1IJJ A;  3DAW A;  2A41 A;  3HM9 A;  4BRK A;  2F8T A;  3N4P A;  1TAU A;  5KTQ A;  1EX4 A;  1DEJ A;  3ZX0 A;  4A61 A;  4WQ5 A;  4OO1 J;  5C25 A;  2HHV A;  4AHS A;  4FJX A;  1EKE A;  3C6A A;  3TAB A;  3TAR A;  4F3T A;  2RKI A;  1LW2 A;  5HRR A;  2E88 A;  4JHD A;  5KRT A;  3AV9 A;  3ZX3 A;  4DS5 A;  5AQP A;  5AZI A;  3LZJ A;  1GLA G;  3MN9 A;  4O5B A;  4GKJ K;  3NH1 A;  1FK9 A;  2VG5 A;  3SCX A;  2BUP A;  3WEE B;  1N8R O;  4KHP K;  1YVN A;  3F5T A;  2WON A;  3VF2 A;  4Q0B A;  3CCR N;  3DLE A;  1YXQ A;  3O9S A;  3RSE B;  4B9Q A;  3G6E N;  3ENH A;  4CCH A;  2YHW A;  3V4I A;  5KQ8 A;  3KK1 A;  2BDP A;  4CJU A;  3H6E A;  1LCU A;  4CJ4 A;  3GL1 A;  1RTJ A;  3ZEU B;  4FPB A;  3OYI A;  3CF5 L;  3P5J A;  4DQQ A;  1NK9 A;  3DLB A;  4QCL A;  4CJT A;  1OH5 A;  3OJU A;  2E5L K;  1XNQ K;  3FE1 A;  2DPN A;  3VQ4 A;  3VQ9 A;  1NK0 A;  2ZQB A;  4FW2 A;  1OVY A;  4JKD A;  5AFU A;  5F2R A;  3RMD A;  2O8D B;  3ALY A;  3MXJ A;  3MXM A;  2FBT A;  2NRV A;  2PAV A;  3AGR A;  4CJW A;  1WAJ A;  3GOI A;  4DFP A;  1HYS A;  3U3G A;  3EL2 A;  4RW7 A;  1VQP N;  1V4T A;  2A1S A;  4DV0 K;  2GUI A;  1ASW A;  5BPL A;  3KKS A;  3WEE A;  2FSK A;  3G25 A;  1YF5 L;  1WLJ A;  3EEQ A;  3VGM A;  2P9K B;  3HT3 A;  1KLM A;  3RSE A;  4OPK A;  4CF9 A;  1RDD A;  4CJS A;  3SAF A;  1IO2 A;  1RNH A;  5HLF A;  4ELV A;  3IRX A;  4WFN L;  1T44 A;  3HVR A;  3LPT A;  1C1A A;  4BE0 A;  4E7H A;  3ZEU A;  3CD6 N;  4MLE A;  1HJO A;  2G8U A;  1MA9 B;  3MCA B;  1EO1 A;  2OTJ N;  4FWP A;  3AVK A;  1XC9 A;  4JI8 K;  3CC4 N;  1VSM A;  5HOO A;  5LL6 Z;  3H3O B;  4A2B A;  3OYG A;  1NGF A;  2F9W A;  1E3M A;  1BG3 A;  4CF1 A;  3F73 A;  3IKM A;  2NRX A;  2XRI A;  3AVC A;  3M6G A;  4Q5V A;  4IWV A;  1NMD A;  5FRO A;  3RTV A;  4O0I A;  3AVH A;  3L0Q A;  3OYF A;  1RT5 A;  3QB0 A;  1ATR A;  2HHS A;  3H46 O;  5ADX H;  5T7B A;  3FFK B;  1NK4 A;  4CZI A;  3LWL A;  4O8U A;  4JAX A;  2P9K A;  1QZ5 A;  3VER A;  2P9P B;  4HTU A;  1NOY A;  1VQL N;  1G99 A;  3QIN A;  2UUA K;  4BRC A;  3CJ1 A;  4PL8 A;  2QKK A;  4CK2 A;  1NK7 A;  3UKR B;  4KHN A;  4CEB A;  4FJ8 A;  3NGI A;  3QBW A;  4CJQ A;  4KB1 A;  4CEO A;  2XY5 A;  2P9N B;  4FM0 A;  4C8K A;  3L2R A;  3VEN A;  2QWP A;  3VQA A;  1X9W A;  1TK8 A;  1YIT N;  4CJE A;  4FJ7 A;  3LP1 A;  4B9L A;  4U67 L;  3BZC A;  2D0P A;  1NGA A;  4KTZ A;  3OYA A;  2I5J A;  2Z1J A;  4GKK K;  3PX4 A;  3PIP L;  4JI4 K;  3TAP A;  3HO1 A;  1RT1 A;  4CJK A;  4NCB A;  1VSK A;  2ATQ A;  3OYK A;  4CHN A;  4DLG A;  1E4F T;  3FR0 A;  4J2E A;  4KHS A;  3C6U A;  1VSD A;  4QS7 A;  5BN8 A;  3B8A X;  5AQZ A;  2P9P A;  2KZZ A;  1P8Z A;  3NF7 A;  1REV A;  2D0A A;  2W41 A;  3ZT1 A;  3UKR A;  2IVP A;  1I3A A;  3O3G A;  3KK3 A;  1EQY A;  1QSS A;  4QAG A;  3K9J A;  4AH9 A;  3VEV A;  2P9N A;  4FK0 A;  4PHT X;  1RGI A;  4DQR A;  2HND A;  2P9L B;  4IOC L;  4RW8 A;  2X74 A;  2HVI A;  4G9Z A;  2AP1 A;  1K6Y A;  3M8Q A;  1RT3 A;  1L3T A;  3MEE A;  1QSY A;  1W97 L;  4FK2 A;  2DFE A;  4K25 A;  4GVM A;  1RBS A;  4DV4 K;  2VQE K;  2OA8 A;  3HRG A;  4FLW A;  3KLG A;  2NRW A;  1HYZ A;  3VEO A;  4JI1 K;  2B5J A;  5E26 A;  4H0V B;  3ZSX A;  3VA3 A;  5F1X A;  3O08 A;  1EWQ A;  2QWL A;  4KKO A;  4AHC A;  3PV8 A;  1HJR A;  2CGL A;  4YNQ A;  3IUC A;  4FJI A;  1RT2 A;  3DXM B;  4CVN E;  4FJ5 A;  4DSE A;  2Q3S A;  3NF9 A;  4H0Y B;  1QTM A;  3QEV A;  1JL1 A;  3B6P A;  1Q7Y O;  3THW B;  3LDN A;  1YTU A;  3EO3 A;  4FWL A;  1KD1 O;  3BUZ B;  1BO5 O;  4NO7 A;  4BC2 A;  2ZGZ A;  3M5R A;  3CQ8 A;  4JNE A;  1T6C A;  2P9L A;  3DRR A;  4LF7 K;  1RDB A;  1O13 A;  3SPZ A;  3C6H A;  1MU2 A;  5C42 A;  3NH2 A;  4FLY A;  1NK5 A;  4O8K A;  1NJY A;  4CZL A;  3CHW A;  2KHO A;  1Q81 O;  1O1W A;  2VQF K;  3H45 C;  4ILJ A;  2YHA A;  4QS9 A;  2Z1I A;  3OVN A;  4CJ7 A;  1XQS C;  3AVN A;  4OKE A;  3TAE A;  4ILH A;  3I55 N;  3HPO A;  1HQU A;  3KZB A;  4CEC A;  2RPI A;  4HWI A;  3HZ6 A;  4LSN A;  2Z1G A;  4FWS A;  3DXM A;  1IBK K;  4W5T A;  1NGH A;  1HNI A;  1SUQ A;  4Z4E A;  3HOT A;  3CQY A;  4CBU A;  1J5O A;  4W5Q A;  3GE1 A;  4H5T A;  3G10 A;  3V1Q A;  1KVA A;  4FWQ A;  5AQL A;  4JI0 K;  3AO1 A;  2R7Y A;  3EE8 A;  1TL1 A;  1ZYQ A;  1GLJ O;  4Z4G A;  1P90 A;  1CXU A;  4FWR A;  4KTW A;  3EKU A;  1GOA A;  1J54 A;  3LDQ A;  4G1Q A;  3V81 A;  3LAM A;  1RFQ A;  4CGD A;  5J1E A;  4DR3 K;  3K57 A;  2P5G A;  3SNN A;  2YJF A;  4NLC A;  4M3R A;  5E41 A;  4AHU A;  4EP5 A;  1UAX A;  2A6A A;  4DSJ A;  4XEI A;  4DTO A;  2UUB K;  4J2D A;  1LWF A;  4H8K A;  2G8W A;  1U47 A;  3NFA A;  4M41 A;  2VG7 A;  4DU3 A;  3GDQ A;  1YIJ N;  3MX2 A;  2QWN A;  4JI6 K;  1VQ6 N;  1ESV A;  3P31 A;  5BRD A;  2KTQ A;  1FW6 A;  3CPE A;  4YDU A;  4BRN A;  4B3M K;  1RDA A;  3O9R A;  4PWD A;  2IOC A;  1L5U A;  4ZHR A;  4DTN A;  3DJC A;  5GAG P;  2KW4 A;  3LAL A;  4CGI A;  4ID1 A;  4B8C A;  4X64 K;  2Q0R A;  1RTI A;  1C0U A;  2GX9 A;  1T7P A;  1BCO A;  3TPQ A;  1YHQ N;  4AIL C;  3M8S A;  4JYA K;  2OCE A;  2P9I B;  2UYT A;  4O0J A;  3EZ5 A;  4UY8 O;  4CIG A;  3PSF A;  4FWN A;  3EYZ A;  3I0S A;  4IKF A;  2JLE A;  3I8D A;  5M1F A;  1W7A A;  3PO5 A;  3FFI A;  4V19 S;  4BRF A;  3S3N A;  5HL7 L;  1BA1 A;  4FOI A;  2ASP A;  1NG9 A;  4DU4 A;  3IFR A;  3HPH A;  2I7N A;  4IFY A;  3ULD A;  1LAW A;  3P38 A;  4YOV A;  4IJN A;  3TSU A;  3DLG A;  2OZM A;  2E1Z A;  4F9O A;  2Q36 A;  4DUY K;  1BA0 A;  1JCE A;  4DSF A;  4I6M A;  3CMA N;  3VQB A;  5GAD P;  1QZ6 A;  1U49 A;  3FZM A;  3A2F A;  4DSL A;  3MXI A;  4WCE L;  1RBR A;  3HST B;  5IT9 O;  2W6L A;  4HTL A;  1XMQ K;  2QK9 A;  4KAZ A;  4BAC A;  4PL7 A;  2HHT A;  3PSI A;  1EET A;  3SYZ A;  1IBL K;  4KH4 A;  3DI6 A;  5E84 A;  1FKO A;  2P9I A;  1VSE A;  1WNS A;  3ZYY X;  4BGA A;  2D0C A;  1U48 A;  5KPR A;  5M1K A;  1RT6 A;  1NBW A;  1WBD A;  4C8O A;  3V1O A;  4IO9 L;  1FJG K;  4BR2 A;  4M3U A;  1EP4 A;  1DT9 A;  3IG1 A;  3ZSZ A;  3IAY A;  3HBT A;  4BE1 A;  4M7Y A;  4F3O A;  4Z0U A;  3CI5 A;  4NXM K;  4CF2 A;  2IGI A;  5H1S Q;  4KHW A;  1TUY A;  5MLC Q;  3V9U A;  1LWC A;  3AA3 A;  3K5L A;  2A3Z A;  1DTT A;  1LAV A;  1S1W A;  3PIO L;  4OGE A;  5A2Q O;  4WFA L;  3VQ8 A;  2WFB A;  2IIR A;  2YNI A;  3SQ2 A;  3ATU A;  3KD5 E;  5AQW A;  3TU5 A;  4UQG A;  3NH0 A;  2D5R A;  3A5L C;  4FXD A;  4XH4 A;  3QFP A;  5LY3 A;  3SAG A;  2A5X A;  4FW1 A;  4IDK A;  4DV6 K;  1LW0 A;  2VWB A;  4BC5 A;  4DFK A;  3QEW A;  1N6Q A;  4JRQ A;  3CCJ N;  2HNZ A;  4RW6 A;  1TKZ A;  1I39 A;  1HUX A;  3LDS A;  3ULE B;  2OPS A;  3V9Z A;  4R79 A;  2UXD K;  4CJL A;  4DTP A;  2YI1 A;  3V9X A;  4B1Z A;  3O3H A;  1R0A A;  2A42 A;  3ZT3 A;  1L3V A;  4B1V A;  3HP6 A;  4DS4 A;  1ASV A;  1OKJ A;  2XO7 A;  1IKY A;  1S72 N;  4RCH A;  1IG9 A;  4E3S A;  4CJ5 A;  1SKR A;  4C8L A;  1IBM K;  4B9S A;  2HOE A;  4KRF A;  1SL0 A;  1JXB A;  4A2A A;  4KFB A;  3ZCM A;  3K5N A;  3VQQ A;  1VK0 A;  4OPJ A;  4WE1 A;  3V9W A;  5JLF A;  3OTO K;  2FBX A;  4OPH A;  3SLC A;  1JLC A;  1GLF O;  4F2R A;  2FXU A;  3SBT A;  5M1N A;  4WQ4 C;  4IEI A;  5EU7 A;  4EHT A;  3VMF B;  4BG8 A;  5ELZ A;  4BRG A;  1IG8 A;  1ZC6 A;  3VEZ A;  3EN9 A;  5AQJ A;  1VQK N;  4CBW A;  4DSK A;  2BH1 A;  3ULE A;  3ZX2 A;  4GVE A;  4ELT A;  1T8E A;  1IKX A;  4JS4 A;  4LC9 B;  2QTD A;  3M3Z A;  4DG1 A;  4C23 A;  2RF2 A;  2WOM A;  1YUW A;  2G8H A;  4EZ9 A;  1D9D A;  4YOW A;  4PA1 A;  4BRD A;  1NGB A;  3O9T A;  4H4M A;  4CD1 A;  3MAQ A;  2ITM A;  3KVG A;  4YOU A;  3ZSV A;  2V52 B;  3D2E B;  3JYT A;  2PY5 A;  1SZ2 A;  4CZK A;  1VQ5 N;  1XI1 A;  1HMV A;  3ZSY A;  1X9J A;  2ZJR L;  2F4V K;  5TKW A;  4M3X A;  4LY7 A;  3BDP A;  5EVZ A;  4CEF A;  3O6W A;  5FLX O;  1HPZ A;  5KI6 A;  1YT3 A;  3O80 A;  4HCC A;  4DR7 K;  1ZXO A;  4O4G A;  3QEX A;  3KLF A;  2BTF A;  4OJR A;  2HBJ A;  4I2Q A;  4YOR A;  3PUF A;  3S9H A;  2YHX A;  4WYB A;  1ATN A;  1HR0 K;  3NVM A;  1YTA A;  3LDP A;  3L4I A;  1RBU A;  1UOC A;  1H1V A;  1GLB G;  2EWS A;  3ITH A;  1NWK A;  4ILG B;  4CJV A;  1N36 K;  5JS2 A;  4BQZ A;  1RTH A;  4DCH A;  3CJC A;  4FVU A;  4ISF A;  3MN7 A;  3QET A;  3WXL A;  3CER A;  4AHV A;  4FJH A;  3FZL A;  4DLE A;  3QFU A;  4DWI A;  4MQ3 A;  2JWL A;  1YI2 N;  3RWU A;  2HHU A;  3DWL A;  2F9T A;  3HVT A;  1VQ9 N;  2DY4 A;  3K5M A;  4QOZ B;  1BGX T;  5AQF A;  3D2E A;  3EY1 A;  1HKB A;  3WNF A;  3RMB A;  4BVP A;  2HBK A;  2NRT A;  3SUP A;  3L2Q A;  4FZY A;  1TKD A;  2UXB K;  4XH5 A;  1T3V A;  3CCV N;  4OVL A;  3E9O A;  1C6V A;  4LH4 A;  3SUQ A;  4LF4 K;  4FWM A;  3TWH A;  4E7I A;  1ZBU A;  3J81 O;  1TGO A;  2BE2 A;  1IV0 A;  3HK2 A;  3AA4 A;  1HX1 A;  1YVU A;  1JLB A;  1RDW X;  3RMC A;  4BRL A;  3DLH A;  1SV5 A;  2OPP A;  1WAF A;  3HYF A;  1X9M A;  4E7L A;  3FGU A;  4C1N I;  1NNE A;  1NKB A;  3A5M C;  4I9Q A;  3LDL A;  3AGK A;  3VEW A;  5I3U A;  4CI6 A;  2QWQ A;  3WXI A;  2YHB A;  5CZ1 A;  2VGM A;  3L2V A;  5BRH A;  4EP4 A;  4Y1C A;  3ISN C;  1NGJ A;  3O4N A;  1Z05 A;  1TYQ B;  3HM8 A;  4ZTJ A;  5EOY A;  4BY9 C;  2DFH A;  4DB3 A;  4BR9 A;  3FZK A;  3CC7 N;  3R9P A;  3OYD A;  5CYQ A;  3IMX A;  1M90 O;  4WQ5 C;  3KLE A;  3G0Z A;  1KLN A;  1NJX A;  3T19 A;  3LP2 A;  3D2F B;  1VHX A;  3O4W A;  3SV4 A;  4E7K A;  4FJ9 A;  3QO9 A;  1S3X A;  3OA9 A;  4B9V A;  3DM2 A;  1BCM A;  3TI0 A;  4M42 A;  2ZD1 A;  2EX3 A;  3KHY A;  3OYL A;  4DV2 K;  5J2P A;  2O4G A;  1B9D A;  5AR0 A;  2RN2 A;  2Q2R A;  3WNH A;  5JS1 A;  3WXM B;  3BF1 A;  3LPU A;  3VQ5 A;  3KJV A;  4DTR A;  1RTD A;  1S1U A;  5J2N A;  2V51 B;  3NDK A;  3CXC M;  3NMU A;  3AA2 A;  4E89 A;  1NK6 A;  4CFB A;  1LOT B;  5HP1 A;  4J2A A;  3ZLJ A;  5HRO A;  3T1H K;  3UB5 A;  5M1P A;  1B92 A;  3E01 A;  2YNF A;  4Z4F A;  2Q31 A;  5AZJ B;  3THV A;  1TYQ A;  3VF4 A;  4KH5 A;  4CF0 A;  1U4B A;  4PY5 A;  3H1Q A;  2WC9 A;  4CFC A;  3HXM A;  3S3M A;  3FLC O;  5KPT A;  5C2D A;  4MO4 A;  1K8A O;  4X62 K;  2E4L A;  2FBY A;  4DTJ A;  2GTD A;  2W40 A;  3D2F A;  4JKF A;  1WSI A;  4B3O A;  1S22 A;  5LJV A;  4JEP A;  4DTS A;  3S41 A;  4KH6 A;  4EHU A;  3IS9 A;  3TAM A;  4B1Y B;  3QNN A;  5FPN A;  3P1G A;  2HHX A;  2CH5 A;  1XC3 A;  1NKE A;  3QNO A;  3L8B A;  2KLA A;  2ZJQ L;  1Y97 A;  1VQ7 N;  2FSJ A;  1FXX A;  4BRO A;  4CJF A;  3KKR A;  4AHT A;  1DTQ A;  3OYM A;  3AVL A;  4EFH A;  1KFD A;  4LF5 K;  2Z1H A;  2X78 A;  2GV9 A;  1MDU B;  2GWJ A;  3I56 N;  3E66 A;  5AQR A;  4BDP A;  5AQN A;  3HTV A;  4I2P A;  5AZJ A;  4DFM A;  3H08 A;  2G8F A;  4FPA A;  3CG7 A;  3HPG A;  1HYV A;  2NRZ A;  2Y1I A;  3OYC A;  1LV5 A;  3BF3 A;  2O8C B;  4IBN A;  2EHG A;  1HLU A;  2P9U A;  5DM6 L;  4BC4 A;  4KHU A;  3UKU B;  3L3U A;  2ZF5 O;  3C65 A;  4E1M A;  2F96 A;  3SZ2 A;  1GLC G;  5FRM A;  1CZA N;  3SV3 A;  3NAE A;  1RIL A;  5J2M A;  3J7Y P;  4A57 A;  4CFA A;  1IKV A;  2YJE A;  3CME N;  4FM2 A;  3F2K A;  4BRP A;  4Z4I A;  5ADX A;  4FJL A;  1V4S A;  1QE1 A;  4CF8 A;  5AQG A;  4FOE A;  1S6P A;  2QXL A;  3GBT A;  3RVC A;  4YFU A;  2GUP A;  3BEX A;  4HUG A;  4JKC A;  2PZS A;  1CLQ A;  3BY5 A;  2ETJ A;  4C8N A;  4JV5 K;  1T05 A;  1VRU A;  1HQE A;  3OBY A;  1BOT O;  1QQN A;  4E19 A;  4E0D A;  2NLX A;  3O4Q A;  5LMU K;  3KK7 A;  4FWK A;  3RRH A;  2O8C A;  3KWG A;  4CER A;  3UKU A;  2P51 A;  4CZM A;  1XHX A;  2H3G X;  2F8S A;  4N76 A;  1ASU A;  4KPY A;  1HKC A;  2PYJ A;  5CE3 A;  5EX5 A;  3EKS A;  1NGD A;  2QWR A;  5AQI A;  2Q97 A;  3AVI A;  4IG0 A;  3AVB A;  4L3Q A;  4LF9 K;  4B9U A;  3RR7 A;  1D5A A;  4MLH A;  3T1A A;  1JLA A;  2KFN A;  4YOT A;  4DV5 K;  3MX5 A;  1Z26 A;  1KTQ A;  1LWE A;  4JN4 A;  2HHW A;  1QS4 A;  2D0O A;  5DM7 L;  4EAH D;  3KK2 A;  3O9Q A;  1SQK A;  4BR5 A;  1RT7 A;  1J53 A;  4JS5 A;  1VQN N;  4HUE A;  1IH7 A;  4BE2 A;  2A1R A;  3U9Z A;  3MMV A;  4KTQ A;  1NJW A;  3K2P A;  3T69 A;  3DRS A;  4IOA L;  3WUH A;  5FDL A;  1VSF A;  4I6M B;  3FZH A;  2NNW A;  3VQP A;  4LH5 A;  4OLB A;  4DUZ K;  1ATS A;  2GEM A;  3AAP A;  3BZK A;  1NGC A;  1HPM A;  2VYP A;  3OY9 A;  1C1B A;  3UIQ A;  2YHY A;  4CZH A;  4LFA K;  4O44 A;  4DF4 A;  4OKK A;  3K58 A;  4YOY A;  1S1V A;  1Z25 A;  5CR4 A;  1BQN A;  4CD3 A;  1QVF M;  2QWM A;  4H5R A;  4JKE A;  4PKH A;  1JLQ A;  4FLV A;  4DTX A;  3QIP A;  3M1F A;  4LFC K;  3WNG A;  3CFP A;  1NKC A;  2OPR A;  4BQL A;  1RBV A;  4CK1 A;  3AAR A;  5D3G A;  3VGK A;  3ZT0 A;  2Y1J A;  1TAQ A;  3AO2 A;  3OS1 A;  2A40 A;  2ASO A;  2D1K A;  2FBV A;  3PX0 A;  3AY9 A;  4IEE A;  4KHQ A;  3CCM N;  1K73 O;  3SUO A;  3OYN A;  3M8P A;  3J8A A;  3SQ4 A;  3DLR A;  5C0Y A;  4IFV A;  3AVF A;  1ZBS A;  1L3U A;  3E1Y A;  3PLA A;  5GIO A;  2D4W A;  3C94 A;  3UE5 A;  5AQU A;  4FYD A;  2GBZ A;  3N4Q A;  1QQO A;  4JI7 K;  4KI6 A;  3A0I X;  2PBD A;  2E2P A;  3AO4 A;  2B4J A;  4RG8 A;  3NCI A;  4DTM A;  1U2V A;  3CCE N;  4FZX C;  1QHT A;  3OYH A;  4N5S A;  4AHR A;  1JLG A;  1CZB A;  1QQM A;  5C12 A;  2W6K A;  1DLO A;  1W2B M;  2CGK A;  4B9M A;  3NF6 A;  4BC3 A;  2P5O A;  3JAM O;  3ID6 A;  3DOL A;  2XY6 A;  4E7J A;  3LL3 A;  3VGL A;  4K43 A;  4JKA A;  1JLE A;  3PO4 A;  4CIF A;  3DYA A;  1B9F A;  1QSL A;  5JLH A;  4FK4 A;  3LM9 A;  2HF3 A;  2IVN A;  3D7E O;  4ZTF A;  1HNZ K;  3K5O A;  2YNG A;  1NM1 A;  3G4S N;  4Y1D A;  3SI6 A;  4H5V A;  3A5O C;  1WOQ A;  1X9S A;  1VSL A;  2OAN A;  4ISE A;  4CBX A;  1GLD G;  4N41 A;  3WQU A;  1DGK N;  1KC8 O;  4CZF A;  4JD2 B;  1E4G T;  1KXP A;  2PYL A;  3ENO A;  2OYQ A;  4FZZ A;  1U45 A;  1KSP A;  2HMI A;  4M7X A;  4CGF A;  1GLL O;  4DFJ A;  3QEI A;  4OPA A;  4I9L A;  3THY A;  4BWJ A;  3HOS A;  1JCF A;  1NJI O;  2YCH A;  4RTF D;  4YDU C;  3TAF A;  3AVJ A;  1EXQ A;  4MFB A;  1KCF A;  3HI0 A;  4H4O A;  1C0G A;  3KD1 E;  4KB0 A;  2VGN A;  3VQ6 A;  4RW4 A;  1KFS A;  4JK9 A;  2DFF A;  3OHR A;  3ENB A;  1VSJ A;  1A5X A;  1Q18 A;  4MO5 A;  4B08 A;  3DLL L;  3PX6 A;  3A5N C;  5M1Q A;  1VAZ A;  2NRR A;  2YV0 X;  5BN9 A;  4BR7 A;  2KKZ A;  2X6N A;  3HP9 A;  3O9U A;  5BRE A;  4LFB K;  3T1Y K;  4B3R K;  5K14 A;  2O8F A;  1C0F A;  1KAZ A;  1VQO N;  3ZSO A;  1WSF A;  4JD2 A;  3SQ1 A;  1CXQ A;  4FWO A;  4CZJ A;  3K59 A;  2QKB A;  3KIO A;  4IZ9 A;  4CEE A;  4B8A B;  4CZG A;  5AQK A;  4DV1 K;  4K8X A;  4BR4 A;  2CH6 A;  3K9K A;  4H0X B;  1S1X A;  5SZT A;  3VPZ A;  3TSQ A;  3C7N A;  4JKH A;  5C10 A;  4RWT A;  4M3T A;  4MDA A;  5AQO A;  1GOC A;  4H5W A;  3TAN A;  1VQM N;  3R6M A;  3P4I A;  2JGU A;  4IJA A;  5AJ3 K;  3OW2 M;  4ID5 A;  3CFO A;  3U4L A;  4CED A;  3IDH A;  2IC3 A;  5BR8 K;  3R3L A;  4OLA A;  1NMN A;  4H0P A;  4F2S A;  1WSG A;  4M45 A;  3GG4 A;  1W0H A;  1NOZ A;  4C8M A;  4DQ8 A;  1HKG A;  2ITG A;  1RT4 A;  1RCH A;  2HNY A;  5LJW A;  3WQT A;  4BG9 A;  1VSI A;  3CCU N;  5HRS A;  3QLH A;  1K9M O; 
#chains in the Genus database with same CATH homology
 3HL8 A;  5HRO A;  5HRP A;  3MEG A;  1B92 A;  3E01 A;  2YNF A;  3AVM A;  4CEA A;  3AO1 A;  1C0T A;  1T03 A;  3THV A;  4Z4F A;  3OS0 A;  2G8K A;  2R7Y A;  1TL1 A;  5CYM A;  4LD0 A;  2W42 A;  1ZYQ A;  4HCB A;  3SUN A;  4FJM A;  4Z4G A;  4B9N A;  2E6L A;  1TVR A;  4IG3 A;  4CF0 A;  4CK3 A;  3TAG A;  1U4B A;  1SKW A;  4FJJ A;  4PY5 A;  4CFC A;  3HXM A;  3S3M A;  4I7F A;  1CXU A;  3KLH A;  4KV8 A;  4KTW A;  5CZ2 A;  3B6O A;  2E4L A;  4ELU A;  1GOA A;  4GMJ B;  1J54 A;  2FBY A;  4G1Q A;  4DTJ A;  3V81 A;  3LAM A;  4N56 A;  1TK5 A;  1D9F A;  4CGD A;  5J1E A;  1JXE A;  1C0M A;  3K57 A;  3SNN A;  2P5G A;  4KO0 A;  2YNH A;  4CGJ A;  1ZBF A;  3CM6 A;  1NJZ A;  4M3R A;  1JLF A;  1SL1 A;  1WSI A;  4B3O A;  1CZ9 A;  4DTS A;  5E41 A;  4AHU A;  4EP5 A;  3VN5 A;  1HRH A;  1UAX A;  2VWJ A;  3RR8 A;  2BAN A;  1HNV A;  4DSJ A;  3IS9 A;  3TAM A;  3QNN A;  1D8Y A;  3P1G A;  4DTO A;  2HHX A;  4J2D A;  1LWF A;  1NKE A;  4H8K A;  3QNO A;  1U47 A;  2G8W A;  3LZI A;  3L8B A;  4L8R B;  3NFA A;  4M41 A;  3VQE A;  2HB5 A;  2VG7 A;  3RMA A;  5HRN A;  3QIO A;  3D0P A;  1S1T A;  1ZBH A;  1Y97 A;  4DU3 A;  1BHL A;  4GW6 A;  3ZT4 A;  1FXX A;  4CJF A;  1TL3 A;  3KKR A;  2XHB A;  4AHT A;  1DTQ A;  4CHQ A;  1XHZ A;  2QXF A;  3OYM A;  3AVL A;  1KFD A;  2KTQ A;  4HVJ A;  3LP3 A;  3QES A;  1RDA A;  5J2Q A;  2Z1H A;  1XWL A;  2X78 A;  1S9G A;  2GV9 A;  4CHP A;  4FCY A;  2ZE2 A;  4PWD A;  4BDP A;  1QQC A;  4BDY A;  2IOC A;  1L5U A;  4ZHR A;  4I2P A;  4DTN A;  4DFM A;  3H08 A;  1S5J A;  5HBM A;  2G8F A;  1C1C A;  3CG7 A;  2KW4 A;  3LAL A;  4CGI A;  5FRN A;  3HPG A;  4ID1 A;  4B8C A;  4CES A;  1WSJ A;  4HHT A;  1HYV A;  3OS2 A;  3F9K A;  1N5Y A;  2Y1I A;  1RTI A;  1C0U A;  4CFD A;  3WNE A;  3OYC A;  1LV5 A;  1T7P A;  1BCO A;  4IBN A;  1Q8I A;  2EHG A;  4AIL C;  3M8S A;  4O0J A;  3TR8 A;  3EZ5 A;  2P1J A;  4CIG A;  4KHU A;  3M8R A;  3EYZ A;  3I0S A;  1KVC A;  4CJP A;  3L3U A;  3ZSQ A;  4IKF A;  4M3Z A;  1JL2 A;  2JLE A;  3I8D A;  3PO5 A;  3HM9 A;  3FFI A;  2F8T A;  4E1M A;  3LAK A;  2F96 A;  3L2W A;  3SZ2 A;  1TAU A;  1W9H A;  3U3Y A;  5FRM A;  3S3N A;  5KTQ A;  3AVG A;  3SV3 A;  3MEC A;  3NGZ A;  3JSM A;  1EX4 A;  3NAE A;  4M3W A;  1RIL A;  5J2M A;  4DU4 A;  3DMJ A;  1A5W A;  3ZT2 A;  3HPH A;  4CFA A;  4CIE A;  1IKV A;  4IFY A;  3ULD A;  1LAW A;  4PQU A;  3TAQ A;  4W5O A;  4FM2 A;  3DLG A;  2OZM A;  4Z4I A;  5C25 A;  2HHV A;  4FJL A;  4AHS A;  2HW3 A;  4FJX A;  1EKE A;  3TAB A;  3TAR A;  4F3T A;  2RKI A;  1LW2 A;  1QE1 A;  4CF8 A;  3T3F A;  4DSF A;  1S6P A;  5HRR A;  4FLX A;  2O4I A;  2YKM A;  3VQB A;  4YFU A;  5KRT A;  3LAN A;  3AV9 A;  3AVA A;  4HUG A;  1U49 A;  2PZS A;  1CLQ A;  4DS5 A;  2ETJ A;  3A2F A;  4C8N A;  1T05 A;  1VRU A;  3MXI A;  5I42 A;  4DSL A;  2HVH A;  1RBR A;  3HST B;  1HQE A;  3LZJ A;  2QK9 A;  4E19 A;  4KAZ A;  4E0D A;  1JKH A;  4BAC A;  3KTQ A;  4NCA A;  4KRE A;  4FJG A;  4O5B A;  3ZSR A;  2HHT A;  3O4Q A;  4LSL A;  1EET A;  3SYZ A;  3RRH A;  3NH1 A;  1FK9 A;  2VG5 A;  3DI6 A;  3SCX A;  1RDC A;  1FKO A;  1VSE A;  1WNS A;  4CER A;  2D0C A;  1U48 A;  2WON A;  4Q0B A;  1RT6 A;  2P51 A;  1XHX A;  3DLE A;  1Q9X A;  4N76 A;  4C8O A;  3OYJ A;  2F8S A;  2YKN A;  1ASU A;  4KPY A;  4CCH A;  3V1O A;  2PYJ A;  3V4I A;  5KRS A;  4M3U A;  3KK1 A;  1EP4 A;  4NCG A;  2BDP A;  4CJU A;  3IG1 A;  3ZSZ A;  3IAY A;  4Z4H A;  4BE1 A;  4CJ4 A;  1VSH A;  3AVI A;  4F3O A;  4M3Y A;  1RTJ A;  4IG0 A;  3AVB A;  4DU1 A;  4Z0U A;  3U6F A;  4B9U A;  4CHZ A;  3OYI A;  4DQP A;  3RR7 A;  4CF2 A;  3P5J A;  1D5A A;  4Z4C A;  4DQQ A;  3T1A A;  2IGI A;  1NK9 A;  1JLA A;  4CJT A;  3DLB A;  4QCL A;  2KFN A;  3OJU A;  4KHW A;  3V9U A;  1LWC A;  4DF8 A;  3AA3 A;  4FLT A;  1Z26 A;  4KHY A;  1KTQ A;  1LWE A;  3K5L A;  3NF8 A;  2HHW A;  3VQ4 A;  1DTT A;  3VQ9 A;  1LAV A;  1QS4 A;  1S1W A;  3VA0 A;  4OGE A;  1NK0 A;  4DQS A;  2ZQB A;  4JLH A;  3VQ8 A;  3KK2 A;  4FW2 A;  2YNI A;  4XIU A;  3SQ2 A;  3KD5 E;  2HHQ A;  1RT7 A;  3SQ0 A;  4UQG A;  3RMD A;  1J53 A;  4JS5 A;  3NH0 A;  2D5R A;  3ALY A;  4E1N A;  3OYB A;  3MXJ A;  4FXD A;  4KI4 A;  4CJ3 A;  4HUE A;  3MXM A;  1IH7 A;  2FBT A;  4BE2 A;  2A1R A;  3VQD A;  4CJW A;  4DSI A;  1WAJ A;  4FW1 A;  3BGR A;  4IDK A;  3O3F A;  4DFP A;  1NJW A;  1LW0 A;  3K2P A;  3U3G A;  4KTQ A;  3QEW A;  4RW7 A;  4DFK A;  1N6Q A;  3DRS A;  4JRQ A;  2A1S A;  2OZS A;  2HNZ A;  4RW6 A;  2GUI A;  1ASW A;  1I39 A;  1TKZ A;  5FDL A;  1VSF A;  3KKS A;  1GOB A;  4CGH A;  3VQP A;  3LDS A;  1WLJ A;  2OPS A;  4LH5 A;  5DMR A;  3V9Z A;  1BL3 A;  4OLB A;  2B6A A;  4DMN A;  3HT3 A;  4CEQ A;  4CJL A;  1KLM A;  4CJR A;  3C95 A;  4CHY A;  4DTP A;  4OPK A;  2IS3 A;  4CF9 A;  1RDD A;  4CJS A;  1UWB A;  3V9X A;  4DQI A;  3O3H A;  4J2B A;  1IO2 A;  1RNH A;  1C1B A;  3OY9 A;  5HLF A;  1R0A A;  4ELV A;  3IRX A;  3UIQ A;  3PY8 A;  1ZBI A;  3ZT3 A;  1L3V A;  3HP6 A;  3HVR A;  3LPT A;  1ASV A;  4DS4 A;  4O44 A;  4DF4 A;  4OKK A;  2XO7 A;  1C1A A;  3K58 A;  2AJQ A;  1IKY A;  1S1V A;  4BE0 A;  4E7H A;  1IG9 A;  4E3S A;  2IDO A;  1Z25 A;  3ZSW A;  4CJ5 A;  1SKR A;  1BQN A;  3QER A;  1BI4 B;  2G8U A;  4C8L A;  3KLI A;  4NYF A;  4B9S A;  4KRF A;  1SL0 A;  1JXB A;  4EZ6 A;  3AVK A;  4KFB A;  1XC9 A;  3ZCM A;  2NUB A;  1VSM A;  3K5N A;  1JLQ A;  4FLV A;  4DTX A;  3VQQ A;  3QIP A;  1VK0 A;  4OPJ A;  4WE1 A;  3OYG A;  3V9W A;  3WNG A;  3CFP A;  2FBX A;  1NKC A;  1HYS A;  4NCB A;  4CF1 A;  3F73 A;  1JLC A;  2OPR A;  2XRI A;  3AVC A;  1TKT A;  1RBV A;  3NHG A;  4CK1 A;  4F2R A;  4Q5V A;  1FKP A;  4BDZ A;  1Q9Y A;  5EU7 A;  3DOK A;  5FRO A;  1KLN A;  3RTV A;  1J9A A;  4OKJ A;  4OGC A;  3ZT0 A;  2Y1J A;  2E6M A;  4O0I A;  1TAQ A;  3AVH A;  4HUF A;  5CY4 A;  3AO2 A;  3OYF A;  1TK0 A;  1RT5 A;  3OS1 A;  2KZM A;  1TKX A;  2HHS A;  3L3V A;  2FBV A;  3PX0 A;  4DSK A;  4KHQ A;  1BIS A;  3LWM A;  5T7B A;  3OYN A;  3SUO A;  3AO3 A;  3M8P A;  1NK4 A;  3LWL A;  3ASM A;  1S9E A;  2VG6 A;  3DLR A;  4JRP A;  3SQ4 A;  4ELT A;  1T8E A;  1IKX A;  1S6Q A;  4IFV A;  3AVF A;  3OYE A;  4HTU A;  4JS4 A;  3QEP A;  1L3U A;  1NOY A;  2DTU A;  3QIN A;  1WN7 A;  3C94 A;  4DG1 A;  4FYD A;  2GBZ A;  2RF2 A;  3OJS A;  2WOM A;  3S3O A;  2G8H A;  1UA0 A;  2QKK A;  4EZ9 A;  1D9D A;  4CK2 A;  4FM1 A;  1NK7 A;  1UA1 A;  1SL2 A;  4KI6 A;  3HJF A;  3AO4 A;  4CEB A;  4KHN A;  1ITG A;  4PA1 A;  4FJ8 A;  3NGI A;  2B4J A;  4H4M A;  4RG8 A;  3NCI A;  4CJQ A;  4DTM A;  4KB1 A;  4CEO A;  2XY5 A;  3MAQ A;  4FM0 A;  4C8K A;  4RW9 A;  3L2R A;  1QHT A;  4FZX C;  4W5N A;  3ZSV A;  3OYH A;  1BI4 A;  5C24 A;  3VQA A;  3JYT A;  4N5S A;  1X9W A;  4AHR A;  1TK8 A;  2PY5 A;  1BQM A;  1JLG A;  4TSX A;  1CZB A;  4CJE A;  4FJ7 A;  3LP1 A;  1XI1 A;  1X1P A;  1HMV A;  4CEZ A;  4B9L A;  3ZSY A;  4CHO A;  1BIU A;  3V6D A;  4M3X A;  1DLO A;  4O55 A;  4LY7 A;  3BDP A;  2X6S A;  3D45 A;  3DLK A;  3MED A;  4KTZ A;  4CEF A;  3OYA A;  4FJ5 A;  2I5J A;  2Z1J A;  1HPZ A;  5KI6 A;  4B9M A;  1YT3 A;  3NF6 A;  3PX4 A;  2P5O A;  4HCC A;  3DOL A;  2OPQ A;  3TAP A;  1IKW A;  1A5V A;  4O4G A;  3HO1 A;  3AO5 A;  4FLU A;  1WSE A;  3KLF A;  4E7J A;  3QEX A;  2XY6 A;  4OJR A;  4I2Q A;  1RT1 A;  4CJK A;  3PUF A;  1JLE A;  3S9H A;  1VSK A;  2ATQ A;  3OYK A;  4CHN A;  4DLG A;  4CIF A;  2LSN A;  3PO4 A;  5DK5 A;  2KFZ A;  3DYA A;  1YTA A;  1B9F A;  1QSL A;  4J2E A;  1RBU A;  1UOC A;  3ITH A;  3C6U A;  4CJV A;  1SKS A;  4KHS A;  4FK4 A;  1KVB A;  2IAJ A;  5JS2 A;  1VSD A;  4ZTF A;  1RTH A;  3V1R A;  3K5O A;  2YNG A;  4Y1D A;  3SI6 A;  3QET A;  2KZZ A;  4AHV A;  4FJH A;  3NE6 A;  3NF7 A;  4CE9 A;  1REV A;  1X9S A;  2D0A A;  4DLE A;  3ZT1 A;  3RRG A;  1VSL A;  4DWI A;  1F21 A;  4MQ3 A;  1I3A A;  3O3G A;  3KK3 A;  3RWU A;  2HHU A;  1QSS A;  3HVT A;  4QAG A;  2DY4 A;  4FK0 A;  4AH9 A;  3K5M A;  4N41 A;  2G8I A;  2XY7 A;  4QOZ B;  1BGX T;  4DQR A;  2HND A;  4RW8 A;  3EY1 A;  2X74 A;  4CGG A;  2HVI A;  3WNF A;  1NK8 A;  1U04 A;  3RMB A;  2PYL A;  1K6Y A;  3M8Q A;  1RT3 A;  4DTU A;  1L3T A;  3MEE A;  2OYQ A;  4F4K A;  3SUP A;  1QSY A;  3L2Q A;  1U45 A;  1KSP A;  4FK2 A;  2DFE A;  4FZZ A;  4FZY A;  1TKD A;  2HMI A;  2KQ2 A;  4GVM A;  4CGF A;  1RBS A;  4DFJ A;  3QEI A;  2OA8 A;  4I9L A;  4OVL A;  1C6V A;  4FLW A;  4LH4 A;  4BWJ A;  3SUQ A;  3KLG A;  3TWH A;  1HYZ A;  4E7I A;  1ZBU A;  2VWK A;  3SPY A;  3CYM A;  2B5J A;  3P83 D;  2FC0 A;  1TGO A;  2BE2 A;  3I0R A;  3ZSX A;  3VA3 A;  3HK2 A;  3AA4 A;  3TAF A;  3AVJ A;  1EXQ A;  1YVU A;  3NBP A;  1JLB A;  4MFB A;  5SWM A;  1KCF A;  4H4O A;  3RMC A;  3DLH A;  1SV5 A;  3C6T A;  4KKO A;  4AHC A;  3KD1 E;  4KB0 A;  3PV8 A;  1HJR A;  2OPP A;  1WAF A;  3HYF A;  3VQ6 A;  4RW4 A;  4YNQ A;  1X9M A;  4E7L A;  1KFS A;  4FJI A;  1RT2 A;  2DFF A;  1NKB A;  4I9Q A;  4FJN A;  5KGX A;  1VSJ A;  1KRP A;  3CFR A;  1A5X A;  4DSE A;  2Q3S A;  3NF9 A;  5I3U A;  3PX6 A;  4B08 A;  1QTM A;  4W5R A;  5HRS A;  1JL1 A;  3B6P A;  3QEV A;  3DRP A;  2YHB A;  5CZ1 A;  1G15 A;  2YV0 X;  3AA5 X;  3L2V A;  4N47 A;  1ZBL A;  4EP4 A;  4Y1C A;  3ISN C;  1YTU A;  2X6N A;  3HP9 A;  5KGW A;  3O4N A;  3V9S A;  2D0B A;  4FJK A;  4ZTJ A;  4PUO A;  2DFH A;  3VQ7 A;  3VQC A;  5K14 A;  3SJJ A;  3CM5 A;  3CQ8 A;  4FLZ A;  3ZSO A;  1WSF A;  3SQ1 A;  3DRR A;  1TV6 A;  1CXQ A;  3K59 A;  2QKB A;  1RBT A;  1RDB A;  1WSH A;  3KIO A;  4CEE A;  4B8A B;  5CYQ A;  3OYD A;  3SPZ A;  4K8X A;  1MU2 A;  5C42 A;  3NH2 A;  3KLE A;  3G0Z A;  4FLY A;  1NK5 A;  1NJY A;  3LP0 A;  3T19 A;  1S1X A;  4NYN A;  1NJX A;  5SZT A;  3LP2 A;  4K8Z A;  4F8R A;  1L3S A;  3SV4 A;  4E7K A;  4M3T A;  4FJ9 A;  1GOC A;  3L2U A;  3QO9 A;  2BGG A;  3TAN A;  1BIZ A;  1O1W A;  4B9V A;  3DM2 A;  2G8V A;  2JGU A;  2YHA A;  1BCM A;  2XY8 A;  3TI0 A;  4M42 A;  2Z1I A;  3OVN A;  3CFO A;  3NGY A;  4ID5 A;  2ZD1 A;  5D3G A;  2EX3 A;  3AVN A;  4OKE A;  2IC3 A;  4CED A;  3OYL A;  2O4G A;  5J2P A;  1B9D A;  4OLA A;  2RN2 A;  4R5P A;  3TAE A;  4F2S A;  1WSG A;  3HPO A;  4M45 A;  4B9T A;  1HQU A;  4CEC A;  2RPI A;  4FVM A;  3WNH A;  5JS1 A;  1W0H A;  4LSN A;  1NOZ A;  2Z1G A;  3LPU A;  4C8M A;  3VQ5 A;  3KJV A;  2ITG A;  4DTR A;  1RT4 A;  1RTD A;  1S1U A;  5J2N A;  3NDK A;  1RCH A;  4W5T A;  2HNY A;  1HNI A;  1SUQ A;  3AA2 A;  4Z4E A;  4ICL A;  4E89 A;  1VSI A;  1NK6 A;  4BWM A;  1VRT A;  1J5O A;  4W5Q A;  4CFB A;  3QLH A;  5HP1 A;  3G10 A;  3V1Q A;  1KVA A;  4J2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...