1CZEA

Aspartate aminotransferase mutant atb17/139s/142n with succinic acid
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
b'MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Cocrystallization of a mutant aspartate aminotransferase with a C5-dicarboxylic substrate analog: structural comparison with the enzyme-C4-dicarboxylic analog complex.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 140
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1czeA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1czeA01
3PDXA 1G4VA 4EFFA 3LV2A 2QBTA 3WCOA 1AHGA 1BKGA 1IJIA 1DJ9A 1PMMA 1M7YA 1QGNA 3GETA 1RVYA 4WBTA 3RBLA 3T32A 4F5HA 2X8UA 3B1EA 3CQ6A 3FCRA 1MLYA 3E77A 2VYCA 1EJIA 1WYTA 2BYJA 3AEMC 3KE3A 2EZ2A 1OXOA 5DJ9A 2VMTA 3DR7A 2AY8A 3CBFA 3II0A 1DGDA 4JEVA 4U2HA 3BN1A 4WXFA 1UU2A 4OMAA 1YJYA 1BJOA 1TASA 3CQ5A 3FVUA 1ASCA 1B5PA 2G6WA 5K8BA 5JAYA 1RV3A 3WKRA 1D7RA 2AY6A 2QMAA 1PG8A 2V0YA 4M2JA 3VK2A 4WXBA 2HUFA 1KMJA 2R0TA 3AENB 4OC9A 1YIYA 1V72A 1IBJA 1ECXA 4LNJA 4WYAA 4BA4A 5G09A 1OHYA 3GZDA 4A0GA 2BKWA 1KKPA 3I4JA 4DBCA 1Y4IA 4E3QA 4F5MA 5J8QA 3F9TA 3VP6A 2DOUA 4MGRA 2EZ1A 4EMYA 1BJWA 1AJSA 1G7WA 4BHDA 1AKCA 2VIBA 1AMQA 4F5GA 2PB0A 1U08A 2CFBA 3G7QA 3AELA 2GMSA 3L44A 3DZZA 4W5KA 1KMKA 1N31A 2OQXA 3DU4A 4B9BA 4FL0A 1D2FA 1W7NA 4RM1A 2FQ6A 1MDOA 2GSAA 3AEPA 2Q7WA 2AY1A 1GCKA 1D7UA 1CQ8A 2EGYA 4AO4A 1YJSA 1GEYA 2W8JA 5M46A 4U1TA 3MEBA 2ZC0A 2CJHA 3ZRPA 4ZM4A 1C7GA 1OXPA 2W8TA 5G4JA 2OGAA 2GB3A 1LW4A 4JE5D 4DQ6A 1SZSA 1ASGA 1LC8A 3UAKA 4CXRA 4R5ZA 2ZY3A 4N0BA 1V2EA 1VEFA 2HOXA 1GDEA 2V1PA 2VGUA 4Q76A 3PD6A 2ORDA 4FFCA 1BJOB 2ZP7A 4O6ZA 2O1BA 3FSLA 4LC3A 4QGRA 3B8XA 4XJPA 4ITGA 3ECDA 8AATA 1X2AA 3LVJA 4JEWA 1ORDA 5EUEA 2DKJA 4CXQA 2HUUA 1D7SA 1ASAA 1N8PA 3A2BA 1QJ3A 3AEJA 1H0CA 1TOKA 2CJGA 3HBXA 5EUDA 4WYFA 1IAXA 3IF2A 2D61A 2CINA 3UWCA 2YCPA 3DR4A 2VMOA 1AJSB 2BI1A 1ARSA 2VIAA 1W7LA 2R2NA 1TOIA 3B1CA 4LW4A 1SZKA 3G8MA 2Z67A 3GZCA 1AICA 5DB5A 5EIGA 4A0FA 1KL2A 2FM1A 2BI2A 2VI8A 1SPAA 3BWNA 1IX8A 4TV7A 1LS3A 1AHFA 3NUBA 4ATQA 4K2BA 3WKSA 2D66A 3JTXA 2W7LA 1AAMA 2AEUA 3AENA 4J5UA 4MQPA 1WYUB 2YCTA 3EI5A 2W7HA 1CZCA 1S08A 1XI9A 1ASNA 4IY7A 2VMVA 3TCMA 1CS1A 3HVYA 1MDZA 1AY4A 3DYDA 2JJGA 3QGUA 4H51A 2OGEA 2QB3A 2BI9A 3HLMA 3NU7A 2C7TA 2VI9A 4CBSA 4BQ0A 3PD6B 5AX8A 2ZY2A 1E5EA 1Z7DA 3GSBA 3FDBA 3NYUA 2VGTA 1BQDA 2JJEA 3A8UX 2FYFA 3TFUA 1MDXA 1SFFA 5E5IA 3ISLA 4ADBA 2CJDA 2OKKA 4JEXA 4A72A 3VK4A 4F5JA 1P3WA 1G4XA 2YRIA 1C0NA 2JGTA 1TARA 1AIAA 2VMSA 3NNKA 4IYOB 3COGA 3DC1A 3LVKA 3PGYA 3BWOA 1E5FA 2E7JA 1AIBA 3HDOA 5IWQA 1IX6A 3VOMA 3FQ7A 4A6TA 5M4DA 4IXOA 3ZRQA 4RJ0A 1WKGA 3AEOA 4Q6RA 5G2PA 1ASMA 3I5TA 3OP7A 2FNUA 2R5CA 5EIGB 1B5OA 3KGXA 2DGKA 3CAIA 4IX8A 2VGVA 1AKAA 2R5EA 3EI9A 2D65A 1JF9A 4E77A 1QJ5A 4W91A 4A0HA 2D64A 3FZ6A 1B4XA 5D95A 9AATA 3NDNA 5BJ4A 5E3KA 2E7UA 4IW7A 1B8GA 3FTBA 1UU0A 1BJ4A 2FNIA 2DGLA 2DKBA 2OKJA 3FFRA 3PPLA 3H7FA 1VJOA 4ISYA 4WYCA 4EB7A 1JS6A 4ZLVA 2W8WA 3W1IA 4CVQA 3EI8A 1LW5A 3QM2A 3WY7A 1O62A 2Z9XA 3VAXA 1TOJA 2W7JA 2C81A 4WD2A 4XJLA 2HP1A 3FFHA 2W8VA 2W7EA 4F5KA 1PMOA 1DJUA 1O69A 4LNMA 1S0AA 3EUCA 2Z9UA 3B1DA 4BMKA 3WCNA 1M0PA 3CQ4A 2CH2A 1KKJA 1WKHA 1YIZA 2YKUA 1IVRA 3FQ8A 4AOAA 1DFOA 2C0RA 2WKAA 3RQ1A 3MADA 5FT4A 3FZ7A 4XQ2A 3FDDA 3RUYA 1WYUA 4OTLA 4P7YA 3USFA 1AY8A 3TQXA 5C6UA 1AHYA 1MAQA 4HVKA 1LC5A 2TPLA 2YCNA 1JG8A 3ELPA 2R5CB 1LK9A 3NRAA 4XAUA 2AEVA 1AAWA 4MQQA 2CANA 1X0MA 2W7GA 3HQTA 4A0RA 3LG0A 4F5IA 2F8JA 3NYSA 1QITA 1B9HA 1TATA 2VGZA 4GE4A 2Z9VA 1W7MA 1BQAA 5TF5A 3PJ0A 4WP0A 3TFTA 5HXXA 1TOEA 2NMPA 2VGWA 1AMRA 3BCAA 2D7YA 2W7FA 2XBNA 4IXZA 4IYOA 1LC7A 2YKXA 2W8UA 4IXSA 2QB2A 5M49A 4ZM3A 2AY3A 1VP4A 1M0NA 3ZRRA 4ZAHA 3IHJA 1JS3A 3JWAA 3LVMA 4AO9A 1BS0A 4ZWVA 1TOGA 2BHXA 4NOGA 2D63A 3N0LA 3MC6A 5EAAA 2ZY4A 2EPJA 1GBNA 3GR9A 1DGEA 3H14A 5FT8A 2AATA 4Y0DA 4K2IA 4ZASA 3BC8A 1AMAA 3N5MA 3HL2A 2W7KA 1OATA 1M4NA 1ARIA 2ZSMA 1AHXA 1WYVA 1I41A 2ZYJA 3N75A 3M5UA 4OBVA 5EUNA 3WLXA 2OATA 4MY5A 3ASBA 1ARHA 3RBFA 2DR1A 3F0HA 2W7DA 4R5FA 1XEYA 2AY4A 2BYLA 4RIZA 3RI6A 3EZSA 1ELQA 2CH1A 3BCBA 4KAMA 3MKJA 3AV7A 3EZ1A 3F6TA 4MSOA 3HT4A 3MBBA 1MGVA 1YNUA 3AEJC 4GSAA 3NTJA 4AZKA 5BJ3A 1I29A 2AY7A 3FZ8A 3E2FA 4OYTA 4R2NA 4E3RA 3KGWA 5F8VA 4R8DA 3FD0A 4Q75A 1J04A 2CY8A 1V2DA 2X3LA 3E9KA 1DTYA 1ELUA 3DRDA 3RCHB 3AEMA 1QISA 2YOBA 4W1XA 3PAAA 1EG5A 3NU8A 4JF1A 4ZWMA 2BWPA 3NX3A 2VMZA 4E1OA 1C7NA 3BWNC 1UKJA 3ELEA 5DJ1A 4J8LA 3UE8A 4RKDA 3TATA 2VMQA 2ZUKA 4F4EA 1GC4A 1CL2A 1RV4A 2HP2A 1KL1A 3MAFA 3DODA 2VGSA 2HOZA 4L0OA 2YKYA 1M0QA 3A9YA 2BIAA 2QA3A 2WK8A 2W7IA 1H1CA 3PDBB 4W8IA 4GDYA 4GE7A 5FT6A 2BWOA 5G2QA 2JJFA 1WYVB 4XK1A 4BA5A 1BJNA 4ZSYA 4ADEA 2VMYA 1M32A 2Z61A 3QBOA 7AATA 4WB0A 1O4SA 3FVXA 4MKJA 1OHWA 4ADDA 4UHOA 1PFFA 4DGTA 3OKSA 1RVUA 3K28A 3QHXA 4OT8A 1ASLA 4P3MA 4AH3A 4AZJA 1QZ9A 5LHAA 1DJEA 1CQ7A 1W3UA 1X28A 4TN4A 4XJOA 2VMRA 3BS8A 4ADCA 1WSTA 2Z9WA 3QN6A 3K7YA 1O61A 3HMUA 3MAUA 4RJYA 4F5FA 1CL1A 3BV0A 3WGBA 3A9ZA 4UOYA 2BI5A 2HORA 2CSTA 4XEWA 3FRKA 2AY5A 3FQAA 1ASFA 1DKAA 3R4TA 5DX5A 2YHKA 1S06A 4A00A 4KXKA 1LKCA 4LNLA 3LVLB 5G4IA 1YAAA 2XH1A 4XJMA 5EFSA 1SF2A 1IAYA 3GBXA 2JJHA 3BCXA 4RITA 3GWPA 4UQVA 4ZSWA 2PO3A 3G0TA 3WX9A 4F5LA 3VK3A 1C7OA 4I8AA 4WYDA 1I43A 4M2MA 2FN6A 1GC0A 4ATPA 3NYTA 5G0AA 3LWSA 4UHMA 1M0OA 3B46A 3MAFB 1ZODA 3GZDC 3ASAA 4PFFA 4UHNA 1ZOBA 3EI7A 3E6GA 4LW2A 4MQRA 2DGMA 2VMNA 1FC4A 1IX7A 1ASBA 2BWNA 1Z3ZA 1AMSA 3E2YA 2YKVA 3PA9A 1UU1A 1SZUA 3BB8A 3R9AA 4ZDOA 2AY9A 2HOYA 1OHVA 4WB0B 3EIAA 4ITXA 3RCHA 3EIBA 4OCAA 4CBRA 4K2MA 4HF8A 4GRXA 2RFVA 3DXVA 1X29A 5F9SA 1GD9A 1J32A 4WYGA 1WYTB 4JF0A 3WGCA 1ARTA 2ZY5A 2VMXA 4WLHA 3FVSA 1EQBA 1FG7A 4W1VA 2HUIA 4A6RA 1YOOA 3ACZA 4EB5A 1W23A 4WXGA 3ZZJA 1AJRA 3JU7A 3LY1A 1YJZA 1QIRA 1SVVA 3ATHA 1GEXA 1S07A 3E2ZA 1MLZA 5LH9A 3QI6A 1C9CA 3W1JA 2O0RA 3AOWA 3EI6A 3GJUA 3PDBA 4Q31A 3ZZKA 4EU1A 1IUGA 3I16A 1CZEA 2BI3A 4A6UA 3FKDA 4RKCA 2X5DA 3P1TA 2AY2A 2BIEA 4JEZA 3WZFA 1FG3A 1CJ0A 1I48A 2GQNA 5E4ZA 1V2FA 2VMUA 2Z20A 1GC3A 1MAPA 2EH6A 1B9IA 4JE5A 4ZDLA 1ZC9A 2QLRA 1AX4A 2PB2A 3K40A 3NUIA 4Y0IA 4TMRA 2Z1YA 2E54A 3PIUA 5FT5A 2VMWA 3D6KA 1ASDA 4PVFA 5EQCA 1GC2A 2E7IA 3W1HA 3JZLA 5HHYA 3AATA 4PIWA 4B98A 1G7XA 4GE9A 4WLJA 4ZDPA 3P6KA 4OBUA 3AOVA 1TPLA 5D5SA 3MC6C 1CQ6A 1M6SA 3DXWA 2D5YA 1S09A 3KKIA 1AHEA 3L8AA 1AKBA 4MKKA 1C4KA 2GMUA 4KYOA 4WYEA 2JG2A 3JW9A 2BIGA 1N2TA 1T3IA 1ARGA 2ZJGA 1AY5A 2WK9A 1GEWA 1ASEA 4RAEA 2CB1A 2Z1ZA 3Q8NA 2HZPA 4N0WA 2YRRA 2WK7A 4RLGA 5EAVA 5I92A 1D7VA 2CTZA 4GEBA 3E2ZB 2C44A 2D7ZA 3JWBA 2X5FA 2JISA 2VMPA 4JEYA 2ZSLA 4M2KA 2VLFA 4Y0HA 2W7MA 2VLHA 4PFNA 5HDMA 2O7CA 3A9XA 5M4BA 1BT4A 4W1WA 3QPGA 2EO5A 1BW0A
chains in the Genus database with same CATH superfamily
3PDXA 1G4VA 4EFFA 3LV2A 2QBTA 3WCOA 1AHGA 1BKGA 1IJIA 1DJ9A 1PMMA 1M7YA 1QGNA 3GETA 1RVYA 4WBTA 3RBLA 3T32A 4F5HA 2X8UA 3B1EA 3CQ6A 3FCRA 1MLYA 3E77A 2VYCA 1EJIA 1WYTA 2BYJA 3AEMC 3KE3A 2EZ2A 1OXOA 5DJ9A 2VMTA 3DR7A 2AY8A 3CBFA 3II0A 1DGDA 4JEVA 4U2HA 3BN1A 4WXFA 1UU2A 4OMAA 1YJYA 1BJOA 1TASA 3CQ5A 3FVUA 1ASCA 1B5PA 2G6WA 5K8BA 5JAYA 1RV3A 3WKRA 1D7RA 2AY6A 2QMAA 1PG8A 2V0YA 4M2JA 3VK2A 4WXBA 2HUFA 1KMJA 2R0TA 3AENB 4OC9A 1YIYA 1V72A 1IBJA 1ECXA 4LNJA 4WYAA 4BA4A 5G09A 1OHYA 3GZDA 3N7NA 4A0GA 2BKWA 1KKPA 3I4JA 4DBCA 1Y4IA 4E3QA 4F5MA 5J8QA 3F9TA 3VP6A 2DOUA 4MGRA 2EZ1A 4EMYA 1BJWA 1AJSA 1G7WA 4BHDA 1AKCA 2VIBA 1AMQA 4F5GA 2PB0A 1U08A 2CFBA 3G7QA 3AELA 2GMSA 3L44A 3DZZA 4W5KA 1KMKA 1N31A 2OQXA 3DU4A 4B9BA 4FL0A 1D2FA 1W7NA 4RM1A 2FQ6A 1MDOA 2GSAA 3AEPA 2Q7WA 2AY1A 1GCKA 1D7UA 1CQ8A 2EGYA 4AO4A 1YJSA 1GEYA 2W8JA 5M46A 4U1TA 3MEBA 2ZC0A 2CJHA 3ZRPA 4ZM4A 1C7GA 1OXPA 2W8TA 5G4JA 2OGAA 2GB3A 1LW4A 4JE5D 4DQ6A 1SZSA 2A1VA 1ASGA 1LC8A 3UAKA 4CXRA 4R5ZA 2ZY3A 4N0BA 1V2EA 1VEFA 2HOXA 1GDEA 2V1PA 2VGUA 4Q76A 3PD6A 2ORDA 4FFCA 1BJOB 2ZP7A 4O6ZA 2O1BA 3FSLA 4LC3A 4QGRA 3B8XA 4XJPA 4ITGA 3ECDA 8AATA 1X2AA 3LVJA 4JEWA 1ORDA 5EUEA 2DKJA 4CXQA 2HUUA 1D7SA 1ASAA 1N8PA 3A2BA 1QJ3A 3AEJA 1H0CA 1TOKA 2CJGA 3HBXA 5EUDA 4WYFA 1IAXA 3IF2A 2D61A 2CINA 3UWCA 2YCPA 3DR4A 2VMOA 1AJSB 2BI1A 1ARSA 2VIAA 1W7LA 2R2NA 1TOIA 3B1CA 4LW4A 1SZKA 3G8MA 2Z67A 3GZCA 1AICA 5DB5A 5EIGA 4A0FA 1KL2A 2FM1A 2BI2A 2VI8A 1SPAA 3BWNA 1IX8A 4TV7A 1LS3A 1AHFA 3NUBA 4ATQA 4K2BA 3WKSA 2D66A 3JTXA 2W7LA 1AAMA 2AEUA 3AENA 4J5UA 4MQPA 1WYUB 2YCTA 3EI5A 2W7HA 1CZCA 1S08A 1XI9A 1ASNA 4IY7A 2VMVA 3TCMA 1CS1A 3HVYA 1MDZA 1AY4A 3DYDA 2JJGA 3QGUA 4H51A 2OGEA 2QB3A 2BI9A 3HLMA 3NU7A 2C7TA 2VI9A 4CBSA 4BQ0A 3PD6B 5AX8A 2ZY2A 1E5EA 1Z7DA 3GSBA 3FDBA 3NYUA 2VGTA 1BQDA 2JJEA 3A8UX 4K05A 2FYFA 3TFUA 1MDXA 1SFFA 5E5IA 3ISLA 4ADBA 2CJDA 2OKKA 4JEXA 4A72A 3VK4A 4F5JA 1P3WA 1G4XA 2YRIA 1C0NA 2JGTA 1TARA 1AIAA 2VMSA 3NNKA 4IYOB 3COGA 3DC1A 3LVKA 3PGYA 3BWOA 1E5FA 2E7JA 1AIBA 3HDOA 5IWQA 1IX6A 3VOMA 3FQ7A 4A6TA 5M4DA 4IXOA 3ZRQA 4RJ0A 1WKGA 3AEOA 4Q6RA 5G2PA 1ASMA 3I5TA 3OP7A 2FNUA 2R5CA 5EIGB 1B5OA 3KGXA 2DGKA 3CAIA 4IX8A 2VGVA 1AKAA 2R5EA 3EI9A 2D65A 1JF9A 4E77A 1QJ5A 4W91A 4A0HA 2D64A 3FZ6A 1B4XA 5D95A 9AATA 3NDNA 5BJ4A 5E3KA 2E7UA 4IW7A 1B8GA 3FTBA 1UU0A 1BJ4A 2FNIA 2DGLA 2DKBA 2OKJA 3FFRA 3PPLA 3H7FA 1VJOA 4ISYA 4WYCA 4EB7A 1JS6A 4ZLVA 2W8WA 3W1IA 3N4SA 4CVQA 3EI8A 1LW5A 3QM2A 3WY7A 1O62A 2Z9XA 3VAXA 1TOJA 2W7JA 2C81A 4WD2A 4XJLA 2HP1A 3FFHA 2W8VA 2W7EA 4F5KA 1PMOA 1DJUA 1O69A 4LNMA 1S0AA 3EUCA 2Z9UA 3B1DA 4BMKA 3WCNA 1M0PA 3CQ4A 2CH2A 1KKJA 1WKHA 1YIZA 2YKUA 1IVRA 3FQ8A 4AOAA 1DFOA 2C0RA 2WKAA 3RQ1A 3MADA 5FT4A 3FZ7A 4XQ2A 3FDDA 3RUYA 1WYUA 4OTLA 4P7YA 3USFA 1AY8A 3TQXA 5C6UA 1AHYA 1MAQA 4HVKA 2EYQA 1LC5A 2TPLA 2YCNA 1JG8A 3ELPA 2R5CB 1LK9A 3NRAA 4XAUA 2AEVA 1AAWA 4MQQA 2CANA 1X0MA 2W7GA 3HQTA 4A0RA 3LG0A 4F5IA 2F8JA 3NYSA 1QITA 1B9HA 1TATA 2VGZA 4GE4A 2Z9VA 1W7MA 1BQAA 5TF5A 3PJ0A 4WP0A 3TFTA 5HXXA 1TOEA 2NMPA 2VGWA 1AMRA 3BCAA 2D7YA 2W7FA 2XBNA 4IXZA 4IYOA 1LC7A 2YKXA 2W8UA 4IXSA 2QB2A 5M49A 4ZM3A 2AY3A 1VP4A 1M0NA 3ZRRA 4ZAHA 3IHJA 1JS3A 3JWAA 3LVMA 4AO9A 1BS0A 4ZWVA 1TOGA 2BHXA 4NOGA 2D63A 3N0LA 3MC6A 5EAAA 2ZY4A 2EPJA 1GBNA 3GR9A 1DGEA 3H14A 5FT8A 2AATA 4Y0DA 4K2IA 4ZASA 3BC8A 1AMAA 3N5MA 3HL2A 2W7KA 1OATA 1M4NA 1ARIA 2ZSMA 1AHXA 1WYVA 1I41A 2ZYJA 3N75A 3M5UA 4OBVA 5EUNA 3WLXA 2OATA 4MY5A 3ASBA 1ARHA 3RBFA 2DR1A 3F0HA 2W7DA 4R5FA 1XEYA 2AY4A 2BYLA 4RIZA 3RI6A 3EZSA 1ELQA 2CH1A 3BCBA 4KAMA 3MKJA 3AV7A 3EZ1A 3F6TA 4MSOA 3HT4A 3MBBA 1MGVA 1YNUA 3AEJC 4GSAA 3NTJA 4AZKA 5BJ3A 1I29A 2AY7A 3FZ8A 3E2FA 4OYTA 4R2NA 4E3RA 3KGWA 5F8VA 4R8DA 2FKIA 3FD0A 4Q75A 1J04A 2CY8A 1V2DA 2X3LA 3E9KA 1DTYA 1ELUA 3DRDA 3RCHB 3AEMA 1QISA 2YOBA 4W1XA 3PAAA 1EG5A 3NU8A 4JF1A 4ZWMA 2BWPA 3NX3A 2VMZA 4E1OA 1C7NA 3BWNC 1UKJA 3ELEA 5DJ1A 4J8LA 3UE8A 4RKDA 3TATA 5KTBA 2VMQA 2ZUKA 4F4EA 1GC4A 1CL2A 1RV4A 2HP2A 1KL1A 3MAFA 2KFPA 3DODA 2VGSA 2HOZA 4L0OA 2YKYA 1M0QA 3A9YA 2BIAA 2QA3A 2WK8A 2W7IA 1H1CA 3PDBB 4W8IA 4GDYA 4GE7A 5FT6A 2BWOA 5G2QA 2JJFA 1WYVB 4XK1A 4BA5A 3N4RA 1BJNA 4ZSYA 4ADEA 2VMYA 1M32A 2Z61A 3QBOA 7AATA 4WB0A 1O4SA 3FVXA 4MKJA 1OHWA 4ADDA 4UHOA 1PFFA 4DGTA 3OKSA 1RVUA 3K28A 3QHXA 4OT8A 1ASLA 4P3MA 4AH3A 4AZJA 1QZ9A 5LHAA 1DJEA 1CQ7A 1W3UA 1X28A 4TN4A 4XJOA 2VMRA 3BS8A 4ADCA 1WSTA 2Z9WA 3QN6A 3K7YA 1O61A 3HMUA 3MAUA 4RJYA 4F5FA 1CL1A 3BV0A 3WGBA 3A9ZA 4UOYA 2BI5A 2HORA 2CSTA 4XEWA 3FRKA 2AY5A 3FQAA 1ASFA 1DKAA 3R4TA 5DX5A 2YHKA 1S06A 4A00A 4KXKA 1LKCA 4LNLA 3LVLB 5G4IA 1YAAA 2XH1A 4XJMA 5EFSA 1SF2A 1IAYA 3GBXA 2JJHA 3BCXA 4RITA 3GWPA 4UQVA 4ZSWA 2PO3A 3G0TA 3WX9A 4F5LA 3VK3A 1C7OA 4I8AA 4WYDA 1I43A 4M2MA 2FN6A 1GC0A 4ATPA 3NYTA 5G0AA 3LWSA 4UHMA 1M0OA 3B46A 3MAFB 1ZODA 3GZDC 3ASAA 4PFFA 4UHNA 3N4XA 1ZOBA 3EI7A 3E6GA 4LW2A 4MQRA 2DGMA 2VMNA 1FC4A 1IX7A 1ASBA 2BWNA 1Z3ZA 1AMSA 3E2YA 2YKVA 3PA9A 1UU1A 1SZUA 3BB8A 3R9AA 4ZDOA 2AY9A 2HOYA 1OHVA 4WB0B 3EIAA 4ITXA 3RCHA 3EIBA 4OCAA 4CBRA 4K2MA 4HF8A 4GRXA 2RFVA 3DXVA 1X29A 5F9SA 1GD9A 1J32A 4WYGA 1WYTB 4JF0A 3WGCA 1ARTA 2ZY5A 2VMXA 4WLHA 3FVSA 1EQBA 1FG7A 4W1VA 2HUIA 4A6RA 1YOOA 3ACZA 4EB5A 1W23A 4WXGA 3ZZJA 1AJRA 3JU7A 3LY1A 1YJZA 2WB6A 1QIRA 1SVVA 3ATHA 1GEXA 1S07A 3E2ZA 1MLZA 5LH9A 3QI6A 1C9CA 3W1JA 2O0RA 3AOWA 3EI6A 3GJUA 3PDBA 4Q31A 1KAFA 3ZZKA 4EU1A 1IUGA 3I16A 1CZEA 2BI3A 4A6UA 3FKDA 4RKCA 2X5DA 3P1TA 2AY2A 2BIEA 4JEZA 3WZFA 1FG3A 1CJ0A 1I48A 2GQNA 5E4ZA 1V2FA 2VMUA 2Z20A 1GC3A 1MAPA 2EH6A 1B9IA 4JE5A 4ZDLA 1ZC9A 2QLRA 1AX4A 2PB2A 3K40A 3NUIA 4Y0IA 4TMRA 2Z1YA 2G7JA 2E54A 3PIUA 5FT5A 2VMWA 3D6KA 1ASDA 4PVFA 3H9XA 5EQCA 1GC2A 2E7IA 3W1HA 3JZLA 5HHYA 3AATA 4PIWA 4B98A 1G7XA 4GE9A 4WLJA 4ZDPA 2QSRA 3P6KA 4OBUA 3AOVA 1TPLA 5D5SA 3MC6C 1CQ6A 1M6SA 3DXWA 2D5YA 1S09A 3KKIA 1AHEA 3L8AA 1AKBA 4MKKA 1C4KA 2GMUA 4KYOA 4WYEA 2JG2A 3JW9A 2BIGA 1N2TA 1T3IA 1ARGA 2ZJGA 1AY5A 2WK9A 1GEWA 1ASEA 4RAEA 2CB1A 2Z1ZA 3Q8NA 2HZPA 4N0WA 2YRRA 2WK7A 4RLGA 4H63Q 5EAVA 5I92A 1D7VA 2CTZA 4GEBA 3E2ZB 2C44A 2D7ZA 3JWBA 2X5FA 2JISA 2VMPA 4JEYA 2ZSLA 4M2KA 2VLFA 4Y0HA 2W7MA 2VLHA 4PFNA 5HDMA 2O7CA 3A9XA 5M4BA 1BT4A 4W1WA 3QPGA 2EO5A 1BW0A
chains in the Genus database with same CATH topology
3PDXA 1G4VA 4EFFA 3LV2A 2QBTA 3WCOA 1AHGA 1BKGA 1IJIA 1DJ9A 1PMMA 1M7YA 1QGNA 3GETA 1RVYA 4WBTA 3RBLA 3T32A 4F5HA 2X8UA 3B1EA 3CQ6A 3FCRA 1MLYA 3E77A 2VYCA 1EJIA 1WYTA 2BYJA 3AEMC 3KE3A 2EZ2A 1OXOA 5DJ9A 2VMTA 3DR7A 2AY8A 3CBFA 3II0A 1DGDA 4JEVA 4U2HA 3BN1A 4WXFA 1UU2A 4OMAA 1YJYA 1BJOA 1TASA 3CQ5A 3FVUA 1ASCA 1B5PA 2G6WA 5K8BA 5JAYA 1RV3A 3WKRA 1D7RA 2AY6A 2QMAA 1PG8A 2V0YA 4M2JA 3VK2A 4WXBA 2HUFA 1KMJA 2R0TA 3AENB 4OC9A 1YIYA 1V72A 1IBJA 1ECXA 4LNJA 4WYAA 4BA4A 5G09A 1OHYA 3GZDA 3N7NA 4A0GA 2BKWA 1KKPA 3I4JA 4DBCA 1Y4IA 4E3QA 4F5MA 5J8QA 3F9TA 3VP6A 2DOUA 4MGRA 2EZ1A 4EMYA 1BJWA 1AJSA 1G7WA 4BHDA 1AKCA 2VIBA 1AMQA 4F5GA 2PB0A 1U08A 2CFBA 3G7QA 3AELA 2GMSA 3L44A 3DZZA 4W5KA 1KMKA 1N31A 2OQXA 3DU4A 4B9BA 4FL0A 1D2FA 1W7NA 4RM1A 2FQ6A 1MDOA 2GSAA 3AEPA 2Q7WA 2AY1A 1GCKA 1D7UA 1CQ8A 2EGYA 4AO4A 1YJSA 1GEYA 2W8JA 5M46A 4U1TA 3MEBA 2ZC0A 2CJHA 3ZRPA 4ZM4A 1C7GA 1OXPA 2W8TA 5G4JA 2OGAA 2GB3A 1LW4A 4JE5D 4DQ6A 1SZSA 2A1VA 1ASGA 1LC8A 3UAKA 4CXRA 4R5ZA 2ZY3A 4N0BA 1V2EA 1VEFA 2HOXA 1GDEA 2V1PA 2VGUA 4Q76A 3PD6A 2ORDA 4FFCA 1BJOB 2ZP7A 4O6ZA 2O1BA 3FSLA 4LC3A 4QGRA 3B8XA 4XJPA 4ITGA 3ECDA 8AATA 1X2AA 3LVJA 4JEWA 1ORDA 5EUEA 2DKJA 4CXQA 2HUUA 1D7SA 1ASAA 1N8PA 3A2BA 1QJ3A 3AEJA 1H0CA 1TOKA 2CJGA 3HBXA 5EUDA 4WYFA 1IAXA 3IF2A 2D61A 2CINA 3UWCA 2YCPA 3DR4A 2VMOA 1AJSB 2BI1A 1ARSA 2VIAA 1W7LA 2R2NA 1TOIA 3B1CA 4LW4A 1SZKA 3G8MA 2Z67A 3GZCA 1AICA 5DB5A 5EIGA 4A0FA 1KL2A 2FM1A 2BI2A 2VI8A 1SPAA 3BWNA 1IX8A 4TV7A 1LS3A 1AHFA 3NUBA 4ATQA 4K2BA 3WKSA 2D66A 3JTXA 2W7LA 1AAMA 2AEUA 3AENA 4J5UA 4MQPA 1WYUB 2YCTA 3EI5A 2W7HA 1CZCA 1S08A 1XI9A 1ASNA 4IY7A 2VMVA 3TCMA 1CS1A 3HVYA 1MDZA 1AY4A 3DYDA 2JJGA 3QGUA 4H51A 2OGEA 2QB3A 2BI9A 3HLMA 3NU7A 2C7TA 2VI9A 4CBSA 4BQ0A 3PD6B 5AX8A 2ZY2A 1E5EA 1Z7DA 3GSBA 3FDBA 3NYUA 2VGTA 1BQDA 2JJEA 3A8UX 4K05A 2FYFA 3TFUA 1MDXA 1SFFA 5E5IA 3ISLA 4ADBA 2CJDA 2OKKA 4JEXA 4A72A 3VK4A 4F5JA 1P3WA 1G4XA 2YRIA 1C0NA 2JGTA 1TARA 1AIAA 2VMSA 3NNKA 4IYOB 3COGA 3DC1A 3LVKA 3PGYA 3BWOA 1E5FA 2E7JA 1AIBA 3HDOA 5IWQA 1IX6A 3VOMA 3FQ7A 4A6TA 5M4DA 4IXOA 3ZRQA 4RJ0A 1WKGA 3AEOA 4Q6RA 5G2PA 1ASMA 3I5TA 3OP7A 2FNUA 2R5CA 5EIGB 1B5OA 3KGXA 2DGKA 3CAIA 4IX8A 2VGVA 1AKAA 2R5EA 3EI9A 2D65A 1JF9A 4E77A 1QJ5A 4W91A 4A0HA 2D64A 3FZ6A 1B4XA 5D95A 9AATA 3NDNA 5BJ4A 5E3KA 2E7UA 4IW7A 1B8GA 3FTBA 1UU0A 1BJ4A 2FNIA 2DGLA 2DKBA 2OKJA 3FFRA 3PPLA 3H7FA 1VJOA 4ISYA 4WYCA 4EB7A 1JS6A 4ZLVA 2W8WA 3W1IA 3N4SA 4CVQA 3EI8A 1LW5A 3QM2A 3WY7A 1O62A 2Z9XA 3VAXA 1TOJA 2W7JA 2C81A 4WD2A 4XJLA 2HP1A 3FFHA 2W8VA 2W7EA 4F5KA 1PMOA 1DJUA 1O69A 4LNMA 1S0AA 3EUCA 2Z9UA 3B1DA 4BMKA 3WCNA 1M0PA 3CQ4A 2CH2A 1KKJA 1WKHA 1YIZA 2YKUA 1IVRA 3FQ8A 4AOAA 1DFOA 2C0RA 2WKAA 3RQ1A 3MADA 5FT4A 3FZ7A 4XQ2A 3FDDA 3RUYA 1WYUA 4OTLA 4P7YA 3USFA 1AY8A 3TQXA 5C6UA 1AHYA 1MAQA 4HVKA 2EYQA 1LC5A 2TPLA 2YCNA 1JG8A 3ELPA 2R5CB 1LK9A 3NRAA 4XAUA 2AEVA 1AAWA 4MQQA 2CANA 1X0MA 2W7GA 3HQTA 4A0RA 3LG0A 4F5IA 2F8JA 3NYSA 1QITA 1B9HA 1TATA 2VGZA 4GE4A 2Z9VA 1W7MA 1BQAA 5TF5A 3PJ0A 4WP0A 3TFTA 5HXXA 1TOEA 2NMPA 2VGWA 1AMRA 3BCAA 2D7YA 2W7FA 2XBNA 4IXZA 4IYOA 1LC7A 2YKXA 2W8UA 4IXSA 2QB2A 5M49A 4ZM3A 2AY3A 1VP4A 1M0NA 3ZRRA 4ZAHA 3IHJA 1JS3A 3JWAA 3LVMA 4AO9A 1BS0A 4ZWVA 1TOGA 2BHXA 4NOGA 2D63A 3N0LA 3MC6A 5EAAA 2ZY4A 2EPJA 1GBNA 3GR9A 1DGEA 3H14A 5FT8A 2AATA 4Y0DA 4K2IA 4ZASA 3BC8A 1AMAA 3N5MA 3HL2A 2W7KA 1OATA 1M4NA 1ARIA 2ZSMA 1AHXA 1WYVA 1I41A 2ZYJA 3N75A 3M5UA 4OBVA 5EUNA 3WLXA 2OATA 4MY5A 3ASBA 1ARHA 3RBFA 2DR1A 3F0HA 2W7DA 4R5FA 1XEYA 2AY4A 2BYLA 4RIZA 3RI6A 3EZSA 1ELQA 2CH1A 3BCBA 4KAMA 3MKJA 3AV7A 3EZ1A 3F6TA 4MSOA 3HT4A 3MBBA 1MGVA 1YNUA 3AEJC 4GSAA 3NTJA 4AZKA 5BJ3A 1I29A 2AY7A 3FZ8A 3E2FA 4OYTA 4R2NA 4E3RA 3KGWA 5F8VA 4R8DA 2FKIA 3FD0A 4Q75A 1J04A 2CY8A 1V2DA 2X3LA 3E9KA 1DTYA 1ELUA 3DRDA 3RCHB 3AEMA 1QISA 2YOBA 4W1XA 3PAAA 1EG5A 3NU8A 4JF1A 4ZWMA 2BWPA 3NX3A 2VMZA 4E1OA 1C7NA 3BWNC 1UKJA 3ELEA 5DJ1A 4J8LA 3UE8A 4RKDA 3TATA 5KTBA 2VMQA 2ZUKA 4F4EA 1GC4A 1CL2A 1RV4A 2HP2A 1KL1A 3MAFA 2KFPA 3DODA 2VGSA 2HOZA 4L0OA 2YKYA 1M0QA 3A9YA 2BIAA 2QA3A 2WK8A 2W7IA 1H1CA 3PDBB 4W8IA 4GDYA 4GE7A 5FT6A 2BWOA 5G2QA 2JJFA 1WYVB 4XK1A 4BA5A 3N4RA 1BJNA 4ZSYA 4ADEA 2VMYA 1M32A 2Z61A 3QBOA 7AATA 4WB0A 1O4SA 3FVXA 4MKJA 1OHWA 4ADDA 4UHOA 1PFFA 4DGTA 3OKSA 1RVUA 3K28A 3QHXA 4OT8A 1ASLA 4P3MA 4AH3A 4AZJA 1QZ9A 5LHAA 1DJEA 1CQ7A 1W3UA 1X28A 4TN4A 4XJOA 2VMRA 3BS8A 4ADCA 1WSTA 2Z9WA 3QN6A 3K7YA 1O61A 3HMUA 3MAUA 4RJYA 4F5FA 1CL1A 3BV0A 3WGBA 3A9ZA 4UOYA 2BI5A 2HORA 2CSTA 4XEWA 3FRKA 2AY5A 3FQAA 1ASFA 1DKAA 3R4TA 5DX5A 2YHKA 1S06A 4A00A 4KXKA 1LKCA 4LNLA 3LVLB 5G4IA 1YAAA 2XH1A 4XJMA 5EFSA 1SF2A 1IAYA 3GBXA 2JJHA 3BCXA 4RITA 3GWPA 4UQVA 4ZSWA 2PO3A 3G0TA 3WX9A 4F5LA 3VK3A 1C7OA 4I8AA 4WYDA 1I43A 4M2MA 2FN6A 1GC0A 4ATPA 3NYTA 5G0AA 3LWSA 4UHMA 1M0OA 3B46A 3MAFB 1ZODA 3GZDC 3ASAA 4PFFA 4UHNA 3N4XA 1ZOBA 3EI7A 3E6GA 4LW2A 4MQRA 2DGMA 2VMNA 1FC4A 1IX7A 1ASBA 2BWNA 1Z3ZA 1AMSA 3E2YA 2YKVA 3PA9A 1UU1A 1SZUA 3BB8A 3R9AA 4ZDOA 2AY9A 2HOYA 1OHVA 4WB0B 3EIAA 4ITXA 3RCHA 3EIBA 4OCAA 4CBRA 4K2MA 4HF8A 4GRXA 2RFVA 3DXVA 1X29A 5F9SA 1GD9A 1J32A 4WYGA 1WYTB 4JF0A 3WGCA 1ARTA 2ZY5A 2VMXA 4WLHA 3FVSA 1EQBA 1FG7A 4W1VA 2HUIA 4A6RA 1YOOA 3ACZA 4EB5A 1W23A 4WXGA 3ZZJA 1AJRA 3JU7A 3LY1A 1YJZA 2WB6A 1QIRA 1SVVA 3ATHA 1GEXA 1S07A 3E2ZA 1MLZA 5LH9A 3QI6A 1C9CA 3W1JA 2O0RA 3AOWA 3EI6A 3GJUA 3PDBA 4Q31A 3ZZKA 4EU1A 1IUGA 3I16A 1CZEA 2BI3A 4A6UA 3FKDA 4RKCA 2X5DA 3P1TA 2AY2A 2BIEA 4JEZA 3WZFA 1FG3A 1CJ0A 1I48A 2GQNA 5E4ZA 1V2FA 2VMUA 2Z20A 1GC3A 1MAPA 2EH6A 1B9IA 4JE5A 4ZDLA 1ZC9A 2QLRA 1AX4A 2PB2A 3K40A 3NUIA 4Y0IA 4TMRA 2Z1YA 2G7JA 2E54A 3PIUA 5FT5A 2VMWA 3D6KA 1ASDA 4PVFA 3H9XA 5EQCA 1GC2A 2E7IA 3W1HA 3JZLA 5HHYA 3AATA 4PIWA 4B98A 1G7XA 4GE9A 4WLJA 4ZDPA 2QSRA 3P6KA 4OBUA 3AOVA 1TPLA 5D5SA 3MC6C 1CQ6A 1M6SA 3DXWA 2D5YA 1S09A 3KKIA 1AHEA 3L8AA 1AKBA 4MKKA 1C4KA 2GMUA 4KYOA 4WYEA 2JG2A 3JW9A 2BIGA 1N2TA 1T3IA 1ARGA 2ZJGA 1AY5A 2WK9A 1GEWA 1ASEA 4RAEA 2CB1A 2Z1ZA 3Q8NA 2HZPA 4N0WA 2YRRA 2WK7A 4RLGA 4H63Q 5EAVA 5I92A 1D7VA 2CTZA 4GEBA 3E2ZB 2C44A 2D7ZA 3JWBA 2X5FA 2JISA 2VMPA 4JEYA 2ZSLA 4M2KA 2VLFA 4Y0HA 2W7MA 2VLHA 4PFNA 5HDMA 2O7CA 3A9XA 5M4BA 1BT4A 4W1WA 3QPGA 2EO5A 1BW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDX A;  1G4V A;  4EFF A;  3LV2 A;  2QBT A;  3WCO A;  1AHG A;  1BKG A;  1IJI A;  1DJ9 A;  1PMM A;  1M7Y A;  1QGN A;  3GET A;  1RVY A;  4WBT A;  3RBL A;  3T32 A;  4F5H A;  2X8U A;  3B1E A;  3CQ6 A;  3FCR A;  1MLY A;  3E77 A;  2VYC A;  1EJI A;  1WYT A;  2BYJ A;  3AEM C;  3KE3 A;  2EZ2 A;  1OXO A;  5DJ9 A;  2VMT A;  3DR7 A;  2AY8 A;  3CBF A;  3II0 A;  1DGD A;  4JEV A;  4U2H A;  3BN1 A;  4WXF A;  1UU2 A;  4OMA A;  1YJY A;  1BJO A;  1TAS A;  3CQ5 A;  3FVU A;  1ASC A;  1B5P A;  2G6W A;  5K8B A;  5JAY A;  1RV3 A;  3WKR A;  1D7R A;  2AY6 A;  2QMA A;  1PG8 A;  2V0Y A;  4M2J A;  3VK2 A;  4WXB A;  2HUF A;  1KMJ A;  2R0T A;  3AEN B;  4OC9 A;  1YIY A;  1V72 A;  1IBJ A;  1ECX A;  4LNJ A;  4WYA A;  4BA4 A;  5G09 A;  1OHY A;  3GZD A;  4A0G A;  2BKW A;  1KKP A;  3I4J A;  4DBC A;  1Y4I A;  4E3Q A;  4F5M A;  5J8Q A;  3F9T A;  3VP6 A;  2DOU A;  4MGR A;  2EZ1 A;  4EMY A;  1BJW A;  1AJS A;  1G7W A;  4BHD A;  1AKC A;  2VIB A;  1AMQ A;  4F5G A;  2PB0 A;  1U08 A;  2CFB A;  3G7Q A;  3AEL A;  2GMS A;  3L44 A;  3DZZ A;  4W5K A;  1KMK A;  1N31 A;  2OQX A;  3DU4 A;  4B9B A;  4FL0 A;  1D2F A;  1W7N A;  4RM1 A;  2FQ6 A;  1MDO A;  2GSA A;  3AEP A;  2Q7W A;  2AY1 A;  1GCK A;  1D7U A;  1CQ8 A;  2EGY A;  4AO4 A;  1YJS A;  1GEY A;  2W8J A;  5M46 A;  4U1T A;  3MEB A;  2ZC0 A;  2CJH A;  3ZRP A;  4ZM4 A;  1C7G A;  1OXP A;  2W8T A;  5G4J A;  2OGA A;  2GB3 A;  1LW4 A;  4JE5 D;  4DQ6 A;  1SZS A;  1ASG A;  1LC8 A;  3UAK A;  4CXR A;  4R5Z A;  2ZY3 A;  4N0B A;  1V2E A;  1VEF A;  2HOX A;  1GDE A;  2V1P A;  2VGU A;  4Q76 A;  3PD6 A;  2ORD A;  4FFC A;  1BJO B;  2ZP7 A;  4O6Z A;  2O1B A;  3FSL A;  4LC3 A;  4QGR A;  3B8X A;  4XJP A;  4ITG A;  3ECD A;  8AAT A;  1X2A A;  3LVJ A;  4JEW A;  1ORD A;  5EUE A;  2DKJ A;  4CXQ A;  2HUU A;  1D7S A;  1ASA A;  1N8P A;  3A2B A;  1QJ3 A;  3AEJ A;  1H0C A;  1TOK A;  2CJG A;  3HBX A;  5EUD A;  4WYF A;  1IAX A;  3IF2 A;  2D61 A;  2CIN A;  3UWC A;  2YCP A;  3DR4 A;  2VMO A;  1AJS B;  2BI1 A;  1ARS A;  2VIA A;  1W7L A;  2R2N A;  1TOI A;  3B1C A;  4LW4 A;  1SZK A;  3G8M A;  2Z67 A;  3GZC A;  1AIC A;  5DB5 A;  5EIG A;  4A0F A;  1KL2 A;  2FM1 A;  2BI2 A;  2VI8 A;  1SPA A;  3BWN A;  1IX8 A;  4TV7 A;  1LS3 A;  1AHF A;  3NUB A;  4ATQ A;  4K2B A;  3WKS A;  2D66 A;  3JTX A;  2W7L A;  1AAM A;  2AEU A;  3AEN A;  4J5U A;  4MQP A;  1WYU B;  2YCT A;  3EI5 A;  2W7H A;  1CZC A;  1S08 A;  1XI9 A;  1ASN A;  4IY7 A;  2VMV A;  3TCM A;  1CS1 A;  3HVY A;  1MDZ A;  1AY4 A;  3DYD A;  2JJG A;  3QGU A;  4H51 A;  2OGE A;  2QB3 A;  2BI9 A;  3HLM A;  3NU7 A;  2C7T A;  2VI9 A;  4CBS A;  4BQ0 A;  3PD6 B;  5AX8 A;  2ZY2 A;  1E5E A;  1Z7D A;  3GSB A;  3FDB A;  3NYU A;  2VGT A;  1BQD A;  2JJE A;  3A8U X;  2FYF A;  3TFU A;  1MDX A;  1SFF A;  5E5I A;  3ISL A;  4ADB A;  2CJD A;  2OKK A;  4JEX A;  4A72 A;  3VK4 A;  4F5J A;  1P3W A;  1G4X A;  2YRI A;  1C0N A;  2JGT A;  1TAR A;  1AIA A;  2VMS A;  3NNK A;  4IYO B;  3COG A;  3DC1 A;  3LVK A;  3PGY A;  3BWO A;  1E5F A;  2E7J A;  1AIB A;  3HDO A;  5IWQ A;  1IX6 A;  3VOM A;  3FQ7 A;  4A6T A;  5M4D A;  4IXO A;  3ZRQ A;  4RJ0 A;  1WKG A;  3AEO A;  4Q6R A;  5G2P A;  1ASM A;  3I5T A;  3OP7 A;  2FNU A;  2R5C A;  5EIG B;  1B5O A;  3KGX A;  2DGK A;  3CAI A;  4IX8 A;  2VGV A;  1AKA A;  2R5E A;  3EI9 A;  2D65 A;  1JF9 A;  4E77 A;  1QJ5 A;  4W91 A;  4A0H A;  2D64 A;  3FZ6 A;  1B4X A;  5D95 A;  9AAT A;  3NDN A;  5BJ4 A;  5E3K A;  2E7U A;  4IW7 A;  1B8G A;  3FTB A;  1UU0 A;  1BJ4 A;  2FNI A;  2DGL A;  2DKB A;  2OKJ A;  3FFR A;  3PPL A;  3H7F A;  1VJO A;  4ISY A;  4WYC A;  4EB7 A;  1JS6 A;  4ZLV A;  2W8W A;  3W1I A;  4CVQ A;  3EI8 A;  1LW5 A;  3QM2 A;  3WY7 A;  1O62 A;  2Z9X A;  3VAX A;  1TOJ A;  2W7J A;  2C81 A;  4WD2 A;  4XJL A;  2HP1 A;  3FFH A;  2W8V A;  2W7E A;  4F5K A;  1PMO A;  1DJU A;  1O69 A;  4LNM A;  1S0A A;  3EUC A;  2Z9U A;  3B1D A;  4BMK A;  3WCN A;  1M0P A;  3CQ4 A;  2CH2 A;  1KKJ A;  1WKH A;  1YIZ A;  2YKU A;  1IVR A;  3FQ8 A;  4AOA A;  1DFO A;  2C0R A;  2WKA A;  3RQ1 A;  3MAD A;  5FT4 A;  3FZ7 A;  4XQ2 A;  3FDD A;  3RUY A;  1WYU A;  4OTL A;  4P7Y A;  3USF A;  1AY8 A;  3TQX A;  5C6U A;  1AHY A;  1MAQ A;  4HVK A;  1LC5 A;  2TPL A;  2YCN A;  1JG8 A;  3ELP A;  2R5C B;  1LK9 A;  3NRA A;  4XAU A;  2AEV A;  1AAW A;  4MQQ A;  2CAN A;  1X0M A;  2W7G A;  3HQT A;  4A0R A;  3LG0 A;  4F5I A;  2F8J A;  3NYS A;  1QIT A;  1B9H A;  1TAT A;  2VGZ A;  4GE4 A;  2Z9V A;  1W7M A;  1BQA A;  5TF5 A;  3PJ0 A;  4WP0 A;  3TFT A;  5HXX A;  1TOE A;  2NMP A;  2VGW A;  1AMR A;  3BCA A;  2D7Y A;  2W7F A;  2XBN A;  4IXZ A;  4IYO A;  1LC7 A;  2YKX A;  2W8U A;  4IXS A;  2QB2 A;  5M49 A;  4ZM3 A;  2AY3 A;  1VP4 A;  1M0N A;  3ZRR A;  4ZAH A;  3IHJ A;  1JS3 A;  3JWA A;  3LVM A;  4AO9 A;  1BS0 A;  4ZWV A;  1TOG A;  2BHX A;  4NOG A;  2D63 A;  3N0L A;  3MC6 A;  5EAA A;  2ZY4 A;  2EPJ A;  1GBN A;  3GR9 A;  1DGE A;  3H14 A;  5FT8 A;  2AAT A;  4Y0D A;  4K2I A;  4ZAS A;  3BC8 A;  1AMA A;  3N5M A;  3HL2 A;  2W7K A;  1OAT A;  1M4N A;  1ARI A;  2ZSM A;  1AHX A;  1WYV A;  1I41 A;  2ZYJ A;  3N75 A;  3M5U A;  4OBV A;  5EUN A;  3WLX A;  2OAT A;  4MY5 A;  3ASB A;  1ARH A;  3RBF A;  2DR1 A;  3F0H A;  2W7D A;  4R5F A;  1XEY A;  2AY4 A;  2BYL A;  4RIZ A;  3RI6 A;  3EZS A;  1ELQ A;  2CH1 A;  3BCB A;  4KAM A;  3MKJ A;  3AV7 A;  3EZ1 A;  3F6T A;  4MSO A;  3HT4 A;  3MBB A;  1MGV A;  1YNU A;  3AEJ C;  4GSA A;  3NTJ A;  4AZK A;  5BJ3 A;  1I29 A;  2AY7 A;  3FZ8 A;  3E2F A;  4OYT A;  4R2N A;  4E3R A;  3KGW A;  5F8V A;  4R8D A;  3FD0 A;  4Q75 A;  1J04 A;  2CY8 A;  1V2D A;  2X3L A;  3E9K A;  1DTY A;  1ELU A;  3DRD A;  3RCH B;  3AEM A;  1QIS A;  2YOB A;  4W1X A;  3PAA A;  1EG5 A;  3NU8 A;  4JF1 A;  4ZWM A;  2BWP A;  3NX3 A;  2VMZ A;  4E1O A;  1C7N A;  3BWN C;  1UKJ A;  3ELE A;  5DJ1 A;  4J8L A;  3UE8 A;  4RKD A;  3TAT A;  2VMQ A;  2ZUK A;  4F4E A;  1GC4 A;  1CL2 A;  1RV4 A;  2HP2 A;  1KL1 A;  3MAF A;  3DOD A;  2VGS A;  2HOZ A;  4L0O A;  2YKY A;  1M0Q A;  3A9Y A;  2BIA A;  2QA3 A;  2WK8 A;  2W7I A;  1H1C A;  3PDB B;  4W8I A;  4GDY A;  4GE7 A;  5FT6 A;  2BWO A;  5G2Q A;  2JJF A;  1WYV B;  4XK1 A;  4BA5 A;  1BJN A;  4ZSY A;  4ADE A;  2VMY A;  1M32 A;  2Z61 A;  3QBO A;  7AAT A;  4WB0 A;  1O4S A;  3FVX A;  4MKJ A;  1OHW A;  4ADD A;  4UHO A;  1PFF A;  4DGT A;  3OKS A;  1RVU A;  3K28 A;  3QHX A;  4OT8 A;  1ASL A;  4P3M A;  4AH3 A;  4AZJ A;  1QZ9 A;  5LHA A;  1DJE A;  1CQ7 A;  1W3U A;  1X28 A;  4TN4 A;  4XJO A;  2VMR A;  3BS8 A;  4ADC A;  1WST A;  2Z9W A;  3QN6 A;  3K7Y A;  1O61 A;  3HMU A;  3MAU A;  4RJY A;  4F5F A;  1CL1 A;  3BV0 A;  3WGB A;  3A9Z A;  4UOY A;  2BI5 A;  2HOR A;  2CST A;  4XEW A;  3FRK A;  2AY5 A;  3FQA A;  1ASF A;  1DKA A;  3R4T A;  5DX5 A;  2YHK A;  1S06 A;  4A00 A;  4KXK A;  1LKC A;  4LNL A;  3LVL B;  5G4I A;  1YAA A;  2XH1 A;  4XJM A;  5EFS A;  1SF2 A;  1IAY A;  3GBX A;  2JJH A;  3BCX A;  4RIT A;  3GWP A;  4UQV A;  4ZSW A;  2PO3 A;  3G0T A;  3WX9 A;  4F5L A;  3VK3 A;  1C7O A;  4I8A A;  4WYD A;  1I43 A;  4M2M A;  2FN6 A;  1GC0 A;  4ATP A;  3NYT A;  5G0A A;  3LWS A;  4UHM A;  1M0O A;  3B46 A;  3MAF B;  1ZOD A;  3GZD C;  3ASA A;  4PFF A;  4UHN A;  1ZOB A;  3EI7 A;  3E6G A;  4LW2 A;  4MQR A;  2DGM A;  2VMN A;  1FC4 A;  1IX7 A;  1ASB A;  2BWN A;  1Z3Z A;  1AMS A;  3E2Y A;  2YKV A;  3PA9 A;  1UU1 A;  1SZU A;  3BB8 A;  3R9A A;  4ZDO A;  2AY9 A;  2HOY A;  1OHV A;  4WB0 B;  3EIA A;  4ITX A;  3RCH A;  3EIB A;  4OCA A;  4CBR A;  4K2M A;  4HF8 A;  4GRX A;  2RFV A;  3DXV A;  1X29 A;  5F9S A;  1GD9 A;  1J32 A;  4WYG A;  1WYT B;  4JF0 A;  3WGC A;  1ART A;  2ZY5 A;  2VMX A;  4WLH A;  3FVS A;  1EQB A;  1FG7 A;  4W1V A;  2HUI A;  4A6R A;  1YOO A;  3ACZ A;  4EB5 A;  1W23 A;  4WXG A;  3ZZJ A;  1AJR A;  3JU7 A;  3LY1 A;  1YJZ A;  1QIR A;  1SVV A;  3ATH A;  1GEX A;  1S07 A;  3E2Z A;  1MLZ A;  5LH9 A;  3QI6 A;  1C9C A;  3W1J A;  2O0R A;  3AOW A;  3EI6 A;  3GJU A;  3PDB A;  4Q31 A;  3ZZK A;  4EU1 A;  1IUG A;  3I16 A;  1CZE A;  2BI3 A;  4A6U A;  3FKD A;  4RKC A;  2X5D A;  3P1T A;  2AY2 A;  2BIE A;  4JEZ A;  3WZF A;  1FG3 A;  1CJ0 A;  1I48 A;  2GQN A;  5E4Z A;  1V2F A;  2VMU A;  2Z20 A;  1GC3 A;  1MAP A;  2EH6 A;  1B9I A;  4JE5 A;  4ZDL A;  1ZC9 A;  2QLR A;  1AX4 A;  2PB2 A;  3K40 A;  3NUI A;  4Y0I A;  4TMR A;  2Z1Y A;  2E54 A;  3PIU A;  5FT5 A;  2VMW A;  3D6K A;  1ASD A;  4PVF A;  5EQC A;  1GC2 A;  2E7I A;  3W1H A;  3JZL A;  5HHY A;  3AAT A;  4PIW A;  4B98 A;  1G7X A;  4GE9 A;  4WLJ A;  4ZDP A;  3P6K A;  4OBU A;  3AOV A;  1TPL A;  5D5S A;  3MC6 C;  1CQ6 A;  1M6S A;  3DXW A;  2D5Y A;  1S09 A;  3KKI A;  1AHE A;  3L8A A;  1AKB A;  4MKK A;  1C4K A;  2GMU A;  4KYO A;  4WYE A;  2JG2 A;  3JW9 A;  2BIG A;  1N2T A;  1T3I A;  1ARG A;  2ZJG A;  1AY5 A;  2WK9 A;  1GEW A;  1ASE A;  4RAE A;  2CB1 A;  2Z1Z A;  3Q8N A;  2HZP A;  4N0W A;  2YRR A;  2WK7 A;  4RLG A;  5EAV A;  5I92 A;  1D7V A;  2CTZ A;  4GEB A;  3E2Z B;  2C44 A;  2D7Z A;  3JWB A;  2X5F A;  2JIS A;  2VMP A;  4JEY A;  2ZSL A;  4M2K A;  2VLF A;  4Y0H A;  2W7M A;  2VLH A;  4PFN A;  5HDM A;  2O7C A;  3A9X A;  5M4B A;  1BT4 A;  4W1W A;  3QPG A;  2EO5 A;  1BW0 A; 
#chains in the Genus database with same CATH topology
 3PDX A;  1G4V A;  4EFF A;  3LV2 A;  2QBT A;  3WCO A;  1AHG A;  1BKG A;  1IJI A;  1DJ9 A;  1PMM A;  1M7Y A;  1QGN A;  3GET A;  1RVY A;  4WBT A;  3RBL A;  3T32 A;  4F5H A;  2X8U A;  3B1E A;  3CQ6 A;  3FCR A;  1MLY A;  3E77 A;  2VYC A;  1EJI A;  1WYT A;  2BYJ A;  3AEM C;  3KE3 A;  2EZ2 A;  1OXO A;  5DJ9 A;  2VMT A;  3DR7 A;  2AY8 A;  3CBF A;  3II0 A;  1DGD A;  4JEV A;  4U2H A;  3BN1 A;  4WXF A;  1UU2 A;  4OMA A;  1YJY A;  1BJO A;  1TAS A;  3CQ5 A;  3FVU A;  1ASC A;  1B5P A;  2G6W A;  5K8B A;  5JAY A;  1RV3 A;  3WKR A;  1D7R A;  2AY6 A;  2QMA A;  1PG8 A;  2V0Y A;  4M2J A;  3VK2 A;  4WXB A;  2HUF A;  1KMJ A;  2R0T A;  3AEN B;  4OC9 A;  1YIY A;  1V72 A;  1IBJ A;  1ECX A;  4LNJ A;  4WYA A;  4BA4 A;  5G09 A;  1OHY A;  3GZD A;  3N7N A;  4A0G A;  2BKW A;  1KKP A;  3I4J A;  4DBC A;  1Y4I A;  4E3Q A;  4F5M A;  5J8Q A;  3F9T A;  3VP6 A;  2DOU A;  4MGR A;  2EZ1 A;  4EMY A;  1BJW A;  1AJS A;  1G7W A;  4BHD A;  1AKC A;  2VIB A;  1AMQ A;  4F5G A;  2PB0 A;  1U08 A;  2CFB A;  3G7Q A;  3AEL A;  2GMS A;  3L44 A;  3DZZ A;  4W5K A;  1KMK A;  1N31 A;  2OQX A;  3DU4 A;  4B9B A;  4FL0 A;  1D2F A;  1W7N A;  4RM1 A;  2FQ6 A;  1MDO A;  2GSA A;  3AEP A;  2Q7W A;  2AY1 A;  1GCK A;  1D7U A;  1CQ8 A;  2EGY A;  4AO4 A;  1YJS A;  1GEY A;  2W8J A;  5M46 A;  4U1T A;  3MEB A;  2ZC0 A;  2CJH A;  3ZRP A;  4ZM4 A;  1C7G A;  1OXP A;  2W8T A;  5G4J A;  2OGA A;  2GB3 A;  1LW4 A;  4JE5 D;  4DQ6 A;  1SZS A;  2A1V A;  1ASG A;  1LC8 A;  3UAK A;  4CXR A;  4R5Z A;  2ZY3 A;  4N0B A;  1V2E A;  1VEF A;  2HOX A;  1GDE A;  2V1P A;  2VGU A;  4Q76 A;  3PD6 A;  2ORD A;  4FFC A;  1BJO B;  2ZP7 A;  4O6Z A;  2O1B A;  3FSL A;  4LC3 A;  4QGR A;  3B8X A;  4XJP A;  4ITG A;  3ECD A;  8AAT A;  1X2A A;  3LVJ A;  4JEW A;  1ORD A;  5EUE A;  2DKJ A;  4CXQ A;  2HUU A;  1D7S A;  1ASA A;  1N8P A;  3A2B A;  1QJ3 A;  3AEJ A;  1H0C A;  1TOK A;  2CJG A;  3HBX A;  5EUD A;  4WYF A;  1IAX A;  3IF2 A;  2D61 A;  2CIN A;  3UWC A;  2YCP A;  3DR4 A;  2VMO A;  1AJS B;  2BI1 A;  1ARS A;  2VIA A;  1W7L A;  2R2N A;  1TOI A;  3B1C A;  4LW4 A;  1SZK A;  3G8M A;  2Z67 A;  3GZC A;  1AIC A;  5DB5 A;  5EIG A;  4A0F A;  1KL2 A;  2FM1 A;  2BI2 A;  2VI8 A;  1SPA A;  3BWN A;  1IX8 A;  4TV7 A;  1LS3 A;  1AHF A;  3NUB A;  4ATQ A;  4K2B A;  3WKS A;  2D66 A;  3JTX A;  2W7L A;  1AAM A;  2AEU A;  3AEN A;  4J5U A;  4MQP A;  1WYU B;  2YCT A;  3EI5 A;  2W7H A;  1CZC A;  1S08 A;  1XI9 A;  1ASN A;  4IY7 A;  2VMV A;  3TCM A;  1CS1 A;  3HVY A;  1MDZ A;  1AY4 A;  3DYD A;  2JJG A;  3QGU A;  4H51 A;  2OGE A;  2QB3 A;  2BI9 A;  3HLM A;  3NU7 A;  2C7T A;  2VI9 A;  4CBS A;  4BQ0 A;  3PD6 B;  5AX8 A;  2ZY2 A;  1E5E A;  1Z7D A;  3GSB A;  3FDB A;  3NYU A;  2VGT A;  1BQD A;  2JJE A;  3A8U X;  4K05 A;  2FYF A;  3TFU A;  1MDX A;  1SFF A;  5E5I A;  3ISL A;  4ADB A;  2CJD A;  2OKK A;  4JEX A;  4A72 A;  3VK4 A;  4F5J A;  1P3W A;  1G4X A;  2YRI A;  1C0N A;  2JGT A;  1TAR A;  1AIA A;  2VMS A;  3NNK A;  4IYO B;  3COG A;  3DC1 A;  3LVK A;  3PGY A;  3BWO A;  1E5F A;  2E7J A;  1AIB A;  3HDO A;  5IWQ A;  1IX6 A;  3VOM A;  3FQ7 A;  4A6T A;  5M4D A;  4IXO A;  3ZRQ A;  4RJ0 A;  1WKG A;  3AEO A;  4Q6R A;  5G2P A;  1ASM A;  3I5T A;  3OP7 A;  2FNU A;  2R5C A;  5EIG B;  1B5O A;  3KGX A;  2DGK A;  3CAI A;  4IX8 A;  2VGV A;  1AKA A;  2R5E A;  3EI9 A;  2D65 A;  1JF9 A;  4E77 A;  1QJ5 A;  4W91 A;  4A0H A;  2D64 A;  3FZ6 A;  1B4X A;  5D95 A;  9AAT A;  3NDN A;  5BJ4 A;  5E3K A;  2E7U A;  4IW7 A;  1B8G A;  3FTB A;  1UU0 A;  1BJ4 A;  2FNI A;  2DGL A;  2DKB A;  2OKJ A;  3FFR A;  3PPL A;  3H7F A;  1VJO A;  4ISY A;  4WYC A;  4EB7 A;  1JS6 A;  4ZLV A;  2W8W A;  3W1I A;  3N4S A;  4CVQ A;  3EI8 A;  1LW5 A;  3QM2 A;  3WY7 A;  1O62 A;  2Z9X A;  3VAX A;  1TOJ A;  2W7J A;  2C81 A;  4WD2 A;  4XJL A;  2HP1 A;  3FFH A;  2W8V A;  2W7E A;  4F5K A;  1PMO A;  1DJU A;  1O69 A;  4LNM A;  1S0A A;  3EUC A;  2Z9U A;  3B1D A;  4BMK A;  3WCN A;  1M0P A;  3CQ4 A;  2CH2 A;  1KKJ A;  1WKH A;  1YIZ A;  2YKU A;  1IVR A;  3FQ8 A;  4AOA A;  1DFO A;  2C0R A;  2WKA A;  3RQ1 A;  3MAD A;  5FT4 A;  3FZ7 A;  4XQ2 A;  3FDD A;  3RUY A;  1WYU A;  4OTL A;  4P7Y A;  3USF A;  1AY8 A;  3TQX A;  5C6U A;  1AHY A;  1MAQ A;  4HVK A;  2EYQ A;  1LC5 A;  2TPL A;  2YCN A;  1JG8 A;  3ELP A;  2R5C B;  1LK9 A;  3NRA A;  4XAU A;  2AEV A;  1AAW A;  4MQQ A;  2CAN A;  1X0M A;  2W7G A;  3HQT A;  4A0R A;  3LG0 A;  4F5I A;  2F8J A;  3NYS A;  1QIT A;  1B9H A;  1TAT A;  2VGZ A;  4GE4 A;  2Z9V A;  1W7M A;  1BQA A;  5TF5 A;  3PJ0 A;  4WP0 A;  3TFT A;  5HXX A;  1TOE A;  2NMP A;  2VGW A;  1AMR A;  3BCA A;  2D7Y A;  2W7F A;  2XBN A;  4IXZ A;  4IYO A;  1LC7 A;  2YKX A;  2W8U A;  4IXS A;  2QB2 A;  5M49 A;  4ZM3 A;  2AY3 A;  1VP4 A;  1M0N A;  3ZRR A;  4ZAH A;  3IHJ A;  1JS3 A;  3JWA A;  3LVM A;  4AO9 A;  1BS0 A;  4ZWV A;  1TOG A;  2BHX A;  4NOG A;  2D63 A;  3N0L A;  3MC6 A;  5EAA A;  2ZY4 A;  2EPJ A;  1GBN A;  3GR9 A;  1DGE A;  3H14 A;  5FT8 A;  2AAT A;  4Y0D A;  4K2I A;  4ZAS A;  3BC8 A;  1AMA A;  3N5M A;  3HL2 A;  2W7K A;  1OAT A;  1M4N A;  1ARI A;  2ZSM A;  1AHX A;  1WYV A;  1I41 A;  2ZYJ A;  3N75 A;  3M5U A;  4OBV A;  5EUN A;  3WLX A;  2OAT A;  4MY5 A;  3ASB A;  1ARH A;  3RBF A;  2DR1 A;  3F0H A;  2W7D A;  4R5F A;  1XEY A;  2AY4 A;  2BYL A;  4RIZ A;  3RI6 A;  3EZS A;  1ELQ A;  2CH1 A;  3BCB A;  4KAM A;  3MKJ A;  3AV7 A;  3EZ1 A;  3F6T A;  4MSO A;  3HT4 A;  3MBB A;  1MGV A;  1YNU A;  3AEJ C;  4GSA A;  3NTJ A;  4AZK A;  5BJ3 A;  1I29 A;  2AY7 A;  3FZ8 A;  3E2F A;  4OYT A;  4R2N A;  4E3R A;  3KGW A;  5F8V A;  4R8D A;  2FKI A;  3FD0 A;  4Q75 A;  1J04 A;  2CY8 A;  1V2D A;  2X3L A;  3E9K A;  1DTY A;  1ELU A;  3DRD A;  3RCH B;  3AEM A;  1QIS A;  2YOB A;  4W1X A;  3PAA A;  1EG5 A;  3NU8 A;  4JF1 A;  4ZWM A;  2BWP A;  3NX3 A;  2VMZ A;  4E1O A;  1C7N A;  3BWN C;  1UKJ A;  3ELE A;  5DJ1 A;  4J8L A;  3UE8 A;  4RKD A;  3TAT A;  5KTB A;  2VMQ A;  2ZUK A;  4F4E A;  1GC4 A;  1CL2 A;  1RV4 A;  2HP2 A;  1KL1 A;  3MAF A;  2KFP A;  3DOD A;  2VGS A;  2HOZ A;  4L0O A;  2YKY A;  1M0Q A;  3A9Y A;  2BIA A;  2QA3 A;  2WK8 A;  2W7I A;  1H1C A;  3PDB B;  4W8I A;  4GDY A;  4GE7 A;  5FT6 A;  2BWO A;  5G2Q A;  2JJF A;  1WYV B;  4XK1 A;  4BA5 A;  3N4R A;  1BJN A;  4ZSY A;  4ADE A;  2VMY A;  1M32 A;  2Z61 A;  3QBO A;  7AAT A;  4WB0 A;  1O4S A;  3FVX A;  4MKJ A;  1OHW A;  4ADD A;  4UHO A;  1PFF A;  4DGT A;  3OKS A;  1RVU A;  3K28 A;  3QHX A;  4OT8 A;  1ASL A;  4P3M A;  4AH3 A;  4AZJ A;  1QZ9 A;  5LHA A;  1DJE A;  1CQ7 A;  1W3U A;  1X28 A;  4TN4 A;  4XJO A;  2VMR A;  3BS8 A;  4ADC A;  1WST A;  2Z9W A;  3QN6 A;  3K7Y A;  1O61 A;  3HMU A;  3MAU A;  4RJY A;  4F5F A;  1CL1 A;  3BV0 A;  3WGB A;  3A9Z A;  4UOY A;  2BI5 A;  2HOR A;  2CST A;  4XEW A;  3FRK A;  2AY5 A;  3FQA A;  1ASF A;  1DKA A;  3R4T A;  5DX5 A;  2YHK A;  1S06 A;  4A00 A;  4KXK A;  1LKC A;  4LNL A;  3LVL B;  5G4I A;  1YAA A;  2XH1 A;  4XJM A;  5EFS A;  1SF2 A;  1IAY A;  3GBX A;  2JJH A;  3BCX A;  4RIT A;  3GWP A;  4UQV A;  4ZSW A;  2PO3 A;  3G0T A;  3WX9 A;  4F5L A;  3VK3 A;  1C7O A;  4I8A A;  4WYD A;  1I43 A;  4M2M A;  2FN6 A;  1GC0 A;  4ATP A;  3NYT A;  5G0A A;  3LWS A;  4UHM A;  1M0O A;  3B46 A;  3MAF B;  1ZOD A;  3GZD C;  3ASA A;  4PFF A;  4UHN A;  3N4X A;  1ZOB A;  3EI7 A;  3E6G A;  4LW2 A;  4MQR A;  2DGM A;  2VMN A;  1FC4 A;  1IX7 A;  1ASB A;  2BWN A;  1Z3Z A;  1AMS A;  3E2Y A;  2YKV A;  3PA9 A;  1UU1 A;  1SZU A;  3BB8 A;  3R9A A;  4ZDO A;  2AY9 A;  2HOY A;  1OHV A;  4WB0 B;  3EIA A;  4ITX A;  3RCH A;  3EIB A;  4OCA A;  4CBR A;  4K2M A;  4HF8 A;  4GRX A;  2RFV A;  3DXV A;  1X29 A;  5F9S A;  1GD9 A;  1J32 A;  4WYG A;  1WYT B;  4JF0 A;  3WGC A;  1ART A;  2ZY5 A;  2VMX A;  4WLH A;  3FVS A;  1EQB A;  1FG7 A;  4W1V A;  2HUI A;  4A6R A;  1YOO A;  3ACZ A;  4EB5 A;  1W23 A;  4WXG A;  3ZZJ A;  1AJR A;  3JU7 A;  3LY1 A;  1YJZ A;  2WB6 A;  1QIR A;  1SVV A;  3ATH A;  1GEX A;  1S07 A;  3E2Z A;  1MLZ A;  5LH9 A;  3QI6 A;  1C9C A;  3W1J A;  2O0R A;  3AOW A;  3EI6 A;  3GJU A;  3PDB A;  4Q31 A;  1KAF A;  3ZZK A;  4EU1 A;  1IUG A;  3I16 A;  1CZE A;  2BI3 A;  4A6U A;  3FKD A;  4RKC A;  2X5D A;  3P1T A;  2AY2 A;  2BIE A;  4JEZ A;  3WZF A;  1FG3 A;  1CJ0 A;  1I48 A;  2GQN A;  5E4Z A;  1V2F A;  2VMU A;  2Z20 A;  1GC3 A;  1MAP A;  2EH6 A;  1B9I A;  4JE5 A;  4ZDL A;  1ZC9 A;  2QLR A;  1AX4 A;  2PB2 A;  3K40 A;  3NUI A;  4Y0I A;  4TMR A;  2Z1Y A;  2G7J A;  2E54 A;  3PIU A;  5FT5 A;  2VMW A;  3D6K A;  1ASD A;  4PVF A;  3H9X A;  5EQC A;  1GC2 A;  2E7I A;  3W1H A;  3JZL A;  5HHY A;  3AAT A;  4PIW A;  4B98 A;  1G7X A;  4GE9 A;  4WLJ A;  4ZDP A;  2QSR A;  3P6K A;  4OBU A;  3AOV A;  1TPL A;  5D5S A;  3MC6 C;  1CQ6 A;  1M6S A;  3DXW A;  2D5Y A;  1S09 A;  3KKI A;  1AHE A;  3L8A A;  1AKB A;  4MKK A;  1C4K A;  2GMU A;  4KYO A;  4WYE A;  2JG2 A;  3JW9 A;  2BIG A;  1N2T A;  1T3I A;  1ARG A;  2ZJG A;  1AY5 A;  2WK9 A;  1GEW A;  1ASE A;  4RAE A;  2CB1 A;  2Z1Z A;  3Q8N A;  2HZP A;  4N0W A;  2YRR A;  2WK7 A;  4RLG A;  4H63 Q;  5EAV A;  5I92 A;  1D7V A;  2CTZ A;  4GEB A;  3E2Z B;  2C44 A;  2D7Z A;  3JWB A;  2X5F A;  2JIS A;  2VMP A;  4JEY A;  2ZSL A;  4M2K A;  2VLF A;  4Y0H A;  2W7M A;  2VLH A;  4PFN A;  5HDM A;  2O7C A;  3A9X A;  5M4B A;  1BT4 A;  4W1W A;  3QPG A;  2EO5 A;  1BW0 A; 
#chains in the Genus database with same CATH homology
 3PDX A;  1G4V A;  4EFF A;  3LV2 A;  2QBT A;  3WCO A;  1AHG A;  1BKG A;  1IJI A;  1DJ9 A;  1PMM A;  1M7Y A;  1QGN A;  3GET A;  1RVY A;  4WBT A;  3RBL A;  3T32 A;  4F5H A;  2X8U A;  3B1E A;  3CQ6 A;  3FCR A;  1MLY A;  3E77 A;  2VYC A;  1EJI A;  1WYT A;  2BYJ A;  3AEM C;  3KE3 A;  2EZ2 A;  1OXO A;  5DJ9 A;  2VMT A;  3DR7 A;  2AY8 A;  3CBF A;  3II0 A;  1DGD A;  4JEV A;  4U2H A;  3BN1 A;  4WXF A;  1UU2 A;  4OMA A;  1YJY A;  1BJO A;  1TAS A;  3CQ5 A;  3FVU A;  1ASC A;  1B5P A;  2G6W A;  5K8B A;  5JAY A;  1RV3 A;  3WKR A;  1D7R A;  2AY6 A;  2QMA A;  1PG8 A;  2V0Y A;  4M2J A;  3VK2 A;  4WXB A;  2HUF A;  1KMJ A;  2R0T A;  3AEN B;  4OC9 A;  1YIY A;  1V72 A;  1IBJ A;  1ECX A;  4LNJ A;  4WYA A;  4BA4 A;  5G09 A;  1OHY A;  3GZD A;  3N7N A;  4A0G A;  2BKW A;  1KKP A;  3I4J A;  4DBC A;  1Y4I A;  4E3Q A;  4F5M A;  5J8Q A;  3F9T A;  3VP6 A;  2DOU A;  4MGR A;  2EZ1 A;  4EMY A;  1BJW A;  1AJS A;  1G7W A;  4BHD A;  1AKC A;  2VIB A;  1AMQ A;  4F5G A;  2PB0 A;  1U08 A;  2CFB A;  3G7Q A;  3AEL A;  2GMS A;  3L44 A;  3DZZ A;  4W5K A;  1KMK A;  1N31 A;  2OQX A;  3DU4 A;  4B9B A;  4FL0 A;  1D2F A;  1W7N A;  4RM1 A;  2FQ6 A;  1MDO A;  2GSA A;  3AEP A;  2Q7W A;  2AY1 A;  1GCK A;  1D7U A;  1CQ8 A;  2EGY A;  4AO4 A;  1YJS A;  1GEY A;  2W8J A;  5M46 A;  4U1T A;  3MEB A;  2ZC0 A;  2CJH A;  3ZRP A;  4ZM4 A;  1C7G A;  1OXP A;  2W8T A;  5G4J A;  2OGA A;  2GB3 A;  1LW4 A;  4JE5 D;  4DQ6 A;  1SZS A;  2A1V A;  1ASG A;  1LC8 A;  3UAK A;  4CXR A;  4R5Z A;  2ZY3 A;  4N0B A;  1V2E A;  1VEF A;  2HOX A;  1GDE A;  2V1P A;  2VGU A;  4Q76 A;  3PD6 A;  2ORD A;  4FFC A;  1BJO B;  2ZP7 A;  4O6Z A;  2O1B A;  3FSL A;  4LC3 A;  4QGR A;  3B8X A;  4XJP A;  4ITG A;  3ECD A;  8AAT A;  1X2A A;  3LVJ A;  4JEW A;  1ORD A;  5EUE A;  2DKJ A;  4CXQ A;  2HUU A;  1D7S A;  1ASA A;  1N8P A;  3A2B A;  1QJ3 A;  3AEJ A;  1H0C A;  1TOK A;  2CJG A;  3HBX A;  5EUD A;  4WYF A;  1IAX A;  3IF2 A;  2D61 A;  2CIN A;  3UWC A;  2YCP A;  3DR4 A;  2VMO A;  1AJS B;  2BI1 A;  1ARS A;  2VIA A;  1W7L A;  2R2N A;  1TOI A;  3B1C A;  4LW4 A;  1SZK A;  3G8M A;  2Z67 A;  3GZC A;  1AIC A;  5DB5 A;  5EIG A;  4A0F A;  1KL2 A;  2FM1 A;  2BI2 A;  2VI8 A;  1SPA A;  3BWN A;  1IX8 A;  4TV7 A;  1LS3 A;  1AHF A;  3NUB A;  4ATQ A;  4K2B A;  3WKS A;  2D66 A;  3JTX A;  2W7L A;  1AAM A;  2AEU A;  3AEN A;  4J5U A;  4MQP A;  1WYU B;  2YCT A;  3EI5 A;  2W7H A;  1CZC A;  1S08 A;  1XI9 A;  1ASN A;  4IY7 A;  2VMV A;  3TCM A;  1CS1 A;  3HVY A;  1MDZ A;  1AY4 A;  3DYD A;  2JJG A;  3QGU A;  4H51 A;  2OGE A;  2QB3 A;  2BI9 A;  3HLM A;  3NU7 A;  2C7T A;  2VI9 A;  4CBS A;  4BQ0 A;  3PD6 B;  5AX8 A;  2ZY2 A;  1E5E A;  1Z7D A;  3GSB A;  3FDB A;  3NYU A;  2VGT A;  1BQD A;  2JJE A;  3A8U X;  4K05 A;  2FYF A;  3TFU A;  1MDX A;  1SFF A;  5E5I A;  3ISL A;  4ADB A;  2CJD A;  2OKK A;  4JEX A;  4A72 A;  3VK4 A;  4F5J A;  1P3W A;  1G4X A;  2YRI A;  1C0N A;  2JGT A;  1TAR A;  1AIA A;  2VMS A;  3NNK A;  4IYO B;  3COG A;  3DC1 A;  3LVK A;  3PGY A;  3BWO A;  1E5F A;  2E7J A;  1AIB A;  3HDO A;  5IWQ A;  1IX6 A;  3VOM A;  3FQ7 A;  4A6T A;  5M4D A;  4IXO A;  3ZRQ A;  4RJ0 A;  1WKG A;  3AEO A;  4Q6R A;  5G2P A;  1ASM A;  3I5T A;  3OP7 A;  2FNU A;  2R5C A;  5EIG B;  1B5O A;  3KGX A;  2DGK A;  3CAI A;  4IX8 A;  2VGV A;  1AKA A;  2R5E A;  3EI9 A;  2D65 A;  1JF9 A;  4E77 A;  1QJ5 A;  4W91 A;  4A0H A;  2D64 A;  3FZ6 A;  1B4X A;  5D95 A;  9AAT A;  3NDN A;  5BJ4 A;  5E3K A;  2E7U A;  4IW7 A;  1B8G A;  3FTB A;  1UU0 A;  1BJ4 A;  2FNI A;  2DGL A;  2DKB A;  2OKJ A;  3FFR A;  3PPL A;  3H7F A;  1VJO A;  4ISY A;  4WYC A;  4EB7 A;  1JS6 A;  4ZLV A;  2W8W A;  3W1I A;  3N4S A;  4CVQ A;  3EI8 A;  1LW5 A;  3QM2 A;  3WY7 A;  1O62 A;  2Z9X A;  3VAX A;  1TOJ A;  2W7J A;  2C81 A;  4WD2 A;  4XJL A;  2HP1 A;  3FFH A;  2W8V A;  2W7E A;  4F5K A;  1PMO A;  1DJU A;  1O69 A;  4LNM A;  1S0A A;  3EUC A;  2Z9U A;  3B1D A;  4BMK A;  3WCN A;  1M0P A;  3CQ4 A;  2CH2 A;  1KKJ A;  1WKH A;  1YIZ A;  2YKU A;  1IVR A;  3FQ8 A;  4AOA A;  1DFO A;  2C0R A;  2WKA A;  3RQ1 A;  3MAD A;  5FT4 A;  3FZ7 A;  4XQ2 A;  3FDD A;  3RUY A;  1WYU A;  4OTL A;  4P7Y A;  3USF A;  1AY8 A;  3TQX A;  5C6U A;  1AHY A;  1MAQ A;  4HVK A;  2EYQ A;  1LC5 A;  2TPL A;  2YCN A;  1JG8 A;  3ELP A;  2R5C B;  1LK9 A;  3NRA A;  4XAU A;  2AEV A;  1AAW A;  4MQQ A;  2CAN A;  1X0M A;  2W7G A;  3HQT A;  4A0R A;  3LG0 A;  4F5I A;  2F8J A;  3NYS A;  1QIT A;  1B9H A;  1TAT A;  2VGZ A;  4GE4 A;  2Z9V A;  1W7M A;  1BQA A;  5TF5 A;  3PJ0 A;  4WP0 A;  3TFT A;  5HXX A;  1TOE A;  2NMP A;  2VGW A;  1AMR A;  3BCA A;  2D7Y A;  2W7F A;  2XBN A;  4IXZ A;  4IYO A;  1LC7 A;  2YKX A;  2W8U A;  4IXS A;  2QB2 A;  5M49 A;  4ZM3 A;  2AY3 A;  1VP4 A;  1M0N A;  3ZRR A;  4ZAH A;  3IHJ A;  1JS3 A;  3JWA A;  3LVM A;  4AO9 A;  1BS0 A;  4ZWV A;  1TOG A;  2BHX A;  4NOG A;  2D63 A;  3N0L A;  3MC6 A;  5EAA A;  2ZY4 A;  2EPJ A;  1GBN A;  3GR9 A;  1DGE A;  3H14 A;  5FT8 A;  2AAT A;  4Y0D A;  4K2I A;  4ZAS A;  3BC8 A;  1AMA A;  3N5M A;  3HL2 A;  2W7K A;  1OAT A;  1M4N A;  1ARI A;  2ZSM A;  1AHX A;  1WYV A;  1I41 A;  2ZYJ A;  3N75 A;  3M5U A;  4OBV A;  5EUN A;  3WLX A;  2OAT A;  4MY5 A;  3ASB A;  1ARH A;  3RBF A;  2DR1 A;  3F0H A;  2W7D A;  4R5F A;  1XEY A;  2AY4 A;  2BYL A;  4RIZ A;  3RI6 A;  3EZS A;  1ELQ A;  2CH1 A;  3BCB A;  4KAM A;  3MKJ A;  3AV7 A;  3EZ1 A;  3F6T A;  4MSO A;  3HT4 A;  3MBB A;  1MGV A;  1YNU A;  3AEJ C;  4GSA A;  3NTJ A;  4AZK A;  5BJ3 A;  1I29 A;  2AY7 A;  3FZ8 A;  3E2F A;  4OYT A;  4R2N A;  4E3R A;  3KGW A;  5F8V A;  4R8D A;  2FKI A;  3FD0 A;  4Q75 A;  1J04 A;  2CY8 A;  1V2D A;  2X3L A;  3E9K A;  1DTY A;  1ELU A;  3DRD A;  3RCH B;  3AEM A;  1QIS A;  2YOB A;  4W1X A;  3PAA A;  1EG5 A;  3NU8 A;  4JF1 A;  4ZWM A;  2BWP A;  3NX3 A;  2VMZ A;  4E1O A;  1C7N A;  3BWN C;  1UKJ A;  3ELE A;  5DJ1 A;  4J8L A;  3UE8 A;  4RKD A;  3TAT A;  5KTB A;  2VMQ A;  2ZUK A;  4F4E A;  1GC4 A;  1CL2 A;  1RV4 A;  2HP2 A;  1KL1 A;  3MAF A;  2KFP A;  3DOD A;  2VGS A;  2HOZ A;  4L0O A;  2YKY A;  1M0Q A;  3A9Y A;  2BIA A;  2QA3 A;  2WK8 A;  2W7I A;  1H1C A;  3PDB B;  4W8I A;  4GDY A;  4GE7 A;  5FT6 A;  2BWO A;  5G2Q A;  2JJF A;  1WYV B;  4XK1 A;  4BA5 A;  3N4R A;  1BJN A;  4ZSY A;  4ADE A;  2VMY A;  1M32 A;  2Z61 A;  3QBO A;  7AAT A;  4WB0 A;  1O4S A;  3FVX A;  4MKJ A;  1OHW A;  4ADD A;  4UHO A;  1PFF A;  4DGT A;  3OKS A;  1RVU A;  3K28 A;  3QHX A;  4OT8 A;  1ASL A;  4P3M A;  4AH3 A;  4AZJ A;  1QZ9 A;  5LHA A;  1DJE A;  1CQ7 A;  1W3U A;  1X28 A;  4TN4 A;  4XJO A;  2VMR A;  3BS8 A;  4ADC A;  1WST A;  2Z9W A;  3QN6 A;  3K7Y A;  1O61 A;  3HMU A;  3MAU A;  4RJY A;  4F5F A;  1CL1 A;  3BV0 A;  3WGB A;  3A9Z A;  4UOY A;  2BI5 A;  2HOR A;  2CST A;  4XEW A;  3FRK A;  2AY5 A;  3FQA A;  1ASF A;  1DKA A;  3R4T A;  5DX5 A;  2YHK A;  1S06 A;  4A00 A;  4KXK A;  1LKC A;  4LNL A;  3LVL B;  5G4I A;  1YAA A;  2XH1 A;  4XJM A;  5EFS A;  1SF2 A;  1IAY A;  3GBX A;  2JJH A;  3BCX A;  4RIT A;  3GWP A;  4UQV A;  4ZSW A;  2PO3 A;  3G0T A;  3WX9 A;  4F5L A;  3VK3 A;  1C7O A;  4I8A A;  4WYD A;  1I43 A;  4M2M A;  2FN6 A;  1GC0 A;  4ATP A;  3NYT A;  5G0A A;  3LWS A;  4UHM A;  1M0O A;  3B46 A;  3MAF B;  1ZOD A;  3GZD C;  3ASA A;  4PFF A;  4UHN A;  3N4X A;  1ZOB A;  3EI7 A;  3E6G A;  4LW2 A;  4MQR A;  2DGM A;  2VMN A;  1FC4 A;  1IX7 A;  1ASB A;  2BWN A;  1Z3Z A;  1AMS A;  3E2Y A;  2YKV A;  3PA9 A;  1UU1 A;  1SZU A;  3BB8 A;  3R9A A;  4ZDO A;  2AY9 A;  2HOY A;  1OHV A;  4WB0 B;  3EIA A;  4ITX A;  3RCH A;  3EIB A;  4OCA A;  4CBR A;  4K2M A;  4HF8 A;  4GRX A;  2RFV A;  3DXV A;  1X29 A;  5F9S A;  1GD9 A;  1J32 A;  4WYG A;  1WYT B;  4JF0 A;  3WGC A;  1ART A;  2ZY5 A;  2VMX A;  4WLH A;  3FVS A;  1EQB A;  1FG7 A;  4W1V A;  2HUI A;  4A6R A;  1YOO A;  3ACZ A;  4EB5 A;  1W23 A;  4WXG A;  3ZZJ A;  1AJR A;  3JU7 A;  3LY1 A;  1YJZ A;  2WB6 A;  1QIR A;  1SVV A;  3ATH A;  1GEX A;  1S07 A;  3E2Z A;  1MLZ A;  5LH9 A;  3QI6 A;  1C9C A;  3W1J A;  2O0R A;  3AOW A;  3EI6 A;  3GJU A;  3PDB A;  4Q31 A;  3ZZK A;  4EU1 A;  1IUG A;  3I16 A;  1CZE A;  2BI3 A;  4A6U A;  3FKD A;  4RKC A;  2X5D A;  3P1T A;  2AY2 A;  2BIE A;  4JEZ A;  3WZF A;  1FG3 A;  1CJ0 A;  1I48 A;  2GQN A;  5E4Z A;  1V2F A;  2VMU A;  2Z20 A;  1GC3 A;  1MAP A;  2EH6 A;  1B9I A;  4JE5 A;  4ZDL A;  1ZC9 A;  2QLR A;  1AX4 A;  2PB2 A;  3K40 A;  3NUI A;  4Y0I A;  4TMR A;  2Z1Y A;  2G7J A;  2E54 A;  3PIU A;  5FT5 A;  2VMW A;  3D6K A;  1ASD A;  4PVF A;  3H9X A;  5EQC A;  1GC2 A;  2E7I A;  3W1H A;  3JZL A;  5HHY A;  3AAT A;  4PIW A;  4B98 A;  1G7X A;  4GE9 A;  4WLJ A;  4ZDP A;  2QSR A;  3P6K A;  4OBU A;  3AOV A;  1TPL A;  5D5S A;  3MC6 C;  1CQ6 A;  1M6S A;  3DXW A;  2D5Y A;  1S09 A;  3KKI A;  1AHE A;  3L8A A;  1AKB A;  4MKK A;  1C4K A;  2GMU A;  4KYO A;  4WYE A;  2JG2 A;  3JW9 A;  2BIG A;  1N2T A;  1T3I A;  1ARG A;  2ZJG A;  1AY5 A;  2WK9 A;  1GEW A;  1ASE A;  4RAE A;  2CB1 A;  2Z1Z A;  3Q8N A;  2HZP A;  4N0W A;  2YRR A;  2WK7 A;  4RLG A;  4H63 Q;  5EAV A;  5I92 A;  1D7V A;  2CTZ A;  4GEB A;  3E2Z B;  2C44 A;  2D7Z A;  3JWB A;  2X5F A;  2JIS A;  2VMP A;  4JEY A;  2ZSL A;  4M2K A;  2VLF A;  4Y0H A;  2W7M A;  2VLH A;  4PFN A;  5HDM A;  2O7C A;  3A9X A;  5M4B A;  1BT4 A;  4W1W A;  3QPG A;  2EO5 A;  1BW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...