1CZCA

Aspartate aminotransferase mutant atb17/139s/142n with glutaric acid
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
396
structure length
396
Chain Sequence
MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ASPARTATE AMINOTRANSFERASE)
publication title Cocrystallization of a mutant aspartate aminotransferase with a C5-dicarboxylic substrate analog: structural comparison with the enzyme-C4-dicarboxylic analog complex.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 136
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1czcA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1czcA01
1PMMA 3DR4A 2Z9UA 1CJ0A 1B4XA 2Z20A 1MDZA 2BI1A 2QA3A 4ZSWA 1WYVA 4ADDA 2AY3A 1LKCA 2ZJGA 2W8JA 4CXRA 3JTXA 3PDBB 3L44A 1LW5A 3MAFB 2VYCA 4J5UA 4MY5A 1IUGA 4ADCA 1CL1A 3ACZA 3NRAA 3LVLB 4HF8A 1Z7DA 1GDEA 5BJ4A 2R2NA 1MDOA 3PAAA 4PVFA 1V2DA 4TN4A 2Z9VA 9AATA 4OC9A 3HL2A 1EJIA 1B5PA 2V0YA 2D5YA 2G6WA 3WKRA 4U2HA 3MAUA 2AY2A 3FKDA 2VMVA 1PG8A 4RKCA 3A9ZA 2QBTA 3PD6A 4RKDA 1AMRA 1B8GA 3WCOA 2BKWA 2AY8A 4ZASA 2CB1A 1BS0A 3ZRRA 1IX6A 2OQXA 5EAAA 1UU1A 3WGCA 2F8JA 1OXPA 4Y0HA 1JS6A 2CY8A 4MQQA 2E7JA 2JISA 3BV0A 1H1CA 2CFBA 4WYDA 1KMKA 1TOIA 2X8UA 4U1TA 1PMOA 2YKVA 2GB3A 3COGA 3PD6B 1DGDA 3FRKA 3LY1A 2QB2A 2VGUA 4MKKA 4ATQA 2ORDA 5I92A 1ZOBA 1X0MA 5EFSA 5G2PA 4A00A 3NYUA 2D61A 1ASDA 3QHXA 3RBLA 3FZ7A 4F5JA 5K8BA 2X5FA 1LW4A 2W7DA 1CQ7A 1YOOA 3EI8A 3FQ8A 1ARGA 4LNMA 3MC6A 4AO4A 2HZPA 2DGLA 2OGAA 1SFFA 2HP2A 4MGRA 4MSOA 4W1XA 3AELA 2AEUA 3EUCA 4ITGA 1JG8A 2VMTA 2EZ2A 3RCHA 3ASAA 4MQPA 3NTJA 2VMNA 2W7MA 1M0OA 1X29A 3TFUA 3F0HA 3FVXA 3NNKA 3NU8A 3WZFA 1G7WA 4GRXA 1B9HA 3PGYA 2X5DA 3K7YA 2Z9XA 3F9TA 2CINA 1FG3A 3FQAA 5EIGA 4ZWVA 4RAEA 1YJSA 3RCHB 2ZY2A 1UU0A 1N8PA 2GMUA 2W7GA 2W7FA 2VMUA 3FVUA 4PFFA 2D65A 2VIBA 4WB0B 4M2MA 4B9BA 5LH9A 3RQ1A 1J32A 2W8UA 3H14A 3DRDA 1O4SA 4BMKA 4XJPA 2DKJA 4B98A 1GC2A 1VEFA 1ASAA 4QGRA 2XBNA 1O69A 4ZDOA 5DX5A 4N0WA 2Z61A 3GSBA 4BQ0A 2ZSMA 1ASFA 2HUFA 1FC4A 1YJYA 3AEMA 1J04A 2JG2A 3VK2A 1DJ9A 1W7MA 2GSAA 4GSAA 4ZLVA 2VMQA 2YCPA 3FDBA 4KAMA 4Q75A 1YIYA 1CZCA 1IAYA 1RVUA 1IJIA 1D7RA 5EUEA 2W7JA 3FSLA 4LC3A 4ZDLA 1M7YA 2CJDA 4DBCA 4A0GA 3B1EA 3KGXA 3DODA 3LVMA 4BHDA 5M4DA 4AZKA 4CBRA 2BI5A 4UHMA 1X2AA 4DQ6A 2W7HA 1W23A 4OCAA 3ZRPA 1YNUA 3EZ1A 3G7QA 2FM1A 2W8VA 3PA9A 4OTLA 2VIAA 2JGTA 3ATHA 4P3MA 2VGVA 2AY9A 1Y4IA 2R5EA 1M0QA 3D6KA 4WXGA 3WCNA 1WYUA 1YAAA 3W1IA 3GBXA 4A0FA 1DKAA 2VMPA 3BN1A 2BWPA 2YKYA 1KKJA 2W7EA 1M32A 4F5HA 4EB7A 3F6TA 2D7YA 1M6SA 3CAIA 1AHGA 3RBFA 3ZRQA 3QM2A 2QLRA 1WKGA 4UHOA 4I8AA 2Z1YA 3MEBA 5FT8A 1S08A 1Z3ZA 3EIAA 3HBXA 3PDBA 1AMSA 2E7UA 2BI2A 2D7ZA 3AEJC 3EI7A 4UOYA 3BS8A 1ASLA 2W7LA 4W5KA 5FT5A 5EAVA 3EI5A 3DXWA 4LW4A 4F5LA 4IYOA 5M49A 2FNIA 3B46A 3A8UX 1GBNA 3EZSA 5DJ9A 1IX7A 3DC1A 4IW7A 4WLJA 4XJOA 4NOGA 1BKGA 4XAUA 1C7OA 1KMJA 4GE4A 4O6ZA 2R0TA 4W1WA 2PO3A 3BCXA 1LC8A 5BJ3A 1DJUA 1MLYA 2YKXA 2W7IA 3QN6A 1AJSB 1OHWA 2QMAA 4FFCA 1UKJA 4JEXA 3DXVA 2BWNA 4IYOB 2OATA 3G8MA 3NYSA 4OMAA 3VK4A 5F9SA 1GCKA 3E6GA 1PFFA 2YKUA 1ASCA 1BQDA 3BCBA 2W8TA 2YRRA 2D63A 4A0HA 3TFTA 2W7KA 4IX8A 4J8LA 1OATA 4W1VA 3WLXA 4AOAA 1I43A 3FFRA 3FZ8A 3IF2A 2Z1ZA 1W7LA 3QGUA 5M46A 3AATA 3WY7A 1WYTB 5E4ZA 1C7NA 1B9IA 4JEYA 4Y0DA 4LW2A 1BJOB 4E3RA 4W8IA 3E2FA 1SVVA 3ASBA 1JS3A 3N75A 3QPGA 1AKAA 3JWBA 1ELUA 1IBJA 1ECXA 2YRIA 1AY5A 3JW9A 3QI6A 1TASA 2VMYA 4JF0A 3I4JA 4IXOA 3UAKA 3NDNA 2ZY4A 3W1JA 1V2EA 1P3WA 2D64A 1TOEA 4KXKA 4R2NA 4A72A 2FYFA 2EPJA 3BWOA 1WKHA 2D66A 1B5OA 4ZSYA 3BWNC 2VMWA 3CQ6A 2CTZA 1QIRA 2VGSA 2WK7A 2YCNA 4RLGA 4ADBA 1OXOA 3LG0A 5TF5A 1SZKA 4LNJA 1LS3A 3UE8A 1GEXA 1S09A 1D7SA 3A9YA 4WB0A 1M0PA 4AO9A 1AMQA 3R9AA 3R4TA 3NX3A 3VOMA 4UHNA 1MLZA 3JWAA 5EUDA 3HLMA 3FZ6A 2BIGA 2HUUA 4WYEA 3USFA 2BHXA 3ISLA 3AOVA 4BA5A 3EI6A 1CQ6A 2BI9A 1TATA 1ORDA 4GE9A 2HUIA 2FNUA 5E3KA 2JJGA 3DZZA 3VP6A 5E5IA 1AY4A 3I5TA 1KL2A 1BW0A 3JU7A 3WKSA 1GC0A 3AENA 3BC8A 1ARHA 1C7GA 2EO5A 4GEBA 1VP4A 2CJHA 1M0NA 1I29A 4OBUA 4WYGA 4KYOA 1AKCA 2VI8A 1AIBA 2E54A 1QJ3A 1ZC9A 4WBTA 5HHYA 1AHYA 3H7FA 4XK1A 1LC5A 3CQ4A 3E2YA 3GZDC 5FT4A 2VGZA 3AENB 1G7XA 3RUYA 3TCMA 4ZM3A 1QZ9A 2ZP7A 3NUIA 4K2BA 3MADA 1AAMA 4JE5A 4OYTA 5F8VA 1OHYA 4AZJA 2Q7WA 2CH1A 3EIBA 2O0RA 4WYAA 2DOUA 3BB8A 1ELQA 1AHEA 1EG5A 2YHKA 1G4XA 1MGVA 2DGKA 3VAXA 2C44A 2AATA 4R5FA 1QISA 3I16A 2CH2A 3RI6A 4BA4A 1ASGA 1ASBA 1OHVA 2VLFA 2XH1A 1N31A 4IXZA 1QITA 3G0TA 4W91A 1MAPA 1S06A 2VGTA 3KGWA 2BIEA 2ZYJA 1W7NA 3K28A 5M4BA 2BWOA 3FFHA 3FCRA 4Q6RA 2W8WA 3HVYA 4XQ2A 4Q31A 2GQNA 4RJ0A 3ZZKA 3GR9A 3LVJA 1RVYA 2WK9A 3FD0A 3AEJA 4A0RA 1AJSA 4GDYA 1E5FA 1AKBA 4N0BA 1AHFA 1ASEA 2ZY5A 1TOKA 2DGMA 5G09A 2JJEA 1O61A 4F5KA 4R5ZA 5LHAA 4EMYA 4ZAHA 1DJEA 1CL2A 1S0AA 3CBFA 4JEZA 3WGBA 2C81A 2V1PA 3A9XA 1G4VA 3P6KA 1AAWA 1GD9A 2HOZA 4WXFA 2BYLA 2HOXA 4JEWA 4RJYA 5G2QA 2OKJA 4XJLA 3KE3A 4WD2A 1WYTA 3AOWA 4JEVA 2AY6A 2AEVA 2EH6A 3EI9A 5JAYA 1BJOA 1WSTA 2FN6A 4A6RA 3IHJA 1TOGA 3B1DA 1FG7A 2VMSA 3B1CA 4TMRA 4OBVA 3TQXA 2JJHA 2DR1A 2TPLA 1V2FA 1C4KA 1O62A 2ZSLA 2AY5A 2RFVA 1RV3A 3DYDA 1C9CA 5J8QA 1I41A 5FT6A 4Y0IA 1WYVB 4P7YA 3QBOA 5IWQA 1ARTA 1DTYA 1JF9A 4GE7A 4K2IA 2X3LA 2R5CA 3OKSA 1KKPA 4E77A 2VMRA 1TOJA 4ATPA 2E7IA 2VMXA 2DKBA 5HXXA 2GMSA 3UWCA 4JF1A 4A6UA 3ZZJA 1LC7A 3PPLA 3CQ5A 3II0A 3Q8NA 1IX8A 2JJFA 4JE5D 4MQRA 1MAQA 1MDXA 4UQVA 2R5CB 3B8XA 3BWNA 1YIZA 4L0OA 5EQCA 1TPLA 2VLHA 3GJUA 4EU1A 3BCAA 1SPAA 4TV7A 1RV4A 2EZ1A 1D7UA 2CANA 4H51A 3MC6C 5D5SA 1AMAA 3L8AA 3N5MA 1CS1A 2AY1A 4M2JA 1SZSA 1ARIA 1CZEA 2AY7A 4R8DA 3LVKA 3DR7A 2CJGA 4RM1A 4F5IA 1QGNA 3AEOA 2C7TA 3E2ZA 3LV2A 3P1TA 7AATA 4HVKA 3M5UA 3GWPA 1TARA 4CXQA 4WP0A 4F5MA 3HQTA 1AY8A 2VI9A 2WK8A 1QJ5A 2ZC0A 1AHXA 1KL1A 3E77A 4F5FA 4CVQA 2ZUKA 4Q76A 3W1HA 3KKIA 5DB5A 1EQBA 3MKJA 4IXSA 1BJNA 3PJ0A 3E2ZB 1SZUA 3ELEA 4WLHA 3AEPA 2QB3A 1IVRA 5AX8A 1AICA 1S07A 1GC4A 4F4EA 1ASMA 4FL0A 1X28A 1YJZA 5G4IA 1ASNA 1BT4A 3N0LA 2BYJA 1SF2A 4XJMA 3GZDA 5C6UA 2VMOA 3AEMC 3TATA 4ISYA 1V72A 1ZODA 5EIGB 3FDDA 4AH3A 4E1OA 2BI3A 4WYFA 4ZM4A 3HDOA 1AIAA 1IAXA 2Z9WA 3WX9A 5EUNA 4ITXA 3DU4A 4CBSA 5HDMA 3T32A 1XI9A 4EFFA 4XEWA 1VJOA 1I48A 2ZY3A 3NUBA 2EGYA 1XEYA 2NMPA 3ELPA 3GETA 3K40A 1T3IA 2VMZA 1UU2A 2PB2A 3FTBA 4PFNA 2FQ6A 2O1BA 2HOYA 3A2BA 3AV7A 3E9KA 4DGTA 2C0RA 2OKKA 4K2MA 4RITA 1U08A 5D95A 4ZDPA 1GC3A 1W3UA 2CSTA 3PDXA 4RIZA 1BJWA 4E3QA 3NU7A 5DJ1A 3NYTA 2O7CA 3FQ7A 3PIUA 2AY4A 4EB5A 8AATA 3ECDA 1M4NA 1GEWA 3VK3A 2PB0A 1D2FA 3HMUA 4MKJA 5G4JA 1N2TA 1GEYA 2YOBA 1BJ4A 1CQ8A 2BIAA 2VGWA 4PIWA 4WYCA 4ADEA 3HT4A 3LWSA 4F5GA 1AX4A 1DGEA 1ARSA 2Z67A 5G0AA 4OT8A 4WXBA 2HP1A 3MBBA 2YCTA 4ZWMA 1AJRA 1H0CA 1E5EA 2HORA 2OGEA 3OP7A 1D7VA 1DFOA 1WYUB 1BQAA 2WKAA 3FVSA 1C0NA 3MAFA 4IY7A 4LNLA 3JZLA 1LK9A 3GZCA 4M2KA 4A6TA
chains in the Genus database with same CATH superfamily
1PMMA 3DR4A 2Z9UA 1CJ0A 1B4XA 2Z20A 1MDZA 2BI1A 2QA3A 4ZSWA 1WYVA 4ADDA 2AY3A 1LKCA 2ZJGA 2W8JA 4CXRA 3JTXA 3PDBB 3L44A 1LW5A 3MAFB 2VYCA 4J5UA 4MY5A 1IUGA 4ADCA 1CL1A 3ACZA 3NRAA 3LVLB 4HF8A 1Z7DA 1GDEA 5BJ4A 2R2NA 1MDOA 3PAAA 4PVFA 1V2DA 4TN4A 2Z9VA 9AATA 4OC9A 3HL2A 1EJIA 1B5PA 2V0YA 2D5YA 2G6WA 3WKRA 4U2HA 3MAUA 2AY2A 3FKDA 2VMVA 1PG8A 4RKCA 3A9ZA 2QBTA 3PD6A 4RKDA 1AMRA 1B8GA 3WCOA 2BKWA 2AY8A 4ZASA 2CB1A 2G7JA 1BS0A 3ZRRA 1IX6A 2OQXA 5EAAA 1UU1A 3WGCA 2F8JA 1OXPA 4Y0HA 1JS6A 2CY8A 4MQQA 2E7JA 2JISA 3BV0A 1H1CA 2CFBA 4WYDA 1KMKA 1TOIA 2X8UA 4U1TA 1PMOA 2YKVA 2GB3A 3COGA 3PD6B 1DGDA 3FRKA 3LY1A 2QB2A 2VGUA 4MKKA 4ATQA 2ORDA 5I92A 1ZOBA 1X0MA 5EFSA 5G2PA 4A00A 3NYUA 2D61A 1ASDA 3QHXA 3RBLA 3FZ7A 4F5JA 3N4RA 5K8BA 2X5FA 1LW4A 2W7DA 1CQ7A 1YOOA 3EI8A 3FQ8A 1ARGA 4LNMA 3MC6A 4AO4A 2HZPA 2DGLA 2OGAA 1SFFA 2HP2A 4MGRA 4MSOA 4W1XA 3AELA 2AEUA 3EUCA 4ITGA 1JG8A 2VMTA 2EZ2A 3RCHA 3ASAA 4MQPA 3NTJA 2VMNA 2W7MA 1M0OA 1X29A 3TFUA 3F0HA 3FVXA 3NNKA 3NU8A 3WZFA 1G7WA 4GRXA 1B9HA 3PGYA 2X5DA 3K7YA 2Z9XA 3F9TA 2CINA 1FG3A 3FQAA 5EIGA 4ZWVA 4RAEA 1YJSA 3RCHB 2ZY2A 1UU0A 1N8PA 2GMUA 2W7GA 2W7FA 2VMUA 3FVUA 4PFFA 2D65A 2VIBA 4WB0B 4M2MA 4B9BA 5LH9A 3RQ1A 1J32A 2W8UA 3H14A 3DRDA 1O4SA 4BMKA 4XJPA 2DKJA 4B98A 1GC2A 1VEFA 1ASAA 4QGRA 2XBNA 1O69A 4ZDOA 5DX5A 4N0WA 2Z61A 3GSBA 4BQ0A 2ZSMA 1ASFA 2HUFA 1FC4A 1YJYA 3AEMA 1J04A 2JG2A 3VK2A 1DJ9A 1W7MA 2GSAA 4GSAA 4ZLVA 2VMQA 2YCPA 3FDBA 4KAMA 4Q75A 1YIYA 3N7NA 2WB6A 1CZCA 1IAYA 1RVUA 1IJIA 1D7RA 5EUEA 2W7JA 3FSLA 4LC3A 4ZDLA 1M7YA 2CJDA 4DBCA 4A0GA 3B1EA 3KGXA 3DODA 3LVMA 4BHDA 5M4DA 4AZKA 4CBRA 2BI5A 4UHMA 1X2AA 4DQ6A 2W7HA 1W23A 4OCAA 3ZRPA 1YNUA 3EZ1A 3G7QA 2FM1A 2W8VA 3PA9A 4OTLA 2FKIA 2VIAA 2JGTA 3ATHA 4P3MA 2VGVA 2AY9A 1Y4IA 2R5EA 1M0QA 3D6KA 4WXGA 3WCNA 1WYUA 1YAAA 3W1IA 3GBXA 4A0FA 1DKAA 2VMPA 3BN1A 2BWPA 2YKYA 1KKJA 2W7EA 1M32A 4F5HA 4EB7A 3F6TA 2D7YA 1M6SA 3CAIA 1AHGA 3RBFA 3ZRQA 3QM2A 2QLRA 1WKGA 4UHOA 4I8AA 2Z1YA 3MEBA 5FT8A 1S08A 1Z3ZA 3EIAA 3HBXA 3PDBA 1AMSA 2E7UA 2BI2A 2D7ZA 3AEJC 3EI7A 4UOYA 3BS8A 1ASLA 2W7LA 4W5KA 5FT5A 5EAVA 3EI5A 3DXWA 4LW4A 4F5LA 4IYOA 5M49A 2FNIA 3B46A 3A8UX 1GBNA 3EZSA 5DJ9A 1IX7A 3DC1A 4IW7A 4WLJA 4XJOA 4NOGA 1BKGA 4XAUA 1C7OA 1KMJA 4GE4A 4O6ZA 2EYQA 2R0TA 4W1WA 2PO3A 3BCXA 1LC8A 5BJ3A 1DJUA 1MLYA 2YKXA 2W7IA 3QN6A 2KFPA 1AJSB 1OHWA 2QMAA 4FFCA 1UKJA 4JEXA 3DXVA 2BWNA 4IYOB 2OATA 3G8MA 3NYSA 4OMAA 3VK4A 5F9SA 1GCKA 3E6GA 1PFFA 2YKUA 1ASCA 1BQDA 3BCBA 2W8TA 2YRRA 2D63A 4A0HA 3TFTA 2W7KA 4IX8A 4J8LA 1OATA 4W1VA 3WLXA 4AOAA 1I43A 3FFRA 3FZ8A 3IF2A 2Z1ZA 1W7LA 3QGUA 5M46A 3AATA 3WY7A 1WYTB 5E4ZA 1C7NA 1B9IA 4JEYA 4Y0DA 4LW2A 1BJOB 4E3RA 4W8IA 3E2FA 1SVVA 3ASBA 1JS3A 3N75A 1KAFA 3QPGA 1AKAA 3JWBA 1ELUA 1IBJA 1ECXA 2YRIA 1AY5A 3JW9A 3QI6A 1TASA 2VMYA 4JF0A 3I4JA 4IXOA 3UAKA 3NDNA 2ZY4A 3W1JA 1V2EA 1P3WA 2D64A 1TOEA 4KXKA 4R2NA 4A72A 2FYFA 2EPJA 4H63Q 3BWOA 1WKHA 2D66A 1B5OA 4ZSYA 3BWNC 2VMWA 3CQ6A 2CTZA 1QIRA 2VGSA 2WK7A 2YCNA 4RLGA 4ADBA 1OXOA 3LG0A 5TF5A 1SZKA 4LNJA 1LS3A 3UE8A 1GEXA 1S09A 1D7SA 3A9YA 4WB0A 1M0PA 4AO9A 1AMQA 3R9AA 3R4TA 3NX3A 3VOMA 4UHNA 1MLZA 3JWAA 5EUDA 3HLMA 3FZ6A 2BIGA 2HUUA 4WYEA 3USFA 2BHXA 3ISLA 3AOVA 4BA5A 3EI6A 1CQ6A 2BI9A 1TATA 1ORDA 4GE9A 2HUIA 2FNUA 5E3KA 2JJGA 3DZZA 3VP6A 5E5IA 1AY4A 3I5TA 1KL2A 1BW0A 3JU7A 3WKSA 1GC0A 3AENA 3BC8A 1ARHA 1C7GA 2EO5A 4GEBA 1VP4A 2CJHA 1M0NA 1I29A 4OBUA 4WYGA 4KYOA 1AKCA 2VI8A 1AIBA 2E54A 1QJ3A 1ZC9A 4WBTA 5HHYA 1AHYA 3H7FA 4XK1A 1LC5A 3CQ4A 3E2YA 3GZDC 5FT4A 2VGZA 3AENB 1G7XA 3RUYA 3TCMA 4ZM3A 1QZ9A 2ZP7A 3NUIA 4K2BA 3MADA 1AAMA 4JE5A 4OYTA 5F8VA 1OHYA 4AZJA 2Q7WA 2CH1A 3EIBA 2O0RA 4WYAA 2DOUA 3BB8A 1ELQA 1AHEA 1EG5A 2YHKA 1G4XA 1MGVA 2DGKA 3VAXA 2C44A 2AATA 4R5FA 1QISA 3I16A 2CH2A 3RI6A 4BA4A 1ASGA 1ASBA 1OHVA 2VLFA 2XH1A 1N31A 4IXZA 1QITA 3G0TA 4W91A 1MAPA 1S06A 2VGTA 3KGWA 2BIEA 2ZYJA 1W7NA 3K28A 5M4BA 2BWOA 3FFHA 3FCRA 4Q6RA 2W8WA 3HVYA 4XQ2A 5KTBA 4Q31A 2GQNA 4RJ0A 3ZZKA 3GR9A 3LVJA 1RVYA 2WK9A 3FD0A 3AEJA 4A0RA 1AJSA 4GDYA 1E5FA 1AKBA 4N0BA 1AHFA 1ASEA 2ZY5A 1TOKA 2DGMA 5G09A 2JJEA 1O61A 4F5KA 4R5ZA 5LHAA 4EMYA 4ZAHA 3N4SA 1DJEA 1CL2A 1S0AA 3CBFA 4JEZA 3WGBA 2C81A 2V1PA 3A9XA 1G4VA 3P6KA 1AAWA 1GD9A 2HOZA 4WXFA 2BYLA 2HOXA 4JEWA 4RJYA 5G2QA 2OKJA 4XJLA 3KE3A 4WD2A 1WYTA 3AOWA 4JEVA 2AY6A 2AEVA 2EH6A 3EI9A 5JAYA 1BJOA 1WSTA 2FN6A 4A6RA 3IHJA 1TOGA 3B1DA 1FG7A 2VMSA 3B1CA 4TMRA 4OBVA 3TQXA 2QSRA 2JJHA 2DR1A 2TPLA 1V2FA 1C4KA 1O62A 2ZSLA 2AY5A 2RFVA 1RV3A 3DYDA 1C9CA 5J8QA 1I41A 5FT6A 4Y0IA 1WYVB 4P7YA 3QBOA 5IWQA 1ARTA 1DTYA 1JF9A 4GE7A 4K2IA 2X3LA 2R5CA 3OKSA 1KKPA 4E77A 2VMRA 1TOJA 4ATPA 2E7IA 2VMXA 2DKBA 5HXXA 2GMSA 3UWCA 4JF1A 4A6UA 3ZZJA 1LC7A 3PPLA 3CQ5A 3II0A 3Q8NA 1IX8A 2JJFA 4JE5D 4MQRA 1MAQA 1MDXA 4UQVA 2R5CB 3B8XA 3BWNA 1YIZA 4L0OA 5EQCA 1TPLA 2VLHA 3N4XA 3GJUA 4EU1A 3BCAA 1SPAA 4TV7A 1RV4A 2EZ1A 1D7UA 2CANA 4H51A 3MC6C 5D5SA 1AMAA 3L8AA 3N5MA 1CS1A 2AY1A 4M2JA 1SZSA 1ARIA 1CZEA 2AY7A 4R8DA 3LVKA 3DR7A 2CJGA 4RM1A 4F5IA 1QGNA 3AEOA 2C7TA 3E2ZA 3LV2A 3P1TA 7AATA 4HVKA 3M5UA 3GWPA 1TARA 4CXQA 4WP0A 4F5MA 3HQTA 1AY8A 2VI9A 2WK8A 1QJ5A 2ZC0A 1AHXA 1KL1A 3E77A 4F5FA 4CVQA 2ZUKA 4Q76A 3W1HA 4K05A 3KKIA 5DB5A 1EQBA 3MKJA 4IXSA 1BJNA 3PJ0A 3E2ZB 1SZUA 3ELEA 4WLHA 3AEPA 2QB3A 1IVRA 5AX8A 1AICA 1S07A 1GC4A 4F4EA 1ASMA 4FL0A 1X28A 1YJZA 5G4IA 1ASNA 1BT4A 3N0LA 2BYJA 1SF2A 4XJMA 3GZDA 3H9XA 5C6UA 2VMOA 3AEMC 3TATA 4ISYA 1V72A 1ZODA 5EIGB 3FDDA 4AH3A 4E1OA 2BI3A 4WYFA 4ZM4A 3HDOA 1AIAA 1IAXA 2Z9WA 3WX9A 5EUNA 4ITXA 3DU4A 4CBSA 5HDMA 3T32A 1XI9A 4EFFA 4XEWA 1VJOA 1I48A 2ZY3A 3NUBA 2EGYA 1XEYA 2NMPA 3ELPA 3GETA 3K40A 1T3IA 2VMZA 1UU2A 2PB2A 3FTBA 4PFNA 2FQ6A 2O1BA 2HOYA 3A2BA 3AV7A 3E9KA 4DGTA 2C0RA 2OKKA 4K2MA 4RITA 1U08A 5D95A 4ZDPA 2A1VA 1GC3A 1W3UA 2CSTA 3PDXA 4RIZA 1BJWA 4E3QA 3NU7A 5DJ1A 3NYTA 2O7CA 3FQ7A 3PIUA 2AY4A 4EB5A 8AATA 3ECDA 1M4NA 1GEWA 3VK3A 2PB0A 1D2FA 3HMUA 4MKJA 5G4JA 1N2TA 1GEYA 2YOBA 1BJ4A 1CQ8A 2BIAA 2VGWA 4PIWA 4WYCA 4ADEA 3HT4A 3LWSA 4F5GA 1AX4A 1DGEA 1ARSA 2Z67A 5G0AA 4OT8A 4WXBA 2HP1A 3MBBA 2YCTA 4ZWMA 1AJRA 1H0CA 1E5EA 2HORA 2OGEA 3OP7A 1D7VA 1DFOA 1WYUB 1BQAA 2WKAA 3FVSA 1C0NA 3MAFA 4IY7A 4LNLA 3JZLA 1LK9A 3GZCA 4M2KA 4A6TA
chains in the Genus database with same CATH topology
1PMMA 3DR4A 2Z9UA 1CJ0A 1B4XA 2Z20A 1MDZA 2BI1A 2QA3A 4ZSWA 1WYVA 4ADDA 2AY3A 1LKCA 2ZJGA 2W8JA 4CXRA 3JTXA 3PDBB 3L44A 1LW5A 3MAFB 2VYCA 4J5UA 4MY5A 1IUGA 4ADCA 1CL1A 3ACZA 3NRAA 3LVLB 4HF8A 1Z7DA 1GDEA 5BJ4A 2R2NA 1MDOA 3PAAA 4PVFA 1V2DA 4TN4A 2Z9VA 9AATA 4OC9A 3HL2A 1EJIA 1B5PA 2V0YA 2D5YA 2G6WA 3WKRA 4U2HA 3MAUA 2AY2A 3FKDA 2VMVA 1PG8A 4RKCA 3A9ZA 2QBTA 3PD6A 4RKDA 1AMRA 1B8GA 3WCOA 2BKWA 2AY8A 4ZASA 2CB1A 2G7JA 1BS0A 3ZRRA 1IX6A 2OQXA 5EAAA 1UU1A 3WGCA 2F8JA 1OXPA 4Y0HA 1JS6A 2CY8A 4MQQA 2E7JA 2JISA 3BV0A 1H1CA 2CFBA 4WYDA 1KMKA 1TOIA 2X8UA 4U1TA 1PMOA 2YKVA 2GB3A 3COGA 3PD6B 1DGDA 3FRKA 3LY1A 2QB2A 2VGUA 4MKKA 4ATQA 2ORDA 5I92A 1ZOBA 1X0MA 5EFSA 5G2PA 4A00A 3NYUA 2D61A 1ASDA 3QHXA 3RBLA 3FZ7A 4F5JA 3N4RA 5K8BA 2X5FA 1LW4A 2W7DA 1CQ7A 1YOOA 3EI8A 3FQ8A 1ARGA 4LNMA 3MC6A 4AO4A 2HZPA 2DGLA 2OGAA 1SFFA 2HP2A 4MGRA 4MSOA 4W1XA 3AELA 2AEUA 3EUCA 4ITGA 1JG8A 2VMTA 2EZ2A 3RCHA 3ASAA 4MQPA 3NTJA 2VMNA 2W7MA 1M0OA 1X29A 3TFUA 3F0HA 3FVXA 3NNKA 3NU8A 3WZFA 1G7WA 4GRXA 1B9HA 3PGYA 2X5DA 3K7YA 2Z9XA 3F9TA 2CINA 1FG3A 3FQAA 5EIGA 4ZWVA 4RAEA 1YJSA 3RCHB 2ZY2A 1UU0A 1N8PA 2GMUA 2W7GA 2W7FA 2VMUA 3FVUA 4PFFA 2D65A 2VIBA 4WB0B 4M2MA 4B9BA 5LH9A 3RQ1A 1J32A 2W8UA 3H14A 3DRDA 1O4SA 4BMKA 4XJPA 2DKJA 4B98A 1GC2A 1VEFA 1ASAA 4QGRA 2XBNA 1O69A 4ZDOA 5DX5A 4N0WA 2Z61A 3GSBA 4BQ0A 2ZSMA 1ASFA 2HUFA 1FC4A 1YJYA 3AEMA 1J04A 2JG2A 3VK2A 1DJ9A 1W7MA 2GSAA 4GSAA 4ZLVA 2VMQA 2YCPA 3FDBA 4KAMA 4Q75A 1YIYA 3N7NA 2WB6A 1CZCA 1IAYA 1RVUA 1IJIA 1D7RA 5EUEA 2W7JA 3FSLA 4LC3A 4ZDLA 1M7YA 2CJDA 4DBCA 4A0GA 3B1EA 3KGXA 3DODA 3LVMA 4BHDA 5M4DA 4AZKA 4CBRA 2BI5A 4UHMA 1X2AA 4DQ6A 2W7HA 1W23A 4OCAA 3ZRPA 1YNUA 3EZ1A 3G7QA 2FM1A 2W8VA 3PA9A 4OTLA 2FKIA 2VIAA 2JGTA 3ATHA 4P3MA 2VGVA 2AY9A 1Y4IA 2R5EA 1M0QA 3D6KA 4WXGA 3WCNA 1WYUA 1YAAA 3W1IA 3GBXA 4A0FA 1DKAA 2VMPA 3BN1A 2BWPA 2YKYA 1KKJA 2W7EA 1M32A 4F5HA 4EB7A 3F6TA 2D7YA 1M6SA 3CAIA 1AHGA 3RBFA 3ZRQA 3QM2A 2QLRA 1WKGA 4UHOA 4I8AA 2Z1YA 3MEBA 5FT8A 1S08A 1Z3ZA 3EIAA 3HBXA 3PDBA 1AMSA 2E7UA 2BI2A 2D7ZA 3AEJC 3EI7A 4UOYA 3BS8A 1ASLA 2W7LA 4W5KA 5FT5A 5EAVA 3EI5A 3DXWA 4LW4A 4F5LA 4IYOA 5M49A 2FNIA 3B46A 3A8UX 1GBNA 3EZSA 5DJ9A 1IX7A 3DC1A 4IW7A 4WLJA 4XJOA 4NOGA 1BKGA 4XAUA 1C7OA 1KMJA 4GE4A 4O6ZA 2EYQA 2R0TA 4W1WA 2PO3A 3BCXA 1LC8A 5BJ3A 1DJUA 1MLYA 2YKXA 2W7IA 3QN6A 2KFPA 1AJSB 1OHWA 2QMAA 4FFCA 1UKJA 4JEXA 3DXVA 2BWNA 4IYOB 2OATA 3G8MA 3NYSA 4OMAA 3VK4A 5F9SA 1GCKA 3E6GA 1PFFA 2YKUA 1ASCA 1BQDA 3BCBA 2W8TA 2YRRA 2D63A 4A0HA 3TFTA 2W7KA 4IX8A 4J8LA 1OATA 4W1VA 3WLXA 4AOAA 1I43A 3FFRA 3FZ8A 3IF2A 2Z1ZA 1W7LA 3QGUA 5M46A 3AATA 3WY7A 1WYTB 5E4ZA 1C7NA 1B9IA 4JEYA 4Y0DA 4LW2A 1BJOB 4E3RA 4W8IA 3E2FA 1SVVA 3ASBA 1JS3A 3N75A 3QPGA 1AKAA 3JWBA 1ELUA 1IBJA 1ECXA 2YRIA 1AY5A 3JW9A 3QI6A 1TASA 2VMYA 4JF0A 3I4JA 4IXOA 3UAKA 3NDNA 2ZY4A 3W1JA 1V2EA 1P3WA 2D64A 1TOEA 4KXKA 4R2NA 4A72A 2FYFA 2EPJA 4H63Q 3BWOA 1WKHA 2D66A 1B5OA 4ZSYA 3BWNC 2VMWA 3CQ6A 2CTZA 1QIRA 2VGSA 2WK7A 2YCNA 4RLGA 4ADBA 1OXOA 3LG0A 5TF5A 1SZKA 4LNJA 1LS3A 3UE8A 1GEXA 1S09A 1D7SA 3A9YA 4WB0A 1M0PA 4AO9A 1AMQA 3R9AA 3R4TA 3NX3A 3VOMA 4UHNA 1MLZA 3JWAA 5EUDA 3HLMA 3FZ6A 2BIGA 2HUUA 4WYEA 3USFA 2BHXA 3ISLA 3AOVA 4BA5A 3EI6A 1CQ6A 2BI9A 1TATA 1ORDA 4GE9A 2HUIA 2FNUA 5E3KA 2JJGA 3DZZA 3VP6A 5E5IA 1AY4A 3I5TA 1KL2A 1BW0A 3JU7A 3WKSA 1GC0A 3AENA 3BC8A 1ARHA 1C7GA 2EO5A 4GEBA 1VP4A 2CJHA 1M0NA 1I29A 4OBUA 4WYGA 4KYOA 1AKCA 2VI8A 1AIBA 2E54A 1QJ3A 1ZC9A 4WBTA 5HHYA 1AHYA 3H7FA 4XK1A 1LC5A 3CQ4A 3E2YA 3GZDC 5FT4A 2VGZA 3AENB 1G7XA 3RUYA 3TCMA 4ZM3A 1QZ9A 2ZP7A 3NUIA 4K2BA 3MADA 1AAMA 4JE5A 4OYTA 5F8VA 1OHYA 4AZJA 2Q7WA 2CH1A 3EIBA 2O0RA 4WYAA 2DOUA 3BB8A 1ELQA 1AHEA 1EG5A 2YHKA 1G4XA 1MGVA 2DGKA 3VAXA 2C44A 2AATA 4R5FA 1QISA 3I16A 2CH2A 3RI6A 4BA4A 1ASGA 1ASBA 1OHVA 2VLFA 2XH1A 1N31A 4IXZA 1QITA 3G0TA 4W91A 1MAPA 1S06A 2VGTA 3KGWA 2BIEA 2ZYJA 1W7NA 3K28A 5M4BA 2BWOA 3FFHA 3FCRA 4Q6RA 2W8WA 3HVYA 4XQ2A 5KTBA 4Q31A 2GQNA 4RJ0A 3ZZKA 3GR9A 3LVJA 1RVYA 2WK9A 3FD0A 3AEJA 4A0RA 1AJSA 4GDYA 1E5FA 1AKBA 4N0BA 1AHFA 1ASEA 2ZY5A 1TOKA 2DGMA 5G09A 2JJEA 1O61A 4F5KA 4R5ZA 5LHAA 4EMYA 4ZAHA 3N4SA 1DJEA 1CL2A 1S0AA 3CBFA 4JEZA 3WGBA 2C81A 2V1PA 3A9XA 1G4VA 3P6KA 1AAWA 1GD9A 2HOZA 4WXFA 2BYLA 2HOXA 4JEWA 4RJYA 5G2QA 2OKJA 4XJLA 3KE3A 4WD2A 1WYTA 3AOWA 4JEVA 2AY6A 2AEVA 2EH6A 3EI9A 5JAYA 1BJOA 1WSTA 2FN6A 4A6RA 3IHJA 1TOGA 3B1DA 1FG7A 2VMSA 3B1CA 4TMRA 4OBVA 3TQXA 2QSRA 2JJHA 2DR1A 2TPLA 1V2FA 1C4KA 1O62A 2ZSLA 2AY5A 2RFVA 1RV3A 3DYDA 1C9CA 5J8QA 1I41A 5FT6A 4Y0IA 1WYVB 4P7YA 3QBOA 5IWQA 1ARTA 1DTYA 1JF9A 4GE7A 4K2IA 2X3LA 2R5CA 3OKSA 1KKPA 4E77A 2VMRA 1TOJA 4ATPA 2E7IA 2VMXA 2DKBA 5HXXA 2GMSA 3UWCA 4JF1A 4A6UA 3ZZJA 1LC7A 3PPLA 3CQ5A 3II0A 3Q8NA 1IX8A 2JJFA 4JE5D 4MQRA 1MAQA 1MDXA 4UQVA 2R5CB 3B8XA 3BWNA 1YIZA 4L0OA 5EQCA 1TPLA 2VLHA 3N4XA 3GJUA 4EU1A 3BCAA 1SPAA 4TV7A 1RV4A 2EZ1A 1D7UA 2CANA 4H51A 3MC6C 5D5SA 1AMAA 3L8AA 3N5MA 1CS1A 2AY1A 4M2JA 1SZSA 1ARIA 1CZEA 2AY7A 4R8DA 3LVKA 3DR7A 2CJGA 4RM1A 4F5IA 1QGNA 3AEOA 2C7TA 3E2ZA 3LV2A 3P1TA 7AATA 4HVKA 3M5UA 3GWPA 1TARA 4CXQA 4WP0A 4F5MA 3HQTA 1AY8A 2VI9A 2WK8A 1QJ5A 2ZC0A 1AHXA 1KL1A 3E77A 4F5FA 4CVQA 2ZUKA 4Q76A 3W1HA 4K05A 3KKIA 5DB5A 1EQBA 3MKJA 4IXSA 1BJNA 3PJ0A 3E2ZB 1SZUA 3ELEA 4WLHA 3AEPA 2QB3A 1IVRA 5AX8A 1AICA 1S07A 1GC4A 4F4EA 1ASMA 4FL0A 1X28A 1YJZA 5G4IA 1ASNA 1BT4A 3N0LA 2BYJA 1SF2A 4XJMA 3GZDA 3H9XA 5C6UA 2VMOA 3AEMC 3TATA 4ISYA 1V72A 1ZODA 5EIGB 3FDDA 4AH3A 4E1OA 2BI3A 4WYFA 4ZM4A 3HDOA 1AIAA 1IAXA 2Z9WA 3WX9A 5EUNA 4ITXA 3DU4A 4CBSA 5HDMA 3T32A 1XI9A 4EFFA 4XEWA 1VJOA 1I48A 2ZY3A 3NUBA 2EGYA 1XEYA 2NMPA 3ELPA 3GETA 3K40A 1T3IA 2VMZA 1UU2A 2PB2A 3FTBA 4PFNA 2FQ6A 2O1BA 2HOYA 3A2BA 3AV7A 3E9KA 4DGTA 2C0RA 2OKKA 4K2MA 4RITA 1U08A 5D95A 4ZDPA 2A1VA 1GC3A 1W3UA 2CSTA 3PDXA 4RIZA 1BJWA 4E3QA 3NU7A 5DJ1A 3NYTA 2O7CA 3FQ7A 3PIUA 2AY4A 4EB5A 8AATA 3ECDA 1M4NA 1GEWA 3VK3A 2PB0A 1D2FA 3HMUA 4MKJA 5G4JA 1N2TA 1GEYA 2YOBA 1BJ4A 1CQ8A 2BIAA 2VGWA 4PIWA 4WYCA 4ADEA 3HT4A 3LWSA 4F5GA 1AX4A 1DGEA 1ARSA 2Z67A 5G0AA 4OT8A 4WXBA 2HP1A 3MBBA 2YCTA 4ZWMA 1AJRA 1H0CA 1E5EA 2HORA 2OGEA 3OP7A 1D7VA 1DFOA 1WYUB 1BQAA 2WKAA 3FVSA 1C0NA 3MAFA 4IY7A 4LNLA 3JZLA 1LK9A 3GZCA 4M2KA 4A6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PMM A;  3DR4 A;  2Z9U A;  1CJ0 A;  1B4X A;  2Z20 A;  1MDZ A;  2BI1 A;  2QA3 A;  4ZSW A;  1WYV A;  4ADD A;  2AY3 A;  1LKC A;  2ZJG A;  2W8J A;  4CXR A;  3JTX A;  3PDB B;  3L44 A;  1LW5 A;  3MAF B;  2VYC A;  4J5U A;  4MY5 A;  1IUG A;  4ADC A;  1CL1 A;  3ACZ A;  3NRA A;  3LVL B;  4HF8 A;  1Z7D A;  1GDE A;  5BJ4 A;  2R2N A;  1MDO A;  3PAA A;  4PVF A;  1V2D A;  4TN4 A;  2Z9V A;  9AAT A;  4OC9 A;  3HL2 A;  1EJI A;  1B5P A;  2V0Y A;  2D5Y A;  2G6W A;  3WKR A;  4U2H A;  3MAU A;  2AY2 A;  3FKD A;  2VMV A;  1PG8 A;  4RKC A;  3A9Z A;  2QBT A;  3PD6 A;  4RKD A;  1AMR A;  1B8G A;  3WCO A;  2BKW A;  2AY8 A;  4ZAS A;  2CB1 A;  1BS0 A;  3ZRR A;  1IX6 A;  2OQX A;  5EAA A;  1UU1 A;  3WGC A;  2F8J A;  1OXP A;  4Y0H A;  1JS6 A;  2CY8 A;  4MQQ A;  2E7J A;  2JIS A;  3BV0 A;  1H1C A;  2CFB A;  4WYD A;  1KMK A;  1TOI A;  2X8U A;  4U1T A;  1PMO A;  2YKV A;  2GB3 A;  3COG A;  3PD6 B;  1DGD A;  3FRK A;  3LY1 A;  2QB2 A;  2VGU A;  4MKK A;  4ATQ A;  2ORD A;  5I92 A;  1ZOB A;  1X0M A;  5EFS A;  5G2P A;  4A00 A;  3NYU A;  2D61 A;  1ASD A;  3QHX A;  3RBL A;  3FZ7 A;  4F5J A;  5K8B A;  2X5F A;  1LW4 A;  2W7D A;  1CQ7 A;  1YOO A;  3EI8 A;  3FQ8 A;  1ARG A;  4LNM A;  3MC6 A;  4AO4 A;  2HZP A;  2DGL A;  2OGA A;  1SFF A;  2HP2 A;  4MGR A;  4MSO A;  4W1X A;  3AEL A;  2AEU A;  3EUC A;  4ITG A;  1JG8 A;  2VMT A;  2EZ2 A;  3RCH A;  3ASA A;  4MQP A;  3NTJ A;  2VMN A;  2W7M A;  1M0O A;  1X29 A;  3TFU A;  3F0H A;  3FVX A;  3NNK A;  3NU8 A;  3WZF A;  1G7W A;  4GRX A;  1B9H A;  3PGY A;  2X5D A;  3K7Y A;  2Z9X A;  3F9T A;  2CIN A;  1FG3 A;  3FQA A;  5EIG A;  4ZWV A;  4RAE A;  1YJS A;  3RCH B;  2ZY2 A;  1UU0 A;  1N8P A;  2GMU A;  2W7G A;  2W7F A;  2VMU A;  3FVU A;  4PFF A;  2D65 A;  2VIB A;  4WB0 B;  4M2M A;  4B9B A;  5LH9 A;  3RQ1 A;  1J32 A;  2W8U A;  3H14 A;  3DRD A;  1O4S A;  4BMK A;  4XJP A;  2DKJ A;  4B98 A;  1GC2 A;  1VEF A;  1ASA A;  4QGR A;  2XBN A;  1O69 A;  4ZDO A;  5DX5 A;  4N0W A;  2Z61 A;  3GSB A;  4BQ0 A;  2ZSM A;  1ASF A;  2HUF A;  1FC4 A;  1YJY A;  3AEM A;  1J04 A;  2JG2 A;  3VK2 A;  1DJ9 A;  1W7M A;  2GSA A;  4GSA A;  4ZLV A;  2VMQ A;  2YCP A;  3FDB A;  4KAM A;  4Q75 A;  1YIY A;  1CZC A;  1IAY A;  1RVU A;  1IJI A;  1D7R A;  5EUE A;  2W7J A;  3FSL A;  4LC3 A;  4ZDL A;  1M7Y A;  2CJD A;  4DBC A;  4A0G A;  3B1E A;  3KGX A;  3DOD A;  3LVM A;  4BHD A;  5M4D A;  4AZK A;  4CBR A;  2BI5 A;  4UHM A;  1X2A A;  4DQ6 A;  2W7H A;  1W23 A;  4OCA A;  3ZRP A;  1YNU A;  3EZ1 A;  3G7Q A;  2FM1 A;  2W8V A;  3PA9 A;  4OTL A;  2VIA A;  2JGT A;  3ATH A;  4P3M A;  2VGV A;  2AY9 A;  1Y4I A;  2R5E A;  1M0Q A;  3D6K A;  4WXG A;  3WCN A;  1WYU A;  1YAA A;  3W1I A;  3GBX A;  4A0F A;  1DKA A;  2VMP A;  3BN1 A;  2BWP A;  2YKY A;  1KKJ A;  2W7E A;  1M32 A;  4F5H A;  4EB7 A;  3F6T A;  2D7Y A;  1M6S A;  3CAI A;  1AHG A;  3RBF A;  3ZRQ A;  3QM2 A;  2QLR A;  1WKG A;  4UHO A;  4I8A A;  2Z1Y A;  3MEB A;  5FT8 A;  1S08 A;  1Z3Z A;  3EIA A;  3HBX A;  3PDB A;  1AMS A;  2E7U A;  2BI2 A;  2D7Z A;  3AEJ C;  3EI7 A;  4UOY A;  3BS8 A;  1ASL A;  2W7L A;  4W5K A;  5FT5 A;  5EAV A;  3EI5 A;  3DXW A;  4LW4 A;  4F5L A;  4IYO A;  5M49 A;  2FNI A;  3B46 A;  3A8U X;  1GBN A;  3EZS A;  5DJ9 A;  1IX7 A;  3DC1 A;  4IW7 A;  4WLJ A;  4XJO A;  4NOG A;  1BKG A;  4XAU A;  1C7O A;  1KMJ A;  4GE4 A;  4O6Z A;  2R0T A;  4W1W A;  2PO3 A;  3BCX A;  1LC8 A;  5BJ3 A;  1DJU A;  1MLY A;  2YKX A;  2W7I A;  3QN6 A;  1AJS B;  1OHW A;  2QMA A;  4FFC A;  1UKJ A;  4JEX A;  3DXV A;  2BWN A;  4IYO B;  2OAT A;  3G8M A;  3NYS A;  4OMA A;  3VK4 A;  5F9S A;  1GCK A;  3E6G A;  1PFF A;  2YKU A;  1ASC A;  1BQD A;  3BCB A;  2W8T A;  2YRR A;  2D63 A;  4A0H A;  3TFT A;  2W7K A;  4IX8 A;  4J8L A;  1OAT A;  4W1V A;  3WLX A;  4AOA A;  1I43 A;  3FFR A;  3FZ8 A;  3IF2 A;  2Z1Z A;  1W7L A;  3QGU A;  5M46 A;  3AAT A;  3WY7 A;  1WYT B;  5E4Z A;  1C7N A;  1B9I A;  4JEY A;  4Y0D A;  4LW2 A;  1BJO B;  4E3R A;  4W8I A;  3E2F A;  1SVV A;  3ASB A;  1JS3 A;  3N75 A;  3QPG A;  1AKA A;  3JWB A;  1ELU A;  1IBJ A;  1ECX A;  2YRI A;  1AY5 A;  3JW9 A;  3QI6 A;  1TAS A;  2VMY A;  4JF0 A;  3I4J A;  4IXO A;  3UAK A;  3NDN A;  2ZY4 A;  3W1J A;  1V2E A;  1P3W A;  2D64 A;  1TOE A;  4KXK A;  4R2N A;  4A72 A;  2FYF A;  2EPJ A;  3BWO A;  1WKH A;  2D66 A;  1B5O A;  4ZSY A;  3BWN C;  2VMW A;  3CQ6 A;  2CTZ A;  1QIR A;  2VGS A;  2WK7 A;  2YCN A;  4RLG A;  4ADB A;  1OXO A;  3LG0 A;  5TF5 A;  1SZK A;  4LNJ A;  1LS3 A;  3UE8 A;  1GEX A;  1S09 A;  1D7S A;  3A9Y A;  4WB0 A;  1M0P A;  4AO9 A;  1AMQ A;  3R9A A;  3R4T A;  3NX3 A;  3VOM A;  4UHN A;  1MLZ A;  3JWA A;  5EUD A;  3HLM A;  3FZ6 A;  2BIG A;  2HUU A;  4WYE A;  3USF A;  2BHX A;  3ISL A;  3AOV A;  4BA5 A;  3EI6 A;  1CQ6 A;  2BI9 A;  1TAT A;  1ORD A;  4GE9 A;  2HUI A;  2FNU A;  5E3K A;  2JJG A;  3DZZ A;  3VP6 A;  5E5I A;  1AY4 A;  3I5T A;  1KL2 A;  1BW0 A;  3JU7 A;  3WKS A;  1GC0 A;  3AEN A;  3BC8 A;  1ARH A;  1C7G A;  2EO5 A;  4GEB A;  1VP4 A;  2CJH A;  1M0N A;  1I29 A;  4OBU A;  4WYG A;  4KYO A;  1AKC A;  2VI8 A;  1AIB A;  2E54 A;  1QJ3 A;  1ZC9 A;  4WBT A;  5HHY A;  1AHY A;  3H7F A;  4XK1 A;  1LC5 A;  3CQ4 A;  3E2Y A;  3GZD C;  5FT4 A;  2VGZ A;  3AEN B;  1G7X A;  3RUY A;  3TCM A;  4ZM3 A;  1QZ9 A;  2ZP7 A;  3NUI A;  4K2B A;  3MAD A;  1AAM A;  4JE5 A;  4OYT A;  5F8V A;  1OHY A;  4AZJ A;  2Q7W A;  2CH1 A;  3EIB A;  2O0R A;  4WYA A;  2DOU A;  3BB8 A;  1ELQ A;  1AHE A;  1EG5 A;  2YHK A;  1G4X A;  1MGV A;  2DGK A;  3VAX A;  2C44 A;  2AAT A;  4R5F A;  1QIS A;  3I16 A;  2CH2 A;  3RI6 A;  4BA4 A;  1ASG A;  1ASB A;  1OHV A;  2VLF A;  2XH1 A;  1N31 A;  4IXZ A;  1QIT A;  3G0T A;  4W91 A;  1MAP A;  1S06 A;  2VGT A;  3KGW A;  2BIE A;  2ZYJ A;  1W7N A;  3K28 A;  5M4B A;  2BWO A;  3FFH A;  3FCR A;  4Q6R A;  2W8W A;  3HVY A;  4XQ2 A;  4Q31 A;  2GQN A;  4RJ0 A;  3ZZK A;  3GR9 A;  3LVJ A;  1RVY A;  2WK9 A;  3FD0 A;  3AEJ A;  4A0R A;  1AJS A;  4GDY A;  1E5F A;  1AKB A;  4N0B A;  1AHF A;  1ASE A;  2ZY5 A;  1TOK A;  2DGM A;  5G09 A;  2JJE A;  1O61 A;  4F5K A;  4R5Z A;  5LHA A;  4EMY A;  4ZAH A;  1DJE A;  1CL2 A;  1S0A A;  3CBF A;  4JEZ A;  3WGB A;  2C81 A;  2V1P A;  3A9X A;  1G4V A;  3P6K A;  1AAW A;  1GD9 A;  2HOZ A;  4WXF A;  2BYL A;  2HOX A;  4JEW A;  4RJY A;  5G2Q A;  2OKJ A;  4XJL A;  3KE3 A;  4WD2 A;  1WYT A;  3AOW A;  4JEV A;  2AY6 A;  2AEV A;  2EH6 A;  3EI9 A;  5JAY A;  1BJO A;  1WST A;  2FN6 A;  4A6R A;  3IHJ A;  1TOG A;  3B1D A;  1FG7 A;  2VMS A;  3B1C A;  4TMR A;  4OBV A;  3TQX A;  2JJH A;  2DR1 A;  2TPL A;  1V2F A;  1C4K A;  1O62 A;  2ZSL A;  2AY5 A;  2RFV A;  1RV3 A;  3DYD A;  1C9C A;  5J8Q A;  1I41 A;  5FT6 A;  4Y0I A;  1WYV B;  4P7Y A;  3QBO A;  5IWQ A;  1ART A;  1DTY A;  1JF9 A;  4GE7 A;  4K2I A;  2X3L A;  2R5C A;  3OKS A;  1KKP A;  4E77 A;  2VMR A;  1TOJ A;  4ATP A;  2E7I A;  2VMX A;  2DKB A;  5HXX A;  2GMS A;  3UWC A;  4JF1 A;  4A6U A;  3ZZJ A;  1LC7 A;  3PPL A;  3CQ5 A;  3II0 A;  3Q8N A;  1IX8 A;  2JJF A;  4JE5 D;  4MQR A;  1MAQ A;  1MDX A;  4UQV A;  2R5C B;  3B8X A;  3BWN A;  1YIZ A;  4L0O A;  5EQC A;  1TPL A;  2VLH A;  3GJU A;  4EU1 A;  3BCA A;  1SPA A;  4TV7 A;  1RV4 A;  2EZ1 A;  1D7U A;  2CAN A;  4H51 A;  3MC6 C;  5D5S A;  1AMA A;  3L8A A;  3N5M A;  1CS1 A;  2AY1 A;  4M2J A;  1SZS A;  1ARI A;  1CZE A;  2AY7 A;  4R8D A;  3LVK A;  3DR7 A;  2CJG A;  4RM1 A;  4F5I A;  1QGN A;  3AEO A;  2C7T A;  3E2Z A;  3LV2 A;  3P1T A;  7AAT A;  4HVK A;  3M5U A;  3GWP A;  1TAR A;  4CXQ A;  4WP0 A;  4F5M A;  3HQT A;  1AY8 A;  2VI9 A;  2WK8 A;  1QJ5 A;  2ZC0 A;  1AHX A;  1KL1 A;  3E77 A;  4F5F A;  4CVQ A;  2ZUK A;  4Q76 A;  3W1H A;  3KKI A;  5DB5 A;  1EQB A;  3MKJ A;  4IXS A;  1BJN A;  3PJ0 A;  3E2Z B;  1SZU A;  3ELE A;  4WLH A;  3AEP A;  2QB3 A;  1IVR A;  5AX8 A;  1AIC A;  1S07 A;  1GC4 A;  4F4E A;  1ASM A;  4FL0 A;  1X28 A;  1YJZ A;  5G4I A;  1ASN A;  1BT4 A;  3N0L A;  2BYJ A;  1SF2 A;  4XJM A;  3GZD A;  5C6U A;  2VMO A;  3AEM C;  3TAT A;  4ISY A;  1V72 A;  1ZOD A;  5EIG B;  3FDD A;  4AH3 A;  4E1O A;  2BI3 A;  4WYF A;  4ZM4 A;  3HDO A;  1AIA A;  1IAX A;  2Z9W A;  3WX9 A;  5EUN A;  4ITX A;  3DU4 A;  4CBS A;  5HDM A;  3T32 A;  1XI9 A;  4EFF A;  4XEW A;  1VJO A;  1I48 A;  2ZY3 A;  3NUB A;  2EGY A;  1XEY A;  2NMP A;  3ELP A;  3GET A;  3K40 A;  1T3I A;  2VMZ A;  1UU2 A;  2PB2 A;  3FTB A;  4PFN A;  2FQ6 A;  2O1B A;  2HOY A;  3A2B A;  3AV7 A;  3E9K A;  4DGT A;  2C0R A;  2OKK A;  4K2M A;  4RIT A;  1U08 A;  5D95 A;  4ZDP A;  1GC3 A;  1W3U A;  2CST A;  3PDX A;  4RIZ A;  1BJW A;  4E3Q A;  3NU7 A;  5DJ1 A;  3NYT A;  2O7C A;  3FQ7 A;  3PIU A;  2AY4 A;  4EB5 A;  8AAT A;  3ECD A;  1M4N A;  1GEW A;  3VK3 A;  2PB0 A;  1D2F A;  3HMU A;  4MKJ A;  5G4J A;  1N2T A;  1GEY A;  2YOB A;  1BJ4 A;  1CQ8 A;  2BIA A;  2VGW A;  4PIW A;  4WYC A;  4ADE A;  3HT4 A;  3LWS A;  4F5G A;  1AX4 A;  1DGE A;  1ARS A;  2Z67 A;  5G0A A;  4OT8 A;  4WXB A;  2HP1 A;  3MBB A;  2YCT A;  4ZWM A;  1AJR A;  1H0C A;  1E5E A;  2HOR A;  2OGE A;  3OP7 A;  1D7V A;  1DFO A;  1WYU B;  1BQA A;  2WKA A;  3FVS A;  1C0N A;  3MAF A;  4IY7 A;  4LNL A;  3JZL A;  1LK9 A;  3GZC A;  4M2K A;  4A6T A; 
#chains in the Genus database with same CATH topology
 1PMM A;  3DR4 A;  2Z9U A;  1CJ0 A;  1B4X A;  2Z20 A;  1MDZ A;  2BI1 A;  2QA3 A;  4ZSW A;  1WYV A;  4ADD A;  2AY3 A;  1LKC A;  2ZJG A;  2W8J A;  4CXR A;  3JTX A;  3PDB B;  3L44 A;  1LW5 A;  3MAF B;  2VYC A;  4J5U A;  4MY5 A;  1IUG A;  4ADC A;  1CL1 A;  3ACZ A;  3NRA A;  3LVL B;  4HF8 A;  1Z7D A;  1GDE A;  5BJ4 A;  2R2N A;  1MDO A;  3PAA A;  4PVF A;  1V2D A;  4TN4 A;  2Z9V A;  9AAT A;  4OC9 A;  3HL2 A;  1EJI A;  1B5P A;  2V0Y A;  2D5Y A;  2G6W A;  3WKR A;  4U2H A;  3MAU A;  2AY2 A;  3FKD A;  2VMV A;  1PG8 A;  4RKC A;  3A9Z A;  2QBT A;  3PD6 A;  4RKD A;  1AMR A;  1B8G A;  3WCO A;  2BKW A;  2AY8 A;  4ZAS A;  2CB1 A;  2G7J A;  1BS0 A;  3ZRR A;  1IX6 A;  2OQX A;  5EAA A;  1UU1 A;  3WGC A;  2F8J A;  1OXP A;  4Y0H A;  1JS6 A;  2CY8 A;  4MQQ A;  2E7J A;  2JIS A;  3BV0 A;  1H1C A;  2CFB A;  4WYD A;  1KMK A;  1TOI A;  2X8U A;  4U1T A;  1PMO A;  2YKV A;  2GB3 A;  3COG A;  3PD6 B;  1DGD A;  3FRK A;  3LY1 A;  2QB2 A;  2VGU A;  4MKK A;  4ATQ A;  2ORD A;  5I92 A;  1ZOB A;  1X0M A;  5EFS A;  5G2P A;  4A00 A;  3NYU A;  2D61 A;  1ASD A;  3QHX A;  3RBL A;  3FZ7 A;  4F5J A;  3N4R A;  5K8B A;  2X5F A;  1LW4 A;  2W7D A;  1CQ7 A;  1YOO A;  3EI8 A;  3FQ8 A;  1ARG A;  4LNM A;  3MC6 A;  4AO4 A;  2HZP A;  2DGL A;  2OGA A;  1SFF A;  2HP2 A;  4MGR A;  4MSO A;  4W1X A;  3AEL A;  2AEU A;  3EUC A;  4ITG A;  1JG8 A;  2VMT A;  2EZ2 A;  3RCH A;  3ASA A;  4MQP A;  3NTJ A;  2VMN A;  2W7M A;  1M0O A;  1X29 A;  3TFU A;  3F0H A;  3FVX A;  3NNK A;  3NU8 A;  3WZF A;  1G7W A;  4GRX A;  1B9H A;  3PGY A;  2X5D A;  3K7Y A;  2Z9X A;  3F9T A;  2CIN A;  1FG3 A;  3FQA A;  5EIG A;  4ZWV A;  4RAE A;  1YJS A;  3RCH B;  2ZY2 A;  1UU0 A;  1N8P A;  2GMU A;  2W7G A;  2W7F A;  2VMU A;  3FVU A;  4PFF A;  2D65 A;  2VIB A;  4WB0 B;  4M2M A;  4B9B A;  5LH9 A;  3RQ1 A;  1J32 A;  2W8U A;  3H14 A;  3DRD A;  1O4S A;  4BMK A;  4XJP A;  2DKJ A;  4B98 A;  1GC2 A;  1VEF A;  1ASA A;  4QGR A;  2XBN A;  1O69 A;  4ZDO A;  5DX5 A;  4N0W A;  2Z61 A;  3GSB A;  4BQ0 A;  2ZSM A;  1ASF A;  2HUF A;  1FC4 A;  1YJY A;  3AEM A;  1J04 A;  2JG2 A;  3VK2 A;  1DJ9 A;  1W7M A;  2GSA A;  4GSA A;  4ZLV A;  2VMQ A;  2YCP A;  3FDB A;  4KAM A;  4Q75 A;  1YIY A;  3N7N A;  2WB6 A;  1CZC A;  1IAY A;  1RVU A;  1IJI A;  1D7R A;  5EUE A;  2W7J A;  3FSL A;  4LC3 A;  4ZDL A;  1M7Y A;  2CJD A;  4DBC A;  4A0G A;  3B1E A;  3KGX A;  3DOD A;  3LVM A;  4BHD A;  5M4D A;  4AZK A;  4CBR A;  2BI5 A;  4UHM A;  1X2A A;  4DQ6 A;  2W7H A;  1W23 A;  4OCA A;  3ZRP A;  1YNU A;  3EZ1 A;  3G7Q A;  2FM1 A;  2W8V A;  3PA9 A;  4OTL A;  2FKI A;  2VIA A;  2JGT A;  3ATH A;  4P3M A;  2VGV A;  2AY9 A;  1Y4I A;  2R5E A;  1M0Q A;  3D6K A;  4WXG A;  3WCN A;  1WYU A;  1YAA A;  3W1I A;  3GBX A;  4A0F A;  1DKA A;  2VMP A;  3BN1 A;  2BWP A;  2YKY A;  1KKJ A;  2W7E A;  1M32 A;  4F5H A;  4EB7 A;  3F6T A;  2D7Y A;  1M6S A;  3CAI A;  1AHG A;  3RBF A;  3ZRQ A;  3QM2 A;  2QLR A;  1WKG A;  4UHO A;  4I8A A;  2Z1Y A;  3MEB A;  5FT8 A;  1S08 A;  1Z3Z A;  3EIA A;  3HBX A;  3PDB A;  1AMS A;  2E7U A;  2BI2 A;  2D7Z A;  3AEJ C;  3EI7 A;  4UOY A;  3BS8 A;  1ASL A;  2W7L A;  4W5K A;  5FT5 A;  5EAV A;  3EI5 A;  3DXW A;  4LW4 A;  4F5L A;  4IYO A;  5M49 A;  2FNI A;  3B46 A;  3A8U X;  1GBN A;  3EZS A;  5DJ9 A;  1IX7 A;  3DC1 A;  4IW7 A;  4WLJ A;  4XJO A;  4NOG A;  1BKG A;  4XAU A;  1C7O A;  1KMJ A;  4GE4 A;  4O6Z A;  2EYQ A;  2R0T A;  4W1W A;  2PO3 A;  3BCX A;  1LC8 A;  5BJ3 A;  1DJU A;  1MLY A;  2YKX A;  2W7I A;  3QN6 A;  2KFP A;  1AJS B;  1OHW A;  2QMA A;  4FFC A;  1UKJ A;  4JEX A;  3DXV A;  2BWN A;  4IYO B;  2OAT A;  3G8M A;  3NYS A;  4OMA A;  3VK4 A;  5F9S A;  1GCK A;  3E6G A;  1PFF A;  2YKU A;  1ASC A;  1BQD A;  3BCB A;  2W8T A;  2YRR A;  2D63 A;  4A0H A;  3TFT A;  2W7K A;  4IX8 A;  4J8L A;  1OAT A;  4W1V A;  3WLX A;  4AOA A;  1I43 A;  3FFR A;  3FZ8 A;  3IF2 A;  2Z1Z A;  1W7L A;  3QGU A;  5M46 A;  3AAT A;  3WY7 A;  1WYT B;  5E4Z A;  1C7N A;  1B9I A;  4JEY A;  4Y0D A;  4LW2 A;  1BJO B;  4E3R A;  4W8I A;  3E2F A;  1SVV A;  3ASB A;  1JS3 A;  3N75 A;  1KAF A;  3QPG A;  1AKA A;  3JWB A;  1ELU A;  1IBJ A;  1ECX A;  2YRI A;  1AY5 A;  3JW9 A;  3QI6 A;  1TAS A;  2VMY A;  4JF0 A;  3I4J A;  4IXO A;  3UAK A;  3NDN A;  2ZY4 A;  3W1J A;  1V2E A;  1P3W A;  2D64 A;  1TOE A;  4KXK A;  4R2N A;  4A72 A;  2FYF A;  2EPJ A;  4H63 Q;  3BWO A;  1WKH A;  2D66 A;  1B5O A;  4ZSY A;  3BWN C;  2VMW A;  3CQ6 A;  2CTZ A;  1QIR A;  2VGS A;  2WK7 A;  2YCN A;  4RLG A;  4ADB A;  1OXO A;  3LG0 A;  5TF5 A;  1SZK A;  4LNJ A;  1LS3 A;  3UE8 A;  1GEX A;  1S09 A;  1D7S A;  3A9Y A;  4WB0 A;  1M0P A;  4AO9 A;  1AMQ A;  3R9A A;  3R4T A;  3NX3 A;  3VOM A;  4UHN A;  1MLZ A;  3JWA A;  5EUD A;  3HLM A;  3FZ6 A;  2BIG A;  2HUU A;  4WYE A;  3USF A;  2BHX A;  3ISL A;  3AOV A;  4BA5 A;  3EI6 A;  1CQ6 A;  2BI9 A;  1TAT A;  1ORD A;  4GE9 A;  2HUI A;  2FNU A;  5E3K A;  2JJG A;  3DZZ A;  3VP6 A;  5E5I A;  1AY4 A;  3I5T A;  1KL2 A;  1BW0 A;  3JU7 A;  3WKS A;  1GC0 A;  3AEN A;  3BC8 A;  1ARH A;  1C7G A;  2EO5 A;  4GEB A;  1VP4 A;  2CJH A;  1M0N A;  1I29 A;  4OBU A;  4WYG A;  4KYO A;  1AKC A;  2VI8 A;  1AIB A;  2E54 A;  1QJ3 A;  1ZC9 A;  4WBT A;  5HHY A;  1AHY A;  3H7F A;  4XK1 A;  1LC5 A;  3CQ4 A;  3E2Y A;  3GZD C;  5FT4 A;  2VGZ A;  3AEN B;  1G7X A;  3RUY A;  3TCM A;  4ZM3 A;  1QZ9 A;  2ZP7 A;  3NUI A;  4K2B A;  3MAD A;  1AAM A;  4JE5 A;  4OYT A;  5F8V A;  1OHY A;  4AZJ A;  2Q7W A;  2CH1 A;  3EIB A;  2O0R A;  4WYA A;  2DOU A;  3BB8 A;  1ELQ A;  1AHE A;  1EG5 A;  2YHK A;  1G4X A;  1MGV A;  2DGK A;  3VAX A;  2C44 A;  2AAT A;  4R5F A;  1QIS A;  3I16 A;  2CH2 A;  3RI6 A;  4BA4 A;  1ASG A;  1ASB A;  1OHV A;  2VLF A;  2XH1 A;  1N31 A;  4IXZ A;  1QIT A;  3G0T A;  4W91 A;  1MAP A;  1S06 A;  2VGT A;  3KGW A;  2BIE A;  2ZYJ A;  1W7N A;  3K28 A;  5M4B A;  2BWO A;  3FFH A;  3FCR A;  4Q6R A;  2W8W A;  3HVY A;  4XQ2 A;  5KTB A;  4Q31 A;  2GQN A;  4RJ0 A;  3ZZK A;  3GR9 A;  3LVJ A;  1RVY A;  2WK9 A;  3FD0 A;  3AEJ A;  4A0R A;  1AJS A;  4GDY A;  1E5F A;  1AKB A;  4N0B A;  1AHF A;  1ASE A;  2ZY5 A;  1TOK A;  2DGM A;  5G09 A;  2JJE A;  1O61 A;  4F5K A;  4R5Z A;  5LHA A;  4EMY A;  4ZAH A;  3N4S A;  1DJE A;  1CL2 A;  1S0A A;  3CBF A;  4JEZ A;  3WGB A;  2C81 A;  2V1P A;  3A9X A;  1G4V A;  3P6K A;  1AAW A;  1GD9 A;  2HOZ A;  4WXF A;  2BYL A;  2HOX A;  4JEW A;  4RJY A;  5G2Q A;  2OKJ A;  4XJL A;  3KE3 A;  4WD2 A;  1WYT A;  3AOW A;  4JEV A;  2AY6 A;  2AEV A;  2EH6 A;  3EI9 A;  5JAY A;  1BJO A;  1WST A;  2FN6 A;  4A6R A;  3IHJ A;  1TOG A;  3B1D A;  1FG7 A;  2VMS A;  3B1C A;  4TMR A;  4OBV A;  3TQX A;  2QSR A;  2JJH A;  2DR1 A;  2TPL A;  1V2F A;  1C4K A;  1O62 A;  2ZSL A;  2AY5 A;  2RFV A;  1RV3 A;  3DYD A;  1C9C A;  5J8Q A;  1I41 A;  5FT6 A;  4Y0I A;  1WYV B;  4P7Y A;  3QBO A;  5IWQ A;  1ART A;  1DTY A;  1JF9 A;  4GE7 A;  4K2I A;  2X3L A;  2R5C A;  3OKS A;  1KKP A;  4E77 A;  2VMR A;  1TOJ A;  4ATP A;  2E7I A;  2VMX A;  2DKB A;  5HXX A;  2GMS A;  3UWC A;  4JF1 A;  4A6U A;  3ZZJ A;  1LC7 A;  3PPL A;  3CQ5 A;  3II0 A;  3Q8N A;  1IX8 A;  2JJF A;  4JE5 D;  4MQR A;  1MAQ A;  1MDX A;  4UQV A;  2R5C B;  3B8X A;  3BWN A;  1YIZ A;  4L0O A;  5EQC A;  1TPL A;  2VLH A;  3N4X A;  3GJU A;  4EU1 A;  3BCA A;  1SPA A;  4TV7 A;  1RV4 A;  2EZ1 A;  1D7U A;  2CAN A;  4H51 A;  3MC6 C;  5D5S A;  1AMA A;  3L8A A;  3N5M A;  1CS1 A;  2AY1 A;  4M2J A;  1SZS A;  1ARI A;  1CZE A;  2AY7 A;  4R8D A;  3LVK A;  3DR7 A;  2CJG A;  4RM1 A;  4F5I A;  1QGN A;  3AEO A;  2C7T A;  3E2Z A;  3LV2 A;  3P1T A;  7AAT A;  4HVK A;  3M5U A;  3GWP A;  1TAR A;  4CXQ A;  4WP0 A;  4F5M A;  3HQT A;  1AY8 A;  2VI9 A;  2WK8 A;  1QJ5 A;  2ZC0 A;  1AHX A;  1KL1 A;  3E77 A;  4F5F A;  4CVQ A;  2ZUK A;  4Q76 A;  3W1H A;  4K05 A;  3KKI A;  5DB5 A;  1EQB A;  3MKJ A;  4IXS A;  1BJN A;  3PJ0 A;  3E2Z B;  1SZU A;  3ELE A;  4WLH A;  3AEP A;  2QB3 A;  1IVR A;  5AX8 A;  1AIC A;  1S07 A;  1GC4 A;  4F4E A;  1ASM A;  4FL0 A;  1X28 A;  1YJZ A;  5G4I A;  1ASN A;  1BT4 A;  3N0L A;  2BYJ A;  1SF2 A;  4XJM A;  3GZD A;  3H9X A;  5C6U A;  2VMO A;  3AEM C;  3TAT A;  4ISY A;  1V72 A;  1ZOD A;  5EIG B;  3FDD A;  4AH3 A;  4E1O A;  2BI3 A;  4WYF A;  4ZM4 A;  3HDO A;  1AIA A;  1IAX A;  2Z9W A;  3WX9 A;  5EUN A;  4ITX A;  3DU4 A;  4CBS A;  5HDM A;  3T32 A;  1XI9 A;  4EFF A;  4XEW A;  1VJO A;  1I48 A;  2ZY3 A;  3NUB A;  2EGY A;  1XEY A;  2NMP A;  3ELP A;  3GET A;  3K40 A;  1T3I A;  2VMZ A;  1UU2 A;  2PB2 A;  3FTB A;  4PFN A;  2FQ6 A;  2O1B A;  2HOY A;  3A2B A;  3AV7 A;  3E9K A;  4DGT A;  2C0R A;  2OKK A;  4K2M A;  4RIT A;  1U08 A;  5D95 A;  4ZDP A;  2A1V A;  1GC3 A;  1W3U A;  2CST A;  3PDX A;  4RIZ A;  1BJW A;  4E3Q A;  3NU7 A;  5DJ1 A;  3NYT A;  2O7C A;  3FQ7 A;  3PIU A;  2AY4 A;  4EB5 A;  8AAT A;  3ECD A;  1M4N A;  1GEW A;  3VK3 A;  2PB0 A;  1D2F A;  3HMU A;  4MKJ A;  5G4J A;  1N2T A;  1GEY A;  2YOB A;  1BJ4 A;  1CQ8 A;  2BIA A;  2VGW A;  4PIW A;  4WYC A;  4ADE A;  3HT4 A;  3LWS A;  4F5G A;  1AX4 A;  1DGE A;  1ARS A;  2Z67 A;  5G0A A;  4OT8 A;  4WXB A;  2HP1 A;  3MBB A;  2YCT A;  4ZWM A;  1AJR A;  1H0C A;  1E5E A;  2HOR A;  2OGE A;  3OP7 A;  1D7V A;  1DFO A;  1WYU B;  1BQA A;  2WKA A;  3FVS A;  1C0N A;  3MAF A;  4IY7 A;  4LNL A;  3JZL A;  1LK9 A;  3GZC A;  4M2K A;  4A6T A; 
#chains in the Genus database with same CATH homology
 1PMM A;  3DR4 A;  2Z9U A;  1CJ0 A;  1B4X A;  2Z20 A;  1MDZ A;  2BI1 A;  2QA3 A;  4ZSW A;  1WYV A;  4ADD A;  2AY3 A;  1LKC A;  2ZJG A;  2W8J A;  4CXR A;  3JTX A;  3PDB B;  3L44 A;  1LW5 A;  3MAF B;  2VYC A;  4J5U A;  4MY5 A;  1IUG A;  4ADC A;  1CL1 A;  3ACZ A;  3NRA A;  3LVL B;  4HF8 A;  1Z7D A;  1GDE A;  5BJ4 A;  2R2N A;  1MDO A;  3PAA A;  4PVF A;  1V2D A;  4TN4 A;  2Z9V A;  9AAT A;  4OC9 A;  3HL2 A;  1EJI A;  1B5P A;  2V0Y A;  2D5Y A;  2G6W A;  3WKR A;  4U2H A;  3MAU A;  2AY2 A;  3FKD A;  2VMV A;  1PG8 A;  4RKC A;  3A9Z A;  2QBT A;  3PD6 A;  4RKD A;  1AMR A;  1B8G A;  3WCO A;  2BKW A;  2AY8 A;  4ZAS A;  2CB1 A;  2G7J A;  1BS0 A;  3ZRR A;  1IX6 A;  2OQX A;  5EAA A;  1UU1 A;  3WGC A;  2F8J A;  1OXP A;  4Y0H A;  1JS6 A;  2CY8 A;  4MQQ A;  2E7J A;  2JIS A;  3BV0 A;  1H1C A;  2CFB A;  4WYD A;  1KMK A;  1TOI A;  2X8U A;  4U1T A;  1PMO A;  2YKV A;  2GB3 A;  3COG A;  3PD6 B;  1DGD A;  3FRK A;  3LY1 A;  2QB2 A;  2VGU A;  4MKK A;  4ATQ A;  2ORD A;  5I92 A;  1ZOB A;  1X0M A;  5EFS A;  5G2P A;  4A00 A;  3NYU A;  2D61 A;  1ASD A;  3QHX A;  3RBL A;  3FZ7 A;  4F5J A;  3N4R A;  5K8B A;  2X5F A;  1LW4 A;  2W7D A;  1CQ7 A;  1YOO A;  3EI8 A;  3FQ8 A;  1ARG A;  4LNM A;  3MC6 A;  4AO4 A;  2HZP A;  2DGL A;  2OGA A;  1SFF A;  2HP2 A;  4MGR A;  4MSO A;  4W1X A;  3AEL A;  2AEU A;  3EUC A;  4ITG A;  1JG8 A;  2VMT A;  2EZ2 A;  3RCH A;  3ASA A;  4MQP A;  3NTJ A;  2VMN A;  2W7M A;  1M0O A;  1X29 A;  3TFU A;  3F0H A;  3FVX A;  3NNK A;  3NU8 A;  3WZF A;  1G7W A;  4GRX A;  1B9H A;  3PGY A;  2X5D A;  3K7Y A;  2Z9X A;  3F9T A;  2CIN A;  1FG3 A;  3FQA A;  5EIG A;  4ZWV A;  4RAE A;  1YJS A;  3RCH B;  2ZY2 A;  1UU0 A;  1N8P A;  2GMU A;  2W7G A;  2W7F A;  2VMU A;  3FVU A;  4PFF A;  2D65 A;  2VIB A;  4WB0 B;  4M2M A;  4B9B A;  5LH9 A;  3RQ1 A;  1J32 A;  2W8U A;  3H14 A;  3DRD A;  1O4S A;  4BMK A;  4XJP A;  2DKJ A;  4B98 A;  1GC2 A;  1VEF A;  1ASA A;  4QGR A;  2XBN A;  1O69 A;  4ZDO A;  5DX5 A;  4N0W A;  2Z61 A;  3GSB A;  4BQ0 A;  2ZSM A;  1ASF A;  2HUF A;  1FC4 A;  1YJY A;  3AEM A;  1J04 A;  2JG2 A;  3VK2 A;  1DJ9 A;  1W7M A;  2GSA A;  4GSA A;  4ZLV A;  2VMQ A;  2YCP A;  3FDB A;  4KAM A;  4Q75 A;  1YIY A;  3N7N A;  2WB6 A;  1CZC A;  1IAY A;  1RVU A;  1IJI A;  1D7R A;  5EUE A;  2W7J A;  3FSL A;  4LC3 A;  4ZDL A;  1M7Y A;  2CJD A;  4DBC A;  4A0G A;  3B1E A;  3KGX A;  3DOD A;  3LVM A;  4BHD A;  5M4D A;  4AZK A;  4CBR A;  2BI5 A;  4UHM A;  1X2A A;  4DQ6 A;  2W7H A;  1W23 A;  4OCA A;  3ZRP A;  1YNU A;  3EZ1 A;  3G7Q A;  2FM1 A;  2W8V A;  3PA9 A;  4OTL A;  2FKI A;  2VIA A;  2JGT A;  3ATH A;  4P3M A;  2VGV A;  2AY9 A;  1Y4I A;  2R5E A;  1M0Q A;  3D6K A;  4WXG A;  3WCN A;  1WYU A;  1YAA A;  3W1I A;  3GBX A;  4A0F A;  1DKA A;  2VMP A;  3BN1 A;  2BWP A;  2YKY A;  1KKJ A;  2W7E A;  1M32 A;  4F5H A;  4EB7 A;  3F6T A;  2D7Y A;  1M6S A;  3CAI A;  1AHG A;  3RBF A;  3ZRQ A;  3QM2 A;  2QLR A;  1WKG A;  4UHO A;  4I8A A;  2Z1Y A;  3MEB A;  5FT8 A;  1S08 A;  1Z3Z A;  3EIA A;  3HBX A;  3PDB A;  1AMS A;  2E7U A;  2BI2 A;  2D7Z A;  3AEJ C;  3EI7 A;  4UOY A;  3BS8 A;  1ASL A;  2W7L A;  4W5K A;  5FT5 A;  5EAV A;  3EI5 A;  3DXW A;  4LW4 A;  4F5L A;  4IYO A;  5M49 A;  2FNI A;  3B46 A;  3A8U X;  1GBN A;  3EZS A;  5DJ9 A;  1IX7 A;  3DC1 A;  4IW7 A;  4WLJ A;  4XJO A;  4NOG A;  1BKG A;  4XAU A;  1C7O A;  1KMJ A;  4GE4 A;  4O6Z A;  2EYQ A;  2R0T A;  4W1W A;  2PO3 A;  3BCX A;  1LC8 A;  5BJ3 A;  1DJU A;  1MLY A;  2YKX A;  2W7I A;  3QN6 A;  2KFP A;  1AJS B;  1OHW A;  2QMA A;  4FFC A;  1UKJ A;  4JEX A;  3DXV A;  2BWN A;  4IYO B;  2OAT A;  3G8M A;  3NYS A;  4OMA A;  3VK4 A;  5F9S A;  1GCK A;  3E6G A;  1PFF A;  2YKU A;  1ASC A;  1BQD A;  3BCB A;  2W8T A;  2YRR A;  2D63 A;  4A0H A;  3TFT A;  2W7K A;  4IX8 A;  4J8L A;  1OAT A;  4W1V A;  3WLX A;  4AOA A;  1I43 A;  3FFR A;  3FZ8 A;  3IF2 A;  2Z1Z A;  1W7L A;  3QGU A;  5M46 A;  3AAT A;  3WY7 A;  1WYT B;  5E4Z A;  1C7N A;  1B9I A;  4JEY A;  4Y0D A;  4LW2 A;  1BJO B;  4E3R A;  4W8I A;  3E2F A;  1SVV A;  3ASB A;  1JS3 A;  3N75 A;  3QPG A;  1AKA A;  3JWB A;  1ELU A;  1IBJ A;  1ECX A;  2YRI A;  1AY5 A;  3JW9 A;  3QI6 A;  1TAS A;  2VMY A;  4JF0 A;  3I4J A;  4IXO A;  3UAK A;  3NDN A;  2ZY4 A;  3W1J A;  1V2E A;  1P3W A;  2D64 A;  1TOE A;  4KXK A;  4R2N A;  4A72 A;  2FYF A;  2EPJ A;  4H63 Q;  3BWO A;  1WKH A;  2D66 A;  1B5O A;  4ZSY A;  3BWN C;  2VMW A;  3CQ6 A;  2CTZ A;  1QIR A;  2VGS A;  2WK7 A;  2YCN A;  4RLG A;  4ADB A;  1OXO A;  3LG0 A;  5TF5 A;  1SZK A;  4LNJ A;  1LS3 A;  3UE8 A;  1GEX A;  1S09 A;  1D7S A;  3A9Y A;  4WB0 A;  1M0P A;  4AO9 A;  1AMQ A;  3R9A A;  3R4T A;  3NX3 A;  3VOM A;  4UHN A;  1MLZ A;  3JWA A;  5EUD A;  3HLM A;  3FZ6 A;  2BIG A;  2HUU A;  4WYE A;  3USF A;  2BHX A;  3ISL A;  3AOV A;  4BA5 A;  3EI6 A;  1CQ6 A;  2BI9 A;  1TAT A;  1ORD A;  4GE9 A;  2HUI A;  2FNU A;  5E3K A;  2JJG A;  3DZZ A;  3VP6 A;  5E5I A;  1AY4 A;  3I5T A;  1KL2 A;  1BW0 A;  3JU7 A;  3WKS A;  1GC0 A;  3AEN A;  3BC8 A;  1ARH A;  1C7G A;  2EO5 A;  4GEB A;  1VP4 A;  2CJH A;  1M0N A;  1I29 A;  4OBU A;  4WYG A;  4KYO A;  1AKC A;  2VI8 A;  1AIB A;  2E54 A;  1QJ3 A;  1ZC9 A;  4WBT A;  5HHY A;  1AHY A;  3H7F A;  4XK1 A;  1LC5 A;  3CQ4 A;  3E2Y A;  3GZD C;  5FT4 A;  2VGZ A;  3AEN B;  1G7X A;  3RUY A;  3TCM A;  4ZM3 A;  1QZ9 A;  2ZP7 A;  3NUI A;  4K2B A;  3MAD A;  1AAM A;  4JE5 A;  4OYT A;  5F8V A;  1OHY A;  4AZJ A;  2Q7W A;  2CH1 A;  3EIB A;  2O0R A;  4WYA A;  2DOU A;  3BB8 A;  1ELQ A;  1AHE A;  1EG5 A;  2YHK A;  1G4X A;  1MGV A;  2DGK A;  3VAX A;  2C44 A;  2AAT A;  4R5F A;  1QIS A;  3I16 A;  2CH2 A;  3RI6 A;  4BA4 A;  1ASG A;  1ASB A;  1OHV A;  2VLF A;  2XH1 A;  1N31 A;  4IXZ A;  1QIT A;  3G0T A;  4W91 A;  1MAP A;  1S06 A;  2VGT A;  3KGW A;  2BIE A;  2ZYJ A;  1W7N A;  3K28 A;  5M4B A;  2BWO A;  3FFH A;  3FCR A;  4Q6R A;  2W8W A;  3HVY A;  4XQ2 A;  5KTB A;  4Q31 A;  2GQN A;  4RJ0 A;  3ZZK A;  3GR9 A;  3LVJ A;  1RVY A;  2WK9 A;  3FD0 A;  3AEJ A;  4A0R A;  1AJS A;  4GDY A;  1E5F A;  1AKB A;  4N0B A;  1AHF A;  1ASE A;  2ZY5 A;  1TOK A;  2DGM A;  5G09 A;  2JJE A;  1O61 A;  4F5K A;  4R5Z A;  5LHA A;  4EMY A;  4ZAH A;  3N4S A;  1DJE A;  1CL2 A;  1S0A A;  3CBF A;  4JEZ A;  3WGB A;  2C81 A;  2V1P A;  3A9X A;  1G4V A;  3P6K A;  1AAW A;  1GD9 A;  2HOZ A;  4WXF A;  2BYL A;  2HOX A;  4JEW A;  4RJY A;  5G2Q A;  2OKJ A;  4XJL A;  3KE3 A;  4WD2 A;  1WYT A;  3AOW A;  4JEV A;  2AY6 A;  2AEV A;  2EH6 A;  3EI9 A;  5JAY A;  1BJO A;  1WST A;  2FN6 A;  4A6R A;  3IHJ A;  1TOG A;  3B1D A;  1FG7 A;  2VMS A;  3B1C A;  4TMR A;  4OBV A;  3TQX A;  2QSR A;  2JJH A;  2DR1 A;  2TPL A;  1V2F A;  1C4K A;  1O62 A;  2ZSL A;  2AY5 A;  2RFV A;  1RV3 A;  3DYD A;  1C9C A;  5J8Q A;  1I41 A;  5FT6 A;  4Y0I A;  1WYV B;  4P7Y A;  3QBO A;  5IWQ A;  1ART A;  1DTY A;  1JF9 A;  4GE7 A;  4K2I A;  2X3L A;  2R5C A;  3OKS A;  1KKP A;  4E77 A;  2VMR A;  1TOJ A;  4ATP A;  2E7I A;  2VMX A;  2DKB A;  5HXX A;  2GMS A;  3UWC A;  4JF1 A;  4A6U A;  3ZZJ A;  1LC7 A;  3PPL A;  3CQ5 A;  3II0 A;  3Q8N A;  1IX8 A;  2JJF A;  4JE5 D;  4MQR A;  1MAQ A;  1MDX A;  4UQV A;  2R5C B;  3B8X A;  3BWN A;  1YIZ A;  4L0O A;  5EQC A;  1TPL A;  2VLH A;  3N4X A;  3GJU A;  4EU1 A;  3BCA A;  1SPA A;  4TV7 A;  1RV4 A;  2EZ1 A;  1D7U A;  2CAN A;  4H51 A;  3MC6 C;  5D5S A;  1AMA A;  3L8A A;  3N5M A;  1CS1 A;  2AY1 A;  4M2J A;  1SZS A;  1ARI A;  1CZE A;  2AY7 A;  4R8D A;  3LVK A;  3DR7 A;  2CJG A;  4RM1 A;  4F5I A;  1QGN A;  3AEO A;  2C7T A;  3E2Z A;  3LV2 A;  3P1T A;  7AAT A;  4HVK A;  3M5U A;  3GWP A;  1TAR A;  4CXQ A;  4WP0 A;  4F5M A;  3HQT A;  1AY8 A;  2VI9 A;  2WK8 A;  1QJ5 A;  2ZC0 A;  1AHX A;  1KL1 A;  3E77 A;  4F5F A;  4CVQ A;  2ZUK A;  4Q76 A;  3W1H A;  4K05 A;  3KKI A;  5DB5 A;  1EQB A;  3MKJ A;  4IXS A;  1BJN A;  3PJ0 A;  3E2Z B;  1SZU A;  3ELE A;  4WLH A;  3AEP A;  2QB3 A;  1IVR A;  5AX8 A;  1AIC A;  1S07 A;  1GC4 A;  4F4E A;  1ASM A;  4FL0 A;  1X28 A;  1YJZ A;  5G4I A;  1ASN A;  1BT4 A;  3N0L A;  2BYJ A;  1SF2 A;  4XJM A;  3GZD A;  3H9X A;  5C6U A;  2VMO A;  3AEM C;  3TAT A;  4ISY A;  1V72 A;  1ZOD A;  5EIG B;  3FDD A;  4AH3 A;  4E1O A;  2BI3 A;  4WYF A;  4ZM4 A;  3HDO A;  1AIA A;  1IAX A;  2Z9W A;  3WX9 A;  5EUN A;  4ITX A;  3DU4 A;  4CBS A;  5HDM A;  3T32 A;  1XI9 A;  4EFF A;  4XEW A;  1VJO A;  1I48 A;  2ZY3 A;  3NUB A;  2EGY A;  1XEY A;  2NMP A;  3ELP A;  3GET A;  3K40 A;  1T3I A;  2VMZ A;  1UU2 A;  2PB2 A;  3FTB A;  4PFN A;  2FQ6 A;  2O1B A;  2HOY A;  3A2B A;  3AV7 A;  3E9K A;  4DGT A;  2C0R A;  2OKK A;  4K2M A;  4RIT A;  1U08 A;  5D95 A;  4ZDP A;  2A1V A;  1GC3 A;  1W3U A;  2CST A;  3PDX A;  4RIZ A;  1BJW A;  4E3Q A;  3NU7 A;  5DJ1 A;  3NYT A;  2O7C A;  3FQ7 A;  3PIU A;  2AY4 A;  4EB5 A;  8AAT A;  3ECD A;  1M4N A;  1GEW A;  3VK3 A;  2PB0 A;  1D2F A;  3HMU A;  4MKJ A;  5G4J A;  1N2T A;  1GEY A;  2YOB A;  1BJ4 A;  1CQ8 A;  2BIA A;  2VGW A;  4PIW A;  4WYC A;  4ADE A;  3HT4 A;  3LWS A;  4F5G A;  1AX4 A;  1DGE A;  1ARS A;  2Z67 A;  5G0A A;  4OT8 A;  4WXB A;  2HP1 A;  3MBB A;  2YCT A;  4ZWM A;  1AJR A;  1H0C A;  1E5E A;  2HOR A;  2OGE A;  3OP7 A;  1D7V A;  1DFO A;  1WYU B;  1BQA A;  2WKA A;  3FVS A;  1C0N A;  3MAF A;  4IY7 A;  4LNL A;  3JZL A;  1LK9 A;  3GZC A;  4M2K A;  4A6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...