1CZBA

Atomic resolution asv integrase core domain from hepes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
147
structure length
141
Chain Sequence
b'GRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
total genus 55
structure length 141
sequence length 147
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1czbA00
3HT3A 3RTVA 3RR8A 4CJFA 1Z26A 3PUFA 3VA3A 4DS5A 1XWLA 3TI0A 4H4MA 1TK0A 2WOMA 2F96A 4CIFA 4OJRA 1D9FA 4FJHA 3VQAA 1JLBA 2A1SA 3IAYA 4NCAA 4DG1A 1NK8A 1NK6A 3PO5A 4ELVA 4KFBA 1BCMA 2FBXA 4KO0A 4DFPA 4M3RA 1U49A 1I3AA 1S9EA 4LSLA 1NJYA 3DM2A 2I5JA 4CEOA 3VQ4A 1I39A 2YNFA 3MEDA 1JL2A 1HYZA 3DRPA 3OS2A 4ICLA 3KKRA 4XIUA 5EU7A 4CJRA 3KLGA 1XHZA 2E4LA 3OYBA 1L3VA 1O1WA 2D0CA 3DRRA 2X74A 1FKPA 4CECA 2IC3A 3QNNA 4CJUA 1U47A 1N6QA 5FDLA 3F73A 4DF4A 2G8VA 4CGHA 4KRFA 5HRNA 3THVA 2RF2A 3K5MA 1GOAA 4Q0BA 1DTTA 2B5JA 4CFDA 3S9HA 3S3NA 3AO2A 1ASWA 1VSEA 2YHAA 3ZSYA 3V81A 2RPIA 2OPQA 3RMDA 1QSYA 3C94A 3NBPA 1JKHA 4KB0A 2F8SA 4CESA 3K5OA 4HTUA 1IH7A 4I2PA 2NUBA 3CFOA 4Z4EA 4RW7A 3SCXA 1J9AA 4C8KA 2B6AA 3LAMA 1U45A 3WNHA 2IDOA 1RDCA 1HYVA 1RDAA 2BGGA 3L3VA 2QKBA 1KTQA 2HB5A 4E7KA 3ZSRA 3A2FA 4AHVA 4OPKA 1Q9XA 1FK9A 3M8SA 4M3UA 3DLHA 3MECA 4EZ9A 1WAJA 1TL3A 4C8NA 4CJEA 1YTAA 5FRMA 1RTJA 3CFPA 4FJXA 4J2EA 4KV8A 2VG6A 1LWFA 4RW4A 4DU3A 4CJKA 3VQBA 4OPJA 4B9TA 4FK2A 1U48A 2EHGA 4JRQA 4FLZA 2OYQA 1YTUA 1REVA 2YHBA 3RWUA 1SV5A 2Z1HA 1S9GA 4CIGA 5HRPA 4Z4FA 4FW2A 5HLFA 1TK8A 3NGIA 3HPOA 5J2QA 3LP3A 2Y1JA 4HVJA 3OYHA 4DSEA 4KHSA 1J54A 4DTXA 4HHTA 3BGRA 5KI6A 4H8KA 4C8MA 3L2VA 4CJ4A 3C6UA 4EP4A 3AVBA 3M8QA 3OYJA 3I8DA 3L2RA 4DQSA 4FM1A 5DMRA 3QEVA 4F4KA 1A5WA 4RW8A 4KAZA 4Z4IA 4IBNA 4CJSA 2W42A 3RMAA 4FJNA 3AA3A 2KZZA 3AVHA 1GOBA 1Q8IA 2HHXA 1WSFA 2XO7A 2FBYA 4E7IA 3U6FA 3OVNA 4M45A 1JLQA 5KGWA 4ZTFA 2FBVA 1XC9A 2RN2A 4FJLA 3K2PA 3QNOA 2VWKA 4AILC 1WSGA 4ID5A 2XY7A 3TAQA 3V9SA 2P51A 4B9VA 3AA2A 5DK5A 2KW4A 4MQ3A 1BCOA 1KLMA 5FROA 1N5YA 4HCCA 3HP6A 4KHQA 4DQQA 2OPSA 2PZSA 1S1VA 3KLHA 3U3YA 3AVNA 3DLGA 1Y97A 3V9XA 4E7LA 3QESA 4FLTA 4FZYA 4CF0A 3OYAA 4BDYA 4E19A 4CHPA 3RR7A 3VQ7A 4CGFA 4DTMA 5KRSA 4KHYA 4DTSA 1WSJA 1EKEA 4CF1A 2G8WA 4FLUA 3SUPA 4BDPA 1BI4A 3SV4A 2HHSA 1RTIA 4O4GA 4OGCA 4B9UA 4CFBA 4CHOA 2B4JA 4FJMA 4KTZA 3OYEA 2Z1JA 1GOCA 1S1UA 1TKXA 4W5RA 4CF8A 1W9HA 3ASMA 4IFYA 4BE0A 2BANA 1EX4A 1DLOA 4DFKA 3RRHA 3V1QA 4HCBA 4FM2A 1RILA 3SPYA 3TANA 4E1MA 5C25A 1SKWA 1NK9A 4LY7A 1KRPA 4FLYA 1BL3A 4PQUA 4DSLA 2O4IA 1EXQA 2O4GA 3SQ2A 1NK4A 4L8RB 1HPZA 3KK1A 4DLGA 2KZMA 1TL1A 2G8KA 1ZYQA 3CG7A 2BE2A 3AVGA 4CEZA 1JLAA 3LP1A 3F9KA 3KK3A 4LD0A 4O0IA 3ZT3A 4Z4HA 3S3MA 1T8EA 4K8XA 5KRTA 3RMCA 1S1TA 3AVMA 3VQ8A 3NF9A 4CJVA 4CJ3A 1SKRA 3OYMA 4NYNA 1QSLA 1UWBA 3H08A 1VSDA 2HVHA 4O44A 1BQNA 4JS4A 3QERA 4BACA 1JL1A 2YKMA 4J2BA 1BIZA 4W5QA 3QEIA 3VQ5A 3ZSZA 4QOZB 1RDBA 2HNDA 4B9SA 3RRGA 4N41A 3OS0A 3IS9A 3PX0A 4FYDA 1BQMA 1LW2A 2VG7A 4GVMA 3T3FA 3G10A 1T05A 4F2RA 4FM0A 1BISA 1JLGA 2G8UA 1BIUA 3LZJA 3AVCA 3AVLA 3BDPA 4FW1A 3HJFA 3KJVA 2XY6A 1F21A 3KLEA 1QS4A 1NKBA 1ASVA 4IDKA 3JSMA 4CJQA 4EZ6A 4QAGA 4N47A 3HM9A 1B9DA 3SQ0A 4CHZA 1JLEA 2D5RA 4Z4CA 4RW9A 3HK2A 3KLIA 1BI4B 3L8BA 3OYGA 4Q5VA 3TABA 3O3FA 1QTMA 5D3GA 4B3OA 3NFAA 4H4OA 4B8AB 4M3YA 4NCGA 5J2NA 1HNVA 2E6MA 2RKIA 1KVBA 4LH5A 2EX3A 3B6PA 3OYLA 4OLBA 1TKDA 2GUIA 3CM5A 1IKXA 3LWMA 3ITHA 4Y1CA 3TAMA 1ZBUA 4DTPA 3NDKA 1SL1A 4YNQA 3SUOA 2HHQA 1WN7A 1X9WA 3AVKA 3HSTB 4J2AA 3DMJA 3HP9A 3DI6A 4IG3A 1LV5A 4FLWA 4OVLA 4JS5A 5J2MA 1VSMA 1VRUA 1L3SA 3I0RA 2D0AA 3C95A 4N5SA 4JLHA 3TARA 2OZSA 1KSPA 2Y1IA 2KFZA 4FVMA 4F2SA 2DFFA 1RT7A 2QXFA 4BDZA 3SV3A 1S1XA 3HVTA 3MXJA 4CEEA 3O3HA 4B9NA 1CXUA 1JLCA 1SL0A 3IRXA 1RTDA 1L5UA 4M3TA 3TAEA 4ELUA 3ZT4A 4W5TA 1SUQA 3VQ6A 4PY5A 5HBMA 4AHRA 3HYFA 4I9LA 3G0ZA 2G8IA 4OGEA 3SI6A 1IG9A 3CYMA 3HXMA 1RT4A 3ZT1A 1C6VA 1NKCA 1B9FA 4DQIA 4E3SA 4FJ9A 3P83D 4CJWA 4MFBA 4B08A 2OPPA 1NK5A 2DFHA 2OA8A 1XHXA 4B9MA 3HVRA 4R5PA 3PV8A 2JLEA 1WLJA 3KTQA 1NK0A 4KTWA 3D0PA 3PO4A 4I9QA 3K58A 1JXBA 4KTQA 2HHWA 3S3OA 1S6QA 2ZQBA 4FJ5A 1TAUA 3P5JA 3ISNC 5HRSA 3HPHA 1CLQA 3AO4A 1Z25A 2DTUA 3AVFA 4CJPA 1WSIA 1VSIA 3VQPA 4CGGA 5K14A 4DTUA 4FK0A 2LSNA 4OKEA 3P1GA 2OZMA 5T7BA 3TAGA 4DSFA 4NCBA 3K5LA 3LWLA 4N56A 1TK5A 1J5OA 4M41A 3ULDA 3V4IA 4IKFA 2OPRA 2DFEA 1B92A 1RBUA 2Q3SA 3NGYA 1G15A 3QEWA 3SJJA 1A5XA 3AVIA 3LP0A 5CYQA 3OYFA 4DS4A 1YT3A 5E41A 1UOCA 1WAFA 4OLAA 5HROA 1Q9YA 4ZTJA 1TAQA 1JLFA 4CE9A 2FBTA 4DSIA 4O55A 2G8HA 1RBSA 2AJQA 1IO2A 3NGZA 4DU4A 1YVUA 4O5BA 4CJTA 3LPUA 3LP2A 1RT3A 2GV9A 4KHNA 4E89A 3WNEA 4DLEA 1VSHA 3DRSA 3WNFA 4AHCA 2HMIA 2KFNA 1KVAA 4FJIA 1KFDA 1KVCA 4KI4A 3DOKA 4CJLA 3MEGA 3O4QA 4CK2A 3AV9A 3VQDA 4E7JA 4KI6A 3MXMA 3M8PA 4AHUA 3QEXA 5KGXA 4YFUA 3EY1A 1NJXA 4DSJA 2ETJA 3NCIA 3OYNA 3EZ5A 1CZBA 3NE6A 3CQ8A 3SQ4A 5JS1A 4CJ5A 3TAPA 3OY9A 1IKWA 1RCHA 4CEBA 3DLBA 1XI1A 1R0AA 3KIOA 3TWHA 2VG5A 1LAVA 1MU2A 2HHUA 4LH4A 1HNIA 1CZ9A 2IGIA 2Z1GA 4DMNA 3NH1A 4KREA 3DLKA 4FCYA 2YNIA 3O3GA 3EYZA 3OJSA 5J2PA 1EETA 3MAQA 1QSSA 3FFIA 5CYMA 1RNHA 3V1OA 3VQEA 3VQQA 3DOLA 4CEQA 2IAJA 2KTQA 1C1CA 4DTJA 4PWDA 4IG0A 3KKSA 3O4NA 2PY5A 4FLVA 1RBTA 3VQCA 4Y1DA 3SYZA 2KQ2A 1RTHA 4GW6A 4BE2A 3CM6A 1NOZA 5JS2A 3ZCMA 4W5NA 1A5VA 1T7PA 3NH0A 1C0TA 4OKKA 2BDPA 4FK4A 3LALA 4Z4GA 4FXDA 2XHBA 3RMBA 4Z0UA 4JRPA 1TKTA 2YNGA 3CFRA 3QEPA 5CZ1A 4KPYA 4DFJA 1WNSA 2G8FA 3T19A 4KKOA 4KHWA 4M42A 4BWMA 3V9UA 2WONA 3IG1A 3ZSQA 4J2DA 3MEEA 2IS3A 4CGIA 4DQPA 3QLHA 1ZBLA 3ZT2A 2HNYA 1NKEA 4ID1A 1BHLA 1C1AA 1U04A 3V1RA 3SUNA 2F8TA 1LWCA 1QQCA 1RT5A 3AO3A 4I2QA 4E7HA 4CK1A 3U3GA 3T1AA 3ZSWA 1T03A 4HUEA 1ZBHA 2XY5A 1VSJA 1D9DA 3E01A 4F3OA 2XRIA 1BGXT 1HYSA 3QIPA 3SPZA 3QETA 1HRHA 2YKNA 1X9SA 1C0MA 4M3XA 3SQ1A 3ZSXA 3TR8A 1RDDA 1X9MA 2E6LA 3L2UA 4DWIA 1FXXA 2A1RA 4CEFA 4CHNA 1QHTA 4ZHRA 3V6DA 3PX4A 1IKVA 3OYKA 3V9ZA 2X6NA 3OS1A 1X1PA 4I7FA 5SWMA 2P1JA 3L3UA 2IOCA 1EP4A 1WSHA 2X78A 3NF8A 1RT6A 1S5JA 2XY8A 4O0JA 4WE1A 3K5NA 5I42A 4E0DA 4FZXC 1ASUA 3SUQA 3LPTA 4FJKA 4DQRA 2D0BA 1S1WA 3DLRA 4CEAA 3NAEA 4C8LA 3NF7A 3NH2A 1ZBIA 1QE1A 3NF6A 3DYAA 3KK2A 4N76A 2HHVA 3L2WA 1UA1A 4KHUA 2VWJA 1L3TA 3WNGA 1LW0A 3ZSOA 1KLNA 1HQUA 3PY8A 4M3ZA 4NYFA 1VRTA 1U4BA 3DLEA 4CGDA 2FC0A 2P5GA 3UIQA 1TKZA 3JYTA 2ATQA 2ZE2A 4PUOA 4C8OA 3OJUA 4CF9A 4DSKA 3OYIA 3AA5X 4CEDA 4CIEA 4DU1A 3I0SA 3QO9A 3TAFA 5C42A 2PYLA 4GMJB 3AA4A 3AVJA 4PA1A 5HRRA 4EP5A 3SZ2A 4K8ZA 1VSKA 5HP1A 4CERA 1SKSA 1W0HA 2QK9A 1JXEA 3ZSVA 5KTQA 5CZ2A 3QIOA 4FJ8A 1UA0A 1UAXA 3ZT0A 4CK3A 3HL8A 5C24A 4IFVA 1RBVA 4CHQA 3L2QA 3QINA 2HHTA 1RBRA 4BWJA 3B6OA 1S6PA 3OYCA 1VSLA 3AO5A 2PYJA 3HO1A 1DTQA 2ITGA 1IKYA 3K57A 3KD5E 3M8RA 4F8RA 4FJ7A 5FRNA 5CY4A 1WSEA 2YNHA 3LDSA 2JGUA 3D45A 4RW6A 1KFSA 1FKOA 2X6SA 1NJZA 2ZD1A 1CXQA 1TV6A 4HUGA 3ALYA 1J53A 1LAWA 2Z1IA 4DFMA 1C1BA 4BE1A 4ELTA 1LWEA 3K59A 2HW3A 4FZZA 1TVRA 4HUFA 4B9LA 1D5AA 4DTNA 3SNNA 2HVIA 4OKJA 4CFCA 3LAKA 2QKKA 3PX6A 4DTRA 3KLFA 1RT2A 5I3UA 1ITGA 5SZTA 1HJRA 1ZBFA 4CF2A 4DF8A 1NK7A 3V9WA 1VK0A 3LANA 2R7YA 1HMVA 2DY4A 1TGOA 1K6YA 4KB1A 3MXIA 4M3WA 4UQGA 2P5OA 3AO1A 4G1QA 3VQ9A 4F3TA 3NHGA 1NOYA 1NJWA 4FJGA 4AH9A 4LSNA 4AHTA 1RT1A 4AHSA 4CFAA 4TSXA 4W5OA 4FLXA 3KD1E 4CCHA 3HPGA 3C6TA 1HQEA 1D8YA 3VN5A 1C0UA 1VSFA 4B8CA 4CGJA 1SL2A 1L3UA 2HNZA 4QCLA 2YV0X 4CHYA 4DTOA 4E1NA 3AVAA 3OYDA 4FJJA 1KCFA 3LZIA 2GBZA 4RG8A 5J1EA 3VA0A
chains in the Genus database with same CATH superfamily
3HT3A 1H1VA 3TI0A 3O9UA 4H4MA 1TK0A 2JWLA 3IAYA 4NCAA 4K42A 4LSLA 3DM2A 3LDQA 4GY2B 2UUBK 3MDQA 4YOUA 4XIUA 4XH1A 4MLEA 4FWKA 3KVGA 5A2QO 3MK6A 4CJUA 3CCEN 4KRFA 5HRNA 4YORA 2ZWHA 2B5JA 4GVEA 3JS6A 3K9JA 3S3NA 1ASWA 1VSEA 2YHAA 2RPIA 2NRXA 3NBPA 3O9QA 4CESA 4LF9K 2ASOA 3K5OA 1IH7A 4Z4EA 4C8KA 1MDUB 2IDOA 4NLBA 3G6EN 4IEIA 2UXDK 2QM1A 3A2FA 1Q9XA 3UB5A 3DLHA 4EZ9A 3CQYA 1OH6A 1ESVA 3CFPA 3H1QA 4DU3A 3FE1A 3J80O 2BH1A 3O9SA 3FGUA 1U48A 2EHGA 3K9KA 4JRQA 1QHAA 4CZEA 1REVA 2Z1HA 4Z4FA 1TK8A 2E8AA 3HPOA 3NGIA 5J2QA 3LP3A 4DSEA 3I8BA 2UU9K 4FOIA 1ZXOA 4H8KA 1W7AA 5AQVA 1X9SA 3AVBA 3I8DA 4FM1A 2UUAK 4KAZA 1QZ6A 5EOYA 3D2EA 3RSEB 2ZJRL 1FW6A 4E7IA 4M45A 5AFUH 2FBVA 2VQFK 3TSQA 1ZBSA 2VWKA 4AILC 2RE2A 3E9PA 2KW4A 2IVOA 5FROA 4DQQA 4M7XA 1VQ7N 2CGLA 2NRZA 4JI0K 3TPQA 3ULEB 1Y64A 3QESA 4FLTA 4PL7A 1Q86O 4FWPA 2V7YA 3A5MC 4JI6K 5KRSA 4DR2K 4KHYA 3WQUA 4CF1A 4BVOA 3SV4A 1RTIA 4OGCA 1R59O 4CFBA 2A40A 3VERA 2Z1JA 1M1KO 4IFYA 4BE0A 1EX4A 1DLOA 4DFKA 3RRHA 3TSPA 1VQLN 5I9EB 3SMPA 4DV3K 4LY7A 3GG4A 4DSLA 3KK1A 1TL1A 3C0BA 3H45C 3CG7A 3BF1A 2BE2A 4WQ4C 3CIPA 3CHWA 3ZT3A 1T8EA 3KWIA 3MN7A 3VQ8A 3THYB 4CJ3A 1UWBA 1BQNA 3QERA 4BACA 1JL1A 4W5QA 4QOZB 4JD2B 4A57A 3RRGA 3WXLA 3IS9A 4FYDA 1BQMA 3KHYA 4GVMA 4YOXA 1JCGA 3CCUN 2QWRA 2QEXN 3AVCA 3HJFA 3PSIA 3VGKA 3KLEA 4IDKA 3JSMA 4BRGA 3HM9A 3SQ0A 3DXKA 4CHZA 2D5RA 3HK2A 4Q5VA 2I7PA 4M3YA 1NBWA 3U9DA 2VQEK 2RKIA 3U8XA 4H0XB 4BC2A 5FLXO 4Y1CA 1ZBUA 1WN7A 4J2AA 3DMJA 4IG3A 3DI6A 4GV9A 4OVLA 3U9ZA 1VRUA 4N5SA 1RGIA 4CW7B 2OZSA 1KSPA 4JK9A 3UE5A 2QXFA 1EWQA 4BDZA 3SV3A 3TTCA 4CEEA 3O3HA 4B9NA 1S22A 1CXUA 1RTDA 2PAVA 3TAEA 5C12A 3VQ6A 4I9LA 1TYQA 4OGEA 4G9ZA 3HXMA 5AQWA 3ZT1A 1NKCA 1EWRA 3P83D 4B08A 2OPPA 2E1YA 2QXLA 5JMVA 1XHXA 5ADXA 4R5PA 3PV8A 4A2BA 4KTWA 1BA1A 5AQGA 3K58A 4DB3A 3S3OA 4NXNK 1NGCA 3BEXA 3P5JA 2DTUA 2HF3A 3AVFA 4CJPA 1VSIA 2HSTA 5K14A 4JI5K 2LSNA 5T7BA 4DSFA 3LWLA 5AQJA 3NGYA 1G15A 3VTHA 1YT3A 4JYAK 4BRFA 5HROA 1Q9YA 1J6ZA 4CE9A 2AJQA 1IO2A 3E9LA 4CJTA 4O5BA 3LPUA 3LP2A 1XC3A 4KH5A 3IMXA 3A5LC 3WNEA 4A2AA 3DRSA 2HMIA 2D0PA 3EO3A 5BRFA 2D1KA 3HTVA 3O5BA 4E7JA 2KKZA 4IWVA 3MXMA 5AQMA 4JEPA 5KGXA 4YFUA 3EY1A 2ETJA 4FL9A 2Q0RA 3EZ5A 3SQ4A 3TAPA 1NGGA 1R0AA 1LAVA 1MU2A 3NH1A 3WXIA 3LM9A 4BGAA 2YNIA 5M1FA 3OJSA 3KWGA 3MAQA 4KH6A 2GWKA 5CYMA 2V51B 3VQQA 4BRNA 4CEQA 4DTJA 4PWDA 1XUPO 3SYZA 4WFBL 2KQ2A 3ZCMA 3NH0A 1C0TA 5IWAK 4OKKA 2BDPA 3LALA 4Z0UA 4JRPA 1HUXA 3IFRA 4YOVA 4LF5K 4DFJA 1WNSA 4M42A 4BWMA 3VEWA 3MEEA 2P9SA 2YJFA 4CGIA 4CZMA 1NKEA 3KK7A 1BHLA 1C1AA 2VYPA 4JI8K 5GAGP 3SUNA 1V4SA 3U3GA 1T03A 4BG9A 1P8ZA 4NLCA 3ENBA 3QIPA 3SPZA 1V4TA 2F4VK 3CJ7A 4M3XA 2UYTA 4CEFA 2X6NA 4EIAA 2QWPA 1EP4A 1WSHA 1NGIA 1RT6A 2YHXA 4JKGB 2A3ZA 3SUQA 2P9NA 3LPTA 4FJKA 5AQKA 4DQRA 4C8LA 3EE9A 1QE1A 3NF6A 3KK2A 2HHVA 4A5AA 2VWJA 1L3TA 3CPEA 3WNGA 2GEMA 1LW0A 3ZSOA 1KLNA 1HQUA 3QB0A 4EFHA 4CGDA 2FC0A 2P5GA 3SBTA 5M1OA 3JYTA 3JAMO 3THXA 1DEJA 3OYIA 3AA5X 3TAFA 3FZHA 5C42A 4GMJB 3AVJA 5KPTA 1QVFM 3O9RA 5CZ2A 3PIPL 1UAXA 5C24A 4IFVA 2YHYA 4BWJA 3B6OA 3AO5A 1DTQA 5AFUA 1IKYA 4K41A 3M8RA 5CY4A 1WSEA 2PFUA 3LDSA 3ZEUB 3AARA 4RW6A 4FWNA 2X6SA 2QWLA 4HUGA 1LAWA 2QWOA 3K59A 4CFCA 3PX6A 4DTRA 3R1XA 5BN9A 5I3UA 5AZJA 3VF4A 4A62A 1ZBFA 2NRWA 1YJWN 2OCEA 2R7YA 2DY4A 1TGOA 2P5OA 3FZLA 3VQ9A 4DV5K 4IEEA 1YVNA 2P9KA 1NGEA 1NOYA 1NJWA 2GTDA 4CFAA 4AHSA 2CGJA 2FSJA 2ZF5O 4FPAA 4CVNE 3CXCM 2QWMA 4DTOA 3OYDA 4BQLA 5DM6L 1GLCG 3RTVA 3PUFA 3VA3A 1CZAN 4B3TK 3L0QA 1D9FA 4FJHA 2A1SA 4M63C 3PO5A 4DV6K 1NK6A 2W41A 1BCMA 2FBXA 1WBBA 2VCPA 4M3RA 1U49A 2ZJQL 1S9EA 5GIOA 4DV1K 3L4IA 3DRPA 3OS2A 4ICLA 5EU7A 3KLGA 4BRQA 4WQ5C 1XHZA 3HZ6A 1O1WA 4CECA 4IZ9A 2IC3A 1QZ5A 3QNNA 1N6QA 1OH5A 2GELA 2V52B 5FDLA 4FWSA 3F9MA 4CBXA 4CGHA 3DLLL 3LDPA 3UKUA 4MDAA 3HOSA 4DUYK 3S9HA 3V81A 1K8KB 3RMDA 1JKHA 3ZETB 4HTUA 3BZCA 2WUSA 4WFNL 3SCXA 3LAMA 1RDAA 3MWPA 2BGGA 3D2FA 3L3VA 1KTQA 4Y0WA 4ILHA 1RDUA 4M3UA 3MECA 4CJEA 4PKGA 3CMEN 4J2EA 2A41A 4JI1K 1ATSA 4OPJA 2O8CA 1YTUA 3RWUA 1SV5A 3FLCO 5C0YA 1YI2N 3WUHA 3OYHA 1J54A 4DTXA 4HHTA 3J8AA 4C8MA 3OYJA 4DQSA 3TTDA 4F4KA 4RW8A 4MO4A 4CJSA 3HI0A 4DUZK 1GOBA 3CPWM 3U6FA 5LJVA 3J7ZO 3CERA 5KGWA 4ZTFA 3EEQA 3H3OB 4B1YB 3AA2A 5DK5A 1N5YA 2QKBA 2ASPA 4JKAA 1S1VA 3U3YA 4CZLA 1Y97A 5AJ3K 1OVYA 4LF4K 3D2FB 4FZYA 3OHRA 3RR7A 1WSJA 1EKEA 2KHOA 2G8WA 4FLUA 4BDPA 1BI4A 2P9LB 5AQNA 2ITMA 1GOCA 4C23A 1XMQK 4CF8A 1W9HA 4IFEA 1VQ4N 3PSFA 4CZIA 4CI6A 4FM2A 4JHDA 4AM6A 4U7BA 3H3NO 1SKWA 1NK9A 3SBGA 4PQUA 4JI7K 2O4IA 2HBKA 2O4GA 3FZMA 1HPZA 2G8KA 2J4RA 5LMUK 3F9KA 3S3MA 2P9UB 4Z4HA 2Q1NA 2W6KA 5KRTA 3RMCA 4ISGA 4DV2K 4CJVA 4B1WB 1SKRA 3OYMA 4NYNA 3H08A 3TTFA 4O44A 2YKMA 4H0PA 3OBYA 5AZIA 4B9SA 2UUCK 3OS0A 3PX0A 2O8DB 4BRCA 1LW2A 1BO5O 1T05A 3G10A 3QFPA 4FWLA 1JLGA 1BIUA 3P38A 5AQXA 3LZJA 3Q7BA 3BDPA 2OTJN 1QS4A 1ASVA 5F2RA 4O8KA 3ZX0A 4CJQA 4EZ6A 4QAGA 1B9DA 1JLEA 4Z4CA 1VQ6N 3WXJA 4BC4A 3KLIA 1BI4B 3QBXA 5D3GA 4B3OA 3NFAA 4H4OA 4B8AB 4EHUA 3NVMA 3AGKA 3ZYYX 1DGKN 3OYLA 4ILGB 2GUIA 3CM5A 5HLFA 2E5LK 1NMDA 4YNQA 1KQSM 3HOTA 3AVKA 4CZFA 3HP9A 1NGJA 1LV5A 3D7EO 5CR4A 1IBKK 3TARA 3C95A 4PL8A 2NRRA 1Q81O 2KFZA 4F2SA 4BR5A 2DFFA 2QA4N 1JLCA 3P4IA 3ZT4A 4CZHA 4B3MK 1GLLO 2G8IA 3G0ZA 4BRAA 4YDUC 2WTUA 1IG9A 3O1WA 1RT4A 1NLVA 1C6VA 4E3SA 4QS9A 4CJWA 4MFBA 2DFHA 1JCFA 5GADP 2P9PA 4FWOA 3VGMA 1N8RO 3ATVA 4BR2A 2GX9A 2FSNA 1HR0K 1HNXK 3KTQA 1Q7YO 3MN5A 3EE8A 4KTQA 3M6GA 2ZJPL 2ZQBA 1TAUA 1CLQA 1BG3A 1Z25A 1WSIA 2W40A 4CGGA 3O8MA 4FK0A 4OKEA 4BRPA 2WFBA 3P1GA 2OZMA 5BPLA 1KD1O 3EZWA 4AF1A 3O4WA 3K5LA 1K9MO 4B3RK 3CJ9A 3V4IA 3RVCA 4DV0K 1RBUA 3H6EA 4H5TA 3VENA 3QEWA 4DQ8A 1OKJA 1A5XA 3LP0A 4BROA 1U2VA 1WAFA 5CE3A 4OLAA 1Z05A 5KPZA 4ZTJA 4DSIA 1YJNN 1LOTB 5C2DA 2JWKA 4FWMA 3DJCA 1RT3A 2GV9A 4KHNA 2YHWA 4DLEA 4CD3A 2KFNA 1KVAA 1KFDA 4CJLA 3AGRA 4CK2A 4DHYA 1KAYA 3VQDA 4BRHA 3M8PA 3QEXA 4DSJA 1NJXA 5AQLA 3LM2A 3OYNA 1IJJA 3CQ8A 4CJ5A 1RCHA 3KIOA 3TWHA 2HHUA 3J7AP 4JKFA 1CZ9A 2IGIA 3DLKA 4FCYA 3O9TA 3O3GA 3D2EB 3FFIA 5GINA 4PKIA 4LFAK 3WEEA 1YAGA 2KLAA 2IAJA 1WBDA 3PLAA 4IG0A 1KC8O 4Y1DA 3CM6A 1A5VA 1T7PA 1U6ZA 1NGDA 4FK4A 4Z4GA 5H1SQ 3RMBA 2A5XA 1TKTA 4BRLA 3QEPA 2Q31A 3QBWA 2G8FA 3T19A 4QS7A 4KHWA 3IG1A 3ZSQA 2IS3A 1ZBLA 3Q7CA 4ID1A 1U04A 4IJAA 2CH5A 3V1RA 1LWCA 3EL2A 3IKMA 4I2QA 2AP1A 4FWRA 2QW9A 3T1AA 3ZSWA 4HUEA 1N34K 3BY5A 1VSJA 2XY5A 3E01A 4F3OA 2XRIA 3OA9A 3W3DA 1BGXT 1HYSA 3ENHA 1GLFO 3QETA 4DR4K 4DWIA 3ZSXA 2HBJA 2F7TA 1RFQA 3V6DA 3OYKA 3OS1A 4I7FA 3G25A 3BZKA 2IOCA 3NF8A 3SAHA 3T1HK 1NGBA 5I42A 3ZLJA 1ASUA 2A42A 2DPNA 1KAXA 1S1WA 2I7NA 3NAEA 1C0GA 1MWKA 3ZX2A 4A59A 3NH2A 4IOXA 1ZBIA 5JLFA 3DXKB 5LY3A 4DV7K 5EX5A 3B8AX 4K25A 4R79A 1WB9A 4NYFA 4OX9K 1U4BA 3VPZA 4CF9A 1SAZA 3CCSN 4CEDA 3I0SA 5M1QA 3AA4A 4PA1A 4EP5A 4F9OA 3SZ2A 4O8UA 1VSKA 5HP1A 1W0HA 3LDNA 1JXEA 2QK9A 4CZKA 3QIOA 5BPMA 1YJ9N 4CK3A 3HL8A 2QWQA 2HHTA 3L2QA 1TYQB 1RBRA 3CJCA 2OANA 3OYCA 1IBMK 1VQON 3K57A 5FRNA 5KQDA 3D45A 3EN9A 1KFSA 1FKOA 4C1NK 1TV6A 1C1BA 4BE1A 4GNIA 4ELTA 1LWEA 2HW3A 1G99A 4WF9L 1TVRA 4B9LA 1D5AA 2HVIA 4FO0A 2GUPA 3MX2A 5EXWA 3DXMA 2NZTA 1YHQN 1VK0A 1XQSC 3HRGA 1K6YA 4KB1A 3THWA 4UQGA 3AO1A 4F3TA 3CJ1A 5AQQA 4FJGA 4LSNA 1RT1A 4FLXA 4XEIA 4JI4K 4PHTX 4O5FA 4B8CA 3J81O 1NWKA 2YV0X 4BQZA 4A61A 5LJWA 1KCFA 3BP8A 3LZIA 4RG8A 5J1EA 2O8BA 5BREA 3VETA 1JLBA 2HHQA 3M3ZA 4DG1A 5BR8K 1I94K 2FF3B 2I5JA 2D0OA 1I39A 2BTFA 1T44A 1HYZA 2YNFA 4H0VB 3MN6A 4H5WA 1L3VA 4CJRA 3VESA 2E4LA 2O8EA 2O8FA 2D0CA 3DRRA 2X74A 1YXQA 3MWTA 3F73A 2G8VA 2P9IA 3VF6A 3THVA 3K5MA 1DTTA 2GWJA 2OPQA 4ILJA 1QSYA 4KB0A 2F8SA 3U4LA 2IVNA 4I2PA 2UXCK 4JI3K 3CFOA 4RW7A 1J9AA 1KAZA 3WNHA 1RDCA 1HYVA 3MX5A 2HHHK 3R9PA 2HB5A 4AHVA 4JK7A 4OPKA 5BR9A 3M8SA 2BUPA 1WAJA 2HBMA 4M7YA 1RTJA 4FJXA 4KV8A 5AQHA 1LWFA 4RW4A 4B9TA 2P9SB 4B1VA 2YHBA 1S9GA 4CIGA 5HRPA 2FSKA 4HVJA 1MA9B 1X3NA 4KHSA 1BUPA 4YHHK 3BGRA 2V7ZA 3CC4N 3QEVA 1VQPN 5DMRA 1A5WA 4Z4IA 2W42A 3CCLN 2P9IB 3AA3A 3FZKA 2KZZA 1Q8IA 2A6AA 2HHXA 1WSFA 4BVPA 3IDHA 1K8AO 3OVNA 1GLBG 1JLQA 4FJLA 3K2PA 1VQKN 3V9SA 2P51A 4MQ3A 1BCOA 3HP6A 4KHQA 2OPSA 3KLHA 1NGFA 3AVNA 3DLGA 1GLJO 2P9NB 3SAGA 4CF0A 4X66K 3CD6N 3VQ7A 4CGFA 3VTIA 1S72N 4JKDA 5IT9O 4V19S 4B9UA 4FJMA 2B4JA 4KTZA 3OYEA 1TKXA 4GKJK 5AQOA 3G71N 3ASMA 2BANA 3V1QA 3SPYA 3TANA 5C25A 4IDHA 3THXB 1BL3A 1NK4A 4CZGA 4DLGA 1ZYQA 4DR7K 4CEZA 1NGHA 4LD0A 4K8XA 1S1TA 3AVMA 4A5BA 3NF9A 4X65K 3T1YK 1QSLA 2NRHA 2HVHA 3GBTA 2E88A 4PKHA 3SLCA 3ZSZA 1RDBA 2HNDA 2VG7A 4I6MA 5AQPA 3W0LA 4F2RA 4H5NA 2G8UA 1IV0A 4FWQA 1ATRA 3AVLA 4FW1A 4WFAL 1F21A 3GE1A 3I33A 4AM7A 5AZJB 4B9QA 3CC7N 3TABA 4NCGA 4J8FA 5J2NA 1KVBA 2EX3A 3B6PA 1FJGK 4OLBA 1TKDA 1SL1A 1IKXA 3LWMA 3ITHA 2P9KB 5HL7L 3NDKA 3SUOA 3CCRN 3ID6A 1NGAA 1QQMA 4NB4A 4FLWA 1L3SA 1VSMA 1IG8A 1OH8A 5GAHP 4FVMA 4JKCA 1RT7A 4BC3A 1S1XA 1ZC6A 3HVTA 4CBWA 3CCMN 4U67L 4M3TA 5BRHA 5M1NA 2WC9A 5AQZA 3VOVA 1EQYA 4PY5A 5HBMA 4FOEA 3L4QA 2QI2A 3P31A 4GV3A 3SI6A 3VEYA 4DQIA 1B9FA 1NU0A 5JVGL 1NK5A 5ADXH 3AAQA 4B9MA 3NVKA 5GIPA 2JLEA 1WLJA 1OH7A 3G4SN 1NK0A 2Q2RA 3D0PA 4I9QA 2HHWA 4FJ5A 5JLHA 1BDGA 1VQ9N 4DTUA 4BR7A 5FPMA 3UKUB 4BR9A 5TKWA 1TK5A 4N56A 1J5OA 4M41A 3CI5A 1OVQA 2OPRA 2HMPA 3AVIA 3SJHA 1DT9A 5E41A 1UOCA 3R8EA 1HKBA 3C65A 1TAQA 2FBTA 4O55A 4CZJA 2G8HA 3JXUA 1RBSA 3OTOK 3CJBA 3NGZA 4H5VA 3BUZB 1YVUA 3CMAN 5F1XA 4E89A 3OW2M 2YCHA 3DOKA 4OPAA 3P39A 5BRDA 2O8CB 4KI6A 1HPMA 1SZ2A 4AHUA 4WQ4A 1CZBA 3J7YP 4AQYK 5JS1A 2VGNA 4WCEL 3OY9A 1IKWA 3DLBA 1XI1A 2VG5A 3IUCA 3A5OC 4LH4A 1HNIA 1VQ5N 3R6MA 2W6LA 4DMNA 5C2FA 4KREA 1E3MA 4UY8O 3EYZA 2E2OA 4LF7K 2UXBK 5J2PA 3CF5L 3GDQA 1BU6O 1HKCA 1YIJN 3DWLA 4QS8A 3VQEA 5C15A 2E2QA 3DOLA 3KKSA 2PY5A 3VQCA 1HLUA 2Q97A 4GW6A 1S3XA 1NOZA 5JS2A 4YOTA 1BA0A 4H0YB 4ISFA 4FXDA 5BPNA 4BRKA 4KH4A 2YNGA 3CFRA 5CZ1A 4KKOA 2WONA 3ZT2A 2HNYA 4H03B 2F8TA 5B8HA 1RT5A 3AO3A 4JHDB 4E7HA 1ZBHA 1D9DA 1T3VA 4KHPK 4JN4A 1HRHA 1C0FA 3RSEA 4EHTA 3M1FA 1FXXA 2A1RA 4CHNA 1QHTA 3V9ZA 1BOTO 2P1JA 5AZIB 4JKBA 2X78A 1S5JA 2XY8A 4O0JA 3WXKA 4FZXC 3ULEA 4DKWA 2D0BA 2Q36A 1YUWA 3DLRA 4CEAA 3NF7A 3DYAA 4N76A 3L2WA 1UA1A 4BGBA 4KHUA 3VEOA 3EKUA 4IOCL 4M3ZA 1VRTA 4YOWA 4JNEA 3VF2A 1TKZA 2QTDA 2ATQA 4PUOA 4C8OA 3OJUA 4DSKA 4CIEA 5F0XA 4DU1A 3QO9A 4DCHA 3TU5A 4K8ZA 4JI2K 4CERA 1SKSA 5JICA 3ZX3A 3ZT0A 1RBVA 4CD1A 4CHQA 1EO1A 2IIRA 3THYA 1S6PA 2PYJA 1VSLA 2WBNA 3KD5E 1VQNN 4FJ7A 4JD2A 3WQTA 1NG9A 1NJZA 2ZD1A 2P9PB 1CXQA 1J53A 2Z1IA 4DFMA 2EWSA 3CQXA 5LL6Z 1X3MA 1VQ8N 4CJ7A 3SNNA 4OKJA 3LAKA 2QKKA 4X64K 2VWBA 1ITGA 1NJIO 1Z6RA 5SZTA 4BC5A 1HJRA 4CF2A 4LC9B 3NHGA 4AH9A 4W5OA 3KD1E 1N36K 1U2VB 4CCHA 4LF8K 1HKGA 3C6TA 3HPGA 1D8YA 4CGJA 2NNWA 3CJAA 1L3UA 2HNZA 1J5EK 4QCLA 3N4QA 5AQTA 4FJJA 5AQIA 2GBZA 5CHIA 4BRDA 3CC2N 3RR8A 4CJFA 1Z26A 4YOYA 4DS5A 1XWLA 2WOMA 2F96A 4CIFA 4OJRA 3VQAA 1NK8A 4ELVA 4KFBA 5FPDA 4KO0A 4DFPA 1I3AA 1NJYA 4CEOA 3VQ4A 3MEDA 1JL2A 5M1PA 3VEZA 1XMOK 3KKRA 4BY9C 3OYBA 3QDKA 4MLHA 1FKPA 4NO7A 3CCQN 1U47A 4BREA 2PBDA 4LF6K 5E84A 4DF4A 4B1ZA 2F9WA 5M1KA 1N32K 2RF2A 1GOAA 4Q0BA 4H0OA 3S41A 5KQ8A 5FPNA 4CFDA 3WEEB 3AO2A 3ZSYA 3C6HA 3C94A 3OBWA 1HJOA 3LDOA 2NUBA 1GLDG 2B6AA 1U45A 3FZFA 3VMFB 1QVGM 4E7KA 3ZSRA 4IOAL 3A5NC 1YF5L 1FK9A 3CCVN 4NXMK 1BWFO 1TL3A 4C8NA 1YTAA 2E2NA 3VGLA 5FRMA 3I55N 4JV5K 2VG6A 4CJKA 3VQBA 1JCEA 4FK2A 4FLZA 2E1ZA 1E4GT 3O1BA 2OYQA 1T6CA 1ATNA 4FW2A 1Q18A 3QICA 5E26A 4IO9L 3VEVA 4JAXA 2Y1JA 4IXCA 4RCHA 5KI6A 3L2VA 4CJ4A 3C6UA 4EP4A 3M8QA 3L2RA 3SMSA 4DR6K 4IBNA 4FJNA 3RMAA 3AVHA 2XO7A 3M5RA 2FBYA 1MWMA 1XC9A 1IBLK 2RN2A 3QNOA 2XY7A 1O13A 1WSGA 4ID5A 3TAQA 4B9VA 4HCCA 1KLMA 3I56N 2PZSA 3V9XA 3ENOA 4E7LA 1VQMN 3OYAA 4BDYA 4E19A 4OO1J 4CHPA 4DTMA 3O6WA 4DTSA 3SUPA 3E1YA 2HHSA 2E2PA 2RHKA 3ATUA 3WXMB 4O4GA 4CHOA 4W5RA 1S1UA 3MMVA 4HWIA 5BN8A 3D6RA 1W2BM 4HCBA 1RILA 4E1MA 1N33K 1KRPA 4FLYA 1D4XA 3FR0A 1EXQA 3SQ2A 4L8RB 4EAHD 2KZMA 2E20A 1GLEG 5EVZA 3AVGA 4BR4A 4DR5K 1JLAA 3LP1A 3UKRA 3KK3A 4O0IA 3E9OA 3ID8A 3SAFA 2ZGZA 4JKEA 1KXPA 1VSDA 4WQ5A 4JS4A 4J2BA 1BIZA 3QEIA 3VQ5A 4N41A 4XH4A 4JKGA 3LDLA 3T3FA 5AQYA 4FM0A 1BISA 4RTFD 2QWNA 3KJVA 2XY6A 1VHXA 1NKBA 3GL1A 1XNRK 4N47A 5JVHL 3DXMB 4RW9A 1HNZK 3L8BA 3OYGA 3O3FA 1QTMA 1XNQK 1HNVA 2E6MA 4LH5A 5HOOA 3THWB 1Q82O 4H0TB 4DTPA 3TAMA 1NM1A 1X9WA 3HSTB 4H5RA 2H3GX 3N4PA 4MDBA 5J2MA 5AQRA 4JS5A 3AAPA 3I0RA 2D0AA 4JLHA 3K0SA 2Y1IA 3MXJA 1SL0A 3UKRB 3IRXA 1NNEA 1L5UA 4ELUA 4W5TA 2O8BB 1SUQA 3CCJN 4AHRA 3HYFA 1K73O 2NRTA 2OTLN 1HNWK 3CYMA 4FPBA 4FJ9A 3ZEUA 1DKGD 2OA8A 3F5TA 4GKKK 4IO8A 4Z94A 3HVRA 3O08A 2O8EB 2O8FB 3A8YA 3LL3A 3PO4A 1JXBA 3QMLA 1GLAG 1S6QA 3ISNC 5HRSA 3HPHA 4OPHA 3AO4A 3VQPA 3F2KA 1M90O 2F9TA 4KBOA 4DR1K 3MCPA 3TAGA 4BR0A 2YJEA 4FSVA 4NCBA 4IKFA 3ULDA 2DFEA 1B92A 2FLOA 2Q3SA 3MN9A 3SJJA 2CH6A 4DS4A 5CYQA 3OYFA 4LFCK 4ISEA 1JLFA 1VAZA 4JKHA 2NRVA 1QQNA 4DU4A 5FPEA 1VSHA 3WNFA 4AHCA 2CGKA 4FJIA 1KVCA 4KI4A 2AA4A 1TUUA 3MEGA 3O4QA 3AV9A 2YI1A 3H46O 3NCIA 3NE6A 2FF6A 5AR0A 1WOQA 4LFBK 2FXUA 3C7NA 4CEBA 4C1NI 1P90A 3AY9A 1YITN 2Z1GA 1NMNA 4RWTA 1EETA 5DM7L 1QSSA 1RNHA 3V1OA 2IVPA 2HOEA 2KTQA 1K8KA 1C1CA 3O4NA 3ZETA 3MCAB 4FLVA 1RBTA 1RTHA 4BE2A 4W5NA 2XHBA 3GOIA 4JK8A 3WT0A 4KPYA 1ILYA 4WYBA 3O80A 3V9UA 4J2DA 2Q0UA 4DQPA 3T69A 3QLHA 4E1JA 4B1XB 2ZGYA 1QQCA 5AQSA 3FFKB 4CK1A 3C7NB 4YDUA 5GAEP 2D4WA 2YKNA 5EY4A 5AQUA 1C0MA 3SQ1A 3TR8A 1RDDA 1X9MA 2E6LA 2VGMA 3L2UA 4ZHRA 3L6QA 1IKVA 3PX4A 3PIOL 1X1PA 5SWMA 3L3UA 2ZM6K 3K5NA 4E0DA 4WE1A 2ASMA 4I6MB 3CETA 3T7ZA 3TSUA 1LCUA 1SQKA 3KZBA 4CBUA 1W97L 4DV4K 3DAWA 5MLCQ 2NLXA 2P9LA 3EKSA 3VEXA 3PY8A 1HX1A 3DLEA 2HBLA 3E66A 1WUAA 3UIQA 1SS6A 3C6AA 1TUYA 2ZE2A 4L3QA 4DR3K 4BG8A 4XH5A 2PYLA 3QFUA 5HRRA 1T6DA 3ZSVA 2YX6A 1JJ2M 1X9JA 3SK3A 2P9UA 5KTQA 4FJ8A 5KPRA 1UA0A 3QINA 4B1UB 3BF3A 3HO1A 2ITGA 2HF4A 4F8RA 4K43A 4B3SK 2YNHA 2JGUA 2O8DA 3HM8A 4HTLA 4IJNA 3NMUA 5C10A 3ALYA 4GV6A 4BRIA 4YY3K 4FZZA 4HUFA 3HSCA 3R3LA 4DTNA 3KLFA 1RT2A 5ELZA 5AQFA 4DF8A 1NK7A 3HBTA 3V9WA 3LANA 5TKYA 1HMVA 4M3WA 3MXIA 3A0IX 4MO5A 4G1QA 4K0KK 1QQOA 4AHTA 4BRMA 3H1VX 5LMNK 4TSXA 1HQEA 3VN5A 1C0UA 1VSFA 1SL2A 4FVUA 4CHYA 4X62K 1E4FT 4E1NA 3AVAA 1RDWX 3VA0A
chains in the Genus database with same CATH topology
3HT3A 3RTVA 3RR8A 4CJFA 1Z26A 3PUFA 3VA3A 4DS5A 1XWLA 3TI0A 4H4MA 1TK0A 2WOMA 2F96A 4CIFA 4OJRA 1D9FA 4FJHA 3VQAA 1JLBA 2A1SA 3IAYA 4NCAA 4DG1A 1NK8A 1NK6A 3PO5A 4ELVA 4KFBA 1BCMA 2FBXA 4KO0A 4DFPA 4M3RA 1U49A 1I3AA 1S9EA 4LSLA 1NJYA 3DM2A 2I5JA 4CEOA 3VQ4A 1I39A 2YNFA 3MEDA 1JL2A 1HYZA 3DRPA 3OS2A 4ICLA 3KKRA 4XIUA 5EU7A 4CJRA 3KLGA 1XHZA 2E4LA 3OYBA 1L3VA 1O1WA 2D0CA 3DRRA 2X74A 1FKPA 4CECA 2IC3A 3QNNA 4CJUA 1U47A 1N6QA 5FDLA 3F73A 4DF4A 2G8VA 4CGHA 4KRFA 5HRNA 3THVA 2RF2A 3K5MA 1GOAA 4Q0BA 1DTTA 2B5JA 4CFDA 3S9HA 3S3NA 3AO2A 1ASWA 1VSEA 2YHAA 3ZSYA 3V81A 2RPIA 2OPQA 3RMDA 1QSYA 3C94A 3NBPA 1JKHA 4KB0A 2F8SA 4CESA 3K5OA 4HTUA 1IH7A 4I2PA 2NUBA 3CFOA 4Z4EA 4RW7A 3SCXA 1J9AA 4C8KA 2B6AA 3LAMA 1U45A 3WNHA 2IDOA 1RDCA 1HYVA 1RDAA 2BGGA 3L3VA 2QKBA 1KTQA 2HB5A 4E7KA 3ZSRA 3A2FA 4AHVA 4OPKA 1Q9XA 1FK9A 3M8SA 4M3UA 3DLHA 3MECA 4EZ9A 1WAJA 1TL3A 4C8NA 4CJEA 1YTAA 5FRMA 1RTJA 3CFPA 4FJXA 4J2EA 4KV8A 2VG6A 1LWFA 4RW4A 4DU3A 4CJKA 3VQBA 4OPJA 4B9TA 4FK2A 1U48A 2EHGA 4JRQA 4FLZA 2OYQA 1YTUA 1REVA 2YHBA 3RWUA 1SV5A 2Z1HA 1S9GA 4CIGA 5HRPA 4Z4FA 4FW2A 5HLFA 1TK8A 3NGIA 3HPOA 5J2QA 3LP3A 2Y1JA 4HVJA 3OYHA 4DSEA 4KHSA 1J54A 4DTXA 4HHTA 3BGRA 5KI6A 4H8KA 4C8MA 3L2VA 4CJ4A 3C6UA 4EP4A 3AVBA 3M8QA 3OYJA 3I8DA 3L2RA 4DQSA 4FM1A 5DMRA 3QEVA 4F4KA 1A5WA 4RW8A 4KAZA 4Z4IA 4IBNA 4CJSA 2W42A 3RMAA 4FJNA 3AA3A 2KZZA 3AVHA 1GOBA 1Q8IA 2HHXA 1WSFA 2XO7A 2FBYA 4E7IA 3U6FA 3OVNA 4M45A 1JLQA 5KGWA 4ZTFA 2FBVA 1XC9A 2RN2A 4FJLA 3K2PA 3QNOA 2VWKA 4AILC 1WSGA 4ID5A 2XY7A 3TAQA 3V9SA 2P51A 4B9VA 3AA2A 5DK5A 2KW4A 4MQ3A 1BCOA 1KLMA 5FROA 1N5YA 4HCCA 3HP6A 4KHQA 4DQQA 2OPSA 2PZSA 1S1VA 3KLHA 3U3YA 3AVNA 3DLGA 1Y97A 3V9XA 4E7LA 3QESA 4FLTA 4FZYA 4CF0A 3OYAA 4BDYA 4E19A 4CHPA 3RR7A 3VQ7A 4CGFA 4DTMA 5KRSA 4KHYA 4DTSA 1WSJA 1EKEA 4CF1A 2G8WA 4FLUA 3SUPA 4BDPA 1BI4A 3SV4A 2HHSA 1RTIA 4O4GA 4OGCA 4B9UA 4CFBA 4CHOA 2B4JA 4FJMA 4KTZA 3OYEA 2Z1JA 1GOCA 1S1UA 1TKXA 4W5RA 4CF8A 1W9HA 3ASMA 4IFYA 4BE0A 2BANA 1EX4A 1DLOA 4DFKA 3RRHA 3V1QA 4HCBA 4FM2A 1RILA 3SPYA 3TANA 4E1MA 5C25A 1SKWA 1NK9A 4LY7A 1KRPA 4FLYA 1BL3A 4PQUA 4DSLA 2O4IA 1EXQA 2O4GA 3SQ2A 1NK4A 4L8RB 1HPZA 3KK1A 4DLGA 2KZMA 1TL1A 2G8KA 1ZYQA 3CG7A 2BE2A 3AVGA 4CEZA 1JLAA 3LP1A 3F9KA 3KK3A 4LD0A 4O0IA 3ZT3A 4Z4HA 3S3MA 1T8EA 4K8XA 5KRTA 3RMCA 1S1TA 3AVMA 3VQ8A 3NF9A 4CJVA 4CJ3A 1SKRA 3OYMA 4NYNA 1QSLA 1UWBA 3H08A 1VSDA 2HVHA 4O44A 1BQNA 4JS4A 3QERA 4BACA 1JL1A 2YKMA 4J2BA 1BIZA 4W5QA 3QEIA 3VQ5A 3ZSZA 4QOZB 1RDBA 2HNDA 4B9SA 3RRGA 4N41A 3OS0A 3IS9A 3PX0A 4FYDA 1BQMA 1LW2A 2VG7A 4GVMA 3T3FA 3G10A 1T05A 4F2RA 4FM0A 1BISA 1JLGA 2G8UA 1BIUA 3LZJA 3AVCA 3AVLA 3BDPA 4FW1A 3HJFA 3KJVA 2XY6A 1F21A 3KLEA 1QS4A 1NKBA 1ASVA 4IDKA 3JSMA 4CJQA 4EZ6A 4QAGA 4N47A 3HM9A 1B9DA 3SQ0A 4CHZA 1JLEA 2D5RA 4Z4CA 4RW9A 3HK2A 3KLIA 1BI4B 3L8BA 3OYGA 4Q5VA 3TABA 3O3FA 1QTMA 5D3GA 4B3OA 3NFAA 4H4OA 4B8AB 4M3YA 4NCGA 5J2NA 1HNVA 2E6MA 2RKIA 1KVBA 4LH5A 2EX3A 3B6PA 3OYLA 4OLBA 1TKDA 2GUIA 3CM5A 1IKXA 3LWMA 3ITHA 4Y1CA 3TAMA 1ZBUA 4DTPA 3NDKA 1SL1A 4YNQA 3SUOA 2HHQA 1WN7A 1X9WA 3AVKA 3HSTB 4J2AA 3DMJA 3HP9A 3DI6A 4IG3A 1LV5A 4FLWA 4OVLA 4JS5A 5J2MA 1VSMA 1VRUA 1L3SA 3I0RA 2D0AA 3C95A 4N5SA 4JLHA 3TARA 2OZSA 1KSPA 2Y1IA 2KFZA 4FVMA 4F2SA 2DFFA 1RT7A 2QXFA 4BDZA 3SV3A 1S1XA 3HVTA 3MXJA 4CEEA 3O3HA 4B9NA 1CXUA 1JLCA 1SL0A 3IRXA 1RTDA 1L5UA 4M3TA 3TAEA 4ELUA 3ZT4A 4W5TA 1SUQA 3VQ6A 4PY5A 5HBMA 4AHRA 3HYFA 4I9LA 3G0ZA 2G8IA 4OGEA 3SI6A 1IG9A 3CYMA 3HXMA 1RT4A 3ZT1A 1C6VA 1NKCA 1B9FA 4DQIA 4E3SA 4FJ9A 3P83D 4CJWA 4MFBA 4B08A 2OPPA 1NK5A 2DFHA 2OA8A 1XHXA 4B9MA 3HVRA 4R5PA 3PV8A 2JLEA 1WLJA 3KTQA 1NK0A 4KTWA 3D0PA 3PO4A 4I9QA 3K58A 1JXBA 4KTQA 2HHWA 3S3OA 1S6QA 2ZQBA 4FJ5A 1TAUA 3P5JA 3ISNC 5HRSA 3HPHA 1CLQA 3AO4A 1Z25A 2DTUA 3AVFA 4CJPA 1WSIA 1VSIA 3VQPA 4CGGA 5K14A 4DTUA 4FK0A 2LSNA 4OKEA 3P1GA 2OZMA 5T7BA 3TAGA 4DSFA 4NCBA 3K5LA 3LWLA 4N56A 1TK5A 1J5OA 4M41A 3ULDA 3V4IA 4IKFA 2OPRA 2DFEA 1B92A 1RBUA 2Q3SA 3NGYA 1G15A 3QEWA 3SJJA 1A5XA 3AVIA 3LP0A 5CYQA 3OYFA 4DS4A 1YT3A 5E41A 1UOCA 1WAFA 4OLAA 5HROA 1Q9YA 4ZTJA 1TAQA 1JLFA 4CE9A 2FBTA 4DSIA 4O55A 2G8HA 1RBSA 2AJQA 1IO2A 3NGZA 4DU4A 1YVUA 4O5BA 4CJTA 3LPUA 3LP2A 1RT3A 2GV9A 4KHNA 4E89A 3WNEA 4DLEA 1VSHA 3DRSA 3WNFA 4AHCA 2HMIA 2KFNA 1KVAA 4FJIA 1KFDA 1KVCA 4KI4A 3DOKA 4CJLA 3MEGA 3O4QA 4CK2A 3AV9A 3VQDA 4E7JA 4KI6A 3MXMA 3M8PA 4AHUA 3QEXA 5KGXA 4YFUA 3EY1A 1NJXA 4DSJA 2ETJA 3NCIA 3OYNA 3EZ5A 1CZBA 3NE6A 3CQ8A 3SQ4A 5JS1A 4CJ5A 3TAPA 3OY9A 1IKWA 1RCHA 4CEBA 3DLBA 1XI1A 1R0AA 3KIOA 3TWHA 2VG5A 1LAVA 1MU2A 2HHUA 4LH4A 1HNIA 1CZ9A 2IGIA 2Z1GA 4DMNA 3NH1A 4KREA 3DLKA 4FCYA 2YNIA 3O3GA 3EYZA 3OJSA 5J2PA 1EETA 3MAQA 1QSSA 3FFIA 5CYMA 1RNHA 3V1OA 3VQEA 3VQQA 3DOLA 4CEQA 2IAJA 2KTQA 1C1CA 4DTJA 4PWDA 4IG0A 3KKSA 3O4NA 2PY5A 4FLVA 1RBTA 3VQCA 4Y1DA 3SYZA 2KQ2A 1RTHA 4GW6A 4BE2A 3CM6A 1NOZA 5JS2A 3ZCMA 4W5NA 1A5VA 1T7PA 3NH0A 1C0TA 4OKKA 2BDPA 4FK4A 3LALA 4Z4GA 4FXDA 2XHBA 3RMBA 4Z0UA 4JRPA 1TKTA 2YNGA 3CFRA 3QEPA 5CZ1A 4KPYA 4DFJA 1WNSA 2G8FA 3T19A 4KKOA 4KHWA 4M42A 4BWMA 3V9UA 2WONA 3IG1A 3ZSQA 4J2DA 3MEEA 2IS3A 4CGIA 4DQPA 3QLHA 1ZBLA 3ZT2A 2HNYA 1NKEA 4ID1A 1BHLA 1C1AA 1U04A 3V1RA 3SUNA 2F8TA 1LWCA 1QQCA 1RT5A 3AO3A 4I2QA 4E7HA 4CK1A 3U3GA 3T1AA 3ZSWA 1T03A 4HUEA 1ZBHA 2XY5A 1VSJA 1D9DA 3E01A 4F3OA 2XRIA 1BGXT 1HYSA 3QIPA 3SPZA 3QETA 1HRHA 2YKNA 1X9SA 1C0MA 4M3XA 3SQ1A 3ZSXA 3TR8A 1RDDA 1X9MA 2E6LA 3L2UA 4DWIA 1FXXA 2A1RA 4CEFA 4CHNA 1QHTA 4ZHRA 3V6DA 3PX4A 1IKVA 3OYKA 3V9ZA 2X6NA 3OS1A 1X1PA 4I7FA 5SWMA 2P1JA 3L3UA 2IOCA 1EP4A 1WSHA 2X78A 3NF8A 1RT6A 1S5JA 2XY8A 4O0JA 4WE1A 3K5NA 5I42A 4E0DA 4FZXC 1ASUA 3SUQA 3LPTA 4FJKA 4DQRA 2D0BA 1S1WA 3DLRA 4CEAA 3NAEA 4C8LA 3NF7A 3NH2A 1ZBIA 1QE1A 3NF6A 3DYAA 3KK2A 4N76A 2HHVA 3L2WA 1UA1A 4KHUA 2VWJA 1L3TA 3WNGA 1LW0A 3ZSOA 1KLNA 1HQUA 3PY8A 4M3ZA 4NYFA 1VRTA 1U4BA 3DLEA 4CGDA 2FC0A 2P5GA 3UIQA 1TKZA 3JYTA 2ATQA 2ZE2A 4PUOA 4C8OA 3OJUA 4CF9A 4DSKA 3OYIA 3AA5X 4CEDA 4CIEA 4DU1A 3I0SA 3QO9A 3TAFA 5C42A 2PYLA 4GMJB 3AA4A 3AVJA 4PA1A 5HRRA 4EP5A 3SZ2A 4K8ZA 1VSKA 5HP1A 4CERA 1SKSA 1W0HA 2QK9A 1JXEA 3ZSVA 5KTQA 5CZ2A 3QIOA 4FJ8A 1UA0A 1UAXA 3ZT0A 4CK3A 3HL8A 5C24A 4IFVA 1RBVA 4CHQA 3L2QA 3QINA 2HHTA 1RBRA 4BWJA 3B6OA 1S6PA 3OYCA 1VSLA 3AO5A 2PYJA 3HO1A 1DTQA 2ITGA 1IKYA 3K57A 3KD5E 3M8RA 4F8RA 4FJ7A 5FRNA 5CY4A 1WSEA 2YNHA 3LDSA 2JGUA 3D45A 4RW6A 1KFSA 1FKOA 2X6SA 1NJZA 2ZD1A 1CXQA 1TV6A 4HUGA 3ALYA 1J53A 1LAWA 2Z1IA 4DFMA 1C1BA 4BE1A 4ELTA 1LWEA 3K59A 2HW3A 4FZZA 1TVRA 4HUFA 4B9LA 1D5AA 4DTNA 3SNNA 2HVIA 4OKJA 4CFCA 3LAKA 2QKKA 3PX6A 4DTRA 3KLFA 1RT2A 5I3UA 1ITGA 5SZTA 1HJRA 1ZBFA 4CF2A 4DF8A 1NK7A 3V9WA 1VK0A 3LANA 2R7YA 1HMVA 2DY4A 1TGOA 1K6YA 4KB1A 3MXIA 4M3WA 4UQGA 2P5OA 3AO1A 4G1QA 3VQ9A 4F3TA 3NHGA 1NOYA 1NJWA 4FJGA 4AH9A 4LSNA 4AHTA 1RT1A 4AHSA 4CFAA 4TSXA 4W5OA 4FLXA 3KD1E 4CCHA 3HPGA 3C6TA 1HQEA 1D8YA 3VN5A 1C0UA 1VSFA 4B8CA 4CGJA 1SL2A 1L3UA 2HNZA 4QCLA 2YV0X 4CHYA 4DTOA 4E1NA 3AVAA 3OYDA 4FJJA 1KCFA 3LZIA 2GBZA 4RG8A 5J1EA 3VA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HT3 A;  3RTV A;  3RR8 A;  4CJF A;  1Z26 A;  3PUF A;  3VA3 A;  4DS5 A;  1XWL A;  3TI0 A;  4H4M A;  1TK0 A;  2WOM A;  2F96 A;  4CIF A;  4OJR A;  1D9F A;  4FJH A;  3VQA A;  1JLB A;  2A1S A;  3IAY A;  4NCA A;  4DG1 A;  1NK8 A;  1NK6 A;  3PO5 A;  4ELV A;  4KFB A;  1BCM A;  2FBX A;  4KO0 A;  4DFP A;  4M3R A;  1U49 A;  1I3A A;  1S9E A;  4LSL A;  1NJY A;  3DM2 A;  2I5J A;  4CEO A;  3VQ4 A;  1I39 A;  2YNF A;  3MED A;  1JL2 A;  1HYZ A;  3DRP A;  3OS2 A;  4ICL A;  3KKR A;  4XIU A;  5EU7 A;  4CJR A;  3KLG A;  1XHZ A;  2E4L A;  3OYB A;  1L3V A;  1O1W A;  2D0C A;  3DRR A;  2X74 A;  1FKP A;  4CEC A;  2IC3 A;  3QNN A;  4CJU A;  1U47 A;  1N6Q A;  5FDL A;  3F73 A;  4DF4 A;  2G8V A;  4CGH A;  4KRF A;  5HRN A;  3THV A;  2RF2 A;  3K5M A;  1GOA A;  4Q0B A;  1DTT A;  2B5J A;  4CFD A;  3S9H A;  3S3N A;  3AO2 A;  1ASW A;  1VSE A;  2YHA A;  3ZSY A;  3V81 A;  2RPI A;  2OPQ A;  3RMD A;  1QSY A;  3C94 A;  3NBP A;  1JKH A;  4KB0 A;  2F8S A;  4CES A;  3K5O A;  4HTU A;  1IH7 A;  4I2P A;  2NUB A;  3CFO A;  4Z4E A;  4RW7 A;  3SCX A;  1J9A A;  4C8K A;  2B6A A;  3LAM A;  1U45 A;  3WNH A;  2IDO A;  1RDC A;  1HYV A;  1RDA A;  2BGG A;  3L3V A;  2QKB A;  1KTQ A;  2HB5 A;  4E7K A;  3ZSR A;  3A2F A;  4AHV A;  4OPK A;  1Q9X A;  1FK9 A;  3M8S A;  4M3U A;  3DLH A;  3MEC A;  4EZ9 A;  1WAJ A;  1TL3 A;  4C8N A;  4CJE A;  1YTA A;  5FRM A;  1RTJ A;  3CFP A;  4FJX A;  4J2E A;  4KV8 A;  2VG6 A;  1LWF A;  4RW4 A;  4DU3 A;  4CJK A;  3VQB A;  4OPJ A;  4B9T A;  4FK2 A;  1U48 A;  2EHG A;  4JRQ A;  4FLZ A;  2OYQ A;  1YTU A;  1REV A;  2YHB A;  3RWU A;  1SV5 A;  2Z1H A;  1S9G A;  4CIG A;  5HRP A;  4Z4F A;  4FW2 A;  5HLF A;  1TK8 A;  3NGI A;  3HPO A;  5J2Q A;  3LP3 A;  2Y1J A;  4HVJ A;  3OYH A;  4DSE A;  4KHS A;  1J54 A;  4DTX A;  4HHT A;  3BGR A;  5KI6 A;  4H8K A;  4C8M A;  3L2V A;  4CJ4 A;  3C6U A;  4EP4 A;  3AVB A;  3M8Q A;  3OYJ A;  3I8D A;  3L2R A;  4DQS A;  4FM1 A;  5DMR A;  3QEV A;  4F4K A;  1A5W A;  4RW8 A;  4KAZ A;  4Z4I A;  4IBN A;  4CJS A;  2W42 A;  3RMA A;  4FJN A;  3AA3 A;  2KZZ A;  3AVH A;  1GOB A;  1Q8I A;  2HHX A;  1WSF A;  2XO7 A;  2FBY A;  4E7I A;  3U6F A;  3OVN A;  4M45 A;  1JLQ A;  5KGW A;  4ZTF A;  2FBV A;  1XC9 A;  2RN2 A;  4FJL A;  3K2P A;  3QNO A;  2VWK A;  4AIL C;  1WSG A;  4ID5 A;  2XY7 A;  3TAQ A;  3V9S A;  2P51 A;  4B9V A;  3AA2 A;  5DK5 A;  2KW4 A;  4MQ3 A;  1BCO A;  1KLM A;  5FRO A;  1N5Y A;  4HCC A;  3HP6 A;  4KHQ A;  4DQQ A;  2OPS A;  2PZS A;  1S1V A;  3KLH A;  3U3Y A;  3AVN A;  3DLG A;  1Y97 A;  3V9X A;  4E7L A;  3QES A;  4FLT A;  4FZY A;  4CF0 A;  3OYA A;  4BDY A;  4E19 A;  4CHP A;  3RR7 A;  3VQ7 A;  4CGF A;  4DTM A;  5KRS A;  4KHY A;  4DTS A;  1WSJ A;  1EKE A;  4CF1 A;  2G8W A;  4FLU A;  3SUP A;  4BDP A;  1BI4 A;  3SV4 A;  2HHS A;  1RTI A;  4O4G A;  4OGC A;  4B9U A;  4CFB A;  4CHO A;  2B4J A;  4FJM A;  4KTZ A;  3OYE A;  2Z1J A;  1GOC A;  1S1U A;  1TKX A;  4W5R A;  4CF8 A;  1W9H A;  3ASM A;  4IFY A;  4BE0 A;  2BAN A;  1EX4 A;  1DLO A;  4DFK A;  3RRH A;  3V1Q A;  4HCB A;  4FM2 A;  1RIL A;  3SPY A;  3TAN A;  4E1M A;  5C25 A;  1SKW A;  1NK9 A;  4LY7 A;  1KRP A;  4FLY A;  1BL3 A;  4PQU A;  4DSL A;  2O4I A;  1EXQ A;  2O4G A;  3SQ2 A;  1NK4 A;  4L8R B;  1HPZ A;  3KK1 A;  4DLG A;  2KZM A;  1TL1 A;  2G8K A;  1ZYQ A;  3CG7 A;  2BE2 A;  3AVG A;  4CEZ A;  1JLA A;  3LP1 A;  3F9K A;  3KK3 A;  4LD0 A;  4O0I A;  3ZT3 A;  4Z4H A;  3S3M A;  1T8E A;  4K8X A;  5KRT A;  3RMC A;  1S1T A;  3AVM A;  3VQ8 A;  3NF9 A;  4CJV A;  4CJ3 A;  1SKR A;  3OYM A;  4NYN A;  1QSL A;  1UWB A;  3H08 A;  1VSD A;  2HVH A;  4O44 A;  1BQN A;  4JS4 A;  3QER A;  4BAC A;  1JL1 A;  2YKM A;  4J2B A;  1BIZ A;  4W5Q A;  3QEI A;  3VQ5 A;  3ZSZ A;  4QOZ B;  1RDB A;  2HND A;  4B9S A;  3RRG A;  4N41 A;  3OS0 A;  3IS9 A;  3PX0 A;  4FYD A;  1BQM A;  1LW2 A;  2VG7 A;  4GVM A;  3T3F A;  3G10 A;  1T05 A;  4F2R A;  4FM0 A;  1BIS A;  1JLG A;  2G8U A;  1BIU A;  3LZJ A;  3AVC A;  3AVL A;  3BDP A;  4FW1 A;  3HJF A;  3KJV A;  2XY6 A;  1F21 A;  3KLE A;  1QS4 A;  1NKB A;  1ASV A;  4IDK A;  3JSM A;  4CJQ A;  4EZ6 A;  4QAG A;  4N47 A;  3HM9 A;  1B9D A;  3SQ0 A;  4CHZ A;  1JLE A;  2D5R A;  4Z4C A;  4RW9 A;  3HK2 A;  3KLI A;  1BI4 B;  3L8B A;  3OYG A;  4Q5V A;  3TAB A;  3O3F A;  1QTM A;  5D3G A;  4B3O A;  3NFA A;  4H4O A;  4B8A B;  4M3Y A;  4NCG A;  5J2N A;  1HNV A;  2E6M A;  2RKI A;  1KVB A;  4LH5 A;  2EX3 A;  3B6P A;  3OYL A;  4OLB A;  1TKD A;  2GUI A;  3CM5 A;  1IKX A;  3LWM A;  3ITH A;  4Y1C A;  3TAM A;  1ZBU A;  4DTP A;  3NDK A;  1SL1 A;  4YNQ A;  3SUO A;  2HHQ A;  1WN7 A;  1X9W A;  3AVK A;  3HST B;  4J2A A;  3DMJ A;  3HP9 A;  3DI6 A;  4IG3 A;  1LV5 A;  4FLW A;  4OVL A;  4JS5 A;  5J2M A;  1VSM A;  1VRU A;  1L3S A;  3I0R A;  2D0A A;  3C95 A;  4N5S A;  4JLH A;  3TAR A;  2OZS A;  1KSP A;  2Y1I A;  2KFZ A;  4FVM A;  4F2S A;  2DFF A;  1RT7 A;  2QXF A;  4BDZ A;  3SV3 A;  1S1X A;  3HVT A;  3MXJ A;  4CEE A;  3O3H A;  4B9N A;  1CXU A;  1JLC A;  1SL0 A;  3IRX A;  1RTD A;  1L5U A;  4M3T A;  3TAE A;  4ELU A;  3ZT4 A;  4W5T A;  1SUQ A;  3VQ6 A;  4PY5 A;  5HBM A;  4AHR A;  3HYF A;  4I9L A;  3G0Z A;  2G8I A;  4OGE A;  3SI6 A;  1IG9 A;  3CYM A;  3HXM A;  1RT4 A;  3ZT1 A;  1C6V A;  1NKC A;  1B9F A;  4DQI A;  4E3S A;  4FJ9 A;  3P83 D;  4CJW A;  4MFB A;  4B08 A;  2OPP A;  1NK5 A;  2DFH A;  2OA8 A;  1XHX A;  4B9M A;  3HVR A;  4R5P A;  3PV8 A;  2JLE A;  1WLJ A;  3KTQ A;  1NK0 A;  4KTW A;  3D0P A;  3PO4 A;  4I9Q A;  3K58 A;  1JXB A;  4KTQ A;  2HHW A;  3S3O A;  1S6Q A;  2ZQB A;  4FJ5 A;  1TAU A;  3P5J A;  3ISN C;  5HRS A;  3HPH A;  1CLQ A;  3AO4 A;  1Z25 A;  2DTU A;  3AVF A;  4CJP A;  1WSI A;  1VSI A;  3VQP A;  4CGG A;  5K14 A;  4DTU A;  4FK0 A;  2LSN A;  4OKE A;  3P1G A;  2OZM A;  5T7B A;  3TAG A;  4DSF A;  4NCB A;  3K5L A;  3LWL A;  4N56 A;  1TK5 A;  1J5O A;  4M41 A;  3ULD A;  3V4I A;  4IKF A;  2OPR A;  2DFE A;  1B92 A;  1RBU A;  2Q3S A;  3NGY A;  1G15 A;  3QEW A;  3SJJ A;  1A5X A;  3AVI A;  3LP0 A;  5CYQ A;  3OYF A;  4DS4 A;  1YT3 A;  5E41 A;  1UOC A;  1WAF A;  4OLA A;  5HRO A;  1Q9Y A;  4ZTJ A;  1TAQ A;  1JLF A;  4CE9 A;  2FBT A;  4DSI A;  4O55 A;  2G8H A;  1RBS A;  2AJQ A;  1IO2 A;  3NGZ A;  4DU4 A;  1YVU A;  4O5B A;  4CJT A;  3LPU A;  3LP2 A;  1RT3 A;  2GV9 A;  4KHN A;  4E89 A;  3WNE A;  4DLE A;  1VSH A;  3DRS A;  3WNF A;  4AHC A;  2HMI A;  2KFN A;  1KVA A;  4FJI A;  1KFD A;  1KVC A;  4KI4 A;  3DOK A;  4CJL A;  3MEG A;  3O4Q A;  4CK2 A;  3AV9 A;  3VQD A;  4E7J A;  4KI6 A;  3MXM A;  3M8P A;  4AHU A;  3QEX A;  5KGX A;  4YFU A;  3EY1 A;  1NJX A;  4DSJ A;  2ETJ A;  3NCI A;  3OYN A;  3EZ5 A;  1CZB A;  3NE6 A;  3CQ8 A;  3SQ4 A;  5JS1 A;  4CJ5 A;  3TAP A;  3OY9 A;  1IKW A;  1RCH A;  4CEB A;  3DLB A;  1XI1 A;  1R0A A;  3KIO A;  3TWH A;  2VG5 A;  1LAV A;  1MU2 A;  2HHU A;  4LH4 A;  1HNI A;  1CZ9 A;  2IGI A;  2Z1G A;  4DMN A;  3NH1 A;  4KRE A;  3DLK A;  4FCY A;  2YNI A;  3O3G A;  3EYZ A;  3OJS A;  5J2P A;  1EET A;  3MAQ A;  1QSS A;  3FFI A;  5CYM A;  1RNH A;  3V1O A;  3VQE A;  3VQQ A;  3DOL A;  4CEQ A;  2IAJ A;  2KTQ A;  1C1C A;  4DTJ A;  4PWD A;  4IG0 A;  3KKS A;  3O4N A;  2PY5 A;  4FLV A;  1RBT A;  3VQC A;  4Y1D A;  3SYZ A;  2KQ2 A;  1RTH A;  4GW6 A;  4BE2 A;  3CM6 A;  1NOZ A;  5JS2 A;  3ZCM A;  4W5N A;  1A5V A;  1T7P A;  3NH0 A;  1C0T A;  4OKK A;  2BDP A;  4FK4 A;  3LAL A;  4Z4G A;  4FXD A;  2XHB A;  3RMB A;  4Z0U A;  4JRP A;  1TKT A;  2YNG A;  3CFR A;  3QEP A;  5CZ1 A;  4KPY A;  4DFJ A;  1WNS A;  2G8F A;  3T19 A;  4KKO A;  4KHW A;  4M42 A;  4BWM A;  3V9U A;  2WON A;  3IG1 A;  3ZSQ A;  4J2D A;  3MEE A;  2IS3 A;  4CGI A;  4DQP A;  3QLH A;  1ZBL A;  3ZT2 A;  2HNY A;  1NKE A;  4ID1 A;  1BHL A;  1C1A A;  1U04 A;  3V1R A;  3SUN A;  2F8T A;  1LWC A;  1QQC A;  1RT5 A;  3AO3 A;  4I2Q A;  4E7H A;  4CK1 A;  3U3G A;  3T1A A;  3ZSW A;  1T03 A;  4HUE A;  1ZBH A;  2XY5 A;  1VSJ A;  1D9D A;  3E01 A;  4F3O A;  2XRI A;  1BGX T;  1HYS A;  3QIP A;  3SPZ A;  3QET A;  1HRH A;  2YKN A;  1X9S A;  1C0M A;  4M3X A;  3SQ1 A;  3ZSX A;  3TR8 A;  1RDD A;  1X9M A;  2E6L A;  3L2U A;  4DWI A;  1FXX A;  2A1R A;  4CEF A;  4CHN A;  1QHT A;  4ZHR A;  3V6D A;  3PX4 A;  1IKV A;  3OYK A;  3V9Z A;  2X6N A;  3OS1 A;  1X1P A;  4I7F A;  5SWM A;  2P1J A;  3L3U A;  2IOC A;  1EP4 A;  1WSH A;  2X78 A;  3NF8 A;  1RT6 A;  1S5J A;  2XY8 A;  4O0J A;  4WE1 A;  3K5N A;  5I42 A;  4E0D A;  4FZX C;  1ASU A;  3SUQ A;  3LPT A;  4FJK A;  4DQR A;  2D0B A;  1S1W A;  3DLR A;  4CEA A;  3NAE A;  4C8L A;  3NF7 A;  3NH2 A;  1ZBI A;  1QE1 A;  3NF6 A;  3DYA A;  3KK2 A;  4N76 A;  2HHV A;  3L2W A;  1UA1 A;  4KHU A;  2VWJ A;  1L3T A;  3WNG A;  1LW0 A;  3ZSO A;  1KLN A;  1HQU A;  3PY8 A;  4M3Z A;  4NYF A;  1VRT A;  1U4B A;  3DLE A;  4CGD A;  2FC0 A;  2P5G A;  3UIQ A;  1TKZ A;  3JYT A;  2ATQ A;  2ZE2 A;  4PUO A;  4C8O A;  3OJU A;  4CF9 A;  4DSK A;  3OYI A;  3AA5 X;  4CED A;  4CIE A;  4DU1 A;  3I0S A;  3QO9 A;  3TAF A;  5C42 A;  2PYL A;  4GMJ B;  3AA4 A;  3AVJ A;  4PA1 A;  5HRR A;  4EP5 A;  3SZ2 A;  4K8Z A;  1VSK A;  5HP1 A;  4CER A;  1SKS A;  1W0H A;  2QK9 A;  1JXE A;  3ZSV A;  5KTQ A;  5CZ2 A;  3QIO A;  4FJ8 A;  1UA0 A;  1UAX A;  3ZT0 A;  4CK3 A;  3HL8 A;  5C24 A;  4IFV A;  1RBV A;  4CHQ A;  3L2Q A;  3QIN A;  2HHT A;  1RBR A;  4BWJ A;  3B6O A;  1S6P A;  3OYC A;  1VSL A;  3AO5 A;  2PYJ A;  3HO1 A;  1DTQ A;  2ITG A;  1IKY A;  3K57 A;  3KD5 E;  3M8R A;  4F8R A;  4FJ7 A;  5FRN A;  5CY4 A;  1WSE A;  2YNH A;  3LDS A;  2JGU A;  3D45 A;  4RW6 A;  1KFS A;  1FKO A;  2X6S A;  1NJZ A;  2ZD1 A;  1CXQ A;  1TV6 A;  4HUG A;  3ALY A;  1J53 A;  1LAW A;  2Z1I A;  4DFM A;  1C1B A;  4BE1 A;  4ELT A;  1LWE A;  3K59 A;  2HW3 A;  4FZZ A;  1TVR A;  4HUF A;  4B9L A;  1D5A A;  4DTN A;  3SNN A;  2HVI A;  4OKJ A;  4CFC A;  3LAK A;  2QKK A;  3PX6 A;  4DTR A;  3KLF A;  1RT2 A;  5I3U A;  1ITG A;  5SZT A;  1HJR A;  1ZBF A;  4CF2 A;  4DF8 A;  1NK7 A;  3V9W A;  1VK0 A;  3LAN A;  2R7Y A;  1HMV A;  2DY4 A;  1TGO A;  1K6Y A;  4KB1 A;  3MXI A;  4M3W A;  4UQG A;  2P5O A;  3AO1 A;  4G1Q A;  3VQ9 A;  4F3T A;  3NHG A;  1NOY A;  1NJW A;  4FJG A;  4AH9 A;  4LSN A;  4AHT A;  1RT1 A;  4AHS A;  4CFA A;  4TSX A;  4W5O A;  4FLX A;  3KD1 E;  4CCH A;  3HPG A;  3C6T A;  1HQE A;  1D8Y A;  3VN5 A;  1C0U A;  1VSF A;  4B8C A;  4CGJ A;  1SL2 A;  1L3U A;  2HNZ A;  4QCL A;  2YV0 X;  4CHY A;  4DTO A;  4E1N A;  3AVA A;  3OYD A;  4FJJ A;  1KCF A;  3LZI A;  2GBZ A;  4RG8 A;  5J1E A;  3VA0 A; 
#chains in the Genus database with same CATH topology
 3HT3 A;  1H1V A;  3TI0 A;  3O9U A;  4H4M A;  1TK0 A;  2JWL A;  3IAY A;  4NCA A;  4K42 A;  4LSL A;  3DM2 A;  3LDQ A;  4GY2 B;  2UUB K;  3MDQ A;  4YOU A;  4XIU A;  4XH1 A;  4MLE A;  4FWK A;  3KVG A;  5A2Q O;  3MK6 A;  4CJU A;  3CCE N;  4KRF A;  5HRN A;  4YOR A;  2ZWH A;  2B5J A;  4GVE A;  3JS6 A;  3K9J A;  3S3N A;  1ASW A;  1VSE A;  2YHA A;  2RPI A;  2NRX A;  3NBP A;  3O9Q A;  4CES A;  4LF9 K;  2ASO A;  3K5O A;  1IH7 A;  4Z4E A;  4C8K A;  1MDU B;  2IDO A;  4NLB A;  3G6E N;  4IEI A;  2UXD K;  2QM1 A;  3A2F A;  1Q9X A;  3UB5 A;  3DLH A;  4EZ9 A;  3CQY A;  1OH6 A;  1ESV A;  3CFP A;  3H1Q A;  4DU3 A;  3FE1 A;  3J80 O;  2BH1 A;  3O9S A;  3FGU A;  1U48 A;  2EHG A;  3K9K A;  4JRQ A;  1QHA A;  4CZE A;  1REV A;  2Z1H A;  4Z4F A;  1TK8 A;  2E8A A;  3HPO A;  3NGI A;  5J2Q A;  3LP3 A;  4DSE A;  3I8B A;  2UU9 K;  4FOI A;  1ZXO A;  4H8K A;  1W7A A;  5AQV A;  1X9S A;  3AVB A;  3I8D A;  4FM1 A;  2UUA K;  4KAZ A;  1QZ6 A;  5EOY A;  3D2E A;  3RSE B;  2ZJR L;  1FW6 A;  4E7I A;  4M45 A;  5AFU H;  2FBV A;  2VQF K;  3TSQ A;  1ZBS A;  2VWK A;  4AIL C;  2RE2 A;  3E9P A;  2KW4 A;  2IVO A;  5FRO A;  4DQQ A;  4M7X A;  1VQ7 N;  2CGL A;  2NRZ A;  4JI0 K;  3TPQ A;  3ULE B;  1Y64 A;  3QES A;  4FLT A;  4PL7 A;  1Q86 O;  4FWP A;  2V7Y A;  3A5M C;  4JI6 K;  5KRS A;  4DR2 K;  4KHY A;  3WQU A;  4CF1 A;  4BVO A;  3SV4 A;  1RTI A;  4OGC A;  1R59 O;  4CFB A;  2A40 A;  3VER A;  2Z1J A;  1M1K O;  4IFY A;  4BE0 A;  1EX4 A;  1DLO A;  4DFK A;  3RRH A;  3TSP A;  1VQL N;  5I9E B;  3SMP A;  4DV3 K;  4LY7 A;  3GG4 A;  4DSL A;  3KK1 A;  1TL1 A;  3C0B A;  3H45 C;  3CG7 A;  3BF1 A;  2BE2 A;  4WQ4 C;  3CIP A;  3CHW A;  3ZT3 A;  1T8E A;  3KWI A;  3MN7 A;  3VQ8 A;  3THY B;  4CJ3 A;  1UWB A;  1BQN A;  3QER A;  4BAC A;  1JL1 A;  4W5Q A;  4QOZ B;  4JD2 B;  4A57 A;  3RRG A;  3WXL A;  3IS9 A;  4FYD A;  1BQM A;  3KHY A;  4GVM A;  4YOX A;  1JCG A;  3CCU N;  2QWR A;  2QEX N;  3AVC A;  3HJF A;  3PSI A;  3VGK A;  3KLE A;  4IDK A;  3JSM A;  4BRG A;  3HM9 A;  3SQ0 A;  3DXK A;  4CHZ A;  2D5R A;  3HK2 A;  4Q5V A;  2I7P A;  4M3Y A;  1NBW A;  3U9D A;  2VQE K;  2RKI A;  3U8X A;  4H0X B;  4BC2 A;  5FLX O;  4Y1C A;  1ZBU A;  1WN7 A;  4J2A A;  3DMJ A;  4IG3 A;  3DI6 A;  4GV9 A;  4OVL A;  3U9Z A;  1VRU A;  4N5S A;  1RGI A;  4CW7 B;  2OZS A;  1KSP A;  4JK9 A;  3UE5 A;  2QXF A;  1EWQ A;  4BDZ A;  3SV3 A;  3TTC A;  4CEE A;  3O3H A;  4B9N A;  1S22 A;  1CXU A;  1RTD A;  2PAV A;  3TAE A;  5C12 A;  3VQ6 A;  4I9L A;  1TYQ A;  4OGE A;  4G9Z A;  3HXM A;  5AQW A;  3ZT1 A;  1NKC A;  1EWR A;  3P83 D;  4B08 A;  2OPP A;  2E1Y A;  2QXL A;  5JMV A;  1XHX A;  5ADX A;  4R5P A;  3PV8 A;  4A2B A;  4KTW A;  1BA1 A;  5AQG A;  3K58 A;  4DB3 A;  3S3O A;  4NXN K;  1NGC A;  3BEX A;  3P5J A;  2DTU A;  2HF3 A;  3AVF A;  4CJP A;  1VSI A;  2HST A;  5K14 A;  4JI5 K;  2LSN A;  5T7B A;  4DSF A;  3LWL A;  5AQJ A;  3NGY A;  1G15 A;  3VTH A;  1YT3 A;  4JYA K;  4BRF A;  5HRO A;  1Q9Y A;  1J6Z A;  4CE9 A;  2AJQ A;  1IO2 A;  3E9L A;  4CJT A;  4O5B A;  3LPU A;  3LP2 A;  1XC3 A;  4KH5 A;  3IMX A;  3A5L C;  3WNE A;  4A2A A;  3DRS A;  2HMI A;  2D0P A;  3EO3 A;  5BRF A;  2D1K A;  3HTV A;  3O5B A;  4E7J A;  2KKZ A;  4IWV A;  3MXM A;  5AQM A;  4JEP A;  5KGX A;  4YFU A;  3EY1 A;  2ETJ A;  4FL9 A;  2Q0R A;  3EZ5 A;  3SQ4 A;  3TAP A;  1NGG A;  1R0A A;  1LAV A;  1MU2 A;  3NH1 A;  3WXI A;  3LM9 A;  4BGA A;  2YNI A;  5M1F A;  3OJS A;  3KWG A;  3MAQ A;  4KH6 A;  2GWK A;  5CYM A;  2V51 B;  3VQQ A;  4BRN A;  4CEQ A;  4DTJ A;  4PWD A;  1XUP O;  3SYZ A;  4WFB L;  2KQ2 A;  3ZCM A;  3NH0 A;  1C0T A;  5IWA K;  4OKK A;  2BDP A;  3LAL A;  4Z0U A;  4JRP A;  1HUX A;  3IFR A;  4YOV A;  4LF5 K;  4DFJ A;  1WNS A;  4M42 A;  4BWM A;  3VEW A;  3MEE A;  2P9S A;  2YJF A;  4CGI A;  4CZM A;  1NKE A;  3KK7 A;  1BHL A;  1C1A A;  2VYP A;  4JI8 K;  5GAG P;  3SUN A;  1V4S A;  3U3G A;  1T03 A;  4BG9 A;  1P8Z A;  4NLC A;  3ENB A;  3QIP A;  3SPZ A;  1V4T A;  2F4V K;  3CJ7 A;  4M3X A;  2UYT A;  4CEF A;  2X6N A;  4EIA A;  2QWP A;  1EP4 A;  1WSH A;  1NGI A;  1RT6 A;  2YHX A;  4JKG B;  2A3Z A;  3SUQ A;  2P9N A;  3LPT A;  4FJK A;  5AQK A;  4DQR A;  4C8L A;  3EE9 A;  1QE1 A;  3NF6 A;  3KK2 A;  2HHV A;  4A5A A;  2VWJ A;  1L3T A;  3CPE A;  3WNG A;  2GEM A;  1LW0 A;  3ZSO A;  1KLN A;  1HQU A;  3QB0 A;  4EFH A;  4CGD A;  2FC0 A;  2P5G A;  3SBT A;  5M1O A;  3JYT A;  3JAM O;  3THX A;  1DEJ A;  3OYI A;  3AA5 X;  3TAF A;  3FZH A;  5C42 A;  4GMJ B;  3AVJ A;  5KPT A;  1QVF M;  3O9R A;  5CZ2 A;  3PIP L;  1UAX A;  5C24 A;  4IFV A;  2YHY A;  4BWJ A;  3B6O A;  3AO5 A;  1DTQ A;  5AFU A;  1IKY A;  4K41 A;  3M8R A;  5CY4 A;  1WSE A;  2PFU A;  3LDS A;  3ZEU B;  3AAR A;  4RW6 A;  4FWN A;  2X6S A;  2QWL A;  4HUG A;  1LAW A;  2QWO A;  3K59 A;  4CFC A;  3PX6 A;  4DTR A;  3R1X A;  5BN9 A;  5I3U A;  5AZJ A;  3VF4 A;  4A62 A;  1ZBF A;  2NRW A;  1YJW N;  2OCE A;  2R7Y A;  2DY4 A;  1TGO A;  2P5O A;  3FZL A;  3VQ9 A;  4DV5 K;  4IEE A;  1YVN A;  2P9K A;  1NGE A;  1NOY A;  1NJW A;  2GTD A;  4CFA A;  4AHS A;  2CGJ A;  2FSJ A;  2ZF5 O;  4FPA A;  4CVN E;  3CXC M;  2QWM A;  4DTO A;  3OYD A;  4BQL A;  5DM6 L;  1GLC G;  3RTV A;  3PUF A;  3VA3 A;  1CZA N;  4B3T K;  3L0Q A;  1D9F A;  4FJH A;  2A1S A;  4M63 C;  3PO5 A;  4DV6 K;  1NK6 A;  2W41 A;  1BCM A;  2FBX A;  1WBB A;  2VCP A;  4M3R A;  1U49 A;  2ZJQ L;  1S9E A;  5GIO A;  4DV1 K;  3L4I A;  3DRP A;  3OS2 A;  4ICL A;  5EU7 A;  3KLG A;  4BRQ A;  4WQ5 C;  1XHZ A;  3HZ6 A;  1O1W A;  4CEC A;  4IZ9 A;  2IC3 A;  1QZ5 A;  3QNN A;  1N6Q A;  1OH5 A;  2GEL A;  2V52 B;  5FDL A;  4FWS A;  3F9M A;  4CBX A;  4CGH A;  3DLL L;  3LDP A;  3UKU A;  4MDA A;  3HOS A;  4DUY K;  3S9H A;  3V81 A;  1K8K B;  3RMD A;  1JKH A;  3ZET B;  4HTU A;  3BZC A;  2WUS A;  4WFN L;  3SCX A;  3LAM A;  1RDA A;  3MWP A;  2BGG A;  3D2F A;  3L3V A;  1KTQ A;  4Y0W A;  4ILH A;  1RDU A;  4M3U A;  3MEC A;  4CJE A;  4PKG A;  3CME N;  4J2E A;  2A41 A;  4JI1 K;  1ATS A;  4OPJ A;  2O8C A;  1YTU A;  3RWU A;  1SV5 A;  3FLC O;  5C0Y A;  1YI2 N;  3WUH A;  3OYH A;  1J54 A;  4DTX A;  4HHT A;  3J8A A;  4C8M A;  3OYJ A;  4DQS A;  3TTD A;  4F4K A;  4RW8 A;  4MO4 A;  4CJS A;  3HI0 A;  4DUZ K;  1GOB A;  3CPW M;  3U6F A;  5LJV A;  3J7Z O;  3CER A;  5KGW A;  4ZTF A;  3EEQ A;  3H3O B;  4B1Y B;  3AA2 A;  5DK5 A;  1N5Y A;  2QKB A;  2ASP A;  4JKA A;  1S1V A;  3U3Y A;  4CZL A;  1Y97 A;  5AJ3 K;  1OVY A;  4LF4 K;  3D2F B;  4FZY A;  3OHR A;  3RR7 A;  1WSJ A;  1EKE A;  2KHO A;  2G8W A;  4FLU A;  4BDP A;  1BI4 A;  2P9L B;  5AQN A;  2ITM A;  1GOC A;  4C23 A;  1XMQ K;  4CF8 A;  1W9H A;  4IFE A;  1VQ4 N;  3PSF A;  4CZI A;  4CI6 A;  4FM2 A;  4JHD A;  4AM6 A;  4U7B A;  3H3N O;  1SKW A;  1NK9 A;  3SBG A;  4PQU A;  4JI7 K;  2O4I A;  2HBK A;  2O4G A;  3FZM A;  1HPZ A;  2G8K A;  2J4R A;  5LMU K;  3F9K A;  3S3M A;  2P9U B;  4Z4H A;  2Q1N A;  2W6K A;  5KRT A;  3RMC A;  4ISG A;  4DV2 K;  4CJV A;  4B1W B;  1SKR A;  3OYM A;  4NYN A;  3H08 A;  3TTF A;  4O44 A;  2YKM A;  4H0P A;  3OBY A;  5AZI A;  4B9S A;  2UUC K;  3OS0 A;  3PX0 A;  2O8D B;  4BRC A;  1LW2 A;  1BO5 O;  1T05 A;  3G10 A;  3QFP A;  4FWL A;  1JLG A;  1BIU A;  3P38 A;  5AQX A;  3LZJ A;  3Q7B A;  3BDP A;  2OTJ N;  1QS4 A;  1ASV A;  5F2R A;  4O8K A;  3ZX0 A;  4CJQ A;  4EZ6 A;  4QAG A;  1B9D A;  1JLE A;  4Z4C A;  1VQ6 N;  3WXJ A;  4BC4 A;  3KLI A;  1BI4 B;  3QBX A;  5D3G A;  4B3O A;  3NFA A;  4H4O A;  4B8A B;  4EHU A;  3NVM A;  3AGK A;  3ZYY X;  1DGK N;  3OYL A;  4ILG B;  2GUI A;  3CM5 A;  5HLF A;  2E5L K;  1NMD A;  4YNQ A;  1KQS M;  3HOT A;  3AVK A;  4CZF A;  3HP9 A;  1NGJ A;  1LV5 A;  3D7E O;  5CR4 A;  1IBK K;  3TAR A;  3C95 A;  4PL8 A;  2NRR A;  1Q81 O;  2KFZ A;  4F2S A;  4BR5 A;  2DFF A;  2QA4 N;  1JLC A;  3P4I A;  3ZT4 A;  4CZH A;  4B3M K;  1GLL O;  2G8I A;  3G0Z A;  4BRA A;  4YDU C;  2WTU A;  1IG9 A;  3O1W A;  1RT4 A;  1NLV A;  1C6V A;  4E3S A;  4QS9 A;  4CJW A;  4MFB A;  2DFH A;  1JCF A;  5GAD P;  2P9P A;  4FWO A;  3VGM A;  1N8R O;  3ATV A;  4BR2 A;  2GX9 A;  2FSN A;  1HR0 K;  1HNX K;  3KTQ A;  1Q7Y O;  3MN5 A;  3EE8 A;  4KTQ A;  3M6G A;  2ZJP L;  2ZQB A;  1TAU A;  1CLQ A;  1BG3 A;  1Z25 A;  1WSI A;  2W40 A;  4CGG A;  3O8M A;  4FK0 A;  4OKE A;  4BRP A;  2WFB A;  3P1G A;  2OZM A;  5BPL A;  1KD1 O;  3EZW A;  4AF1 A;  3O4W A;  3K5L A;  1K9M O;  4B3R K;  3CJ9 A;  3V4I A;  3RVC A;  4DV0 K;  1RBU A;  3H6E A;  4H5T A;  3VEN A;  3QEW A;  4DQ8 A;  1OKJ A;  1A5X A;  3LP0 A;  4BRO A;  1U2V A;  1WAF A;  5CE3 A;  4OLA A;  1Z05 A;  5KPZ A;  4ZTJ A;  4DSI A;  1YJN N;  1LOT B;  5C2D A;  2JWK A;  4FWM A;  3DJC A;  1RT3 A;  2GV9 A;  4KHN A;  2YHW A;  4DLE A;  4CD3 A;  2KFN A;  1KVA A;  1KFD A;  4CJL A;  3AGR A;  4CK2 A;  4DHY A;  1KAY A;  3VQD A;  4BRH A;  3M8P A;  3QEX A;  4DSJ A;  1NJX A;  5AQL A;  3LM2 A;  3OYN A;  1IJJ A;  3CQ8 A;  4CJ5 A;  1RCH A;  3KIO A;  3TWH A;  2HHU A;  3J7A P;  4JKF A;  1CZ9 A;  2IGI A;  3DLK A;  4FCY A;  3O9T A;  3O3G A;  3D2E B;  3FFI A;  5GIN A;  4PKI A;  4LFA K;  3WEE A;  1YAG A;  2KLA A;  2IAJ A;  1WBD A;  3PLA A;  4IG0 A;  1KC8 O;  4Y1D A;  3CM6 A;  1A5V A;  1T7P A;  1U6Z A;  1NGD A;  4FK4 A;  4Z4G A;  5H1S Q;  3RMB A;  2A5X A;  1TKT A;  4BRL A;  3QEP A;  2Q31 A;  3QBW A;  2G8F A;  3T19 A;  4QS7 A;  4KHW A;  3IG1 A;  3ZSQ A;  2IS3 A;  1ZBL A;  3Q7C A;  4ID1 A;  1U04 A;  4IJA A;  2CH5 A;  3V1R A;  1LWC A;  3EL2 A;  3IKM A;  4I2Q A;  2AP1 A;  4FWR A;  2QW9 A;  3T1A A;  3ZSW A;  4HUE A;  1N34 K;  3BY5 A;  1VSJ A;  2XY5 A;  3E01 A;  4F3O A;  2XRI A;  3OA9 A;  3W3D A;  1BGX T;  1HYS A;  3ENH A;  1GLF O;  3QET A;  4DR4 K;  4DWI A;  3ZSX A;  2HBJ A;  2F7T A;  1RFQ A;  3V6D A;  3OYK A;  3OS1 A;  4I7F A;  3G25 A;  3BZK A;  2IOC A;  3NF8 A;  3SAH A;  3T1H K;  1NGB A;  5I42 A;  3ZLJ A;  1ASU A;  2A42 A;  2DPN A;  1KAX A;  1S1W A;  2I7N A;  3NAE A;  1C0G A;  1MWK A;  3ZX2 A;  4A59 A;  3NH2 A;  4IOX A;  1ZBI A;  5JLF A;  3DXK B;  5LY3 A;  4DV7 K;  5EX5 A;  3B8A X;  4K25 A;  4R79 A;  1WB9 A;  4NYF A;  4OX9 K;  1U4B A;  3VPZ A;  4CF9 A;  1SAZ A;  3CCS N;  4CED A;  3I0S A;  5M1Q A;  3AA4 A;  4PA1 A;  4EP5 A;  4F9O A;  3SZ2 A;  4O8U A;  1VSK A;  5HP1 A;  1W0H A;  3LDN A;  1JXE A;  2QK9 A;  4CZK A;  3QIO A;  5BPM A;  1YJ9 N;  4CK3 A;  3HL8 A;  2QWQ A;  2HHT A;  3L2Q A;  1TYQ B;  1RBR A;  3CJC A;  2OAN A;  3OYC A;  1IBM K;  1VQO N;  3K57 A;  5FRN A;  5KQD A;  3D45 A;  3EN9 A;  1KFS A;  1FKO A;  4C1N K;  1TV6 A;  1C1B A;  4BE1 A;  4GNI A;  4ELT A;  1LWE A;  2HW3 A;  1G99 A;  4WF9 L;  1TVR A;  4B9L A;  1D5A A;  2HVI A;  4FO0 A;  2GUP A;  3MX2 A;  5EXW A;  3DXM A;  2NZT A;  1YHQ N;  1VK0 A;  1XQS C;  3HRG A;  1K6Y A;  4KB1 A;  3THW A;  4UQG A;  3AO1 A;  4F3T A;  3CJ1 A;  5AQQ A;  4FJG A;  4LSN A;  1RT1 A;  4FLX A;  4XEI A;  4JI4 K;  4PHT X;  4O5F A;  4B8C A;  3J81 O;  1NWK A;  2YV0 X;  4BQZ A;  4A61 A;  5LJW A;  1KCF A;  3BP8 A;  3LZI A;  4RG8 A;  5J1E A;  2O8B A;  5BRE A;  3VET A;  1JLB A;  2HHQ A;  3M3Z A;  4DG1 A;  5BR8 K;  1I94 K;  2FF3 B;  2I5J A;  2D0O A;  1I39 A;  2BTF A;  1T44 A;  1HYZ A;  2YNF A;  4H0V B;  3MN6 A;  4H5W A;  1L3V A;  4CJR A;  3VES A;  2E4L A;  2O8E A;  2O8F A;  2D0C A;  3DRR A;  2X74 A;  1YXQ A;  3MWT A;  3F73 A;  2G8V A;  2P9I A;  3VF6 A;  3THV A;  3K5M A;  1DTT A;  2GWJ A;  2OPQ A;  4ILJ A;  1QSY A;  4KB0 A;  2F8S A;  3U4L A;  2IVN A;  4I2P A;  2UXC K;  4JI3 K;  3CFO A;  4RW7 A;  1J9A A;  1KAZ A;  3WNH A;  1RDC A;  1HYV A;  3MX5 A;  2HHH K;  3R9P A;  2HB5 A;  4AHV A;  4JK7 A;  4OPK A;  5BR9 A;  3M8S A;  2BUP A;  1WAJ A;  2HBM A;  4M7Y A;  1RTJ A;  4FJX A;  4KV8 A;  5AQH A;  1LWF A;  4RW4 A;  4B9T A;  2P9S B;  4B1V A;  2YHB A;  1S9G A;  4CIG A;  5HRP A;  2FSK A;  4HVJ A;  1MA9 B;  1X3N A;  4KHS A;  1BUP A;  4YHH K;  3BGR A;  2V7Z A;  3CC4 N;  3QEV A;  1VQP N;  5DMR A;  1A5W A;  4Z4I A;  2W42 A;  3CCL N;  2P9I B;  3AA3 A;  3FZK A;  2KZZ A;  1Q8I A;  2A6A A;  2HHX A;  1WSF A;  4BVP A;  3IDH A;  1K8A O;  3OVN A;  1GLB G;  1JLQ A;  4FJL A;  3K2P A;  1VQK N;  3V9S A;  2P51 A;  4MQ3 A;  1BCO A;  3HP6 A;  4KHQ A;  2OPS A;  3KLH A;  1NGF A;  3AVN A;  3DLG A;  1GLJ O;  2P9N B;  3SAG A;  4CF0 A;  4X66 K;  3CD6 N;  3VQ7 A;  4CGF A;  3VTI A;  1S72 N;  4JKD A;  5IT9 O;  4V19 S;  4B9U A;  4FJM A;  2B4J A;  4KTZ A;  3OYE A;  1TKX A;  4GKJ K;  5AQO A;  3G71 N;  3ASM A;  2BAN A;  3V1Q A;  3SPY A;  3TAN A;  5C25 A;  4IDH A;  3THX B;  1BL3 A;  1NK4 A;  4CZG A;  4DLG A;  1ZYQ A;  4DR7 K;  4CEZ A;  1NGH A;  4LD0 A;  4K8X A;  1S1T A;  3AVM A;  4A5B A;  3NF9 A;  4X65 K;  3T1Y K;  1QSL A;  2NRH A;  2HVH A;  3GBT A;  2E88 A;  4PKH A;  3SLC A;  3ZSZ A;  1RDB A;  2HND A;  2VG7 A;  4I6M A;  5AQP A;  3W0L A;  4F2R A;  4H5N A;  2G8U A;  1IV0 A;  4FWQ A;  1ATR A;  3AVL A;  4FW1 A;  4WFA L;  1F21 A;  3GE1 A;  3I33 A;  4AM7 A;  5AZJ B;  4B9Q A;  3CC7 N;  3TAB A;  4NCG A;  4J8F A;  5J2N A;  1KVB A;  2EX3 A;  3B6P A;  1FJG K;  4OLB A;  1TKD A;  1SL1 A;  1IKX A;  3LWM A;  3ITH A;  2P9K B;  5HL7 L;  3NDK A;  3SUO A;  3CCR N;  3ID6 A;  1NGA A;  1QQM A;  4NB4 A;  4FLW A;  1L3S A;  1VSM A;  1IG8 A;  1OH8 A;  5GAH P;  4FVM A;  4JKC A;  1RT7 A;  4BC3 A;  1S1X A;  1ZC6 A;  3HVT A;  4CBW A;  3CCM N;  4U67 L;  4M3T A;  5BRH A;  5M1N A;  2WC9 A;  5AQZ A;  3VOV A;  1EQY A;  4PY5 A;  5HBM A;  4FOE A;  3L4Q A;  2QI2 A;  3P31 A;  4GV3 A;  3SI6 A;  3VEY A;  4DQI A;  1B9F A;  1NU0 A;  5JVG L;  1NK5 A;  5ADX H;  3AAQ A;  4B9M A;  3NVK A;  5GIP A;  2JLE A;  1WLJ A;  1OH7 A;  3G4S N;  1NK0 A;  2Q2R A;  3D0P A;  4I9Q A;  2HHW A;  4FJ5 A;  5JLH A;  1BDG A;  1VQ9 N;  4DTU A;  4BR7 A;  5FPM A;  3UKU B;  4BR9 A;  5TKW A;  1TK5 A;  4N56 A;  1J5O A;  4M41 A;  3CI5 A;  1OVQ A;  2OPR A;  2HMP A;  3AVI A;  3SJH A;  1DT9 A;  5E41 A;  1UOC A;  3R8E A;  1HKB A;  3C65 A;  1TAQ A;  2FBT A;  4O55 A;  4CZJ A;  2G8H A;  3JXU A;  1RBS A;  3OTO K;  3CJB A;  3NGZ A;  4H5V A;  3BUZ B;  1YVU A;  3CMA N;  5F1X A;  4E89 A;  3OW2 M;  2YCH A;  3DOK A;  4OPA A;  3P39 A;  5BRD A;  2O8C B;  4KI6 A;  1HPM A;  1SZ2 A;  4AHU A;  4WQ4 A;  1CZB A;  3J7Y P;  4AQY K;  5JS1 A;  2VGN A;  4WCE L;  3OY9 A;  1IKW A;  3DLB A;  1XI1 A;  2VG5 A;  3IUC A;  3A5O C;  4LH4 A;  1HNI A;  1VQ5 N;  3R6M A;  2W6L A;  4DMN A;  5C2F A;  4KRE A;  1E3M A;  4UY8 O;  3EYZ A;  2E2O A;  4LF7 K;  2UXB K;  5J2P A;  3CF5 L;  3GDQ A;  1BU6 O;  1HKC A;  1YIJ N;  3DWL A;  4QS8 A;  3VQE A;  5C15 A;  2E2Q A;  3DOL A;  3KKS A;  2PY5 A;  3VQC A;  1HLU A;  2Q97 A;  4GW6 A;  1S3X A;  1NOZ A;  5JS2 A;  4YOT A;  1BA0 A;  4H0Y B;  4ISF A;  4FXD A;  5BPN A;  4BRK A;  4KH4 A;  2YNG A;  3CFR A;  5CZ1 A;  4KKO A;  2WON A;  3ZT2 A;  2HNY A;  4H03 B;  2F8T A;  5B8H A;  1RT5 A;  3AO3 A;  4JHD B;  4E7H A;  1ZBH A;  1D9D A;  1T3V A;  4KHP K;  4JN4 A;  1HRH A;  1C0F A;  3RSE A;  4EHT A;  3M1F A;  1FXX A;  2A1R A;  4CHN A;  1QHT A;  3V9Z A;  1BOT O;  2P1J A;  5AZI B;  4JKB A;  2X78 A;  1S5J A;  2XY8 A;  4O0J A;  3WXK A;  4FZX C;  3ULE A;  4DKW A;  2D0B A;  2Q36 A;  1YUW A;  3DLR A;  4CEA A;  3NF7 A;  3DYA A;  4N76 A;  3L2W A;  1UA1 A;  4BGB A;  4KHU A;  3VEO A;  3EKU A;  4IOC L;  4M3Z A;  1VRT A;  4YOW A;  4JNE A;  3VF2 A;  1TKZ A;  2QTD A;  2ATQ A;  4PUO A;  4C8O A;  3OJU A;  4DSK A;  4CIE A;  5F0X A;  4DU1 A;  3QO9 A;  4DCH A;  3TU5 A;  4K8Z A;  4JI2 K;  4CER A;  1SKS A;  5JIC A;  3ZX3 A;  3ZT0 A;  1RBV A;  4CD1 A;  4CHQ A;  1EO1 A;  2IIR A;  3THY A;  1S6P A;  2PYJ A;  1VSL A;  2WBN A;  3KD5 E;  1VQN N;  4FJ7 A;  4JD2 A;  3WQT A;  1NG9 A;  1NJZ A;  2ZD1 A;  2P9P B;  1CXQ A;  1J53 A;  2Z1I A;  4DFM A;  2EWS A;  3CQX A;  5LL6 Z;  1X3M A;  1VQ8 N;  4CJ7 A;  3SNN A;  4OKJ A;  3LAK A;  2QKK A;  4X64 K;  2VWB A;  1ITG A;  1NJI O;  1Z6R A;  5SZT A;  4BC5 A;  1HJR A;  4CF2 A;  4LC9 B;  3NHG A;  4AH9 A;  4W5O A;  3KD1 E;  1N36 K;  1U2V B;  4CCH A;  4LF8 K;  1HKG A;  3C6T A;  3HPG A;  1D8Y A;  4CGJ A;  2NNW A;  3CJA A;  1L3U A;  2HNZ A;  1J5E K;  4QCL A;  3N4Q A;  5AQT A;  4FJJ A;  5AQI A;  2GBZ A;  5CHI A;  4BRD A;  3CC2 N;  3RR8 A;  4CJF A;  1Z26 A;  4YOY A;  4DS5 A;  1XWL A;  2WOM A;  2F96 A;  4CIF A;  4OJR A;  3VQA A;  1NK8 A;  4ELV A;  4KFB A;  5FPD A;  4KO0 A;  4DFP A;  1I3A A;  1NJY A;  4CEO A;  3VQ4 A;  3MED A;  1JL2 A;  5M1P A;  3VEZ A;  1XMO K;  3KKR A;  4BY9 C;  3OYB A;  3QDK A;  4MLH A;  1FKP A;  4NO7 A;  3CCQ N;  1U47 A;  4BRE A;  2PBD A;  4LF6 K;  5E84 A;  4DF4 A;  4B1Z A;  2F9W A;  5M1K A;  1N32 K;  2RF2 A;  1GOA A;  4Q0B A;  4H0O A;  3S41 A;  5KQ8 A;  5FPN A;  4CFD A;  3WEE B;  3AO2 A;  3ZSY A;  3C6H A;  3C94 A;  3OBW A;  1HJO A;  3LDO A;  2NUB A;  1GLD G;  2B6A A;  1U45 A;  3FZF A;  3VMF B;  1QVG M;  4E7K A;  3ZSR A;  4IOA L;  3A5N C;  1YF5 L;  1FK9 A;  3CCV N;  4NXM K;  1BWF O;  1TL3 A;  4C8N A;  1YTA A;  2E2N A;  3VGL A;  5FRM A;  3I55 N;  4JV5 K;  2VG6 A;  4CJK A;  3VQB A;  1JCE A;  4FK2 A;  4FLZ A;  2E1Z A;  1E4G T;  3O1B A;  2OYQ A;  1T6C A;  1ATN A;  4FW2 A;  1Q18 A;  3QIC A;  5E26 A;  4IO9 L;  3VEV A;  4JAX A;  2Y1J A;  4IXC A;  4RCH A;  5KI6 A;  3L2V A;  4CJ4 A;  3C6U A;  4EP4 A;  3M8Q A;  3L2R A;  3SMS A;  4DR6 K;  4IBN A;  4FJN A;  3RMA A;  3AVH A;  2XO7 A;  3M5R A;  2FBY A;  1MWM A;  1XC9 A;  1IBL K;  2RN2 A;  3QNO A;  2XY7 A;  1O13 A;  1WSG A;  4ID5 A;  3TAQ A;  4B9V A;  4HCC A;  1KLM A;  3I56 N;  2PZS A;  3V9X A;  3ENO A;  4E7L A;  1VQM N;  3OYA A;  4BDY A;  4E19 A;  4OO1 J;  4CHP A;  4DTM A;  3O6W A;  4DTS A;  3SUP A;  3E1Y A;  2HHS A;  2E2P A;  2RHK A;  3ATU A;  3WXM B;  4O4G A;  4CHO A;  4W5R A;  1S1U A;  3MMV A;  4HWI A;  5BN8 A;  3D6R A;  1W2B M;  4HCB A;  1RIL A;  4E1M A;  1N33 K;  1KRP A;  4FLY A;  1D4X A;  3FR0 A;  1EXQ A;  3SQ2 A;  4L8R B;  4EAH D;  2KZM A;  2E20 A;  1GLE G;  5EVZ A;  3AVG A;  4BR4 A;  4DR5 K;  1JLA A;  3LP1 A;  3UKR A;  3KK3 A;  4O0I A;  3E9O A;  3ID8 A;  3SAF A;  2ZGZ A;  4JKE A;  1KXP A;  1VSD A;  4WQ5 A;  4JS4 A;  4J2B A;  1BIZ A;  3QEI A;  3VQ5 A;  4N41 A;  4XH4 A;  4JKG A;  3LDL A;  3T3F A;  5AQY A;  4FM0 A;  1BIS A;  4RTF D;  2QWN A;  3KJV A;  2XY6 A;  1VHX A;  1NKB A;  3GL1 A;  1XNR K;  4N47 A;  5JVH L;  3DXM B;  4RW9 A;  1HNZ K;  3L8B A;  3OYG A;  3O3F A;  1QTM A;  1XNQ K;  1HNV A;  2E6M A;  4LH5 A;  5HOO A;  3THW B;  1Q82 O;  4H0T B;  4DTP A;  3TAM A;  1NM1 A;  1X9W A;  3HST B;  4H5R A;  2H3G X;  3N4P A;  4MDB A;  5J2M A;  5AQR A;  4JS5 A;  3AAP A;  3I0R A;  2D0A A;  4JLH A;  3K0S A;  2Y1I A;  3MXJ A;  1SL0 A;  3UKR B;  3IRX A;  1NNE A;  1L5U A;  4ELU A;  4W5T A;  2O8B B;  1SUQ A;  3CCJ N;  4AHR A;  3HYF A;  1K73 O;  2NRT A;  2OTL N;  1HNW K;  3CYM A;  4FPB A;  4FJ9 A;  3ZEU A;  1DKG D;  2OA8 A;  3F5T A;  4GKK K;  4IO8 A;  4Z94 A;  3HVR A;  3O08 A;  2O8E B;  2O8F B;  3A8Y A;  3LL3 A;  3PO4 A;  1JXB A;  3QML A;  1GLA G;  1S6Q A;  3ISN C;  5HRS A;  3HPH A;  4OPH A;  3AO4 A;  3VQP A;  3F2K A;  1M90 O;  2F9T A;  4KBO A;  4DR1 K;  3MCP A;  3TAG A;  4BR0 A;  2YJE A;  4FSV A;  4NCB A;  4IKF A;  3ULD A;  2DFE A;  1B92 A;  2FLO A;  2Q3S A;  3MN9 A;  3SJJ A;  2CH6 A;  4DS4 A;  5CYQ A;  3OYF A;  4LFC K;  4ISE A;  1JLF A;  1VAZ A;  4JKH A;  2NRV A;  1QQN A;  4DU4 A;  5FPE A;  1VSH A;  3WNF A;  4AHC A;  2CGK A;  4FJI A;  1KVC A;  4KI4 A;  2AA4 A;  1TUU A;  3MEG A;  3O4Q A;  3AV9 A;  2YI1 A;  3H46 O;  3NCI A;  3NE6 A;  2FF6 A;  5AR0 A;  1WOQ A;  4LFB K;  2FXU A;  3C7N A;  4CEB A;  4C1N I;  1P90 A;  3AY9 A;  1YIT N;  2Z1G A;  1NMN A;  4RWT A;  1EET A;  5DM7 L;  1QSS A;  1RNH A;  3V1O A;  2IVP A;  2HOE A;  2KTQ A;  1K8K A;  1C1C A;  3O4N A;  3ZET A;  3MCA B;  4FLV A;  1RBT A;  1RTH A;  4BE2 A;  4W5N A;  2XHB A;  3GOI A;  4JK8 A;  3WT0 A;  4KPY A;  1ILY A;  4WYB A;  3O80 A;  3V9U A;  4J2D A;  2Q0U A;  4DQP A;  3T69 A;  3QLH A;  4E1J A;  4B1X B;  2ZGY A;  1QQC A;  5AQS A;  3FFK B;  4CK1 A;  3C7N B;  4YDU A;  5GAE P;  2D4W A;  2YKN A;  5EY4 A;  5AQU A;  1C0M A;  3SQ1 A;  3TR8 A;  1RDD A;  1X9M A;  2E6L A;  2VGM A;  3L2U A;  4ZHR A;  3L6Q A;  1IKV A;  3PX4 A;  3PIO L;  1X1P A;  5SWM A;  3L3U A;  2ZM6 K;  3K5N A;  4E0D A;  4WE1 A;  2ASM A;  4I6M B;  3CET A;  3T7Z A;  3TSU A;  1LCU A;  1SQK A;  3KZB A;  4CBU A;  1W97 L;  4DV4 K;  3DAW A;  5MLC Q;  2NLX A;  2P9L A;  3EKS A;  3VEX A;  3PY8 A;  1HX1 A;  3DLE A;  2HBL A;  3E66 A;  1WUA A;  3UIQ A;  1SS6 A;  3C6A A;  1TUY A;  2ZE2 A;  4L3Q A;  4DR3 K;  4BG8 A;  4XH5 A;  2PYL A;  3QFU A;  5HRR A;  1T6D A;  3ZSV A;  2YX6 A;  1JJ2 M;  1X9J A;  3SK3 A;  2P9U A;  5KTQ A;  4FJ8 A;  5KPR A;  1UA0 A;  3QIN A;  4B1U B;  3BF3 A;  3HO1 A;  2ITG A;  2HF4 A;  4F8R A;  4K43 A;  4B3S K;  2YNH A;  2JGU A;  2O8D A;  3HM8 A;  4HTL A;  4IJN A;  3NMU A;  5C10 A;  3ALY A;  4GV6 A;  4BRI A;  4YY3 K;  4FZZ A;  4HUF A;  3HSC A;  3R3L A;  4DTN A;  3KLF A;  1RT2 A;  5ELZ A;  5AQF A;  4DF8 A;  1NK7 A;  3HBT A;  3V9W A;  3LAN A;  5TKY A;  1HMV A;  4M3W A;  3MXI A;  3A0I X;  4MO5 A;  4G1Q A;  4K0K K;  1QQO A;  4AHT A;  4BRM A;  3H1V X;  5LMN K;  4TSX A;  1HQE A;  3VN5 A;  1C0U A;  1VSF A;  1SL2 A;  4FVU A;  4CHY A;  4X62 K;  1E4F T;  4E1N A;  3AVA A;  1RDW X;  3VA0 A; 
#chains in the Genus database with same CATH homology
 3HT3 A;  3RTV A;  3RR8 A;  4CJF A;  1Z26 A;  3PUF A;  3VA3 A;  4DS5 A;  1XWL A;  3TI0 A;  4H4M A;  1TK0 A;  2WOM A;  2F96 A;  4CIF A;  4OJR A;  1D9F A;  4FJH A;  3VQA A;  1JLB A;  2A1S A;  3IAY A;  4NCA A;  4DG1 A;  1NK8 A;  1NK6 A;  3PO5 A;  4ELV A;  4KFB A;  1BCM A;  2FBX A;  4KO0 A;  4DFP A;  4M3R A;  1U49 A;  1I3A A;  1S9E A;  4LSL A;  1NJY A;  3DM2 A;  2I5J A;  4CEO A;  3VQ4 A;  1I39 A;  2YNF A;  3MED A;  1JL2 A;  1HYZ A;  3DRP A;  3OS2 A;  4ICL A;  3KKR A;  4XIU A;  5EU7 A;  4CJR A;  3KLG A;  1XHZ A;  2E4L A;  3OYB A;  1L3V A;  1O1W A;  2D0C A;  3DRR A;  2X74 A;  1FKP A;  4CEC A;  2IC3 A;  3QNN A;  4CJU A;  1U47 A;  1N6Q A;  5FDL A;  3F73 A;  4DF4 A;  2G8V A;  4CGH A;  4KRF A;  5HRN A;  3THV A;  2RF2 A;  3K5M A;  1GOA A;  4Q0B A;  1DTT A;  2B5J A;  4CFD A;  3S9H A;  3S3N A;  3AO2 A;  1ASW A;  1VSE A;  2YHA A;  3ZSY A;  3V81 A;  2RPI A;  2OPQ A;  3RMD A;  1QSY A;  3C94 A;  3NBP A;  1JKH A;  4KB0 A;  2F8S A;  4CES A;  3K5O A;  4HTU A;  1IH7 A;  4I2P A;  2NUB A;  3CFO A;  4Z4E A;  4RW7 A;  3SCX A;  1J9A A;  4C8K A;  2B6A A;  3LAM A;  1U45 A;  3WNH A;  2IDO A;  1RDC A;  1HYV A;  1RDA A;  2BGG A;  3L3V A;  2QKB A;  1KTQ A;  2HB5 A;  4E7K A;  3ZSR A;  3A2F A;  4AHV A;  4OPK A;  1Q9X A;  1FK9 A;  3M8S A;  4M3U A;  3DLH A;  3MEC A;  4EZ9 A;  1WAJ A;  1TL3 A;  4C8N A;  4CJE A;  1YTA A;  5FRM A;  1RTJ A;  3CFP A;  4FJX A;  4J2E A;  4KV8 A;  2VG6 A;  1LWF A;  4RW4 A;  4DU3 A;  4CJK A;  3VQB A;  4OPJ A;  4B9T A;  4FK2 A;  1U48 A;  2EHG A;  4JRQ A;  4FLZ A;  2OYQ A;  1YTU A;  1REV A;  2YHB A;  3RWU A;  1SV5 A;  2Z1H A;  1S9G A;  4CIG A;  5HRP A;  4Z4F A;  4FW2 A;  5HLF A;  1TK8 A;  3NGI A;  3HPO A;  5J2Q A;  3LP3 A;  2Y1J A;  4HVJ A;  3OYH A;  4DSE A;  4KHS A;  1J54 A;  4DTX A;  4HHT A;  3BGR A;  5KI6 A;  4H8K A;  4C8M A;  3L2V A;  4CJ4 A;  3C6U A;  4EP4 A;  3AVB A;  3M8Q A;  3OYJ A;  3I8D A;  3L2R A;  4DQS A;  4FM1 A;  5DMR A;  3QEV A;  4F4K A;  1A5W A;  4RW8 A;  4KAZ A;  4Z4I A;  4IBN A;  4CJS A;  2W42 A;  3RMA A;  4FJN A;  3AA3 A;  2KZZ A;  3AVH A;  1GOB A;  1Q8I A;  2HHX A;  1WSF A;  2XO7 A;  2FBY A;  4E7I A;  3U6F A;  3OVN A;  4M45 A;  1JLQ A;  5KGW A;  4ZTF A;  2FBV A;  1XC9 A;  2RN2 A;  4FJL A;  3K2P A;  3QNO A;  2VWK A;  4AIL C;  1WSG A;  4ID5 A;  2XY7 A;  3TAQ A;  3V9S A;  2P51 A;  4B9V A;  3AA2 A;  5DK5 A;  2KW4 A;  4MQ3 A;  1BCO A;  1KLM A;  5FRO A;  1N5Y A;  4HCC A;  3HP6 A;  4KHQ A;  4DQQ A;  2OPS A;  2PZS A;  1S1V A;  3KLH A;  3U3Y A;  3AVN A;  3DLG A;  1Y97 A;  3V9X A;  4E7L A;  3QES A;  4FLT A;  4FZY A;  4CF0 A;  3OYA A;  4BDY A;  4E19 A;  4CHP A;  3RR7 A;  3VQ7 A;  4CGF A;  4DTM A;  5KRS A;  4KHY A;  4DTS A;  1WSJ A;  1EKE A;  4CF1 A;  2G8W A;  4FLU A;  3SUP A;  4BDP A;  1BI4 A;  3SV4 A;  2HHS A;  1RTI A;  4O4G A;  4OGC A;  4B9U A;  4CFB A;  4CHO A;  2B4J A;  4FJM A;  4KTZ A;  3OYE A;  2Z1J A;  1GOC A;  1S1U A;  1TKX A;  4W5R A;  4CF8 A;  1W9H A;  3ASM A;  4IFY A;  4BE0 A;  2BAN A;  1EX4 A;  1DLO A;  4DFK A;  3RRH A;  3V1Q A;  4HCB A;  4FM2 A;  1RIL A;  3SPY A;  3TAN A;  4E1M A;  5C25 A;  1SKW A;  1NK9 A;  4LY7 A;  1KRP A;  4FLY A;  1BL3 A;  4PQU A;  4DSL A;  2O4I A;  1EXQ A;  2O4G A;  3SQ2 A;  1NK4 A;  4L8R B;  1HPZ A;  3KK1 A;  4DLG A;  2KZM A;  1TL1 A;  2G8K A;  1ZYQ A;  3CG7 A;  2BE2 A;  3AVG A;  4CEZ A;  1JLA A;  3LP1 A;  3F9K A;  3KK3 A;  4LD0 A;  4O0I A;  3ZT3 A;  4Z4H A;  3S3M A;  1T8E A;  4K8X A;  5KRT A;  3RMC A;  1S1T A;  3AVM A;  3VQ8 A;  3NF9 A;  4CJV A;  4CJ3 A;  1SKR A;  3OYM A;  4NYN A;  1QSL A;  1UWB A;  3H08 A;  1VSD A;  2HVH A;  4O44 A;  1BQN A;  4JS4 A;  3QER A;  4BAC A;  1JL1 A;  2YKM A;  4J2B A;  1BIZ A;  4W5Q A;  3QEI A;  3VQ5 A;  3ZSZ A;  4QOZ B;  1RDB A;  2HND A;  4B9S A;  3RRG A;  4N41 A;  3OS0 A;  3IS9 A;  3PX0 A;  4FYD A;  1BQM A;  1LW2 A;  2VG7 A;  4GVM A;  3T3F A;  3G10 A;  1T05 A;  4F2R A;  4FM0 A;  1BIS A;  1JLG A;  2G8U A;  1BIU A;  3LZJ A;  3AVC A;  3AVL A;  3BDP A;  4FW1 A;  3HJF A;  3KJV A;  2XY6 A;  1F21 A;  3KLE A;  1QS4 A;  1NKB A;  1ASV A;  4IDK A;  3JSM A;  4CJQ A;  4EZ6 A;  4QAG A;  4N47 A;  3HM9 A;  1B9D A;  3SQ0 A;  4CHZ A;  1JLE A;  2D5R A;  4Z4C A;  4RW9 A;  3HK2 A;  3KLI A;  1BI4 B;  3L8B A;  3OYG A;  4Q5V A;  3TAB A;  3O3F A;  1QTM A;  5D3G A;  4B3O A;  3NFA A;  4H4O A;  4B8A B;  4M3Y A;  4NCG A;  5J2N A;  1HNV A;  2E6M A;  2RKI A;  1KVB A;  4LH5 A;  2EX3 A;  3B6P A;  3OYL A;  4OLB A;  1TKD A;  2GUI A;  3CM5 A;  1IKX A;  3LWM A;  3ITH A;  4Y1C A;  3TAM A;  1ZBU A;  4DTP A;  3NDK A;  1SL1 A;  4YNQ A;  3SUO A;  2HHQ A;  1WN7 A;  1X9W A;  3AVK A;  3HST B;  4J2A A;  3DMJ A;  3HP9 A;  3DI6 A;  4IG3 A;  1LV5 A;  4FLW A;  4OVL A;  4JS5 A;  5J2M A;  1VSM A;  1VRU A;  1L3S A;  3I0R A;  2D0A A;  3C95 A;  4N5S A;  4JLH A;  3TAR A;  2OZS A;  1KSP A;  2Y1I A;  2KFZ A;  4FVM A;  4F2S A;  2DFF A;  1RT7 A;  2QXF A;  4BDZ A;  3SV3 A;  1S1X A;  3HVT A;  3MXJ A;  4CEE A;  3O3H A;  4B9N A;  1CXU A;  1JLC A;  1SL0 A;  3IRX A;  1RTD A;  1L5U A;  4M3T A;  3TAE A;  4ELU A;  3ZT4 A;  4W5T A;  1SUQ A;  3VQ6 A;  4PY5 A;  5HBM A;  4AHR A;  3HYF A;  4I9L A;  3G0Z A;  2G8I A;  4OGE A;  3SI6 A;  1IG9 A;  3CYM A;  3HXM A;  1RT4 A;  3ZT1 A;  1C6V A;  1NKC A;  1B9F A;  4DQI A;  4E3S A;  4FJ9 A;  3P83 D;  4CJW A;  4MFB A;  4B08 A;  2OPP A;  1NK5 A;  2DFH A;  2OA8 A;  1XHX A;  4B9M A;  3HVR A;  4R5P A;  3PV8 A;  2JLE A;  1WLJ A;  3KTQ A;  1NK0 A;  4KTW A;  3D0P A;  3PO4 A;  4I9Q A;  3K58 A;  1JXB A;  4KTQ A;  2HHW A;  3S3O A;  1S6Q A;  2ZQB A;  4FJ5 A;  1TAU A;  3P5J A;  3ISN C;  5HRS A;  3HPH A;  1CLQ A;  3AO4 A;  1Z25 A;  2DTU A;  3AVF A;  4CJP A;  1WSI A;  1VSI A;  3VQP A;  4CGG A;  5K14 A;  4DTU A;  4FK0 A;  2LSN A;  4OKE A;  3P1G A;  2OZM A;  5T7B A;  3TAG A;  4DSF A;  4NCB A;  3K5L A;  3LWL A;  4N56 A;  1TK5 A;  1J5O A;  4M41 A;  3ULD A;  3V4I A;  4IKF A;  2OPR A;  2DFE A;  1B92 A;  1RBU A;  2Q3S A;  3NGY A;  1G15 A;  3QEW A;  3SJJ A;  1A5X A;  3AVI A;  3LP0 A;  5CYQ A;  3OYF A;  4DS4 A;  1YT3 A;  5E41 A;  1UOC A;  1WAF A;  4OLA A;  5HRO A;  1Q9Y A;  4ZTJ A;  1TAQ A;  1JLF A;  4CE9 A;  2FBT A;  4DSI A;  4O55 A;  2G8H A;  1RBS A;  2AJQ A;  1IO2 A;  3NGZ A;  4DU4 A;  1YVU A;  4O5B A;  4CJT A;  3LPU A;  3LP2 A;  1RT3 A;  2GV9 A;  4KHN A;  4E89 A;  3WNE A;  4DLE A;  1VSH A;  3DRS A;  3WNF A;  4AHC A;  2HMI A;  2KFN A;  1KVA A;  4FJI A;  1KFD A;  1KVC A;  4KI4 A;  3DOK A;  4CJL A;  3MEG A;  3O4Q A;  4CK2 A;  3AV9 A;  3VQD A;  4E7J A;  4KI6 A;  3MXM A;  3M8P A;  4AHU A;  3QEX A;  5KGX A;  4YFU A;  3EY1 A;  1NJX A;  4DSJ A;  2ETJ A;  3NCI A;  3OYN A;  3EZ5 A;  1CZB A;  3NE6 A;  3CQ8 A;  3SQ4 A;  5JS1 A;  4CJ5 A;  3TAP A;  3OY9 A;  1IKW A;  1RCH A;  4CEB A;  3DLB A;  1XI1 A;  1R0A A;  3KIO A;  3TWH A;  2VG5 A;  1LAV A;  1MU2 A;  2HHU A;  4LH4 A;  1HNI A;  1CZ9 A;  2IGI A;  2Z1G A;  4DMN A;  3NH1 A;  4KRE A;  3DLK A;  4FCY A;  2YNI A;  3O3G A;  3EYZ A;  3OJS A;  5J2P A;  1EET A;  3MAQ A;  1QSS A;  3FFI A;  5CYM A;  1RNH A;  3V1O A;  3VQE A;  3VQQ A;  3DOL A;  4CEQ A;  2IAJ A;  2KTQ A;  1C1C A;  4DTJ A;  4PWD A;  4IG0 A;  3KKS A;  3O4N A;  2PY5 A;  4FLV A;  1RBT A;  3VQC A;  4Y1D A;  3SYZ A;  2KQ2 A;  1RTH A;  4GW6 A;  4BE2 A;  3CM6 A;  1NOZ A;  5JS2 A;  3ZCM A;  4W5N A;  1A5V A;  1T7P A;  3NH0 A;  1C0T A;  4OKK A;  2BDP A;  4FK4 A;  3LAL A;  4Z4G A;  4FXD A;  2XHB A;  3RMB A;  4Z0U A;  4JRP A;  1TKT A;  2YNG A;  3CFR A;  3QEP A;  5CZ1 A;  4KPY A;  4DFJ A;  1WNS A;  2G8F A;  3T19 A;  4KKO A;  4KHW A;  4M42 A;  4BWM A;  3V9U A;  2WON A;  3IG1 A;  3ZSQ A;  4J2D A;  3MEE A;  2IS3 A;  4CGI A;  4DQP A;  3QLH A;  1ZBL A;  3ZT2 A;  2HNY A;  1NKE A;  4ID1 A;  1BHL A;  1C1A A;  1U04 A;  3V1R A;  3SUN A;  2F8T A;  1LWC A;  1QQC A;  1RT5 A;  3AO3 A;  4I2Q A;  4E7H A;  4CK1 A;  3U3G A;  3T1A A;  3ZSW A;  1T03 A;  4HUE A;  1ZBH A;  2XY5 A;  1VSJ A;  1D9D A;  3E01 A;  4F3O A;  2XRI A;  1BGX T;  1HYS A;  3QIP A;  3SPZ A;  3QET A;  1HRH A;  2YKN A;  1X9S A;  1C0M A;  4M3X A;  3SQ1 A;  3ZSX A;  3TR8 A;  1RDD A;  1X9M A;  2E6L A;  3L2U A;  4DWI A;  1FXX A;  2A1R A;  4CEF A;  4CHN A;  1QHT A;  4ZHR A;  3V6D A;  3PX4 A;  1IKV A;  3OYK A;  3V9Z A;  2X6N A;  3OS1 A;  1X1P A;  4I7F A;  5SWM A;  2P1J A;  3L3U A;  2IOC A;  1EP4 A;  1WSH A;  2X78 A;  3NF8 A;  1RT6 A;  1S5J A;  2XY8 A;  4O0J A;  4WE1 A;  3K5N A;  5I42 A;  4E0D A;  4FZX C;  1ASU A;  3SUQ A;  3LPT A;  4FJK A;  4DQR A;  2D0B A;  1S1W A;  3DLR A;  4CEA A;  3NAE A;  4C8L A;  3NF7 A;  3NH2 A;  1ZBI A;  1QE1 A;  3NF6 A;  3DYA A;  3KK2 A;  4N76 A;  2HHV A;  3L2W A;  1UA1 A;  4KHU A;  2VWJ A;  1L3T A;  3WNG A;  1LW0 A;  3ZSO A;  1KLN A;  1HQU A;  3PY8 A;  4M3Z A;  4NYF A;  1VRT A;  1U4B A;  3DLE A;  4CGD A;  2FC0 A;  2P5G A;  3UIQ A;  1TKZ A;  3JYT A;  2ATQ A;  2ZE2 A;  4PUO A;  4C8O A;  3OJU A;  4CF9 A;  4DSK A;  3OYI A;  3AA5 X;  4CED A;  4CIE A;  4DU1 A;  3I0S A;  3QO9 A;  3TAF A;  5C42 A;  2PYL A;  4GMJ B;  3AA4 A;  3AVJ A;  4PA1 A;  5HRR A;  4EP5 A;  3SZ2 A;  4K8Z A;  1VSK A;  5HP1 A;  4CER A;  1SKS A;  1W0H A;  2QK9 A;  1JXE A;  3ZSV A;  5KTQ A;  5CZ2 A;  3QIO A;  4FJ8 A;  1UA0 A;  1UAX A;  3ZT0 A;  4CK3 A;  3HL8 A;  5C24 A;  4IFV A;  1RBV A;  4CHQ A;  3L2Q A;  3QIN A;  2HHT A;  1RBR A;  4BWJ A;  3B6O A;  1S6P A;  3OYC A;  1VSL A;  3AO5 A;  2PYJ A;  3HO1 A;  1DTQ A;  2ITG A;  1IKY A;  3K57 A;  3KD5 E;  3M8R A;  4F8R A;  4FJ7 A;  5FRN A;  5CY4 A;  1WSE A;  2YNH A;  3LDS A;  2JGU A;  3D45 A;  4RW6 A;  1KFS A;  1FKO A;  2X6S A;  1NJZ A;  2ZD1 A;  1CXQ A;  1TV6 A;  4HUG A;  3ALY A;  1J53 A;  1LAW A;  2Z1I A;  4DFM A;  1C1B A;  4BE1 A;  4ELT A;  1LWE A;  3K59 A;  2HW3 A;  4FZZ A;  1TVR A;  4HUF A;  4B9L A;  1D5A A;  4DTN A;  3SNN A;  2HVI A;  4OKJ A;  4CFC A;  3LAK A;  2QKK A;  3PX6 A;  4DTR A;  3KLF A;  1RT2 A;  5I3U A;  1ITG A;  5SZT A;  1HJR A;  1ZBF A;  4CF2 A;  4DF8 A;  1NK7 A;  3V9W A;  1VK0 A;  3LAN A;  2R7Y A;  1HMV A;  2DY4 A;  1TGO A;  1K6Y A;  4KB1 A;  3MXI A;  4M3W A;  4UQG A;  2P5O A;  3AO1 A;  4G1Q A;  3VQ9 A;  4F3T A;  3NHG A;  1NOY A;  1NJW A;  4FJG A;  4AH9 A;  4LSN A;  4AHT A;  1RT1 A;  4AHS A;  4CFA A;  4TSX A;  4W5O A;  4FLX A;  3KD1 E;  4CCH A;  3HPG A;  3C6T A;  1HQE A;  1D8Y A;  3VN5 A;  1C0U A;  1VSF A;  4B8C A;  4CGJ A;  1SL2 A;  1L3U A;  2HNZ A;  4QCL A;  2YV0 X;  4CHY A;  4DTO A;  4E1N A;  3AVA A;  3OYD A;  4FJJ A;  1KCF A;  3LZI A;  2GBZ A;  4RG8 A;  5J1E A;  3VA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...