1CZVA

Crystal structure of the c2 domain of human coagulation factor v: dimeric crystal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
159
structure length
159
Chain Sequence
b'CSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COAGULATION FACTOR V)
publication title Crystal structures of the membrane-binding C2 domain of human coagulation factor V.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 35
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1czvA00
4LKSA 1SHWB 3K75B 2ZEZA 2E32A 3EB7A 3K4AA 2KD7A 2J1RA 5CYYA 1W9SA 3CIHA 4A45A 4KMQA 5B4XA 4BDVB 3I97A 1L7QA 3UESA 3WNKA 3C7EA 2VZPA 2ID4A 3NJXA 1P8JA 3T2PA 4W8JA 2C9KA 3GM8A 5JR2A 1T2XA 1JZ4A 2J1VA 1JU4A 2W1WA 2VZVA 2DCKA 2L9LA 1F4HA 3U37A 3ETPA 5C70A 2DCJA 4ET7A 3A21A 5DN2A 1UYYA 3IAQA 2ZEXA 4XZUG 1EUUA 2VCAA 2BZDA 4JX0A 5EJZB 4ZZ8A 1KEXA 5DQ0A 3T09A 1JHJA 1WKYA 1JZ6A 2W92A 2JE8A 5HPOA 1D7PM 2Y8KA 3PUHA 3WF0A 2C4XA 2Y64A 3GXUA 4P02B 5CZKA 1UX7A 2W1QA 4E8DA 5F7UA 4OYUA 3MV11 1F4AA 3MO4A 3IDAA 4YPJA 2Y6KA 1JYXA 3HNYM 1JI6A 4DXSA 3CQOA 3I2IA 2W5FA 3SEEA 4TTGA 2RVAA 2VL4A 4DUVA 3AC0A 3ACHA 1K45A 3W5NA 3C7FA 3BN6A 3VD3A 1W9WA 3WF1A 4GZ9A 4DEQA 2WQ8A 1GNYA 3HN3A 2XOMA 1JZ2A 3ECQA 2VQUA 1UMIA 1KGYA 2DDUA 4QX0A 3OGRA 2HYXA 4P08A 4JHZA 3CMGA 4M4RA 3MUZ1 2W1SA 4QB6A 2W47A 2R7EB 2YB7A 1PX3A 3D3AA 5EIYB 3CDZB 3I3DA 2JD9A 2VMFA 4JKMA 1R64A 4MGSA 4KWUA 2WO3A 3I3EA 2V72A 1UXXX 4P5YA 4A42A 4ZZ5A 1US3A 2VC9A 3WF3A 5B4NA 1TVGA 5G04L 3WNLA 3LPFA 3I2HA 3VDBA 4FI9A 3NQHA 1O59A 1GUIA 2E26A 4TXWA 3WEZA 4OUEA 3I2KA 3ZM8A 3WF2A 4BXSV 3THCA 1UMHA 4DUXA 3VD5A 3OB8A 3DYMA 5J1XA 2QQJA 4W4ZA 4LHSA 2YG0A 2Z4FA 1CIYA 1OD3A 4ZY9A 1ULPA 4OMCA 4IUGA 4LQRA 3W5MA 2ZXQA 1OH4A 4UI9L 1NAEA 2B9VA 2YC2A 3OGSA 2LW8A 1XNAA 2VCCA 2QQKA 1UY1A 2VZOA 2VMEA 3T2OA 5LCWL 4UOJA 3PUIA 2J1TA 1CX1A 1PX4A 3CZUA 2WAAA 3VD9A 1J84A 1NKGA 3OGVA 1UY0A 1GMMA 2JDAA 2W1UA 2Y6JA 4XURA 2XQXA 2WUHA 3FN9A 2VZSA 2WZEA 4QX2A 3T08A 3NJVA 2VMCA 4DXRA 2W94A 4CUCA 1JYNA 2VZRA 1UY3A 4XUOA 3OEAA 4XVHA 3FL7A 3IIIA 2WN3A 4E8CA 2VZQA 3K4ZA 1W9TA 4XUTA 3HPNA 4MADA 2YC4A 4OZOA 1BHGA 2BGOA 4L0PA 3VD4A 3NNGA 2ORXA 3GGLA 1SG3A 2WZ8A 4A41A 4MO3M 5JXHA 2HLEA 1JU3A 2WYSA 2CDPA 3K77A 3T2QA 1MPXA 4QDSA 2X10A 2WN2A 5C7GA 4CU6A 2ZEWA 3I2FA 2ZEYA 4GWJA 4BJ0A 2VZ1A 5JXIA 1OT5A 4DXTA 1XPWA 2X05A 1GOGA 2J1AA 2EICA 1GU3A 4AG4A 3ACFA 3LQCA 2QBXA 2YFZA 1GOFA 2Y6LA 3C8XA 3HEIA 5G05L 1W0NA 1O8PA 1UY4A 5DMYA 3THDA 2WABA 4JKLA 2W46A 3LPGA 3C7OA 2B4KA 3WNNA 4ARYA 1JZ7A 2CDOA 1W8NA 3LEGA 3VDAA 4OMDA 3BGAA 4QDRA 4D0QA 3ACIA 5FUIA 3HJRA 3CZJA 5LA1A 2RV9A 1LNSA 2VMDA 2JKXA 1PMJX 4QB1A 5I0DA 2BGPA 1K12A 1XC6A 5HXMA 2VZTA 4P00B 1OF3A 3GDBA 3A22A 3MBWA 3VD7A 2V4VA 4Z2AA 5EJ1B 3E1F1 3C7HA 5LA0A 1UZ0A 2VZUA 2W87A 2EIBA 1W8OA 2J1SA 2QQIA 5IYYA 4RN5A 1CZSA 4UAPA 4BK4A 2QQNA 1US2A 3A7QA 1DLCA 2QQLA 2VM9A 1CZTA 4QX1A 5JUVA 4CU9A 4XUNA 1HN1A 3ACGA 4MOAA 4CU7A 1IQDC 4QPWA 3LE0A 2EIDA 2E31A 3FHAA 3OG2A 1UYXA 1YQ2A 4ZXEA 2QQOA 3UETA 3WNOA 5JMOA 5C71A 4W50A 2E33A 3K46A 5JXGA 1JZ5A 3A23A 1XNTA 2VR4A 3IAPA 1WCQA 3LEKA 4DEVA 5IFTA 1GOHA 1K3IA 3F2ZA 4BK5A 1CZVA 1DYOA 3DYOA 1UWWA 1ULOA 2LS6A 2W3JA 2VQTA 1JYVA 1JYWA 3SEPA 5IHRA 1J83A 3EYPA 1K42A 3SKJE 1I5PA 1RYYA 2OKXA 4DUWA 3WQBA 1NX9A 3WNMA 2XHNA 4M4PA 1W99A 3UNPA 3WF4A 2VJXA 1EUTA 2WDBA 1UXZA 4KI5M 4D8MA 2RJ2A 2ORZA 3K4DA 3IB3A 2WBKA 2WO2A 4GWIA 1L7RA 2BBAA 4PT6A 4A3ZA 2J1EA 1DP0A 4QB2A 5IJRA 1JZ8A 1O8SA 2XONA 2VO5A 1TG7A 4PQQA 3I2JA 2V5DA 4CUAA 2C26A 4ARXA 1H6YA 4XUQA 1PMHX 1H6XA 3MUY1 2VTFA 3ABZA 2W91A 3LEIA 4RYDA 4A6OA 2W95A 4A44A 3OBAA 4QAWA 3T0BA 4JKKA 4HG6B 1UY2A 3CKHA 3MV01 2VCBA 5A1AA 3C7GA 1SDDB 4LPLA 2VOTA 3T0AA 4AAXA 2Y6HA 1JZ3A 4A4AA 3HNMA 5DPNA 3T0DA 3OEBA 3I2GA 4QX3A 2VZ3A 3VDCA 2J7MA 5JXJA 1OF4A 2W9XA 2WO1A 2J22A 2WAOA 1UYZA 3WSOA 3FHQA 2PQSA 4PF1A 2QQMA 3P1IA 3I3BA 3WNPA 1NUKA 4CUBA 4CVUA 5LA2A 4XUPA 3NRUA 3HNBM 4MGQA 2BERA 3HOBA 3JXSA 2Y6GA 2YFUA 4QDQA 1GQPA 4CU8A 2EIEA 3DECA 2J1UA 2X09A 3J7HA 3SKVA 3DYPA 3P6BA 5IFPA
chains in the Genus database with same CATH superfamily
2WNOA 3K75B 1O6UA 2ZEZA 4S2DA 1SQ4A 2D7FA 4IGQA 2E32A 3KVBA 4M3CE 1PGW1 4JC1A 4Q4X3 4D94A 1VRH2 3SITA 2KD7A 1AL21 4FO9A 2ZHLA 4BMBA 5JZGC 2Y0IA 3RZKA 4A45A 4BDVB 4P9JA 1AYN1 3I97A 3QCWA 4ZKTB 2D40A 5GJ6A 4XTMA 4UF0A 1W6PB 2CWMA 3FC0A 1VB4A 3USSA 1W9YA 2AEYA 3AJYA 5BNPA 1VBD2 4LBQD 1GBGA 3FUOA 3GZAA 1RUF1 1RUI1 4DNYA 3ZFFA 1H8VA 1VBE2 5ABJA 2VBBA 3RYKA 4Q4W1 2P1BA 4OI4A 2R6QA 1JZ4A 2J1VA 4TZDA 4NE9A 2VZVA 1WCDJ 3CF6E 1W06A 2DCKA 4XACA 3ETPA 5F5QA 1VAMA 1H2MA 1JN2P 2J42A 1BBT2 5FLHA 3H8RA 1WWYA 2XKPA 2YBKA 5EFUA 3H8UA 3OBRA 1MQTA 2A3WA 3D82A 5FZHA 3DN7A 4XZUG 4XIKA 4R9CA 1VBA1 1YFUA 2D3PA 4YGDA 5H9PA 4RQPC 5HCBA 1OUXA 1Y4WA 1AR62 4FP2A 4ZZ8A 2YGLA 3M70A 5F1RA 1VBC2 1ZRRA 1PO21 1WW5A 2C6SA 4MGIE 4NHYA 3IT8A 4WVWA 4Y26A 5HCFA 3T09A 1W8TA 2WKKA 4NPMA 2XXZA 2W92A 3AL6A 3ZXDA 3O1VA 1ND2C 1F5FA 4JGZB 1V00A 2XL9A 5ACA2 4W6WA 3NNJA 4Y3OA 4YM1A 5T3NA 3N9LA 4AQ2A 1KS5A 2Y8KA 3CO2A 1TME3 1AF9A 2C4XA 2G1MA 2Y26A 2Y64A 4FPJA 2WS91 5FLIA 3WF0A 1NLQA 1RVF3 3POGA 2VTXA 4P02B 2OW4A 1LB2A 4Z8BA 1UX7A 2R0HA 1W3VA 3GBWA 4JGZC 4OYUA 4AI3A 1E5HA 5FAXA 4HMZA 1DBNA 1PVC3 4D6SA 2YPJA 1NE6A 2JB4A 1HRI3 4XEZA 1MZ5A 4ZU5A 2AGSA 4HZFA 3SEEA 3MF9A 1GFF2 2WRAA 3E5UA 2GMPA 2HEVF 2VL4A 4L2NA 3SXWA 4BPZA 4CDQA 3AC0A 3W58A 4YZ4A 3B9IA 1K45A 4UYBA 2EXKA 1ENRA 4QPIC 1UL9A 2D97A 1S0GA 2VNRA 3C7FA 3PJYA 5EP9A 3VD3A 1HX6A 2A7AA 3OD0A 4AWDA 3OY8B 4UBGA 5BYNA 4MG2A 5F3EA 3S30A 1S1AA 4NIHA 2WQ8A 1AL0G 2HH9A 3HN3A 4HETA 4K6BA 1T6GC 1JZ2A 4OHVA 5I91A 3IPVA 2RJKA 2VQUA 2GNBA 4IEOA 2Q8CA 2I07B 2HEWF 4IE5A 3TEXA 4P08A 1REFA 4S2FA 3X29B 1AL22 5F2WA 5A1FA 2YC0A 1W3XA 3Q8AA 2BW8A 3WT3A 2X8KA 3ZSJA 1AYN2 4FFIA 4GULA 5DAPA 2YB7A 4E2QA 3I7DA 5FZ9A 5EIYB 3CDZB 4LNVA 2JD9A 4Q1PA 4MGSA 1POV3 2CAUA 2WO3A 4EROA 3BI3A 4NAOA 4EWDA 3OUIA 2WNVA 3BKZA 3AK0A 1QJX3 1IPSA 3QBQA 4L92A 1RUF2 3CL1A 4KGQA 1RUI2 4O7XA 4OVEA 4E4DX 1WD3A 4LK6A 5IVYA 4H55A 4NO4A 1I3HA 4Q26A 4CEYA 2OPWA 1V6LA 3BOWA 1C8NA 2FQPA 3INAA 4Q0VA 3AKQA 2DUQA 3MLLA 3LPFA 4BIFA 4GJYA 4YGEA 3FLTA 4FCAA 3GYDA 3ST7A 4WM8B 5CNAA 3NQHA 1ZZ7A 4RL7A 2Z42A 3BTYA 1ENQA 4GMP0 5A33B 2PN5A 2W39A 3J4UH 3ZM8A 4FQ4A 4BXSV 1VBA2 4FFGA 1WA4A 2XLGA 3AVSA 3UKTA 2VVEA 3VD5A 3L9JT 4LO5B 2YUEA 5A7OA 3DYMA 1LGCA 5FBJA 2D98A 2AR6A 5E6HA 4LE4A 1CAWB 1HIXA 2PHTA 2R041 1FV3A 4W4ZA 5IVFA 4ZY9A 2VXJA 4FFHA 4LBLA 4L9BA 1H8TA 1REDA 1H2NA 1XU2A 4NWVA 4OMCA 4EYUA 4N43A 2E51A 4LQRA 3CEWA 3V65A 3W5MA 2WT1A 4K8RB 4XW3A 3WDTA 3DUIA 1ZRIA 5C4WB 4UFKA 3HT1A 1MS0A 4A7YA 1CJPA 2LW8A 4XE9A 1XNAA 4NUBA 4DY5A 1UIKA 1HQWA 2DCYA 2ZJCA 1XNDA 2QUOA 1H2LA 1JUIA 4JRAA 4XABA 2PLV2 4XQDA 3T2OA 4UFHA 3J7LA 2GNMA 2IXIA 5A32A 3B94A 3IMNA 3GF6A 4UOJA 5I93A 1VALA 3O1SA 2ZGQA 3JBG3 1CX1A 5GZEA 1JXNA 3CZUA 3IZOA 1Q8OA 4QHBA 5FP7A 5FO9B 1YFYA 2EAKA 2RMU2 4LLOA 1WBLA 4AYUA 4XBLA 1XB9A 2YBPA 3E5XA 3FE5A 4QPGA 1OI6A 4PCRA 2OPKA 1GMMA 1ASJ2 2W08A 2ZZQA 4B7EA 3V56A 4FPOB 4QXBA 2Y6JA 1W6OB 5JAXA 1UO9A 4OHXA 1V9U3 2DVDA 2WUHA 2WZEA 3FN9A 4QX2A 5DG2A 1LHUA 4XCAA 5FYZA 4XCBA 1NY71 4Q1RA 3HBZA 4DXRA 5A6XA 3MIEA 4OHZA 2HWC3 5D8AA 2ZGMA 1X33A 4CUCA 2DUPA 1YQ8A 2VG9A 3JCIA 2Z5WA 3C3VA 3KQRA 2VU9A 4IEWA 5LBBA 1J3PA 2VW2A 5FP8A 4N53A 2CU5A 1GZWB 4FPEA 1RUOA 2YC4A 3W21A 1U5ZA 5FY8A 2BGOA 1VRH3 4HPKB 4I0BA 3J7NA 3VD4A 2ZS6B 5A1LA 3GGLA 4UW4A 4XFHA 2RS51 1DQ6A 3BIWE 4Z82A 5FYCA 3POEA 4XJ9A 4MO3M 2HLEA 2D6MA 1QHDA 3SISA 1IS6A 2WYSA 2GH8A 4O61A 5L9VA 2CDPA 2JICA 4XJWA 2XJPA 3GNEA 4GH4B 1MPXA 1U0AA 1VBD3 2P3JA 2A73B 2ZEWA 1VBE3 2ZEYA 4FFFA 4FPLA 3ZSEA 2VZ1A 3BU0A 1WMDA 2XJRA 5JZGA 4YG6A 2YU1A 1RC6A 3IN9A 5BXXA 1YFWA 2XJVA 4DXTA 4LT5A 4LO6B 1YYNA 1E5IA 1NT0A 3IBMA 1Y9GA 1CR7A 2HBUA 3MIBA 3ZYFA 5IVCA 3ACFA 4AGRA 2ERFA 4FOVA 3LQCA 2Q5TA 2XQRA 4Q5OA 1KITA 1REEA 1H4HA 1UY4A 4WZCA 3THDA 4UFJA 1LECA 5D1IA 2ZGNA 4RGGA 4C0BA 2W46A 3LPGA 4BYYA 2Y34A 1VBC3 2QE3A 2R042 3Q8BA 1BK0A 3V0BA 1PZ7A 1QXPA 3LFIA 1YCIA 5KC5A 4Z92B 5ACA3 3RWNA 3WVJA 3JUUA 3AX4A 2GC3A 3LA7A 2KA3A 1W8FA 5FUIA 1MACA 3CZJA 4AVBA 2VMDA 2JE7A 4RQPA 3TN93 3ZYRA 1C4RA 3DL3A 2OUJA 1KRIA 3SH4A 3DPRB 1OXCA 2BWCA 5FZCA 4B4RA 1K12A 3AFKA 3OUJA 3U1XA 1ND2A 4P00B 4Q4Y3 3WG2A 1RUG2 3WQ7A 4AE2A 3AP4A 2Z69A 3E1F1 5DZFA 5GZFA 3BTZA 2EIBA 4SBVA 1IG0A 3N9OA 4BOWA 3V0AB 1RUE2 2C0ZA 2QQIA 1W2AX 4OUSA 5E89A 2NMOA 3KZ4C 1YI9A 4JGZA 5FZ8A 2JG8B 1Q5OA 3KT7A 1HXS1 4HOOA 4A3XA 1NY72 3A7QA 2ZX4A 3WOGA 4YFZA 4JDOA 1IKPA 2VM9A 1CZTA 4IEQA 2ZKLA 4W6XA 4EV0A 4HKWA 5FZ4A 3WINE 3RNSA 3ZVXA 4CU9A 2R49A 5L9RA 2DVGA 5EXOA 2F4PA 4CU7A 3ZFEB 4EWEA 5CIRA 1UZYA 1SCRA 5HV4A 1YRZA 2DCZA 3LE0A 5LBFA 4QPIA 4YARA 1YHFA 3LF7A 3MW4A 1UN1A 4OULA 4IEYA 1AL23 4ZXEA 3UETA 1NOVA 4HSLA 3WXPA 3WNOA 5C71A 1YJKA 2RS52 1I6XA 4W50A 1AYN3 4L11A 1FXZA 5JXGA 2PHLA 3A23A 1ULCA 2VR4A 1E5SA 5IVVA 3FMGA 1WCQA 1XSRA 2BRTA 2FCTA 1GOHA 3AP9A 1DQ5A 1RUF3 3NNMA 2GMMA 1OLQA 5FXXA 4E4SA 1ZZ9A 3R6SA 4CP9B 1WLDA 1CZVA 4META 4NIIA 3T4VA 2DTWA 1W6MB 2GN7A 1ENSA 1NCRC 1QF3A 1O5UA 1RVF1 2EVXA 2MEV2 3WDYA 4QX7A 5FZ0A 1C57A 1K42A 4AR2A 1FNZA 3LA2A 3VBUB 5E16A 4BMEA 4UT5A 2OKXA 1VBA3 3WQBA 3WNMA 3R0RA 1BJQA 1W99A 2VJXA 1OMIA 1EUTA 4SLIA 1OBNA 1BXHA 1HRI1 3H50A 2WDBA 2IZWA 1UKGA 2VUAA 3DXUA 1S0FA 2PELA 4RFRB 3T1LA 1UXZA 1LHVA 1DU3D 4HBNA 1DGLA 1K5MB 1V70A 3VBUC 3VDDA 1CD3G 2RJ2A 2ORZA 3NV4A 1MZ6A 2C9AA 4PBOA 4RS5C 5I0SA 1YFXA 2ZGUA 2HYKA 2WO2A 3FBMA 5FCCA 2QVSB 4YW3A 4PHZA 1VPHA 1O4YA 3EMRA 1VE0A 3K3OA 1SLTA 4A3ZA 4QB2A 2AEZA 4X8PA 1TNRA 1JZ8A 1K5MC 2UY9A 3KGZA 1STMA 1SBEA 5KHIA 2PLV3 2P2KA 1DIWA 2D6NA 4LJHA 4PQQA 2VMGA 2WFPA 3E97A 3U0ZA 1NZIA 3HQRA 1D4VB 5B2GB 3EXUA 1TMF2 3O0XA 1OQDA 4Y20B 4BWOA 5A6ZA 2RMU3 4XUQA 2ZMLA 4WM7C 4JGYB 1OFNA 4Y1XA 5C3RA 4AEKA 4NMIA 4HSJA 1LHWA 5GLUA 1ASJ3 1HDKA 4RYDA 1G7YA 4C8DA 4QKBA 5AVAA 1HXS2 2XWJB 2CHHA 1POV1 3MLKA 4FAGA 4YSFA 3RYPA 3NAPC 1ONAA 5CFCB 4K8FA 4IV1B 3TEWA 1SDDB 3I8TA 1W6QB 2DTYA 2YBSA 3M3OA 3RMXA 5EYYA 2VH9A 4JAAA 5FR3A 2D5HA 2XDVA 3J9SA 2XUEA 3NW4A 5SV5A 1WMEA 1LOBA 1DCSA 4A4AA 3GHMA 3IDBB 5C5TA 5FK7A 3VKOA 3T0DA 5IK5A 1HV1A 2LRPA 4K3UA 4QX3A 5FO8B 3AB0A 1ZBE1 2W9XA 2VE1A 3AMPA 4I2OA 5A7QA 2IVJA 2J22A 2WAOA 3WP3A 3WSOA 2D44A 2ZAHA 5C8WA 1J59A 1XOYA 1ZRCA 2CAVA 4UW5A 1G9CA 4HVQA 2Y33A 4JV4A 2X5IB 3ZSMA 1U5IA 5C6CA 3NO8A 4YGBA 2GP3A 5FZ1A 4XUPA 5FUPA 5DUVA 3POYA 3TWIA 2WA4A 2YFUA 2G19A 2ZMKA 2X29A 4XF9A 4CU8A 2EIEA 3VZLA 3SKVA 5FP3A 3P6BA 2BP6A 3CJIC 5IWFA 1HKDA 3IDCB 5JOXA 3LZZA 1DGRN 4HPKA 2YZ4A 3EB7A 4R9AA 3K4AA 4BQ4A 5FIXA 5CYYA 5IUQA 4LBQB 1LESA 4LHNA 4KMQA 5L7OB 5I8TA 4JTOA 3IKWA 4RGKA 2GH2A 4J1WA 4H7LA 5I0TA 2OIIA 5C8CB 3QLQA 1XQNA 4QXHA 1XYNA 4AK3A 4TLGA 4AFAA 2IC1A 4IQPA 3NWKA 5FZBA 1NA1B 4XIOA 4W8JA 3UK9A 3GM8A 5L7OC 2WWSA 1J3QA 4FOYA 4D7YA 1DZRA 3GBGA 3AM2A 5IAVA 5HBAA 2FMDA 3ZFGC 1LULA 4ET7A 1ULEA 2HWC1 1NA1C 5DN2A 3RSJA 4F8AA 1KJLA 5EJ3A 2E7AA 3Q8CA 4CPBA 3N9NA 3IAQA 1RUG3 2JECA 4CP1A 1MEC2 3S7IA 1FI2A 3VL9A 3VZKA 4JX0A 1OHFA 4KGGA 4CEWC 3AXDA 1RUE3 4IE6A 4KBBA 1PVXA 3J8F1 1MS5A 1JHJA 1WKYA 4YZ5A 3PVOA 2XR4A 3FUQA 4LA3A 1NLRA 1ENXA 2E63A 4MSVA 3VBSB 5J09A 1JZ6A 1O3QA 2RDSA 5FZIA 4A2UA 4MXWB 1YC61 3KT4A 3ALQA 1VBD1 1D7PM 1LGBA 3PUHA 4CCOA 1QXRA 1UZZA 2WO7A 5LBCA 1UNBA 1QH7A 1WGPA 1JS9A 1TQ5A 1MZFA 4E8DA 5A70A 1VMJA 4AEMA 4YNIA 5C3QA 3MV11 4H2AA 5FMCA 3ES4A 4ZPIA 1OA4A 1RGSA 3BPZA 4MZUA 2IXCA 4MGYE 4DXSA 4YVSB 2B42B 4EN0A 1ZBE2 4XFBA 2RS53 5ERLA 2DUOA 4BLJA 2A3YA 3HAGA 4MH0E 2W5FA 2A6XA 4QM9A 2RVAA 3V0AA 1TZOA 5F3GA 5T5JA 4DUVA 3ZDVA 2VVDA 5CFDC 1VBC1 4I30A 4YG0A 4YVSC 4F3JA 2OXBA 2WZR1 5FZAA 2BFUL 3WF1A 1COV1 2XJSA 4AQ6A 4LBOA 4EN6B 1EY2A 1HQLA 2NYYA 4W65A 3HIFA 4NN0A 4PDWC 2O8QA 5AVPA 3JB8A 5FY1A 3VBHC 1GNYA 2IXLA 3ZYIB 2XOMA 1HJGA 4N90A 5FKBA 3ECQA 5A7NA 1UMIA 2E53A 4DO0A 3TN91 4AEJA 2MEV3 4V2VA 1H1IA 2AENA 1W2UA 2KXLA 1J58A 3CMGA 1RJ8A 3APBA 3P3PA 3MLJA 5FJKA 2VVFA 5JOWA 4LO8A 5T50A 2PQQA 4Q4Y1 2R7EB 4NIGA 3LKJA 1EPZA 1PX3A 3VBOC 5BNOA 2VMFA 1XNKA 4JKMA 1NCRA 4NRMA 3ZLIA 2R072 1QJZA 2WT2A 1ULGA 3SC7X 4PQ9A 4AI8A 3I3EA 4K1YA 3OYWB 1W8ZA 1PK6C 3T2TA 1GQHA 1DYPA 2SBAA 3O1UA 2QNKA 5FJHA 5FXWA 5JCTA 1KS4A 1W6MA 3MPBA 5F6LB 4N7UA 5T52A 3FLRA 1N3QA 1LOEA 1MZEA 2DWRA 3WF3A 3I2DA 1TVGA 5SV8A 4DXZA 4FI9A 2QQVA 5FMDA 3PURA 4MYEA 1GANA 2HWC2 3VZJA 1FYUA 3WEZA 4TXWA 3VBUA 1X7NA 3SHRA 4RS5A 5J48A 3KV6A 3I2KA 1TMF3 4CUGA 1UMHA 1NG0A 1RUD2 4RHV2 4OQ9A 1HB4A 3MIDA 5HXVA 1AJKA 3S5QA 1F31A 2WWJA 5FPXA 5K9YA 5FTTC 5K0UC 5J1XA 2JG9C 3J8F2 4K9SA 3VHRA 1IKQA 4HKOA 1K5MA 4LHSA 4NAMA 4YW1A 2QDRA 2W0XA 1XE8A 2PHDA 3LEMA 4XZPA 4CDUB 1HXS3 4LORA 1LGNA 2MHFA 5A7PA 1F15A 3K51A 5DUUA 1XJAA 3ZSKA 2ZXQA 4QX5A 2DYCA 3H1MA 4A6SA 2B9VA 3OGSA 1QWRA 2VCCA 4WM7A 5F5IA 3ORJA 2GZWA 2Q8OA 4CDUC 1ZZBA 4G4FA 5DABA 1GZTA 2ARCA 3LDRA 4GA9A 2UWBA 4LO7A 4YRDA 5CG8A 3PIJA 5LCWL 1YO8A 2YXSA 4HFSA 1IQAA 4Y33A 1Q8QA 4PI0A 4Y20A 1QIQA 1N3OA 3KVAA 4OI1A 1PX4A 4CCCA 3S57A 4LKDA 3ENRA 2GC0A 2A6YA 3LGRA 1GWKA 3NAPA 1X9TA 4LR4A 4EN9B 1HB3A 1ZM1A 3ZXLA 2G9ZA 3OGVA 4BQWA 4AOCA 1FATA 3WV6A 1V6JA 4LOTA 2JDAA 2WLQA 3G6JB 1GNHA 3H42B 1S0CA 3KB5A 1EYBA 2R1BA 3WZ1A 2Q1ZB 5LB6A 2WZR2 3K2OA 4ZHNA 5DDJ3 4XURA 1BLZA 4QHOA 1COV2 2XQXA 5KHHA 2VZSA 5FZDA 4E9KA 1CQ9A 1H2KA 1G6NA 3WQ0A 4AI2A 1AXZA 4IE4A 3MIFA 5LW9A 1M06G 1TNFA 2W94A 1IHMA 1JTZX 2VZRA 3EJKA 1XE7A 3N7LA 3OEAA 5BV6A 4Q27A 3TN92 5JSPA 3PIGA 4XETA 1W9TA 1W0PA 5CKQA 4UW6A 4MADA 2PLV1 3BVCA 3D5OA 1AX1A 2QQWA 5EHDA 4Q4Y2 4QWNA 1KQRA 4JQRA 5D21A 4M00A 4FP3A 3M3QA 3AJZA 4YVWB 5FPBA 2RMU1 3RMYA 2E6VA 3R05A 5IVEA 3UGFA 3BOPA 3N7JA 3CJIA 4FAHA 1HN0A 4JDNA 3U07A 2R1DA 1FPN3 1QOTA 1F35A 1ASJ1 4LBMA 5T55A 4YVWC 2VD7A 1JYTA 2CV6A 1AXKA 5IW0A 2IXKA 2VOWA 3N9PA 3TNPB 1SLCA 4I09A 2GNTA 1GOGA 2E9QA 1DZQA 2J1AA 4KU7A 2XB6C 1DGWX 2A71A 3AMNA 4AG4A 1VJ2A 1VRBA 3SCHA 2A75A 4PI2A 2DBIA 2FCUA 2LROA 1MEC3 2Y6LA 5FZ6A 3VBFB 1AR91 3NV1A 4NIDA 3SCGA 4LBQA 3KD4A 5JPNB 5L7OA 3C7OA 3POFA 4IGOA 2FDJA 5JDBA 4I0WB 2PA7A 4CYDA 3VBFC 3ZFGA 4KQ7A 2PHWA 2CDOA 2D43A 2CNAA 3ZYBA 3VDAA 2XJTA 2AREA 4AW7A 5E1RA 5FY9A 2BEOA 4QGNA 4B1LA 2BOJA 5IAXA 4HONA 4K21A 1KDMA 4NRQA 3KV5A 2DF7A 3WCRA 5JLVA 5LA1A 4IEZA 1Y9MA 3OBZA 3R4DB 5K8SA 1SFPA 4CEWA 3BCWA 1RUH1 4CCEA 3RZZA 4XJUA 3RFRA 2BGPA 3WP6A 1JODA 1AR83 3MIHA 1OF3A 3GDBA 3PVNA 3MBWA 3KV9A 4P9XA 1AJOA 1ZBE3 2FBEA 2V4VA 3MF6A 4YW7A 3VD7A 4CCDA 2JB8A 1UZ0A 3NJYA 1ZNPA 1PGL1 1W8OA 3USUA 4WM8C 4FPYA 3U11A 3SLIA 4ATEA 4FTBA 2BJSA 4LO4B 1OOPB 4CP0A 3E5QA 4Y22A 1OSGA 4S2HA 3ZXGA 1UX6A 3HD8B 2FDGA 3D6EA 4OI0A 4KG8A 3NKGA 5JUVA 1XNBA 4LBJA 1Q3EA 2C1FA 2O14A 4XUNA 3RGBA 3PLQA 1CAVB 3F95A 4BXFA 2C24A 3ACGA 1OURA 4UFMA 2PYTA 2OZ6A 4MOAA 5CVRA 5GLWA 4BIOA 4IXLA 3J26N 2ZGOA 5CFDA 3U75A 1OKQA 1VAVA 1Z78A 2E31A 2H0VA 4YVSA 5FLJA 4AFCA 5AFEA 1QNWA 4JHTA 1GV9A 4CDWB 4DFSA 3H3ZA 1H4GA 3QH6A 3T3YA 5C4WC 3VHNA 3K46A 1FOD1 1RUG1 2Z2SB 1G86A 2G4IA 1W2OA 4PDWA 4U2AA 4HKLA 4Y4RA 2CWSA 5EYXA 1JMUB 5GALA 3VBHA 4Y4YA 3GZUC 5AC91 4Z1VA 2YROA 3BALA 2P34A 1CESA 3LEKA 4DEVA 3L2YA 1RUE1 2R073 5FYHA 4CDWC 5IFTA 1SLAA 2JKBA 5KXBA 1GZCA 3W9AA 1YWKA 3OOXA 4OI2A 5FYBA 1DQ1A 3N36A 3F2ZA 1ULOA 5KHJA 1JOBA 4FT8A 2W3JA 4XFCA 1AZDA 1LENA 3ROUA 2F17A 1EP0A 1JYVA 3SEPA 2VOKA 5FZEA 1APNA 3EYPA 4INDA 4L8QA 1W0OA 3VBOA 3OBTA 1T6BX 3I3QA 4AAPA 2ZX3A 2YGMA 5FYSA 1K5JA 4FQZA 5J3UA 3OGJA 5F8PA 1I5PA 1AR92 1QH6A 2JDZA 4DUWA 1RUD3 3HR9A 1NX9A 1PK6A 4N7IA 2XHNA 4RHV3 4X6QB 3VHOA 2FZ2A 1SFNA 1A8MA 1SBFA 1WZXA 2A6VA 1ND3B 1CAUB 3OJBA 3J8F3 1DG6A 1PO12 5DAQA 1Y43B 2GNDA 1C5IA 3M4FA 4D8MA 1LEDA 3PU8A 5C9AB 3K4DA 5K7PA 2FDKA 1IS4A 3BB6A 2K2SA 5IVBA 1OVSA 4JTNA 5A3UA 4UBHA 4MUVA 4M0HA 5F32A 1FX5A 1ND3C 4QGMA 1L7RA 5JOYA 4PT6A 4GMP1 4AI0A 1YQCA 3ON7A 5IJRA 4YM3A 1RUH2 3JB4C 1TG7A 5K0UA 2JG9A 4QU2A 5C9AC 1A3KA 5FZ7A 4WVMA 1B35B 2AH2A 4GH4C 2BOIA 3AZXA 5KXCA 3LOBA 1OC1A 5LA9A 2MEV1 2TBVA 4OFGA 4IEXA 1G9BA 4M0NA 1POQA 1PGL2 3B5LB 1H6XA 3N7KA 4ASMB 1SEFA 3AL5A 2PFWA 4NPLA 1VMFA 1SACA 3PMSA 2DU0A 3BTAA 4R52A 5JI9A 2VTFA 4AFBA 4CDUA 1NCQB 5FPLA 1W6PA 3PL0A 5GKAC 4M3CF 4C90A 3PUQA 2VMHA 5JSRA 3IM0A 2WZR3 2Z79A 3PDQA 1GZ9A 1ULFA 4AXOA 5A3NA 5C3PA 3T0BA 1COV3 4YYOA 3ZPYA 1YJLA 4XILA 4BH9A 2VTXJ 3LSDA 2D3RA 3MV01 1NYWA 3GCXA 3GBFA 1LR5A 3LWCA 4IERA 4MGKE 2WYFA 1BEV1 1W8HA 3C7GA 4AVAA 4PIYA 1NCQC 1ZRFA 2B5HA 4AI1A 3ZKUA 2ZGPA 4LPLA 3LIGA 5FO7B 5KR7A 4FXGB 2P6CA 2YDEA 3LD8A 3RPQA 1CAXB 3ZPOA 1D2QA 3ETQA 5BUVA 2DU1A 2Y6HA 5DXDA 2AC1A 5LZ6A 3HNMA 5DPNA 3VHPA 1DQ0A 3IIAA 4QKFA 2YU2A 4QKNA 1HB1A 2J7MA 1SZBA 1IPJA 1OF4A 4Q2FA 1G9AA 1EV12 1FOD2 3AKPA 4CDXB 5FZKA 3WUDA 1EAH3 1TMF1 1NLSA 3OUHA 1A78A 1OPOA 1X36A 1UYZA 2IUWA 5AC92 3Q8EA 1I9RA 3DPRC 2QQMA 1UOFA 4QQPA 3WNPA 4Z07A 1NUKA 2H6CA 2WQZC 4QMAA 5FQ0B 2UYBA 3I49A 4L97A 4CUBA 1JOJA 4FPGA 3PUSA 1XE0A 3NRUA 2ZX1A 1HLCA 4MGQA 2BERA 3JXSA 2WWUA 2BQPA 1GQPA 4QDQA 4U36A 4FTSA 5T5LA 3B93A 2LALA 2J1UA 2K46A 2X09A 3FFZA 3J7HA 2GC1A 3DYPA 4AQTA 5H9SA 5IFPA 2ILMA 4LKSA 4XBQA 5LWBA 2RHPA 2JG8C 4XQ4A 1S2KA 2NZ9A 1XSQA 3MEPA 4HL0A 2WZPP 1AX0A 4XOGA 1QDCA 2XL7A 1RL3A 3AMQA 3L2HA 2J1RA 4YVWA 1J1LA 4Z2WA 5C3SA 2ZOEB 2VECA 5B4XA 4PLMA 4X8NA 2WINB 2OZJA 5IT6A 3UESA 3ZFEC 4BLIA 2CL2A 4OQ8A 3JU9A 4BQ2A 3ZMOA 4A7ZA 1ZA7A 3GALA 5CEHA 2FDIA 4Q4V1 1B09A 2ID4A 4IGPA 1P8JA 4P5HA 2D93A 3T2PA 3MFCA 3OY8A 2WFF1 5DDJ1 2MNGA 1T2XA 2CGNA 3E6DA 2W1WA 1SLBA 1IG3A 1POV0 2L9LA 4FPFA 5C70A 2YPDA 2ARBA 4AVTA 4B4QA 2DCJA 3KSCA 3A21A 3KF3A 1UYYA 2SLIA 3NVCA 3VBFA 4IESA 2WC2A 1R1ZA 2PHRA 4D6RA 2ZEXA 3VKNA 1GLHA 2VCAA 1LU1A 2BZDA 3ELNA 5EJZB 4XXPA 5FMBA 3CLPA 3JQWA 1KEXA 5DQ0A 3H1WA 4LHKA 5A80A 3RZGA 4HK9A 4GAZA 2Q0AA 1BQPA 5JI7A 1M4WA 4FPKA 5JOZA 2GN3A 5F9TA 2NN8A 5I8SA 3PU3A 1YIFA 1DQ2A 1BEV2 4BM8A 5HPOA 4PJYA 1WMFA 1FPN1 1PM4A 5C33A 5FYTA 2XLAA 1R081 1RINA 1V6OA 5FWEA 3GJBA 3MPPG 1W8WA 5CZKA 2W1QA 3MGUA 2XVGA 2ADEA 4Q8KA 3AKTA 4WM8A 4BQ5A 1F4AA 3MO4A 4BZ4A 2BNNA 5HI0A 3IDAA 3WW1A 5DUXA 2FZ1A 4YPJA 3RJ2X 1HJFA 5FOJB 1JYXA 1C1FA 1JI6A 3H1YA 1MS3A 1NXMA 2RE9A 3ILNA 5A33A 1YI7A 1UZVA 2UYAA 2A70A 2BU9A 3I2IA 2Y60A 4TTGA 1MEC1 4XAAA 1DGWA 5CADA 4UF0B 2EALA 3ZXJA 3UJQA 1CAWA 1GKBA 3KHBA 4JQTA 5DAVA 3RJRA 5BNPB 2PXJA 4ZS2A 1F5JA 4NWWA 1OLMA 4ASLA 3W5NA 5FMOL 3AKRA 5FYVA 3RVHA 5ABJB 4GZ9A 4URTA 5KWRA 1CAVA 2DV9A 5C4WA 4JGYC 4ORFA 2JE9A 2XLFA 5A6YA 2ZGRA 3AFGA 4N8MA 5I0UA 1IOAA 2BNOA 4COYA 1OH3A 2JIJA 3NV2A 3POBA 4L99A 1KGYA 2DDUA 5FYUA 2JJ6A 4E2SA 3OGRA 2HYXA 3UL2A 4URAA 1R091 4JHZA 4CDWA 1MQTB 1AR93 4HANA 1N47A 1Q8SA 2PHUA 5DG1A 2ADDA 4GQ7A 4LULA 1AR81 1WCUA 2W1SA 3HMYA 1GR3A 5A6QA 2YMZA 4Y5Z0 5CFCC 1OKOA 4IV1C 1NXD1 5CU1A 4CPBD 1PO13 3CU7A 3H7JA 1UW8A 1YQ5A 3I3DA 1OLME 2AZ5A 1R64A 4KWUA 1OUSA 5J98B 3MI8A 3VUOA 2JDHA 2R30A 2F4LA 5FV3A 5LY2A 4D7TA 5EZWA 3LSEA 1KJRA 1OLRA 1QOOA 3PVBB 4Q4V2 1W6OA 1SFYA 2V72A 3ZX7A 3NNLA 5CKNA 1DQ4A 2WFF2 5DDJ2 1LRHA 2CGOA 3WHUA 4ZZ5A 4EN7B 1TE1B 4NROA 3LIHA 4DIQA 2RDNA 4GJZA 1RUH3 5G04L 3WNLA 1W2NA 3I2HA 4HVOA 3LCPA 2ZGTA 1XXNA 4COVA 2H6BA 1L7LA 5DZEA 1O59A 1GUIA 2X5IC 2E26A 1Q8PA 3AYCA 5F6KA 5BY5A 4QD2A 5F3CA 3M7AA 4OUEA 1GZWA 3AXEA 3WF2A 2UURA 3WX5A 3O1RA 4AHXA 5CISA 2EF6A 4DUXA 4Q0UA 1ND3A 5FY0A 4F83A 2MPFA 3OB8A 4CDQB 4EQVA 4EJRA 2JIGA 1RUJ1 5GZGA 2Z4FA 1MS9A 3EBRA 2EXHA 4HLTA 5C9AA 3WW4A 1ULPA 2NPIA 2BYVE 2BWAA 2RG4A 5A3LA 4GH4A 4FTEA 4HN0A 1DDLA 4MX3A 2R071 4I02A 5LK5A 3H3LA 5J37A 1LAJA 3WUCA 3S5AA 1FPN2 4MVTA 5FYMA 1R082 2AACA 3TAYA 4QXCA 5FXVA 4RFT0 1A34A 3IPVB 1CJDA 1S0IA 3FJSA 4XBNA 1AXYA 1UY1A 2ZGLA 4D6QA 1PNFA 5C8CC 4YFWA 1XYPA 4DB5A 4NHMA 3ZN4A 3CNAA 1S2BA 3EQEA 1SBDA 3DEMA 3UV9A 3ZR5A 5IK7A 2Q30A 1F8VA 1D2SA 2OT7A 3DKQA 2D6PA 5KHGA 1EV13 1FOD3 1YXWA 2ENRA 2WAAA 4UWDA 4XF3A 1N1TA 4D69A 5BNQA 1J84A 5JR7B 1NKGA 3VD9A 4BA6A 1RUD1 4RHV1 1NCQA 5KC6A 2NP0A 4AFDA 2R061 5AC93 2P3IA 1UY0A 4Q0SA 4R9DA 2BGCA 2HWE2 5HCHA 5LRSA 4UW3A 4CCJA 2HKXA 3T08A 1UU6A 2O8OA 3NJVA 4CEYB 2IFWA 2VMCA 3DXTA 1URXA 4CZSA 3VN4A 2WA3A 1H0BA 1RXGA 1VIWB 4XUOA 2HWF2 2WNUB 3VBSC 2VZQA 1ZX5A 3DPRA 3KQ4B 3M3CA 4MHRA 4XUTA 4ATFA 5CA6A 1R092 2ZGSA 3AZYA 2B46X 3HPNA 4IE7A 4QX8A 4P9YA 2K0GA 4GD4A 1BHGA 5CB7A 5J7MA 4XAEA 4MGZE 4XFGA 2QZ2A 1AR82 2JX9A 2ZGKA 3T1MA 4LBNA 4ES8A 2ZCWA 1SG3A 3PVEA 2WZ8A 2GU9A 4ZU4A 2WNUC 1JOPA 3CJXA 1ODMA 2V5YA 2VNOA 2D6KA 3K77A 5FZMA 3T2QA 3WP4A 3ZIXA 1QJY1 4BQXA 2O0OA 1H8TB 1OQ1A 3KS7A 4FPCA 4N43B 4HVRA 3ATGA 2A1XA 1AR72 2JG8A 1LEMA 2X10A 4WVVA 1GNZA 1I1EA 4K20A 3I2OA 5J96B 4KL1A 3I2FA 1VAKA 4GMP3 4BJ0A 4RD7A 2BVVA 4Y24A 3RS6A 2QJVA 4CXYA 1ZZ6A 2RR13 2Q4SA 5FZOB 3O12A 4FSJA 1ULDA 1XPWA 1V6NA 1S4CA 1UU4A 1W8UA 3U14A 4EWAA 2P37A 3ITQA 3ZFEA 4QKDA 3R4UA 2ZBJA 1D4M3 4BU2A 1LKNA 3I54A 1BCXA 4TYSA 4OUMA 4D7SA 1QJEA 3HEIA 1GOFA 4LITA 5G05L 2VUCA 4CXXA 5F37A 3IWZA 2ET1A 2QTWB 1O8PA 3P3NA 2HEYF 2DFBA 3TB0A 5DMYA 1NQDA 3ASIA 2WABA 4IV3B 2B7YA 1RUJ2 3PTRB 4LOSA 4P9GA 4QPGB 4UXAA 5KXEA 4OZXA 4XDPA 4ARYA 1JZ7A 1AYM1 2GMEA 3QACA 2OS2A 1EAH1 4LMFA 3RZMA 1N1VA 2BFUS 3IDEA 3WDUA 4P14A 3LEGA 4MV2A 4LUKA 4NRPA 1MS1A 5DUWA 4XXAA 4IV3C 1FMD1 1BEV3 2QKDA 3ACIA 3HJRA 2BPA2 3S0MA 4CP9A 3O5SA 2I45A 2NM1A 1U5YA 3R4SA 1SPPB 1LNSA 5D8AB 4ISQA 4AF9A 4YGCA 5LK7B 2JKXA 1PMJX 3HN1A 4QQOA 4QB1A 2D6OX 2V73A 2HBTA 4R9BA 4AI9A 3I59B 4N53B 5A3PA 5I0DA 2CTVA 5F3IA 2LM3A 5HXMA 4DOUA 2XBO1 1WLWA 1BMV1 5FPZA 1SDWA 3A22A 3BODA 1Q8VA 3OF1A 5DAWA 5C5UA 4Z2AA 5EJ1B 1W6NB 3C7HA 1Z7S1 4YM0A 3RWKX 4I01A 3UKVA 2FD8A 2DVAA 4Y5SA 3KM5A 2R062 3BTXA 5HV0A 4LKEA 2UWAA 4OHYA 3AZWA 4UAPA 2OQ7A 1HQNA 3I4IA 2QQNA 3MYXA 1US2A 1LCLA 1DLCA 1LOCA 2QQLA 1C8M1 3HWJA 4CA9A 5JZGB 4QX1A 1QJU2 4M01A 4COZA 1WLCA 3K48A 4ITCA 4DY3A 4FOQA 4P9LA 3RRDA 2DVFA 4DPNA 4PF5A 1C28A 5FREA 5FZFA 1BVP1 2XVLA 4GALA 2EIDA 1QNYA 3FHAA 3KCYA 2GC2A 2QQOA 1R1A1 1RJ7A 4O9EA 5FYIA 4RSUA 2PMWB 2HWB2 2E33A 1LU2A 1ZYBA 4I3PA 1PIV3 1UYPA 4JGYA 4LBKA 3V0BB 1IS5A 3IAPA 4Y1ZA 1QJY2 4AZZA 4ES9A 2BTVC 1DGRA 2XJQA 3WG3A 2TEPA 5T5OA 4Q4V3 4BCUA 3WQ1A 4IDZA 2WFF3 1UPSA 3M1HA 5FY7A 2ZACA 5LATA 3DYOA 2IWGB 1Q56A 4RQPB 4Y1UA 5CFCA 2LS6A 4LIVA 5EPAA 1UQXA 4WVZA 4IV1A 2QFEA 5FY5A 1JYIA 4GWMA 1W6QA 2NQYA 5FKCA 3SCFA 4OLLA 4QQLA 1YUDA 5IHRA 2VOXA 4IEVA 4GXLA 2WSVA 1ND2B 3AYDA 2RJLA 5GLTA 1N1YA 1UCXA 3E6CC 3D0SA 1RYYA 3MIGA 2XWBB 3OTFA 5A7SA 4EZ4A 4ISRA 3HQXA 2YHJA 3T4HB 1LHOA 2XH6A 3WF4A 1LJ7A 3E6BA 4FXKB 4PLNA 3UNPA 4B3NA 1AYM2 3W59A 1KDKA 2RM21 1EAH2 2XUMA 3VB9A 2I74A 2JDKA 1OQEA 3N3HA 3IB3A 1AX2A 2X5IA 4GIQA 2WBKA 2VW1A 4IEUA 1JH5A 3UYJA 3WW3A 1JYCA 4LIUA 1FMD2 1QEXA 2BBAA 3H3UA 2VPVA 2XMLA 1J1TA 1R083 3O1PA 2EIGA 2Q1FA 4DZGA 1MS8A 1O8SA 2VO5A 1LOAA 2XONA 1D0GA 2ZA9A 4YG3A 3WLUA 4EE2A 4KG0A 4YW4A 1YNAA 3TYJA 3ZO0B 1G8WA 1UOJA 3AP5A 4NOTA 4XC9A 3PNAA 3W20A 2RS12 4QPIB 3QH7A 2XBO2 4KWJA 1BMV2 2VBDA 4CUAA 3VKMA 4C1WA 1LOFC 1Z7S2 2C26A 2NLRA 2A6ZA 1RHI2 1H6YA 2CSGA 4XTPA 1PMHX 3OCPA 3MUY1 3PMEA 1E57A 4JCKA 1KFXL 1PMIA 4LUMA 1NE4A 3A0KA 4KH9A 2ARXA 5L73A 1CWPA 4CSWA 3ABZA 2HWD1 1GQGA 3FHIB 3ZOIA 5M0TA 2HWE3 4QPYA 3UGHA 4I3GA 4A6OA 3KGLA 4YM2A 3HQUA 3M2MA 1GYKA 1PO11 3OD4A 3M8LA 5C8CA 4QAWA 2BBVA 4NIAA 1ST8A 1WBFA 1FT9A 3VZMA 1O91A 2ZAAA 2IVIB 2ZABA 4K7JA 5FP4A 1RIRA 1C8M2 1NA1A 2VOVA 2QQUA 2X53S 5L36A 5A1AA 3TOJA 4PBPA 5L19A 2VNGA 5FZGA 4WV8A 2VOTA 1JBCA 2O1QA 2VGDA 2HWF3 2PTMA 2ZX2A 3T0AA 4CE8A 1PGW2 5BNNB 3BIEA 3RZJA 1R093 1JZ3A 3H9AA 2GP5A 2JDYA 4PIZA 3UKNA 1HV0A 3WDXA 1R1A2 3I2GA 1AVBA 3VDCA 4DMIA 3ACLA 5JXJA 1O5LA 4XMAA 4CP2A 1VBB1 1PHMA 3NJZA 1QQP3 5BNNC 4FVVA 1UOGA 4ASKA 4KWKA 4B1MA 1ZZCA 3LFMA 4LLFA 4PF1A 3THPA 3VDDB 3B02A 3O1TA 4LK7A 2B39A 4EZHA 3P1IA 2WJSA 3I3BA 1KFUL 3O1MA 1WUVA 3VBSA 2ETEA 2CGPA 4XF1A 1AR73 4CVUA 2XG3A 4MXWA 4Q4W2 1OPMA 5AFBA 5EV7A 3VGIA 3JQXA 3B9CA 2OQ6A 4YW6A 5KHKA 3DECA 3VDDC 4XPVA 3D8CA 5T54A 5TSWA 1E5RA 2WNUA 3DGTA 3ZXEA 4B8EA 1IZ3A 1SHWB 3B7MA 2K9ZA 1OOPC 4XHXA 4XFFA 3OGGA 1RITA 2CYFA 4BHPA 2VULA 5JWPA 1PO22 4J1XA 1RUJ3 1W9SA 2Q1MA 3CIHA 3UT0A 4TWTA 3ME2A 3TNQA 2PHFA 1GICA 4LEJA 2RM22 1EV11 2XVKA 3ZSLA 1L7QA 2VUJA 4BQ3A 3WNKA 5A3TA 5JPMB 2VCMA 3UJOA 2JXAA 2P5BA 3C7EA 1Y3TA 2VZPA 4P9IA 3JD73 2WSUA 4ZU7A 1S55A 3NJXA 2WS92 3JZVA 5FPUA 1ZVFA 2C9KA 4MGTA 4IL7A 4AEDB 2LTNA 5JR2A 5FZOA 1JU4A 1QJFA 3P5BA 3N9MA 4GB31 3ZN6B 1F4HA 2VUDA 3PJQA 5GZDA 3POSA 3U37A 4AGGA 4XJAA 4YZ2A 4EN8B 4ONUA 1GWMA 1UKRA 1O3TA 1RUNA 1FNYA 5JIAA 5GM0A 2G9GA 4AEDC 2BDRA 4BISA 1HW5A 1QDOA 4IEPA 4RR3B 4FBFA 1W03A 4RA0A 2YV8A 1EUUA 4IV3A 4IW3A 1DHKB 1OVPA 3ZMNA 2R063 3THTA 3N35A 4TN7A 2HWD2 3N9QA 3AMHA 2VQ0A 4R4ZA 2Q8DA 3I3MA 2VXRA 3NV3A 3Q8FA 4RR3C 1Q43A 3ILFA 2JE8A 2E7QA 3CBNA 5CBLA 5FYYA 1GP4A 4NHXA 5FPAA 5JMCA 1C1LA 3PTYA 3OYWA 2YYOA 4XDQA 1O3SA 5GLVA 1QJU3 2UY8A 1SPPA 1W05A 2AUYA 2IFRA 1SCSA 1QMJA 2ZTNA 3GXUA 3U10A 3VL8A 3WR0A 1GP5A 3I59A 3B69A 3LDKA 3ZXKA 5F7UA 1XU1A 2RR11 4AVCA 4HK8A 2DURA 2PHXA 1VMHA 2WNEA 4ZONA 4BE3A 5F2SA 2Y6KA 3HNYM 4J25A 3V64A 1S0DA 1W6NA 3GHNA 2W52A 2HWB3 1VBB2 1D4M1 1MS4A 2C5DA 4LA2A 3CQOA 3LOIA 4ZXKA 4CRQA 2ATFA 3QD6A 4F7ZA 3RI8A 2ET7A 4GKYA 2VY0A 3SNMA 4D3WA 1QJY3 3KLSA 3ACHA 4V2WA 1O7FA 1PNGA 1B35C 3FWEA 3QOPA 3BN6A 3G7DA 3VBRB 1W9WA 1PM7A 5FWJA 2GALA 3MHZA 5C3OA 1NQJA 4DEQA 3WD5A 2H0BA 2YY1A 4J6GA 3NNFA 2WQ4A 4O65A 4OHWA 1X8MA 3LDBA 4XF0A 3H8OA 1BBT3 1U5XA 1RUC1 4A7KA 3KT1A 3H7YA 2JDPA 2OA2A 1O3RA 2GSYA 3A0NA 3VBRC 4BQYA 4Q8LA 4QX0A 4MHUA 5ANQA 5FY4A 3WG1A 3MW2A 4AVVA 5E88A 4KU8A 1AR63 3T30A 2B9UA 1VR3A 4M4RA 3MUZ1 5IK8A 2GDFA 4QB6A 1X9PA 2W47A 3PUAA 3WG4A 1SLIA 1YEWA 3VZNA 1AYM3 3GZTB 4CCNA 2P3YA 3D3AA 5A3OA 4AL9A 1OFSA 4C1XA 1WD4A 5FRAA 1FAYA 5CKMA 2Q8EA 4CCLA 3WDVA 2P6HA 3ZYPA 1ZBA1 4O9GA 1W04A 2WL1A 1O4TA 1L3JA 1FMD3 1UXXX 3M3EA 3MDPA 3NKTA 4P5YA 5FXZA 4A42A 3GZEA 1QKQA 4W6YA 1US3A 1XRUA 4CDXC 1DF0A 2FCVA 2VC9A 2TNFA 4GB32 4QT6A 4YWAA 2JDNA 5B4NA 1Y7BA 3OPWA 1HRV1 2XHKA 5FK8A 3U4XA 2QQPA 2W2IA 4JZRA 3VDBA 4XHBA 4QM8A 1RMU1 2RS31 4BQ1A 2RS13 5H9RA 2XBO3 5FZLA 3GJAA 3LB9A 5EWSA 3DCQA 3AP6A 4Q4X1 1Z7S3 5EQUA 4CCMA 3D4KA 3UGGA 3THCA 1RHI3 3VZOA 2B45X 1OD5A 3O1OA 3N4MA 2QQJA 3AZVA 4E4ZA 2YG0A 1CIYA 1OD3A 1D0HA 3S6PA 2DBNA 1PIV1 1W9FA 1KXGA 1VLNA 5IATA 4I0AA 2VQAA 3KHCA 4IUGA 2ZPXA 1C8M3 4XF4A 4B4PA 4KBZA 1ODNA 1OH4A 1LOFA 2EXJA 1NAEA 4UI9L 2YC2A 2EAAA 3O14A 4H7MA 5FUNA 3SH3A 3NMBA 2LUWA 2IXJA 4TLFA 3SH5A 2A3XA 2QQKA 3B01A 3OPTA 5F5AA 2RR12 3WDWA 1CPMA 2VMEA 2VZOA 1X8EA 4R8HA 1SLLA 1Z0HA 1OA2A 3AYAA 2GAUA 3PUIA 1R1A3 2DCTA 2J1TA 2PAMA 2WR9A 4XFIA 5CG9A 1D4M2 1YLLA 5KXDA 3DV8A 3MFAA 1GP6A 4M3CB 4XFAA 3ZN5A 3ZXAC 5DAXA 3BYWA 2Y6FA 4UFIA 1H9PA 3K3NA 3VKFC 5BNOB 3WNXA 1ZA4A 3RZLA 3KV4A 1NCRB 2ZX0A 4MLOA 4NHLA 3WP5A 1H9WA 1RUI3 2W1UA 3MICA 4HN1A 1ZREA 2EXIA 4Q4W3 3U78A 1UIJA 1UD1A 2RDQA 1H30A 3IMMA 1IS3A 1N3PA 2TUNA 3KCCA 2ZHKA 4PLOA 5BNOC 1WW4A 4YZ1A 5A7WB 1TME1 1UMZA 4YW5A 1RUC2 5BNNA 1JYNA 2BNMA 1UY3A 1O4ZA 2QZ3A 1CN1A 3FL7A 3IIIA 2WN3A 2CY6A 4XVHA 5APAA 3K4ZA 4R4XA 4E8CA 4JVAA 3OPZA 1ACCA 1N1SA 4RS5B 4LE3A 3HBKA 1PVC1 4XYXA 2JDUA 1ZZ8A 4OZOA 1CX4A 5LRRA 3MW3A 5LBEA 4L0PA 2JDMA 3FZ3A 3NNGA 2ORXA 5A3MA 1PO23 5ANNA 1BKZA 5K4LA 1IGOA 2VBPA 4ZS3A 1QY4A 4A41A 2RM23 5JXHA 2ZHMA 2IXHA 1JU3A 4QXKA 1X50A 2V09A 5A3WA 1X82A 4WZFA 1WA6X 5F39A 1ZBA2 3AP7A 4QDSA 1OOPA 2WN2A 5C7GA 2HWE1 2WS93 4CU6A 5LY1A 1UF2C 4GWJA 2PAKA 3O0VA 2KR2A 5F5CA 3ZFFB 4G9SB 5JXIA 1OT5A 3A4UA 4K1ZA 1HRV2 2XGXA 3AVRA 4WM7B 4XQWA 4LKFA 5JSOA 2X05A 1OA3A 2ZZJA 1C3HA 1RXFA 1RMU2 3URFA 2RS32 3FBYA 5I0RA 2EICA 5FZ3A 5BNPC 1GU3A 3TEZA 3H0OA 3MZHA 4QQHA 1WCKA 2FMYA 5E8AA 3O7OA 2HWF1 1LODA 2QBXA 1BZWA 2YFZA 3C8XA 1LTEA 4Q4X2 3ZFFC 1W0NA 5ABJC 1UOBA 4MXVA 4K40A 1V6KA 4LTAA 3NAPB 3VLBB 5D2AA 4JKLA 1CPNA 4QHZA 2ZKNA 2B4KA 2HWD3 3HT2A 4XJZA 3WW2A 3WNNA 2FDFA 5FMOS 3TRSB 4YZ3A 3ZYGA 4AHYA 1PIV2 1QQP1 3DF0A 5LASA 2D5FA 1CONA 1DLLA 4LHLA 1W8NA 1MQTC 4UFLA 4GKXA 4OMDA 1CGPA 4Y5TA 3BGAA 2D3SA 4QDRA 1QJX1 4AEDA 3ILRA 1MVQA 4D0QA 3SMHA 4C0HA 1AR71 5JIUA 1UZWA 3ZN6A 2RV9A 2UWCA 1J3RA 2P4EA 3LAGA 1BK1A 2OX0A 4YLZA 1LHNA 5I8YA 1XC6A 4Q29A 2A6WA 3VKLA 2VZTA 4RR3A 2OUHA 1G9DA 1MR5A 5GZCA 4NPRA 1VBB3 3PHMA 5FBZA 2JWPA 1MVEA 5LA0A 2VMIA 2VZUA 2W87A 3LA3A 4E27A 1CAUA 4YW2A 3RDIA 2J1SA 3RG0A 5IYYA 4RN5A 4IETA 1CZSA 3CJIB 4B29A 1UU5A 3DKWA 4DINB 2UU8A 2A5ZA 2BVBA 4QU1A 4BK4A 2BUKA 4CCKA 3FFQA 2D6LX 3JD71 4JDMA 4N9IA 4RGAA 4DQAA 1TME2 4CDQC 1A6CA 1RTVA 3RQ0A 1RVF2 1HN1A 3ZKYA 2JD4A 1IQDC 2R0FA 4QPWA 2ZHNA 3KWVA 2DVBA 4XJ8A 1B35A 1DFQA 1PVC2 3KCXA 4QGLA 2N7GA 3OG2A 1UYXA 1YQ2A 4KWLA 1G9FA 4NHKA 3RYRA 3JBG1 3S7EA 4BB3A 5JMOA 5LEJA 1HRI2 2B8MA 2R043 3ES1A 4NJ4A 1BVVA 2VAUA 2V4AA 3EHKA 4OCTA 3POIA 4E4HA 5FDBA 1JZ5A 1XNTA 1TEIA 3WY6A 1DZTA 1GSLA 1PZ9A 1F9KA 4FOWA 3ZXFA 1V6MA 3FLPA 3ZFGB 3BUCA 1U12A 1S2EA 3AZZA 3VBRA 3J7MA 5FP9A 2BV4A 2WNVB 1K3IA 4HXCA 3EO6A 1V9U1 5IK4A 3SQOA 4BK5A 2NMNA 1DYOA 1UWWA 4HT1T 4GB33 4XMIA 3NL1A 1WW6A 4CEWB 1XYOA 3TBDA 1XBFA 2VQTA 4P9WA 1QJU1 4N9HA 1A8DA 1JYWA 3ZYJB 2G9FA 1J83A 1QU0A 1QOSA 2RDRA 3M3IA 1IPKA 3N7MA 1LOGA 2WNVC 1CAXA 4TSVA 5BPXA 3RI9A 4AHZA 2WLPA 3U4SA 1VP6A 3SKJE 3Q9OA 5FPVA 3RZHA 4WBBA 4CEYC 1VRH1 4PIXA 4AGVA 4M4PA 3HVDA 1F2NA 4CXWA 4QQ2A 2DFCA 3AYEA 5FFOC 5KBFA 4IE0A 3USUB 4AVSA 4CDXA 1UPIA 2HWB1 4H3WA 4S2GA 1QQP2 5L9BA 1SMVA 4KI5M 1EPWA 3O0WA 2AYHA 3OSDA 2XKOA 3NSTA 1ALYA 4Y22B 4DS0A 5FQ0A 1NZCA 4Y1YA 1QJX2 4GWIA 1CVNA 2JEMA 3BPSA 1BYHA 4V1PA 1VBE1 1H1AA 1W90A 4CTEA 2J1EA 1AHSA 1DP0A 3B00A 2FHRA 1S0BA 3POJA 1QGLA 5J36A 2F6BA 3ZR6A 1YQ6A 4G3YC 3KMHA 1H8TC 3AKSA 4H14A 4AQSA 4COWA 5CFDB 4N43C 2XPJA 1BBT1 3I2JA 2ZMNA 4JRLA 1KD7A 2V5DA 3CHXA 4XDOA 5A32B 3ZIWA 1WW7A 2I2SA 3ZDSA 4AFMA 1WMXA 3H8XA 1ZRDA 1WCSA 4DRRA 4ARXA 1W2TA 4PDWB 5FOBB 1AR61 3KF5A 3VBHB 2KM2A 1V6IA 5DZGA 5JVVA 2P17A 2W91A 3WCSA 3LEIA 1UAIA 2ES3A 1GWLA 1H1MA 2W95A 4A44A 2OYZA 1YIPA 3OBAA 4JKKA 3C2UA 4HG6B 1UY2A 3CKHA 4NR1A 5ACA1 1RB8G 1JW6A 1HB2A 2QCSB 2VCBA 3BU7A 3JD72 1DYKA 5T5PA 1XNCA 1I5ZA 2EA7A 3POWA 2FDHA 1S0EA 4QPGC 1C5HA 1PZ8A 1RUC3 3WHTA 4KNCA 2E7TA 3VV1A 3VBOB 5GLZA 4AAXA 5ISLA 2OVUA 2P3KA 2R32A 3ZYHA 2XJUA 3OEBA 3JBG2 1PK6B 2RS11 1CIWA 2VZ3A 2PAEA 3B3QE 1JHNA 4NVPA 1S0JA 3GCWA 4M3CA 3D0JA 2WO1A 5HCAA 1FV2A 2WIIB 4GWNA 5D8AC 4DRVA 2ARAA 1W28A 5LEKA 1RHI1 3FHQA 4Y1VA 4AHWA 2PQSA 4B7KA 2Y0OA 4X6RB 4N53C 1W39A 1Y9QA 2R16A 3TEYA 1ZBA3 5IVJA 2VNVA 5LA2A 4C91A 1PGSA 2WT0A 3AMMA 3FX3A 4Q0QA 4Q0PA 1V9U2 4COUA 2VW0A 3HNBM 1JUHA 3HOBA 2Y6GA 4LXLA 2QDNA 5A7WA 2JENA 2Y38A 1HRV3 1QXJA 2HJIA 1WLTA 4E2GA 5K0UB 1V0AA 2JG9B 1VB2A 1AUYA 1RMU3 2RS33 2W68A 4FPHA 4WVMB 5CAZA 5H9QA
chains in the Genus database with same CATH topology
4LKSA 1SHWB 3K75B 2ZEZA 2E32A 3EB7A 3K4AA 2KD7A 2J1RA 5CYYA 1W9SA 3CIHA 4A45A 4KMQA 5B4XA 4BDVB 3I97A 1L7QA 3UESA 3WNKA 3C7EA 2VZPA 2ID4A 3NJXA 1P8JA 3T2PA 4W8JA 2C9KA 3GM8A 5JR2A 1T2XA 1JZ4A 2J1VA 1JU4A 2W1WA 2VZVA 2DCKA 2L9LA 1F4HA 3U37A 3ETPA 5C70A 2DCJA 4ET7A 3A21A 5DN2A 1UYYA 3IAQA 2ZEXA 4XZUG 1EUUA 2VCAA 2BZDA 4JX0A 5EJZB 4ZZ8A 1KEXA 5DQ0A 3T09A 1JHJA 1WKYA 1JZ6A 2W92A 2JE8A 5HPOA 1D7PM 2Y8KA 3PUHA 3WF0A 2C4XA 2Y64A 3GXUA 4P02B 5CZKA 1UX7A 2W1QA 4E8DA 5F7UA 4OYUA 3MV11 1F4AA 3MO4A 3IDAA 4YPJA 2Y6KA 1JYXA 3HNYM 1JI6A 4DXSA 3CQOA 3I2IA 2W5FA 3SEEA 4TTGA 2RVAA 2VL4A 4DUVA 3AC0A 3ACHA 1K45A 3W5NA 3C7FA 3BN6A 3VD3A 1W9WA 3WF1A 4GZ9A 4DEQA 2WQ8A 1GNYA 3HN3A 2XOMA 1JZ2A 3ECQA 2VQUA 1UMIA 1KGYA 2DDUA 4QX0A 3OGRA 2HYXA 4P08A 4JHZA 3CMGA 4M4RA 3MUZ1 2W1SA 4QB6A 2W47A 2R7EB 2YB7A 1PX3A 3D3AA 5EIYB 3CDZB 3I3DA 2JD9A 2VMFA 4JKMA 1R64A 4MGSA 4KWUA 2WO3A 3I3EA 2V72A 1UXXX 4P5YA 4A42A 4ZZ5A 1US3A 2VC9A 3WF3A 5B4NA 1TVGA 5G04L 3WNLA 3LPFA 3I2HA 3VDBA 4FI9A 3NQHA 1O59A 1GUIA 2E26A 4TXWA 3WEZA 4OUEA 3I2KA 3ZM8A 3WF2A 4BXSV 3THCA 1UMHA 4DUXA 3VD5A 3OB8A 3DYMA 5J1XA 2QQJA 4W4ZA 4LHSA 2YG0A 2Z4FA 1CIYA 1OD3A 4ZY9A 1ULPA 4OMCA 4IUGA 4LQRA 3W5MA 2ZXQA 1OH4A 4UI9L 1NAEA 2B9VA 2YC2A 3OGSA 2LW8A 1XNAA 2VCCA 2QQKA 1UY1A 2VZOA 2VMEA 3T2OA 5LCWL 4UOJA 3PUIA 2J1TA 1CX1A 1PX4A 3CZUA 2WAAA 3VD9A 1J84A 1NKGA 3OGVA 1UY0A 1GMMA 2JDAA 2W1UA 2Y6JA 4XURA 2XQXA 2WUHA 3FN9A 2VZSA 2WZEA 4QX2A 3T08A 3NJVA 2VMCA 4DXRA 2W94A 4CUCA 1JYNA 2VZRA 1UY3A 4XUOA 3OEAA 4XVHA 3FL7A 3IIIA 2WN3A 4E8CA 2VZQA 3K4ZA 1W9TA 4XUTA 3HPNA 4MADA 2YC4A 4OZOA 1BHGA 2BGOA 4L0PA 3VD4A 3NNGA 2ORXA 3GGLA 1SG3A 2WZ8A 4A41A 4MO3M 5JXHA 2HLEA 1JU3A 2WYSA 2CDPA 3K77A 3T2QA 1MPXA 4QDSA 2X10A 2WN2A 5C7GA 4CU6A 2ZEWA 3I2FA 2ZEYA 4GWJA 4BJ0A 2VZ1A 5JXIA 1OT5A 4DXTA 1XPWA 2X05A 1GOGA 2J1AA 2EICA 1GU3A 4AG4A 3ACFA 3LQCA 2QBXA 2YFZA 1GOFA 2Y6LA 3C8XA 3HEIA 5G05L 1W0NA 1O8PA 1UY4A 5DMYA 3THDA 2WABA 4JKLA 2W46A 3LPGA 3C7OA 2B4KA 3WNNA 4ARYA 1JZ7A 2CDOA 1W8NA 3LEGA 3VDAA 4OMDA 3BGAA 4QDRA 4D0QA 3ACIA 5FUIA 3HJRA 3CZJA 5LA1A 2RV9A 1LNSA 2VMDA 2JKXA 1PMJX 4QB1A 5I0DA 2BGPA 1K12A 1XC6A 5HXMA 2VZTA 4P00B 1OF3A 3GDBA 3A22A 3MBWA 3VD7A 2V4VA 4Z2AA 5EJ1B 3E1F1 3C7HA 5LA0A 1UZ0A 2VZUA 2W87A 2EIBA 1W8OA 2J1SA 2QQIA 5IYYA 4RN5A 1CZSA 4UAPA 4BK4A 2QQNA 1US2A 3A7QA 1DLCA 2QQLA 2VM9A 1CZTA 4QX1A 5JUVA 4CU9A 4XUNA 1HN1A 3ACGA 4MOAA 4CU7A 1IQDC 4QPWA 3LE0A 2EIDA 2E31A 3FHAA 3OG2A 1UYXA 1YQ2A 4ZXEA 2QQOA 3UETA 3WNOA 5JMOA 5C71A 4W50A 2E33A 3K46A 5JXGA 1JZ5A 3A23A 1XNTA 2VR4A 3IAPA 1WCQA 3LEKA 4DEVA 5IFTA 1GOHA 1K3IA 3F2ZA 4BK5A 1CZVA 1DYOA 3DYOA 1UWWA 1ULOA 2LS6A 2W3JA 2VQTA 1JYVA 1JYWA 3SEPA 5IHRA 1J83A 3EYPA 1K42A 3SKJE 1I5PA 1RYYA 2OKXA 4DUWA 3WQBA 1NX9A 3WNMA 2XHNA 4M4PA 1W99A 3UNPA 3WF4A 2VJXA 1EUTA 2WDBA 1UXZA 4KI5M 4D8MA 2RJ2A 2ORZA 3K4DA 3IB3A 2WBKA 2WO2A 4GWIA 1L7RA 2BBAA 4PT6A 4A3ZA 2J1EA 1DP0A 4QB2A 5IJRA 1JZ8A 1O8SA 2XONA 2VO5A 1TG7A 4PQQA 3I2JA 2V5DA 4CUAA 2C26A 4ARXA 1H6YA 4XUQA 1PMHX 1H6XA 3MUY1 2VTFA 3ABZA 2W91A 3LEIA 4RYDA 4A6OA 2W95A 4A44A 3OBAA 4QAWA 3T0BA 4JKKA 4HG6B 1UY2A 3CKHA 3MV01 2VCBA 5A1AA 3C7GA 1SDDB 4LPLA 2VOTA 3T0AA 4AAXA 2Y6HA 1JZ3A 4A4AA 3HNMA 5DPNA 3T0DA 3OEBA 3I2GA 4QX3A 2VZ3A 3VDCA 2J7MA 5JXJA 1OF4A 2W9XA 2WO1A 2J22A 2WAOA 1UYZA 3WSOA 3FHQA 2PQSA 4PF1A 2QQMA 3P1IA 3I3BA 3WNPA 1NUKA 4CUBA 4CVUA 5LA2A 4XUPA 3NRUA 3HNBM 4MGQA 2BERA 3HOBA 3JXSA 2Y6GA 2YFUA 4QDQA 1GQPA 4CU8A 2EIEA 3DECA 2J1UA 2X09A 3J7HA 3SKVA 3DYPA 3P6BA 5IFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKS A;  1SHW B;  3K75 B;  2ZEZ A;  2E32 A;  3EB7 A;  3K4A A;  2KD7 A;  2J1R A;  5CYY A;  1W9S A;  3CIH A;  4A45 A;  4KMQ A;  5B4X A;  4BDV B;  3I97 A;  1L7Q A;  3UES A;  3WNK A;  3C7E A;  2VZP A;  2ID4 A;  3NJX A;  1P8J A;  3T2P A;  4W8J A;  2C9K A;  3GM8 A;  5JR2 A;  1T2X A;  1JZ4 A;  2J1V A;  1JU4 A;  2W1W A;  2VZV A;  2DCK A;  2L9L A;  1F4H A;  3U37 A;  3ETP A;  5C70 A;  2DCJ A;  4ET7 A;  3A21 A;  5DN2 A;  1UYY A;  3IAQ A;  2ZEX A;  4XZU G;  1EUU A;  2VCA A;  2BZD A;  4JX0 A;  5EJZ B;  4ZZ8 A;  1KEX A;  5DQ0 A;  3T09 A;  1JHJ A;  1WKY A;  1JZ6 A;  2W92 A;  2JE8 A;  5HPO A;  1D7P M;  2Y8K A;  3PUH A;  3WF0 A;  2C4X A;  2Y64 A;  3GXU A;  4P02 B;  5CZK A;  1UX7 A;  2W1Q A;  4E8D A;  5F7U A;  4OYU A;  3MV1 1;  1F4A A;  3MO4 A;  3IDA A;  4YPJ A;  2Y6K A;  1JYX A;  3HNY M;  1JI6 A;  4DXS A;  3CQO A;  3I2I A;  2W5F A;  3SEE A;  4TTG A;  2RVA A;  2VL4 A;  4DUV A;  3AC0 A;  3ACH A;  1K45 A;  3W5N A;  3C7F A;  3BN6 A;  3VD3 A;  1W9W A;  3WF1 A;  4GZ9 A;  4DEQ A;  2WQ8 A;  1GNY A;  3HN3 A;  2XOM A;  1JZ2 A;  3ECQ A;  2VQU A;  1UMI A;  1KGY A;  2DDU A;  4QX0 A;  3OGR A;  2HYX A;  4P08 A;  4JHZ A;  3CMG A;  4M4R A;  3MUZ 1;  2W1S A;  4QB6 A;  2W47 A;  2R7E B;  2YB7 A;  1PX3 A;  3D3A A;  5EIY B;  3CDZ B;  3I3D A;  2JD9 A;  2VMF A;  4JKM A;  1R64 A;  4MGS A;  4KWU A;  2WO3 A;  3I3E A;  2V72 A;  1UXX X;  4P5Y A;  4A42 A;  4ZZ5 A;  1US3 A;  2VC9 A;  3WF3 A;  5B4N A;  1TVG A;  5G04 L;  3WNL A;  3LPF A;  3I2H A;  3VDB A;  4FI9 A;  3NQH A;  1O59 A;  1GUI A;  2E26 A;  4TXW A;  3WEZ A;  4OUE A;  3I2K A;  3ZM8 A;  3WF2 A;  4BXS V;  3THC A;  1UMH A;  4DUX A;  3VD5 A;  3OB8 A;  3DYM A;  5J1X A;  2QQJ A;  4W4Z A;  4LHS A;  2YG0 A;  2Z4F A;  1CIY A;  1OD3 A;  4ZY9 A;  1ULP A;  4OMC A;  4IUG A;  4LQR A;  3W5M A;  2ZXQ A;  1OH4 A;  4UI9 L;  1NAE A;  2B9V A;  2YC2 A;  3OGS A;  2LW8 A;  1XNA A;  2VCC A;  2QQK A;  1UY1 A;  2VZO A;  2VME A;  3T2O A;  5LCW L;  4UOJ A;  3PUI A;  2J1T A;  1CX1 A;  1PX4 A;  3CZU A;  2WAA A;  3VD9 A;  1J84 A;  1NKG A;  3OGV A;  1UY0 A;  1GMM A;  2JDA A;  2W1U A;  2Y6J A;  4XUR A;  2XQX A;  2WUH A;  3FN9 A;  2VZS A;  2WZE A;  4QX2 A;  3T08 A;  3NJV A;  2VMC A;  4DXR A;  2W94 A;  4CUC A;  1JYN A;  2VZR A;  1UY3 A;  4XUO A;  3OEA A;  4XVH A;  3FL7 A;  3III A;  2WN3 A;  4E8C A;  2VZQ A;  3K4Z A;  1W9T A;  4XUT A;  3HPN A;  4MAD A;  2YC4 A;  4OZO A;  1BHG A;  2BGO A;  4L0P A;  3VD4 A;  3NNG A;  2ORX A;  3GGL A;  1SG3 A;  2WZ8 A;  4A41 A;  4MO3 M;  5JXH A;  2HLE A;  1JU3 A;  2WYS A;  2CDP A;  3K77 A;  3T2Q A;  1MPX A;  4QDS A;  2X10 A;  2WN2 A;  5C7G A;  4CU6 A;  2ZEW A;  3I2F A;  2ZEY A;  4GWJ A;  4BJ0 A;  2VZ1 A;  5JXI A;  1OT5 A;  4DXT A;  1XPW A;  2X05 A;  1GOG A;  2J1A A;  2EIC A;  1GU3 A;  4AG4 A;  3ACF A;  3LQC A;  2QBX A;  2YFZ A;  1GOF A;  2Y6L A;  3C8X A;  3HEI A;  5G05 L;  1W0N A;  1O8P A;  1UY4 A;  5DMY A;  3THD A;  2WAB A;  4JKL A;  2W46 A;  3LPG A;  3C7O A;  2B4K A;  3WNN A;  4ARY A;  1JZ7 A;  2CDO A;  1W8N A;  3LEG A;  3VDA A;  4OMD A;  3BGA A;  4QDR A;  4D0Q A;  3ACI A;  5FUI A;  3HJR A;  3CZJ A;  5LA1 A;  2RV9 A;  1LNS A;  2VMD A;  2JKX A;  1PMJ X;  4QB1 A;  5I0D A;  2BGP A;  1K12 A;  1XC6 A;  5HXM A;  2VZT A;  4P00 B;  1OF3 A;  3GDB A;  3A22 A;  3MBW A;  3VD7 A;  2V4V A;  4Z2A A;  5EJ1 B;  3E1F 1;  3C7H A;  5LA0 A;  1UZ0 A;  2VZU A;  2W87 A;  2EIB A;  1W8O A;  2J1S A;  2QQI A;  5IYY A;  4RN5 A;  1CZS A;  4UAP A;  4BK4 A;  2QQN A;  1US2 A;  3A7Q A;  1DLC A;  2QQL A;  2VM9 A;  1CZT A;  4QX1 A;  5JUV A;  4CU9 A;  4XUN A;  1HN1 A;  3ACG A;  4MOA A;  4CU7 A;  1IQD C;  4QPW A;  3LE0 A;  2EID A;  2E31 A;  3FHA A;  3OG2 A;  1UYX A;  1YQ2 A;  4ZXE A;  2QQO A;  3UET A;  3WNO A;  5JMO A;  5C71 A;  4W50 A;  2E33 A;  3K46 A;  5JXG A;  1JZ5 A;  3A23 A;  1XNT A;  2VR4 A;  3IAP A;  1WCQ A;  3LEK A;  4DEV A;  5IFT A;  1GOH A;  1K3I A;  3F2Z A;  4BK5 A;  1CZV A;  1DYO A;  3DYO A;  1UWW A;  1ULO A;  2LS6 A;  2W3J A;  2VQT A;  1JYV A;  1JYW A;  3SEP A;  5IHR A;  1J83 A;  3EYP A;  1K42 A;  3SKJ E;  1I5P A;  1RYY A;  2OKX A;  4DUW A;  3WQB A;  1NX9 A;  3WNM A;  2XHN A;  4M4P A;  1W99 A;  3UNP A;  3WF4 A;  2VJX A;  1EUT A;  2WDB A;  1UXZ A;  4KI5 M;  4D8M A;  2RJ2 A;  2ORZ A;  3K4D A;  3IB3 A;  2WBK A;  2WO2 A;  4GWI A;  1L7R A;  2BBA A;  4PT6 A;  4A3Z A;  2J1E A;  1DP0 A;  4QB2 A;  5IJR A;  1JZ8 A;  1O8S A;  2XON A;  2VO5 A;  1TG7 A;  4PQQ A;  3I2J A;  2V5D A;  4CUA A;  2C26 A;  4ARX A;  1H6Y A;  4XUQ A;  1PMH X;  1H6X A;  3MUY 1;  2VTF A;  3ABZ A;  2W91 A;  3LEI A;  4RYD A;  4A6O A;  2W95 A;  4A44 A;  3OBA A;  4QAW A;  3T0B A;  4JKK A;  4HG6 B;  1UY2 A;  3CKH A;  3MV0 1;  2VCB A;  5A1A A;  3C7G A;  1SDD B;  4LPL A;  2VOT A;  3T0A A;  4AAX A;  2Y6H A;  1JZ3 A;  4A4A A;  3HNM A;  5DPN A;  3T0D A;  3OEB A;  3I2G A;  4QX3 A;  2VZ3 A;  3VDC A;  2J7M A;  5JXJ A;  1OF4 A;  2W9X A;  2WO1 A;  2J22 A;  2WAO A;  1UYZ A;  3WSO A;  3FHQ A;  2PQS A;  4PF1 A;  2QQM A;  3P1I A;  3I3B A;  3WNP A;  1NUK A;  4CUB A;  4CVU A;  5LA2 A;  4XUP A;  3NRU A;  3HNB M;  4MGQ A;  2BER A;  3HOB A;  3JXS A;  2Y6G A;  2YFU A;  4QDQ A;  1GQP A;  4CU8 A;  2EIE A;  3DEC A;  2J1U A;  2X09 A;  3J7H A;  3SKV A;  3DYP A;  3P6B A;  5IFP A; 
#chains in the Genus database with same CATH topology
 2WNO A;  3K75 B;  1O6U A;  2ZEZ A;  4S2D A;  1SQ4 A;  2D7F A;  4IGQ A;  2E32 A;  3KVB A;  4M3C E;  1PGW 1;  4JC1 A;  4Q4X 3;  4D94 A;  1VRH 2;  3SIT A;  2KD7 A;  1AL2 1;  4FO9 A;  2ZHL A;  4BMB A;  5JZG C;  2Y0I A;  3RZK A;  4A45 A;  4BDV B;  4P9J A;  1AYN 1;  3I97 A;  3QCW A;  4ZKT B;  2D40 A;  5GJ6 A;  4XTM A;  4UF0 A;  1W6P B;  2CWM A;  3FC0 A;  1VB4 A;  3USS A;  1W9Y A;  2AEY A;  3AJY A;  5BNP A;  1VBD 2;  4LBQ D;  1GBG A;  3FUO A;  3GZA A;  1RUF 1;  1RUI 1;  4DNY A;  3ZFF A;  1H8V A;  1VBE 2;  5ABJ A;  2VBB A;  3RYK A;  4Q4W 1;  2P1B A;  4OI4 A;  2R6Q A;  1JZ4 A;  2J1V A;  4TZD A;  4NE9 A;  2VZV A;  1WCD J;  3CF6 E;  1W06 A;  2DCK A;  4XAC A;  3ETP A;  5F5Q A;  1VAM A;  1H2M A;  1JN2 P;  2J42 A;  1BBT 2;  5FLH A;  3H8R A;  1WWY A;  2XKP A;  2YBK A;  5EFU A;  3H8U A;  3OBR A;  1MQT A;  2A3W A;  3D82 A;  5FZH A;  3DN7 A;  4XZU G;  4XIK A;  4R9C A;  1VBA 1;  1YFU A;  2D3P A;  4YGD A;  5H9P A;  4RQP C;  5HCB A;  1OUX A;  1Y4W A;  1AR6 2;  4FP2 A;  4ZZ8 A;  2YGL A;  3M70 A;  5F1R A;  1VBC 2;  1ZRR A;  1PO2 1;  1WW5 A;  2C6S A;  4MGI E;  4NHY A;  3IT8 A;  4WVW A;  4Y26 A;  5HCF A;  3T09 A;  1W8T A;  2WKK A;  4NPM A;  2XXZ A;  2W92 A;  3AL6 A;  3ZXD A;  3O1V A;  1ND2 C;  1F5F A;  4JGZ B;  1V00 A;  2XL9 A;  5ACA 2;  4W6W A;  3NNJ A;  4Y3O A;  4YM1 A;  5T3N A;  3N9L A;  4AQ2 A;  1KS5 A;  2Y8K A;  3CO2 A;  1TME 3;  1AF9 A;  2C4X A;  2G1M A;  2Y26 A;  2Y64 A;  4FPJ A;  2WS9 1;  5FLI A;  3WF0 A;  1NLQ A;  1RVF 3;  3POG A;  2VTX A;  4P02 B;  2OW4 A;  1LB2 A;  4Z8B A;  1UX7 A;  2R0H A;  1W3V A;  3GBW A;  4JGZ C;  4OYU A;  4AI3 A;  1E5H A;  5FAX A;  4HMZ A;  1DBN A;  1PVC 3;  4D6S A;  2YPJ A;  1NE6 A;  2JB4 A;  1HRI 3;  4XEZ A;  1MZ5 A;  4ZU5 A;  2AGS A;  4HZF A;  3SEE A;  3MF9 A;  1GFF 2;  2WRA A;  3E5U A;  2GMP A;  2HEV F;  2VL4 A;  4L2N A;  3SXW A;  4BPZ A;  4CDQ A;  3AC0 A;  3W58 A;  4YZ4 A;  3B9I A;  1K45 A;  4UYB A;  2EXK A;  1ENR A;  4QPI C;  1UL9 A;  2D97 A;  1S0G A;  2VNR A;  3C7F A;  3PJY A;  5EP9 A;  3VD3 A;  1HX6 A;  2A7A A;  3OD0 A;  4AWD A;  3OY8 B;  4UBG A;  5BYN A;  4MG2 A;  5F3E A;  3S30 A;  1S1A A;  4NIH A;  2WQ8 A;  1AL0 G;  2HH9 A;  3HN3 A;  4HET A;  4K6B A;  1T6G C;  1JZ2 A;  4OHV A;  5I91 A;  3IPV A;  2RJK A;  2VQU A;  2GNB A;  4IEO A;  2Q8C A;  2I07 B;  2HEW F;  4IE5 A;  3TEX A;  4P08 A;  1REF A;  4S2F A;  3X29 B;  1AL2 2;  5F2W A;  5A1F A;  2YC0 A;  1W3X A;  3Q8A A;  2BW8 A;  3WT3 A;  2X8K A;  3ZSJ A;  1AYN 2;  4FFI A;  4GUL A;  5DAP A;  2YB7 A;  4E2Q A;  3I7D A;  5FZ9 A;  5EIY B;  3CDZ B;  4LNV A;  2JD9 A;  4Q1P A;  4MGS A;  1POV 3;  2CAU A;  2WO3 A;  4ERO A;  3BI3 A;  4NAO A;  4EWD A;  3OUI A;  2WNV A;  3BKZ A;  3AK0 A;  1QJX 3;  1IPS A;  3QBQ A;  4L92 A;  1RUF 2;  3CL1 A;  4KGQ A;  1RUI 2;  4O7X A;  4OVE A;  4E4D X;  1WD3 A;  4LK6 A;  5IVY A;  4H55 A;  4NO4 A;  1I3H A;  4Q26 A;  4CEY A;  2OPW A;  1V6L A;  3BOW A;  1C8N A;  2FQP A;  3INA A;  4Q0V A;  3AKQ A;  2DUQ A;  3MLL A;  3LPF A;  4BIF A;  4GJY A;  4YGE A;  3FLT A;  4FCA A;  3GYD A;  3ST7 A;  4WM8 B;  5CNA A;  3NQH A;  1ZZ7 A;  4RL7 A;  2Z42 A;  3BTY A;  1ENQ A;  4GMP 0;  5A33 B;  2PN5 A;  2W39 A;  3J4U H;  3ZM8 A;  4FQ4 A;  4BXS V;  1VBA 2;  4FFG A;  1WA4 A;  2XLG A;  3AVS A;  3UKT A;  2VVE A;  3VD5 A;  3L9J T;  4LO5 B;  2YUE A;  5A7O A;  3DYM A;  1LGC A;  5FBJ A;  2D98 A;  2AR6 A;  5E6H A;  4LE4 A;  1CAW B;  1HIX A;  2PHT A;  2R04 1;  1FV3 A;  4W4Z A;  5IVF A;  4ZY9 A;  2VXJ A;  4FFH A;  4LBL A;  4L9B A;  1H8T A;  1RED A;  1H2N A;  1XU2 A;  4NWV A;  4OMC A;  4EYU A;  4N43 A;  2E51 A;  4LQR A;  3CEW A;  3V65 A;  3W5M A;  2WT1 A;  4K8R B;  4XW3 A;  3WDT A;  3DUI A;  1ZRI A;  5C4W B;  4UFK A;  3HT1 A;  1MS0 A;  4A7Y A;  1CJP A;  2LW8 A;  4XE9 A;  1XNA A;  4NUB A;  4DY5 A;  1UIK A;  1HQW A;  2DCY A;  2ZJC A;  1XND A;  2QUO A;  1H2L A;  1JUI A;  4JRA A;  4XAB A;  2PLV 2;  4XQD A;  3T2O A;  4UFH A;  3J7L A;  2GNM A;  2IXI A;  5A32 A;  3B94 A;  3IMN A;  3GF6 A;  4UOJ A;  5I93 A;  1VAL A;  3O1S A;  2ZGQ A;  3JBG 3;  1CX1 A;  5GZE A;  1JXN A;  3CZU A;  3IZO A;  1Q8O A;  4QHB A;  5FP7 A;  5FO9 B;  1YFY A;  2EAK A;  2RMU 2;  4LLO A;  1WBL A;  4AYU A;  4XBL A;  1XB9 A;  2YBP A;  3E5X A;  3FE5 A;  4QPG A;  1OI6 A;  4PCR A;  2OPK A;  1GMM A;  1ASJ 2;  2W08 A;  2ZZQ A;  4B7E A;  3V56 A;  4FPO B;  4QXB A;  2Y6J A;  1W6O B;  5JAX A;  1UO9 A;  4OHX A;  1V9U 3;  2DVD A;  2WUH A;  2WZE A;  3FN9 A;  4QX2 A;  5DG2 A;  1LHU A;  4XCA A;  5FYZ A;  4XCB A;  1NY7 1;  4Q1R A;  3HBZ A;  4DXR A;  5A6X A;  3MIE A;  4OHZ A;  2HWC 3;  5D8A A;  2ZGM A;  1X33 A;  4CUC A;  2DUP A;  1YQ8 A;  2VG9 A;  3JCI A;  2Z5W A;  3C3V A;  3KQR A;  2VU9 A;  4IEW A;  5LBB A;  1J3P A;  2VW2 A;  5FP8 A;  4N53 A;  2CU5 A;  1GZW B;  4FPE A;  1RUO A;  2YC4 A;  3W21 A;  1U5Z A;  5FY8 A;  2BGO A;  1VRH 3;  4HPK B;  4I0B A;  3J7N A;  3VD4 A;  2ZS6 B;  5A1L A;  3GGL A;  4UW4 A;  4XFH A;  2RS5 1;  1DQ6 A;  3BIW E;  4Z82 A;  5FYC A;  3POE A;  4XJ9 A;  4MO3 M;  2HLE A;  2D6M A;  1QHD A;  3SIS A;  1IS6 A;  2WYS A;  2GH8 A;  4O61 A;  5L9V A;  2CDP A;  2JIC A;  4XJW A;  2XJP A;  3GNE A;  4GH4 B;  1MPX A;  1U0A A;  1VBD 3;  2P3J A;  2A73 B;  2ZEW A;  1VBE 3;  2ZEY A;  4FFF A;  4FPL A;  3ZSE A;  2VZ1 A;  3BU0 A;  1WMD A;  2XJR A;  5JZG A;  4YG6 A;  2YU1 A;  1RC6 A;  3IN9 A;  5BXX A;  1YFW A;  2XJV A;  4DXT A;  4LT5 A;  4LO6 B;  1YYN A;  1E5I A;  1NT0 A;  3IBM A;  1Y9G A;  1CR7 A;  2HBU A;  3MIB A;  3ZYF A;  5IVC A;  3ACF A;  4AGR A;  2ERF A;  4FOV A;  3LQC A;  2Q5T A;  2XQR A;  4Q5O A;  1KIT A;  1REE A;  1H4H A;  1UY4 A;  4WZC A;  3THD A;  4UFJ A;  1LEC A;  5D1I A;  2ZGN A;  4RGG A;  4C0B A;  2W46 A;  3LPG A;  4BYY A;  2Y34 A;  1VBC 3;  2QE3 A;  2R04 2;  3Q8B A;  1BK0 A;  3V0B A;  1PZ7 A;  1QXP A;  3LFI A;  1YCI A;  5KC5 A;  4Z92 B;  5ACA 3;  3RWN A;  3WVJ A;  3JUU A;  3AX4 A;  2GC3 A;  3LA7 A;  2KA3 A;  1W8F A;  5FUI A;  1MAC A;  3CZJ A;  4AVB A;  2VMD A;  2JE7 A;  4RQP A;  3TN9 3;  3ZYR A;  1C4R A;  3DL3 A;  2OUJ A;  1KRI A;  3SH4 A;  3DPR B;  1OXC A;  2BWC A;  5FZC A;  4B4R A;  1K12 A;  3AFK A;  3OUJ A;  3U1X A;  1ND2 A;  4P00 B;  4Q4Y 3;  3WG2 A;  1RUG 2;  3WQ7 A;  4AE2 A;  3AP4 A;  2Z69 A;  3E1F 1;  5DZF A;  5GZF A;  3BTZ A;  2EIB A;  4SBV A;  1IG0 A;  3N9O A;  4BOW A;  3V0A B;  1RUE 2;  2C0Z A;  2QQI A;  1W2A X;  4OUS A;  5E89 A;  2NMO A;  3KZ4 C;  1YI9 A;  4JGZ A;  5FZ8 A;  2JG8 B;  1Q5O A;  3KT7 A;  1HXS 1;  4HOO A;  4A3X A;  1NY7 2;  3A7Q A;  2ZX4 A;  3WOG A;  4YFZ A;  4JDO A;  1IKP A;  2VM9 A;  1CZT A;  4IEQ A;  2ZKL A;  4W6X A;  4EV0 A;  4HKW A;  5FZ4 A;  3WIN E;  3RNS A;  3ZVX A;  4CU9 A;  2R49 A;  5L9R A;  2DVG A;  5EXO A;  2F4P A;  4CU7 A;  3ZFE B;  4EWE A;  5CIR A;  1UZY A;  1SCR A;  5HV4 A;  1YRZ A;  2DCZ A;  3LE0 A;  5LBF A;  4QPI A;  4YAR A;  1YHF A;  3LF7 A;  3MW4 A;  1UN1 A;  4OUL A;  4IEY A;  1AL2 3;  4ZXE A;  3UET A;  1NOV A;  4HSL A;  3WXP A;  3WNO A;  5C71 A;  1YJK A;  2RS5 2;  1I6X A;  4W50 A;  1AYN 3;  4L11 A;  1FXZ A;  5JXG A;  2PHL A;  3A23 A;  1ULC A;  2VR4 A;  1E5S A;  5IVV A;  3FMG A;  1WCQ A;  1XSR A;  2BRT A;  2FCT A;  1GOH A;  3AP9 A;  1DQ5 A;  1RUF 3;  3NNM A;  2GMM A;  1OLQ A;  5FXX A;  4E4S A;  1ZZ9 A;  3R6S A;  4CP9 B;  1WLD A;  1CZV A;  4MET A;  4NII A;  3T4V A;  2DTW A;  1W6M B;  2GN7 A;  1ENS A;  1NCR C;  1QF3 A;  1O5U A;  1RVF 1;  2EVX A;  2MEV 2;  3WDY A;  4QX7 A;  5FZ0 A;  1C57 A;  1K42 A;  4AR2 A;  1FNZ A;  3LA2 A;  3VBU B;  5E16 A;  4BME A;  4UT5 A;  2OKX A;  1VBA 3;  3WQB A;  3WNM A;  3R0R A;  1BJQ A;  1W99 A;  2VJX A;  1OMI A;  1EUT A;  4SLI A;  1OBN A;  1BXH A;  1HRI 1;  3H50 A;  2WDB A;  2IZW A;  1UKG A;  2VUA A;  3DXU A;  1S0F A;  2PEL A;  4RFR B;  3T1L A;  1UXZ A;  1LHV A;  1DU3 D;  4HBN A;  1DGL A;  1K5M B;  1V70 A;  3VBU C;  3VDD A;  1CD3 G;  2RJ2 A;  2ORZ A;  3NV4 A;  1MZ6 A;  2C9A A;  4PBO A;  4RS5 C;  5I0S A;  1YFX A;  2ZGU A;  2HYK A;  2WO2 A;  3FBM A;  5FCC A;  2QVS B;  4YW3 A;  4PHZ A;  1VPH A;  1O4Y A;  3EMR A;  1VE0 A;  3K3O A;  1SLT A;  4A3Z A;  4QB2 A;  2AEZ A;  4X8P A;  1TNR A;  1JZ8 A;  1K5M C;  2UY9 A;  3KGZ A;  1STM A;  1SBE A;  5KHI A;  2PLV 3;  2P2K A;  1DIW A;  2D6N A;  4LJH A;  4PQQ A;  2VMG A;  2WFP A;  3E97 A;  3U0Z A;  1NZI A;  3HQR A;  1D4V B;  5B2G B;  3EXU A;  1TMF 2;  3O0X A;  1OQD A;  4Y20 B;  4BWO A;  5A6Z A;  2RMU 3;  4XUQ A;  2ZML A;  4WM7 C;  4JGY B;  1OFN A;  4Y1X A;  5C3R A;  4AEK A;  4NMI A;  4HSJ A;  1LHW A;  5GLU A;  1ASJ 3;  1HDK A;  4RYD A;  1G7Y A;  4C8D A;  4QKB A;  5AVA A;  1HXS 2;  2XWJ B;  2CHH A;  1POV 1;  3MLK A;  4FAG A;  4YSF A;  3RYP A;  3NAP C;  1ONA A;  5CFC B;  4K8F A;  4IV1 B;  3TEW A;  1SDD B;  3I8T A;  1W6Q B;  2DTY A;  2YBS A;  3M3O A;  3RMX A;  5EYY A;  2VH9 A;  4JAA A;  5FR3 A;  2D5H A;  2XDV A;  3J9S A;  2XUE A;  3NW4 A;  5SV5 A;  1WME A;  1LOB A;  1DCS A;  4A4A A;  3GHM A;  3IDB B;  5C5T A;  5FK7 A;  3VKO A;  3T0D A;  5IK5 A;  1HV1 A;  2LRP A;  4K3U A;  4QX3 A;  5FO8 B;  3AB0 A;  1ZBE 1;  2W9X A;  2VE1 A;  3AMP A;  4I2O A;  5A7Q A;  2IVJ A;  2J22 A;  2WAO A;  3WP3 A;  3WSO A;  2D44 A;  2ZAH A;  5C8W A;  1J59 A;  1XOY A;  1ZRC A;  2CAV A;  4UW5 A;  1G9C A;  4HVQ A;  2Y33 A;  4JV4 A;  2X5I B;  3ZSM A;  1U5I A;  5C6C A;  3NO8 A;  4YGB A;  2GP3 A;  5FZ1 A;  4XUP A;  5FUP A;  5DUV A;  3POY A;  3TWI A;  2WA4 A;  2YFU A;  2G19 A;  2ZMK A;  2X29 A;  4XF9 A;  4CU8 A;  2EIE A;  3VZL A;  3SKV A;  5FP3 A;  3P6B A;  2BP6 A;  3CJI C;  5IWF A;  1HKD A;  3IDC B;  5JOX A;  3LZZ A;  1DGR N;  4HPK A;  2YZ4 A;  3EB7 A;  4R9A A;  3K4A A;  4BQ4 A;  5FIX A;  5CYY A;  5IUQ A;  4LBQ B;  1LES A;  4LHN A;  4KMQ A;  5L7O B;  5I8T A;  4JTO A;  3IKW A;  4RGK A;  2GH2 A;  4J1W A;  4H7L A;  5I0T A;  2OII A;  5C8C B;  3QLQ A;  1XQN A;  4QXH A;  1XYN A;  4AK3 A;  4TLG A;  4AFA A;  2IC1 A;  4IQP A;  3NWK A;  5FZB A;  1NA1 B;  4XIO A;  4W8J A;  3UK9 A;  3GM8 A;  5L7O C;  2WWS A;  1J3Q A;  4FOY A;  4D7Y A;  1DZR A;  3GBG A;  3AM2 A;  5IAV A;  5HBA A;  2FMD A;  3ZFG C;  1LUL A;  4ET7 A;  1ULE A;  2HWC 1;  1NA1 C;  5DN2 A;  3RSJ A;  4F8A A;  1KJL A;  5EJ3 A;  2E7A A;  3Q8C A;  4CPB A;  3N9N A;  3IAQ A;  1RUG 3;  2JEC A;  4CP1 A;  1MEC 2;  3S7I A;  1FI2 A;  3VL9 A;  3VZK A;  4JX0 A;  1OHF A;  4KGG A;  4CEW C;  3AXD A;  1RUE 3;  4IE6 A;  4KBB A;  1PVX A;  3J8F 1;  1MS5 A;  1JHJ A;  1WKY A;  4YZ5 A;  3PVO A;  2XR4 A;  3FUQ A;  4LA3 A;  1NLR A;  1ENX A;  2E63 A;  4MSV A;  3VBS B;  5J09 A;  1JZ6 A;  1O3Q A;  2RDS A;  5FZI A;  4A2U A;  4MXW B;  1YC6 1;  3KT4 A;  3ALQ A;  1VBD 1;  1D7P M;  1LGB A;  3PUH A;  4CCO A;  1QXR A;  1UZZ A;  2WO7 A;  5LBC A;  1UNB A;  1QH7 A;  1WGP A;  1JS9 A;  1TQ5 A;  1MZF A;  4E8D A;  5A70 A;  1VMJ A;  4AEM A;  4YNI A;  5C3Q A;  3MV1 1;  4H2A A;  5FMC A;  3ES4 A;  4ZPI A;  1OA4 A;  1RGS A;  3BPZ A;  4MZU A;  2IXC A;  4MGY E;  4DXS A;  4YVS B;  2B42 B;  4EN0 A;  1ZBE 2;  4XFB A;  2RS5 3;  5ERL A;  2DUO A;  4BLJ A;  2A3Y A;  3HAG A;  4MH0 E;  2W5F A;  2A6X A;  4QM9 A;  2RVA A;  3V0A A;  1TZO A;  5F3G A;  5T5J A;  4DUV A;  3ZDV A;  2VVD A;  5CFD C;  1VBC 1;  4I30 A;  4YG0 A;  4YVS C;  4F3J A;  2OXB A;  2WZR 1;  5FZA A;  2BFU L;  3WF1 A;  1COV 1;  2XJS A;  4AQ6 A;  4LBO A;  4EN6 B;  1EY2 A;  1HQL A;  2NYY A;  4W65 A;  3HIF A;  4NN0 A;  4PDW C;  2O8Q A;  5AVP A;  3JB8 A;  5FY1 A;  3VBH C;  1GNY A;  2IXL A;  3ZYI B;  2XOM A;  1HJG A;  4N90 A;  5FKB A;  3ECQ A;  5A7N A;  1UMI A;  2E53 A;  4DO0 A;  3TN9 1;  4AEJ A;  2MEV 3;  4V2V A;  1H1I A;  2AEN A;  1W2U A;  2KXL A;  1J58 A;  3CMG A;  1RJ8 A;  3APB A;  3P3P A;  3MLJ A;  5FJK A;  2VVF A;  5JOW A;  4LO8 A;  5T50 A;  2PQQ A;  4Q4Y 1;  2R7E B;  4NIG A;  3LKJ A;  1EPZ A;  1PX3 A;  3VBO C;  5BNO A;  2VMF A;  1XNK A;  4JKM A;  1NCR A;  4NRM A;  3ZLI A;  2R07 2;  1QJZ A;  2WT2 A;  1ULG A;  3SC7 X;  4PQ9 A;  4AI8 A;  3I3E A;  4K1Y A;  3OYW B;  1W8Z A;  1PK6 C;  3T2T A;  1GQH A;  1DYP A;  2SBA A;  3O1U A;  2QNK A;  5FJH A;  5FXW A;  5JCT A;  1KS4 A;  1W6M A;  3MPB A;  5F6L B;  4N7U A;  5T52 A;  3FLR A;  1N3Q A;  1LOE A;  1MZE A;  2DWR A;  3WF3 A;  3I2D A;  1TVG A;  5SV8 A;  4DXZ A;  4FI9 A;  2QQV A;  5FMD A;  3PUR A;  4MYE A;  1GAN A;  2HWC 2;  3VZJ A;  1FYU A;  3WEZ A;  4TXW A;  3VBU A;  1X7N A;  3SHR A;  4RS5 A;  5J48 A;  3KV6 A;  3I2K A;  1TMF 3;  4CUG A;  1UMH A;  1NG0 A;  1RUD 2;  4RHV 2;  4OQ9 A;  1HB4 A;  3MID A;  5HXV A;  1AJK A;  3S5Q A;  1F31 A;  2WWJ A;  5FPX A;  5K9Y A;  5FTT C;  5K0U C;  5J1X A;  2JG9 C;  3J8F 2;  4K9S A;  3VHR A;  1IKQ A;  4HKO A;  1K5M A;  4LHS A;  4NAM A;  4YW1 A;  2QDR A;  2W0X A;  1XE8 A;  2PHD A;  3LEM A;  4XZP A;  4CDU B;  1HXS 3;  4LOR A;  1LGN A;  2MHF A;  5A7P A;  1F15 A;  3K51 A;  5DUU A;  1XJA A;  3ZSK A;  2ZXQ A;  4QX5 A;  2DYC A;  3H1M A;  4A6S A;  2B9V A;  3OGS A;  1QWR A;  2VCC A;  4WM7 A;  5F5I A;  3ORJ A;  2GZW A;  2Q8O A;  4CDU C;  1ZZB A;  4G4F A;  5DAB A;  1GZT A;  2ARC A;  3LDR A;  4GA9 A;  2UWB A;  4LO7 A;  4YRD A;  5CG8 A;  3PIJ A;  5LCW L;  1YO8 A;  2YXS A;  4HFS A;  1IQA A;  4Y33 A;  1Q8Q A;  4PI0 A;  4Y20 A;  1QIQ A;  1N3O A;  3KVA A;  4OI1 A;  1PX4 A;  4CCC A;  3S57 A;  4LKD A;  3ENR A;  2GC0 A;  2A6Y A;  3LGR A;  1GWK A;  3NAP A;  1X9T A;  4LR4 A;  4EN9 B;  1HB3 A;  1ZM1 A;  3ZXL A;  2G9Z A;  3OGV A;  4BQW A;  4AOC A;  1FAT A;  3WV6 A;  1V6J A;  4LOT A;  2JDA A;  2WLQ A;  3G6J B;  1GNH A;  3H42 B;  1S0C A;  3KB5 A;  1EYB A;  2R1B A;  3WZ1 A;  2Q1Z B;  5LB6 A;  2WZR 2;  3K2O A;  4ZHN A;  5DDJ 3;  4XUR A;  1BLZ A;  4QHO A;  1COV 2;  2XQX A;  5KHH A;  2VZS A;  5FZD A;  4E9K A;  1CQ9 A;  1H2K A;  1G6N A;  3WQ0 A;  4AI2 A;  1AXZ A;  4IE4 A;  3MIF A;  5LW9 A;  1M06 G;  1TNF A;  2W94 A;  1IHM A;  1JTZ X;  2VZR A;  3EJK A;  1XE7 A;  3N7L A;  3OEA A;  5BV6 A;  4Q27 A;  3TN9 2;  5JSP A;  3PIG A;  4XET A;  1W9T A;  1W0P A;  5CKQ A;  4UW6 A;  4MAD A;  2PLV 1;  3BVC A;  3D5O A;  1AX1 A;  2QQW A;  5EHD A;  4Q4Y 2;  4QWN A;  1KQR A;  4JQR A;  5D21 A;  4M00 A;  4FP3 A;  3M3Q A;  3AJZ A;  4YVW B;  5FPB A;  2RMU 1;  3RMY A;  2E6V A;  3R05 A;  5IVE A;  3UGF A;  3BOP A;  3N7J A;  3CJI A;  4FAH A;  1HN0 A;  4JDN A;  3U07 A;  2R1D A;  1FPN 3;  1QOT A;  1F35 A;  1ASJ 1;  4LBM A;  5T55 A;  4YVW C;  2VD7 A;  1JYT A;  2CV6 A;  1AXK A;  5IW0 A;  2IXK A;  2VOW A;  3N9P A;  3TNP B;  1SLC A;  4I09 A;  2GNT A;  1GOG A;  2E9Q A;  1DZQ A;  2J1A A;  4KU7 A;  2XB6 C;  1DGW X;  2A71 A;  3AMN A;  4AG4 A;  1VJ2 A;  1VRB A;  3SCH A;  2A75 A;  4PI2 A;  2DBI A;  2FCU A;  2LRO A;  1MEC 3;  2Y6L A;  5FZ6 A;  3VBF B;  1AR9 1;  3NV1 A;  4NID A;  3SCG A;  4LBQ A;  3KD4 A;  5JPN B;  5L7O A;  3C7O A;  3POF A;  4IGO A;  2FDJ A;  5JDB A;  4I0W B;  2PA7 A;  4CYD A;  3VBF C;  3ZFG A;  4KQ7 A;  2PHW A;  2CDO A;  2D43 A;  2CNA A;  3ZYB A;  3VDA A;  2XJT A;  2ARE A;  4AW7 A;  5E1R A;  5FY9 A;  2BEO A;  4QGN A;  4B1L A;  2BOJ A;  5IAX A;  4HON A;  4K21 A;  1KDM A;  4NRQ A;  3KV5 A;  2DF7 A;  3WCR A;  5JLV A;  5LA1 A;  4IEZ A;  1Y9M A;  3OBZ A;  3R4D B;  5K8S A;  1SFP A;  4CEW A;  3BCW A;  1RUH 1;  4CCE A;  3RZZ A;  4XJU A;  3RFR A;  2BGP A;  3WP6 A;  1JOD A;  1AR8 3;  3MIH A;  1OF3 A;  3GDB A;  3PVN A;  3MBW A;  3KV9 A;  4P9X A;  1AJO A;  1ZBE 3;  2FBE A;  2V4V A;  3MF6 A;  4YW7 A;  3VD7 A;  4CCD A;  2JB8 A;  1UZ0 A;  3NJY A;  1ZNP A;  1PGL 1;  1W8O A;  3USU A;  4WM8 C;  4FPY A;  3U11 A;  3SLI A;  4ATE A;  4FTB A;  2BJS A;  4LO4 B;  1OOP B;  4CP0 A;  3E5Q A;  4Y22 A;  1OSG A;  4S2H A;  3ZXG A;  1UX6 A;  3HD8 B;  2FDG A;  3D6E A;  4OI0 A;  4KG8 A;  3NKG A;  5JUV A;  1XNB A;  4LBJ A;  1Q3E A;  2C1F A;  2O14 A;  4XUN A;  3RGB A;  3PLQ A;  1CAV B;  3F95 A;  4BXF A;  2C24 A;  3ACG A;  1OUR A;  4UFM A;  2PYT A;  2OZ6 A;  4MOA A;  5CVR A;  5GLW A;  4BIO A;  4IXL A;  3J26 N;  2ZGO A;  5CFD A;  3U75 A;  1OKQ A;  1VAV A;  1Z78 A;  2E31 A;  2H0V A;  4YVS A;  5FLJ A;  4AFC A;  5AFE A;  1QNW A;  4JHT A;  1GV9 A;  4CDW B;  4DFS A;  3H3Z A;  1H4G A;  3QH6 A;  3T3Y A;  5C4W C;  3VHN A;  3K46 A;  1FOD 1;  1RUG 1;  2Z2S B;  1G86 A;  2G4I A;  1W2O A;  4PDW A;  4U2A A;  4HKL A;  4Y4R A;  2CWS A;  5EYX A;  1JMU B;  5GAL A;  3VBH A;  4Y4Y A;  3GZU C;  5AC9 1;  4Z1V A;  2YRO A;  3BAL A;  2P34 A;  1CES A;  3LEK A;  4DEV A;  3L2Y A;  1RUE 1;  2R07 3;  5FYH A;  4CDW C;  5IFT A;  1SLA A;  2JKB A;  5KXB A;  1GZC A;  3W9A A;  1YWK A;  3OOX A;  4OI2 A;  5FYB A;  1DQ1 A;  3N36 A;  3F2Z A;  1ULO A;  5KHJ A;  1JOB A;  4FT8 A;  2W3J A;  4XFC A;  1AZD A;  1LEN A;  3ROU A;  2F17 A;  1EP0 A;  1JYV A;  3SEP A;  2VOK A;  5FZE A;  1APN A;  3EYP A;  4IND A;  4L8Q A;  1W0O A;  3VBO A;  3OBT A;  1T6B X;  3I3Q A;  4AAP A;  2ZX3 A;  2YGM A;  5FYS A;  1K5J A;  4FQZ A;  5J3U A;  3OGJ A;  5F8P A;  1I5P A;  1AR9 2;  1QH6 A;  2JDZ A;  4DUW A;  1RUD 3;  3HR9 A;  1NX9 A;  1PK6 A;  4N7I A;  2XHN A;  4RHV 3;  4X6Q B;  3VHO A;  2FZ2 A;  1SFN A;  1A8M A;  1SBF A;  1WZX A;  2A6V A;  1ND3 B;  1CAU B;  3OJB A;  3J8F 3;  1DG6 A;  1PO1 2;  5DAQ A;  1Y43 B;  2GND A;  1C5I A;  3M4F A;  4D8M A;  1LED A;  3PU8 A;  5C9A B;  3K4D A;  5K7P A;  2FDK A;  1IS4 A;  3BB6 A;  2K2S A;  5IVB A;  1OVS A;  4JTN A;  5A3U A;  4UBH A;  4MUV A;  4M0H A;  5F32 A;  1FX5 A;  1ND3 C;  4QGM A;  1L7R A;  5JOY A;  4PT6 A;  4GMP 1;  4AI0 A;  1YQC A;  3ON7 A;  5IJR A;  4YM3 A;  1RUH 2;  3JB4 C;  1TG7 A;  5K0U A;  2JG9 A;  4QU2 A;  5C9A C;  1A3K A;  5FZ7 A;  4WVM A;  1B35 B;  2AH2 A;  4GH4 C;  2BOI A;  3AZX A;  5KXC A;  3LOB A;  1OC1 A;  5LA9 A;  2MEV 1;  2TBV A;  4OFG A;  4IEX A;  1G9B A;  4M0N A;  1POQ A;  1PGL 2;  3B5L B;  1H6X A;  3N7K A;  4ASM B;  1SEF A;  3AL5 A;  2PFW A;  4NPL A;  1VMF A;  1SAC A;  3PMS A;  2DU0 A;  3BTA A;  4R52 A;  5JI9 A;  2VTF A;  4AFB A;  4CDU A;  1NCQ B;  5FPL A;  1W6P A;  3PL0 A;  5GKA C;  4M3C F;  4C90 A;  3PUQ A;  2VMH A;  5JSR A;  3IM0 A;  2WZR 3;  2Z79 A;  3PDQ A;  1GZ9 A;  1ULF A;  4AXO A;  5A3N A;  5C3P A;  3T0B A;  1COV 3;  4YYO A;  3ZPY A;  1YJL A;  4XIL A;  4BH9 A;  2VTX J;  3LSD A;  2D3R A;  3MV0 1;  1NYW A;  3GCX A;  3GBF A;  1LR5 A;  3LWC A;  4IER A;  4MGK E;  2WYF A;  1BEV 1;  1W8H A;  3C7G A;  4AVA A;  4PIY A;  1NCQ C;  1ZRF A;  2B5H A;  4AI1 A;  3ZKU A;  2ZGP A;  4LPL A;  3LIG A;  5FO7 B;  5KR7 A;  4FXG B;  2P6C A;  2YDE A;  3LD8 A;  3RPQ A;  1CAX B;  3ZPO A;  1D2Q A;  3ETQ A;  5BUV A;  2DU1 A;  2Y6H A;  5DXD A;  2AC1 A;  5LZ6 A;  3HNM A;  5DPN A;  3VHP A;  1DQ0 A;  3IIA A;  4QKF A;  2YU2 A;  4QKN A;  1HB1 A;  2J7M A;  1SZB A;  1IPJ A;  1OF4 A;  4Q2F A;  1G9A A;  1EV1 2;  1FOD 2;  3AKP A;  4CDX B;  5FZK A;  3WUD A;  1EAH 3;  1TMF 1;  1NLS A;  3OUH A;  1A78 A;  1OPO A;  1X36 A;  1UYZ A;  2IUW A;  5AC9 2;  3Q8E A;  1I9R A;  3DPR C;  2QQM A;  1UOF A;  4QQP A;  3WNP A;  4Z07 A;  1NUK A;  2H6C A;  2WQZ C;  4QMA A;  5FQ0 B;  2UYB A;  3I49 A;  4L97 A;  4CUB A;  1JOJ A;  4FPG A;  3PUS A;  1XE0 A;  3NRU A;  2ZX1 A;  1HLC A;  4MGQ A;  2BER A;  3JXS A;  2WWU A;  2BQP A;  1GQP A;  4QDQ A;  4U36 A;  4FTS A;  5T5L A;  3B93 A;  2LAL A;  2J1U A;  2K46 A;  2X09 A;  3FFZ A;  3J7H A;  2GC1 A;  3DYP A;  4AQT A;  5H9S A;  5IFP A;  2ILM A;  4LKS A;  4XBQ A;  5LWB A;  2RHP A;  2JG8 C;  4XQ4 A;  1S2K A;  2NZ9 A;  1XSQ A;  3MEP A;  4HL0 A;  2WZP P;  1AX0 A;  4XOG A;  1QDC A;  2XL7 A;  1RL3 A;  3AMQ A;  3L2H A;  2J1R A;  4YVW A;  1J1L A;  4Z2W A;  5C3S A;  2ZOE B;  2VEC A;  5B4X A;  4PLM A;  4X8N A;  2WIN B;  2OZJ A;  5IT6 A;  3UES A;  3ZFE C;  4BLI A;  2CL2 A;  4OQ8 A;  3JU9 A;  4BQ2 A;  3ZMO A;  4A7Z A;  1ZA7 A;  3GAL A;  5CEH A;  2FDI A;  4Q4V 1;  1B09 A;  2ID4 A;  4IGP A;  1P8J A;  4P5H A;  2D93 A;  3T2P A;  3MFC A;  3OY8 A;  2WFF 1;  5DDJ 1;  2MNG A;  1T2X A;  2CGN A;  3E6D A;  2W1W A;  1SLB A;  1IG3 A;  1POV 0;  2L9L A;  4FPF A;  5C70 A;  2YPD A;  2ARB A;  4AVT A;  4B4Q A;  2DCJ A;  3KSC A;  3A21 A;  3KF3 A;  1UYY A;  2SLI A;  3NVC A;  3VBF A;  4IES A;  2WC2 A;  1R1Z A;  2PHR A;  4D6R A;  2ZEX A;  3VKN A;  1GLH A;  2VCA A;  1LU1 A;  2BZD A;  3ELN A;  5EJZ B;  4XXP A;  5FMB A;  3CLP A;  3JQW A;  1KEX A;  5DQ0 A;  3H1W A;  4LHK A;  5A80 A;  3RZG A;  4HK9 A;  4GAZ A;  2Q0A A;  1BQP A;  5JI7 A;  1M4W A;  4FPK A;  5JOZ A;  2GN3 A;  5F9T A;  2NN8 A;  5I8S A;  3PU3 A;  1YIF A;  1DQ2 A;  1BEV 2;  4BM8 A;  5HPO A;  4PJY A;  1WMF A;  1FPN 1;  1PM4 A;  5C33 A;  5FYT A;  2XLA A;  1R08 1;  1RIN A;  1V6O A;  5FWE A;  3GJB A;  3MPP G;  1W8W A;  5CZK A;  2W1Q A;  3MGU A;  2XVG A;  2ADE A;  4Q8K A;  3AKT A;  4WM8 A;  4BQ5 A;  1F4A A;  3MO4 A;  4BZ4 A;  2BNN A;  5HI0 A;  3IDA A;  3WW1 A;  5DUX A;  2FZ1 A;  4YPJ A;  3RJ2 X;  1HJF A;  5FOJ B;  1JYX A;  1C1F A;  1JI6 A;  3H1Y A;  1MS3 A;  1NXM A;  2RE9 A;  3ILN A;  5A33 A;  1YI7 A;  1UZV A;  2UYA A;  2A70 A;  2BU9 A;  3I2I A;  2Y60 A;  4TTG A;  1MEC 1;  4XAA A;  1DGW A;  5CAD A;  4UF0 B;  2EAL A;  3ZXJ A;  3UJQ A;  1CAW A;  1GKB A;  3KHB A;  4JQT A;  5DAV A;  3RJR A;  5BNP B;  2PXJ A;  4ZS2 A;  1F5J A;  4NWW A;  1OLM A;  4ASL A;  3W5N A;  5FMO L;  3AKR A;  5FYV A;  3RVH A;  5ABJ B;  4GZ9 A;  4URT A;  5KWR A;  1CAV A;  2DV9 A;  5C4W A;  4JGY C;  4ORF A;  2JE9 A;  2XLF A;  5A6Y A;  2ZGR A;  3AFG A;  4N8M A;  5I0U A;  1IOA A;  2BNO A;  4COY A;  1OH3 A;  2JIJ A;  3NV2 A;  3POB A;  4L99 A;  1KGY A;  2DDU A;  5FYU A;  2JJ6 A;  4E2S A;  3OGR A;  2HYX A;  3UL2 A;  4URA A;  1R09 1;  4JHZ A;  4CDW A;  1MQT B;  1AR9 3;  4HAN A;  1N47 A;  1Q8S A;  2PHU A;  5DG1 A;  2ADD A;  4GQ7 A;  4LUL A;  1AR8 1;  1WCU A;  2W1S A;  3HMY A;  1GR3 A;  5A6Q A;  2YMZ A;  4Y5Z 0;  5CFC C;  1OKO A;  4IV1 C;  1NXD 1;  5CU1 A;  4CPB D;  1PO1 3;  3CU7 A;  3H7J A;  1UW8 A;  1YQ5 A;  3I3D A;  1OLM E;  2AZ5 A;  1R64 A;  4KWU A;  1OUS A;  5J98 B;  3MI8 A;  3VUO A;  2JDH A;  2R30 A;  2F4L A;  5FV3 A;  5LY2 A;  4D7T A;  5EZW A;  3LSE A;  1KJR A;  1OLR A;  1QOO A;  3PVB B;  4Q4V 2;  1W6O A;  1SFY A;  2V72 A;  3ZX7 A;  3NNL A;  5CKN A;  1DQ4 A;  2WFF 2;  5DDJ 2;  1LRH A;  2CGO A;  3WHU A;  4ZZ5 A;  4EN7 B;  1TE1 B;  4NRO A;  3LIH A;  4DIQ A;  2RDN A;  4GJZ A;  1RUH 3;  5G04 L;  3WNL A;  1W2N A;  3I2H A;  4HVO A;  3LCP A;  2ZGT A;  1XXN A;  4COV A;  2H6B A;  1L7L A;  5DZE A;  1O59 A;  1GUI A;  2X5I C;  2E26 A;  1Q8P A;  3AYC A;  5F6K A;  5BY5 A;  4QD2 A;  5F3C A;  3M7A A;  4OUE A;  1GZW A;  3AXE A;  3WF2 A;  2UUR A;  3WX5 A;  3O1R A;  4AHX A;  5CIS A;  2EF6 A;  4DUX A;  4Q0U A;  1ND3 A;  5FY0 A;  4F83 A;  2MPF A;  3OB8 A;  4CDQ B;  4EQV A;  4EJR A;  2JIG A;  1RUJ 1;  5GZG A;  2Z4F A;  1MS9 A;  3EBR A;  2EXH A;  4HLT A;  5C9A A;  3WW4 A;  1ULP A;  2NPI A;  2BYV E;  2BWA A;  2RG4 A;  5A3L A;  4GH4 A;  4FTE A;  4HN0 A;  1DDL A;  4MX3 A;  2R07 1;  4I02 A;  5LK5 A;  3H3L A;  5J37 A;  1LAJ A;  3WUC A;  3S5A A;  1FPN 2;  4MVT A;  5FYM A;  1R08 2;  2AAC A;  3TAY A;  4QXC A;  5FXV A;  4RFT 0;  1A34 A;  3IPV B;  1CJD A;  1S0I A;  3FJS A;  4XBN A;  1AXY A;  1UY1 A;  2ZGL A;  4D6Q A;  1PNF A;  5C8C C;  4YFW A;  1XYP A;  4DB5 A;  4NHM A;  3ZN4 A;  3CNA A;  1S2B A;  3EQE A;  1SBD A;  3DEM A;  3UV9 A;  3ZR5 A;  5IK7 A;  2Q30 A;  1F8V A;  1D2S A;  2OT7 A;  3DKQ A;  2D6P A;  5KHG A;  1EV1 3;  1FOD 3;  1YXW A;  2ENR A;  2WAA A;  4UWD A;  4XF3 A;  1N1T A;  4D69 A;  5BNQ A;  1J84 A;  5JR7 B;  1NKG A;  3VD9 A;  4BA6 A;  1RUD 1;  4RHV 1;  1NCQ A;  5KC6 A;  2NP0 A;  4AFD A;  2R06 1;  5AC9 3;  2P3I A;  1UY0 A;  4Q0S A;  4R9D A;  2BGC A;  2HWE 2;  5HCH A;  5LRS A;  4UW3 A;  4CCJ A;  2HKX A;  3T08 A;  1UU6 A;  2O8O A;  3NJV A;  4CEY B;  2IFW A;  2VMC A;  3DXT A;  1URX A;  4CZS A;  3VN4 A;  2WA3 A;  1H0B A;  1RXG A;  1VIW B;  4XUO A;  2HWF 2;  2WNU B;  3VBS C;  2VZQ A;  1ZX5 A;  3DPR A;  3KQ4 B;  3M3C A;  4MHR A;  4XUT A;  4ATF A;  5CA6 A;  1R09 2;  2ZGS A;  3AZY A;  2B46 X;  3HPN A;  4IE7 A;  4QX8 A;  4P9Y A;  2K0G A;  4GD4 A;  1BHG A;  5CB7 A;  5J7M A;  4XAE A;  4MGZ E;  4XFG A;  2QZ2 A;  1AR8 2;  2JX9 A;  2ZGK A;  3T1M A;  4LBN A;  4ES8 A;  2ZCW A;  1SG3 A;  3PVE A;  2WZ8 A;  2GU9 A;  4ZU4 A;  2WNU C;  1JOP A;  3CJX A;  1ODM A;  2V5Y A;  2VNO A;  2D6K A;  3K77 A;  5FZM A;  3T2Q A;  3WP4 A;  3ZIX A;  1QJY 1;  4BQX A;  2O0O A;  1H8T B;  1OQ1 A;  3KS7 A;  4FPC A;  4N43 B;  4HVR A;  3ATG A;  2A1X A;  1AR7 2;  2JG8 A;  1LEM A;  2X10 A;  4WVV A;  1GNZ A;  1I1E A;  4K20 A;  3I2O A;  5J96 B;  4KL1 A;  3I2F A;  1VAK A;  4GMP 3;  4BJ0 A;  4RD7 A;  2BVV A;  4Y24 A;  3RS6 A;  2QJV A;  4CXY A;  1ZZ6 A;  2RR1 3;  2Q4S A;  5FZO B;  3O12 A;  4FSJ A;  1ULD A;  1XPW A;  1V6N A;  1S4C A;  1UU4 A;  1W8U A;  3U14 A;  4EWA A;  2P37 A;  3ITQ A;  3ZFE A;  4QKD A;  3R4U A;  2ZBJ A;  1D4M 3;  4BU2 A;  1LKN A;  3I54 A;  1BCX A;  4TYS A;  4OUM A;  4D7S A;  1QJE A;  3HEI A;  1GOF A;  4LIT A;  5G05 L;  2VUC A;  4CXX A;  5F37 A;  3IWZ A;  2ET1 A;  2QTW B;  1O8P A;  3P3N A;  2HEY F;  2DFB A;  3TB0 A;  5DMY A;  1NQD A;  3ASI A;  2WAB A;  4IV3 B;  2B7Y A;  1RUJ 2;  3PTR B;  4LOS A;  4P9G A;  4QPG B;  4UXA A;  5KXE A;  4OZX A;  4XDP A;  4ARY A;  1JZ7 A;  1AYM 1;  2GME A;  3QAC A;  2OS2 A;  1EAH 1;  4LMF A;  3RZM A;  1N1V A;  2BFU S;  3IDE A;  3WDU A;  4P14 A;  3LEG A;  4MV2 A;  4LUK A;  4NRP A;  1MS1 A;  5DUW A;  4XXA A;  4IV3 C;  1FMD 1;  1BEV 3;  2QKD A;  3ACI A;  3HJR A;  2BPA 2;  3S0M A;  4CP9 A;  3O5S A;  2I45 A;  2NM1 A;  1U5Y A;  3R4S A;  1SPP B;  1LNS A;  5D8A B;  4ISQ A;  4AF9 A;  4YGC A;  5LK7 B;  2JKX A;  1PMJ X;  3HN1 A;  4QQO A;  4QB1 A;  2D6O X;  2V73 A;  2HBT A;  4R9B A;  4AI9 A;  3I59 B;  4N53 B;  5A3P A;  5I0D A;  2CTV A;  5F3I A;  2LM3 A;  5HXM A;  4DOU A;  2XBO 1;  1WLW A;  1BMV 1;  5FPZ A;  1SDW A;  3A22 A;  3BOD A;  1Q8V A;  3OF1 A;  5DAW A;  5C5U A;  4Z2A A;  5EJ1 B;  1W6N B;  3C7H A;  1Z7S 1;  4YM0 A;  3RWK X;  4I01 A;  3UKV A;  2FD8 A;  2DVA A;  4Y5S A;  3KM5 A;  2R06 2;  3BTX A;  5HV0 A;  4LKE A;  2UWA A;  4OHY A;  3AZW A;  4UAP A;  2OQ7 A;  1HQN A;  3I4I A;  2QQN A;  3MYX A;  1US2 A;  1LCL A;  1DLC A;  1LOC A;  2QQL A;  1C8M 1;  3HWJ A;  4CA9 A;  5JZG B;  4QX1 A;  1QJU 2;  4M01 A;  4COZ A;  1WLC A;  3K48 A;  4ITC A;  4DY3 A;  4FOQ A;  4P9L A;  3RRD A;  2DVF A;  4DPN A;  4PF5 A;  1C28 A;  5FRE A;  5FZF A;  1BVP 1;  2XVL A;  4GAL A;  2EID A;  1QNY A;  3FHA A;  3KCY A;  2GC2 A;  2QQO A;  1R1A 1;  1RJ7 A;  4O9E A;  5FYI A;  4RSU A;  2PMW B;  2HWB 2;  2E33 A;  1LU2 A;  1ZYB A;  4I3P A;  1PIV 3;  1UYP A;  4JGY A;  4LBK A;  3V0B B;  1IS5 A;  3IAP A;  4Y1Z A;  1QJY 2;  4AZZ A;  4ES9 A;  2BTV C;  1DGR A;  2XJQ A;  3WG3 A;  2TEP A;  5T5O A;  4Q4V 3;  4BCU A;  3WQ1 A;  4IDZ A;  2WFF 3;  1UPS A;  3M1H A;  5FY7 A;  2ZAC A;  5LAT A;  3DYO A;  2IWG B;  1Q56 A;  4RQP B;  4Y1U A;  5CFC A;  2LS6 A;  4LIV A;  5EPA A;  1UQX A;  4WVZ A;  4IV1 A;  2QFE A;  5FY5 A;  1JYI A;  4GWM A;  1W6Q A;  2NQY A;  5FKC A;  3SCF A;  4OLL A;  4QQL A;  1YUD A;  5IHR A;  2VOX A;  4IEV A;  4GXL A;  2WSV A;  1ND2 B;  3AYD A;  2RJL A;  5GLT A;  1N1Y A;  1UCX A;  3E6C C;  3D0S A;  1RYY A;  3MIG A;  2XWB B;  3OTF A;  5A7S A;  4EZ4 A;  4ISR A;  3HQX A;  2YHJ A;  3T4H B;  1LHO A;  2XH6 A;  3WF4 A;  1LJ7 A;  3E6B A;  4FXK B;  4PLN A;  3UNP A;  4B3N A;  1AYM 2;  3W59 A;  1KDK A;  2RM2 1;  1EAH 2;  2XUM A;  3VB9 A;  2I74 A;  2JDK A;  1OQE A;  3N3H A;  3IB3 A;  1AX2 A;  2X5I A;  4GIQ A;  2WBK A;  2VW1 A;  4IEU A;  1JH5 A;  3UYJ A;  3WW3 A;  1JYC A;  4LIU A;  1FMD 2;  1QEX A;  2BBA A;  3H3U A;  2VPV A;  2XML A;  1J1T A;  1R08 3;  3O1P A;  2EIG A;  2Q1F A;  4DZG A;  1MS8 A;  1O8S A;  2VO5 A;  1LOA A;  2XON A;  1D0G A;  2ZA9 A;  4YG3 A;  3WLU A;  4EE2 A;  4KG0 A;  4YW4 A;  1YNA A;  3TYJ A;  3ZO0 B;  1G8W A;  1UOJ A;  3AP5 A;  4NOT A;  4XC9 A;  3PNA A;  3W20 A;  2RS1 2;  4QPI B;  3QH7 A;  2XBO 2;  4KWJ A;  1BMV 2;  2VBD A;  4CUA A;  3VKM A;  4C1W A;  1LOF C;  1Z7S 2;  2C26 A;  2NLR A;  2A6Z A;  1RHI 2;  1H6Y A;  2CSG A;  4XTP A;  1PMH X;  3OCP A;  3MUY 1;  3PME A;  1E57 A;  4JCK A;  1KFX L;  1PMI A;  4LUM A;  1NE4 A;  3A0K A;  4KH9 A;  2ARX A;  5L73 A;  1CWP A;  4CSW A;  3ABZ A;  2HWD 1;  1GQG A;  3FHI B;  3ZOI A;  5M0T A;  2HWE 3;  4QPY A;  3UGH A;  4I3G A;  4A6O A;  3KGL A;  4YM2 A;  3HQU A;  3M2M A;  1GYK A;  1PO1 1;  3OD4 A;  3M8L A;  5C8C A;  4QAW A;  2BBV A;  4NIA A;  1ST8 A;  1WBF A;  1FT9 A;  3VZM A;  1O91 A;  2ZAA A;  2IVI B;  2ZAB A;  4K7J A;  5FP4 A;  1RIR A;  1C8M 2;  1NA1 A;  2VOV A;  2QQU A;  2X53 S;  5L36 A;  5A1A A;  3TOJ A;  4PBP A;  5L19 A;  2VNG A;  5FZG A;  4WV8 A;  2VOT A;  1JBC A;  2O1Q A;  2VGD A;  2HWF 3;  2PTM A;  2ZX2 A;  3T0A A;  4CE8 A;  1PGW 2;  5BNN B;  3BIE A;  3RZJ A;  1R09 3;  1JZ3 A;  3H9A A;  2GP5 A;  2JDY A;  4PIZ A;  3UKN A;  1HV0 A;  3WDX A;  1R1A 2;  3I2G A;  1AVB A;  3VDC A;  4DMI A;  3ACL A;  5JXJ A;  1O5L A;  4XMA A;  4CP2 A;  1VBB 1;  1PHM A;  3NJZ A;  1QQP 3;  5BNN C;  4FVV A;  1UOG A;  4ASK A;  4KWK A;  4B1M A;  1ZZC A;  3LFM A;  4LLF A;  4PF1 A;  3THP A;  3VDD B;  3B02 A;  3O1T A;  4LK7 A;  2B39 A;  4EZH A;  3P1I A;  2WJS A;  3I3B A;  1KFU L;  3O1M A;  1WUV A;  3VBS A;  2ETE A;  2CGP A;  4XF1 A;  1AR7 3;  4CVU A;  2XG3 A;  4MXW A;  4Q4W 2;  1OPM A;  5AFB A;  5EV7 A;  3VGI A;  3JQX A;  3B9C A;  2OQ6 A;  4YW6 A;  5KHK A;  3DEC A;  3VDD C;  4XPV A;  3D8C A;  5T54 A;  5TSW A;  1E5R A;  2WNU A;  3DGT A;  3ZXE A;  4B8E A;  1IZ3 A;  1SHW B;  3B7M A;  2K9Z A;  1OOP C;  4XHX A;  4XFF A;  3OGG A;  1RIT A;  2CYF A;  4BHP A;  2VUL A;  5JWP A;  1PO2 2;  4J1X A;  1RUJ 3;  1W9S A;  2Q1M A;  3CIH A;  3UT0 A;  4TWT A;  3ME2 A;  3TNQ A;  2PHF A;  1GIC A;  4LEJ A;  2RM2 2;  1EV1 1;  2XVK A;  3ZSL A;  1L7Q A;  2VUJ A;  4BQ3 A;  3WNK A;  5A3T A;  5JPM B;  2VCM A;  3UJO A;  2JXA A;  2P5B A;  3C7E A;  1Y3T A;  2VZP A;  4P9I A;  3JD7 3;  2WSU A;  4ZU7 A;  1S55 A;  3NJX A;  2WS9 2;  3JZV A;  5FPU A;  1ZVF A;  2C9K A;  4MGT A;  4IL7 A;  4AED B;  2LTN A;  5JR2 A;  5FZO A;  1JU4 A;  1QJF A;  3P5B A;  3N9M A;  4GB3 1;  3ZN6 B;  1F4H A;  2VUD A;  3PJQ A;  5GZD A;  3POS A;  3U37 A;  4AGG A;  4XJA A;  4YZ2 A;  4EN8 B;  4ONU A;  1GWM A;  1UKR A;  1O3T A;  1RUN A;  1FNY A;  5JIA A;  5GM0 A;  2G9G A;  4AED C;  2BDR A;  4BIS A;  1HW5 A;  1QDO A;  4IEP A;  4RR3 B;  4FBF A;  1W03 A;  4RA0 A;  2YV8 A;  1EUU A;  4IV3 A;  4IW3 A;  1DHK B;  1OVP A;  3ZMN A;  2R06 3;  3THT A;  3N35 A;  4TN7 A;  2HWD 2;  3N9Q A;  3AMH A;  2VQ0 A;  4R4Z A;  2Q8D A;  3I3M A;  2VXR A;  3NV3 A;  3Q8F A;  4RR3 C;  1Q43 A;  3ILF A;  2JE8 A;  2E7Q A;  3CBN A;  5CBL A;  5FYY A;  1GP4 A;  4NHX A;  5FPA A;  5JMC A;  1C1L A;  3PTY A;  3OYW A;  2YYO A;  4XDQ A;  1O3S A;  5GLV A;  1QJU 3;  2UY8 A;  1SPP A;  1W05 A;  2AUY A;  2IFR A;  1SCS A;  1QMJ A;  2ZTN A;  3GXU A;  3U10 A;  3VL8 A;  3WR0 A;  1GP5 A;  3I59 A;  3B69 A;  3LDK A;  3ZXK A;  5F7U A;  1XU1 A;  2RR1 1;  4AVC A;  4HK8 A;  2DUR A;  2PHX A;  1VMH A;  2WNE A;  4ZON A;  4BE3 A;  5F2S A;  2Y6K A;  3HNY M;  4J25 A;  3V64 A;  1S0D A;  1W6N A;  3GHN A;  2W52 A;  2HWB 3;  1VBB 2;  1D4M 1;  1MS4 A;  2C5D A;  4LA2 A;  3CQO A;  3LOI A;  4ZXK A;  4CRQ A;  2ATF A;  3QD6 A;  4F7Z A;  3RI8 A;  2ET7 A;  4GKY A;  2VY0 A;  3SNM A;  4D3W A;  1QJY 3;  3KLS A;  3ACH A;  4V2W A;  1O7F A;  1PNG A;  1B35 C;  3FWE A;  3QOP A;  3BN6 A;  3G7D A;  3VBR B;  1W9W A;  1PM7 A;  5FWJ A;  2GAL A;  3MHZ A;  5C3O A;  1NQJ A;  4DEQ A;  3WD5 A;  2H0B A;  2YY1 A;  4J6G A;  3NNF A;  2WQ4 A;  4O65 A;  4OHW A;  1X8M A;  3LDB A;  4XF0 A;  3H8O A;  1BBT 3;  1U5X A;  1RUC 1;  4A7K A;  3KT1 A;  3H7Y A;  2JDP A;  2OA2 A;  1O3R A;  2GSY A;  3A0N A;  3VBR C;  4BQY A;  4Q8L A;  4QX0 A;  4MHU A;  5ANQ A;  5FY4 A;  3WG1 A;  3MW2 A;  4AVV A;  5E88 A;  4KU8 A;  1AR6 3;  3T30 A;  2B9U A;  1VR3 A;  4M4R A;  3MUZ 1;  5IK8 A;  2GDF A;  4QB6 A;  1X9P A;  2W47 A;  3PUA A;  3WG4 A;  1SLI A;  1YEW A;  3VZN A;  1AYM 3;  3GZT B;  4CCN A;  2P3Y A;  3D3A A;  5A3O A;  4AL9 A;  1OFS A;  4C1X A;  1WD4 A;  5FRA A;  1FAY A;  5CKM A;  2Q8E A;  4CCL A;  3WDV A;  2P6H A;  3ZYP A;  1ZBA 1;  4O9G A;  1W04 A;  2WL1 A;  1O4T A;  1L3J A;  1FMD 3;  1UXX X;  3M3E A;  3MDP A;  3NKT A;  4P5Y A;  5FXZ A;  4A42 A;  3GZE A;  1QKQ A;  4W6Y A;  1US3 A;  1XRU A;  4CDX C;  1DF0 A;  2FCV A;  2VC9 A;  2TNF A;  4GB3 2;  4QT6 A;  4YWA A;  2JDN A;  5B4N A;  1Y7B A;  3OPW A;  1HRV 1;  2XHK A;  5FK8 A;  3U4X A;  2QQP A;  2W2I A;  4JZR A;  3VDB A;  4XHB A;  4QM8 A;  1RMU 1;  2RS3 1;  4BQ1 A;  2RS1 3;  5H9R A;  2XBO 3;  5FZL A;  3GJA A;  3LB9 A;  5EWS A;  3DCQ A;  3AP6 A;  4Q4X 1;  1Z7S 3;  5EQU A;  4CCM A;  3D4K A;  3UGG A;  3THC A;  1RHI 3;  3VZO A;  2B45 X;  1OD5 A;  3O1O A;  3N4M A;  2QQJ A;  3AZV A;  4E4Z A;  2YG0 A;  1CIY A;  1OD3 A;  1D0H A;  3S6P A;  2DBN A;  1PIV 1;  1W9F A;  1KXG A;  1VLN A;  5IAT A;  4I0A A;  2VQA A;  3KHC A;  4IUG A;  2ZPX A;  1C8M 3;  4XF4 A;  4B4P A;  4KBZ A;  1ODN A;  1OH4 A;  1LOF A;  2EXJ A;  1NAE A;  4UI9 L;  2YC2 A;  2EAA A;  3O14 A;  4H7M A;  5FUN A;  3SH3 A;  3NMB A;  2LUW A;  2IXJ A;  4TLF A;  3SH5 A;  2A3X A;  2QQK A;  3B01 A;  3OPT A;  5F5A A;  2RR1 2;  3WDW A;  1CPM A;  2VME A;  2VZO A;  1X8E A;  4R8H A;  1SLL A;  1Z0H A;  1OA2 A;  3AYA A;  2GAU A;  3PUI A;  1R1A 3;  2DCT A;  2J1T A;  2PAM A;  2WR9 A;  4XFI A;  5CG9 A;  1D4M 2;  1YLL A;  5KXD A;  3DV8 A;  3MFA A;  1GP6 A;  4M3C B;  4XFA A;  3ZN5 A;  3ZXA C;  5DAX A;  3BYW A;  2Y6F A;  4UFI A;  1H9P A;  3K3N A;  3VKF C;  5BNO B;  3WNX A;  1ZA4 A;  3RZL A;  3KV4 A;  1NCR B;  2ZX0 A;  4MLO A;  4NHL A;  3WP5 A;  1H9W A;  1RUI 3;  2W1U A;  3MIC A;  4HN1 A;  1ZRE A;  2EXI A;  4Q4W 3;  3U78 A;  1UIJ A;  1UD1 A;  2RDQ A;  1H30 A;  3IMM A;  1IS3 A;  1N3P A;  2TUN A;  3KCC A;  2ZHK A;  4PLO A;  5BNO C;  1WW4 A;  4YZ1 A;  5A7W B;  1TME 1;  1UMZ A;  4YW5 A;  1RUC 2;  5BNN A;  1JYN A;  2BNM A;  1UY3 A;  1O4Z A;  2QZ3 A;  1CN1 A;  3FL7 A;  3III A;  2WN3 A;  2CY6 A;  4XVH A;  5APA A;  3K4Z A;  4R4X A;  4E8C A;  4JVA A;  3OPZ A;  1ACC A;  1N1S A;  4RS5 B;  4LE3 A;  3HBK A;  1PVC 1;  4XYX A;  2JDU A;  1ZZ8 A;  4OZO A;  1CX4 A;  5LRR A;  3MW3 A;  5LBE A;  4L0P A;  2JDM A;  3FZ3 A;  3NNG A;  2ORX A;  5A3M A;  1PO2 3;  5ANN A;  1BKZ A;  5K4L A;  1IGO A;  2VBP A;  4ZS3 A;  1QY4 A;  4A41 A;  2RM2 3;  5JXH A;  2ZHM A;  2IXH A;  1JU3 A;  4QXK A;  1X50 A;  2V09 A;  5A3W A;  1X82 A;  4WZF A;  1WA6 X;  5F39 A;  1ZBA 2;  3AP7 A;  4QDS A;  1OOP A;  2WN2 A;  5C7G A;  2HWE 1;  2WS9 3;  4CU6 A;  5LY1 A;  1UF2 C;  4GWJ A;  2PAK A;  3O0V A;  2KR2 A;  5F5C A;  3ZFF B;  4G9S B;  5JXI A;  1OT5 A;  3A4U A;  4K1Z A;  1HRV 2;  2XGX A;  3AVR A;  4WM7 B;  4XQW A;  4LKF A;  5JSO A;  2X05 A;  1OA3 A;  2ZZJ A;  1C3H A;  1RXF A;  1RMU 2;  3URF A;  2RS3 2;  3FBY A;  5I0R A;  2EIC A;  5FZ3 A;  5BNP C;  1GU3 A;  3TEZ A;  3H0O A;  3MZH A;  4QQH A;  1WCK A;  2FMY A;  5E8A A;  3O7O A;  2HWF 1;  1LOD A;  2QBX A;  1BZW A;  2YFZ A;  3C8X A;  1LTE A;  4Q4X 2;  3ZFF C;  1W0N A;  5ABJ C;  1UOB A;  4MXV A;  4K40 A;  1V6K A;  4LTA A;  3NAP B;  3VLB B;  5D2A A;  4JKL A;  1CPN A;  4QHZ A;  2ZKN A;  2B4K A;  2HWD 3;  3HT2 A;  4XJZ A;  3WW2 A;  3WNN A;  2FDF A;  5FMO S;  3TRS B;  4YZ3 A;  3ZYG A;  4AHY A;  1PIV 2;  1QQP 1;  3DF0 A;  5LAS A;  2D5F A;  1CON A;  1DLL A;  4LHL A;  1W8N A;  1MQT C;  4UFL A;  4GKX A;  4OMD A;  1CGP A;  4Y5T A;  3BGA A;  2D3S A;  4QDR A;  1QJX 1;  4AED A;  3ILR A;  1MVQ A;  4D0Q A;  3SMH A;  4C0H A;  1AR7 1;  5JIU A;  1UZW A;  3ZN6 A;  2RV9 A;  2UWC A;  1J3R A;  2P4E A;  3LAG A;  1BK1 A;  2OX0 A;  4YLZ A;  1LHN A;  5I8Y A;  1XC6 A;  4Q29 A;  2A6W A;  3VKL A;  2VZT A;  4RR3 A;  2OUH A;  1G9D A;  1MR5 A;  5GZC A;  4NPR A;  1VBB 3;  3PHM A;  5FBZ A;  2JWP A;  1MVE A;  5LA0 A;  2VMI A;  2VZU A;  2W87 A;  3LA3 A;  4E27 A;  1CAU A;  4YW2 A;  3RDI A;  2J1S A;  3RG0 A;  5IYY A;  4RN5 A;  4IET A;  1CZS A;  3CJI B;  4B29 A;  1UU5 A;  3DKW A;  4DIN B;  2UU8 A;  2A5Z A;  2BVB A;  4QU1 A;  4BK4 A;  2BUK A;  4CCK A;  3FFQ A;  2D6L X;  3JD7 1;  4JDM A;  4N9I A;  4RGA A;  4DQA A;  1TME 2;  4CDQ C;  1A6C A;  1RTV A;  3RQ0 A;  1RVF 2;  1HN1 A;  3ZKY A;  2JD4 A;  1IQD C;  2R0F A;  4QPW A;  2ZHN A;  3KWV A;  2DVB A;  4XJ8 A;  1B35 A;  1DFQ A;  1PVC 2;  3KCX A;  4QGL A;  2N7G A;  3OG2 A;  1UYX A;  1YQ2 A;  4KWL A;  1G9F A;  4NHK A;  3RYR A;  3JBG 1;  3S7E A;  4BB3 A;  5JMO A;  5LEJ A;  1HRI 2;  2B8M A;  2R04 3;  3ES1 A;  4NJ4 A;  1BVV A;  2VAU A;  2V4A A;  3EHK A;  4OCT A;  3POI A;  4E4H A;  5FDB A;  1JZ5 A;  1XNT A;  1TEI A;  3WY6 A;  1DZT A;  1GSL A;  1PZ9 A;  1F9K A;  4FOW A;  3ZXF A;  1V6M A;  3FLP A;  3ZFG B;  3BUC A;  1U12 A;  1S2E A;  3AZZ A;  3VBR A;  3J7M A;  5FP9 A;  2BV4 A;  2WNV B;  1K3I A;  4HXC A;  3EO6 A;  1V9U 1;  5IK4 A;  3SQO A;  4BK5 A;  2NMN A;  1DYO A;  1UWW A;  4HT1 T;  4GB3 3;  4XMI A;  3NL1 A;  1WW6 A;  4CEW B;  1XYO A;  3TBD A;  1XBF A;  2VQT A;  4P9W A;  1QJU 1;  4N9H A;  1A8D A;  1JYW A;  3ZYJ B;  2G9F A;  1J83 A;  1QU0 A;  1QOS A;  2RDR A;  3M3I A;  1IPK A;  3N7M A;  1LOG A;  2WNV C;  1CAX A;  4TSV A;  5BPX A;  3RI9 A;  4AHZ A;  2WLP A;  3U4S A;  1VP6 A;  3SKJ E;  3Q9O A;  5FPV A;  3RZH A;  4WBB A;  4CEY C;  1VRH 1;  4PIX A;  4AGV A;  4M4P A;  3HVD A;  1F2N A;  4CXW A;  4QQ2 A;  2DFC A;  3AYE A;  5FFO C;  5KBF A;  4IE0 A;  3USU B;  4AVS A;  4CDX A;  1UPI A;  2HWB 1;  4H3W A;  4S2G A;  1QQP 2;  5L9B A;  1SMV A;  4KI5 M;  1EPW A;  3O0W A;  2AYH A;  3OSD A;  2XKO A;  3NST A;  1ALY A;  4Y22 B;  4DS0 A;  5FQ0 A;  1NZC A;  4Y1Y A;  1QJX 2;  4GWI A;  1CVN A;  2JEM A;  3BPS A;  1BYH A;  4V1P A;  1VBE 1;  1H1A A;  1W90 A;  4CTE A;  2J1E A;  1AHS A;  1DP0 A;  3B00 A;  2FHR A;  1S0B A;  3POJ A;  1QGL A;  5J36 A;  2F6B A;  3ZR6 A;  1YQ6 A;  4G3Y C;  3KMH A;  1H8T C;  3AKS A;  4H14 A;  4AQS A;  4COW A;  5CFD B;  4N43 C;  2XPJ A;  1BBT 1;  3I2J A;  2ZMN A;  4JRL A;  1KD7 A;  2V5D A;  3CHX A;  4XDO A;  5A32 B;  3ZIW A;  1WW7 A;  2I2S A;  3ZDS A;  4AFM A;  1WMX A;  3H8X A;  1ZRD A;  1WCS A;  4DRR A;  4ARX A;  1W2T A;  4PDW B;  5FOB B;  1AR6 1;  3KF5 A;  3VBH B;  2KM2 A;  1V6I A;  5DZG A;  5JVV A;  2P17 A;  2W91 A;  3WCS A;  3LEI A;  1UAI A;  2ES3 A;  1GWL A;  1H1M A;  2W95 A;  4A44 A;  2OYZ A;  1YIP A;  3OBA A;  4JKK A;  3C2U A;  4HG6 B;  1UY2 A;  3CKH A;  4NR1 A;  5ACA 1;  1RB8 G;  1JW6 A;  1HB2 A;  2QCS B;  2VCB A;  3BU7 A;  3JD7 2;  1DYK A;  5T5P A;  1XNC A;  1I5Z A;  2EA7 A;  3POW A;  2FDH A;  1S0E A;  4QPG C;  1C5H A;  1PZ8 A;  1RUC 3;  3WHT A;  4KNC A;  2E7T A;  3VV1 A;  3VBO B;  5GLZ A;  4AAX A;  5ISL A;  2OVU A;  2P3K A;  2R32 A;  3ZYH A;  2XJU A;  3OEB A;  3JBG 2;  1PK6 B;  2RS1 1;  1CIW A;  2VZ3 A;  2PAE A;  3B3Q E;  1JHN A;  4NVP A;  1S0J A;  3GCW A;  4M3C A;  3D0J A;  2WO1 A;  5HCA A;  1FV2 A;  2WII B;  4GWN A;  5D8A C;  4DRV A;  2ARA A;  1W28 A;  5LEK A;  1RHI 1;  3FHQ A;  4Y1V A;  4AHW A;  2PQS A;  4B7K A;  2Y0O A;  4X6R B;  4N53 C;  1W39 A;  1Y9Q A;  2R16 A;  3TEY A;  1ZBA 3;  5IVJ A;  2VNV A;  5LA2 A;  4C91 A;  1PGS A;  2WT0 A;  3AMM A;  3FX3 A;  4Q0Q A;  4Q0P A;  1V9U 2;  4COU A;  2VW0 A;  3HNB M;  1JUH A;  3HOB A;  2Y6G A;  4LXL A;  2QDN A;  5A7W A;  2JEN A;  2Y38 A;  1HRV 3;  1QXJ A;  2HJI A;  1WLT A;  4E2G A;  5K0U B;  1V0A A;  2JG9 B;  1VB2 A;  1AUY A;  1RMU 3;  2RS3 3;  2W68 A;  4FPH A;  4WVM B;  5CAZ A;  5H9Q A; 
#chains in the Genus database with same CATH homology
 4LKS A;  1SHW B;  3K75 B;  2ZEZ A;  2E32 A;  3EB7 A;  3K4A A;  2KD7 A;  2J1R A;  5CYY A;  1W9S A;  3CIH A;  4A45 A;  4KMQ A;  5B4X A;  4BDV B;  3I97 A;  1L7Q A;  3UES A;  3WNK A;  3C7E A;  2VZP A;  2ID4 A;  3NJX A;  1P8J A;  3T2P A;  4W8J A;  2C9K A;  3GM8 A;  5JR2 A;  1T2X A;  1JZ4 A;  2J1V A;  1JU4 A;  2W1W A;  2VZV A;  2DCK A;  2L9L A;  1F4H A;  3U37 A;  3ETP A;  5C70 A;  2DCJ A;  4ET7 A;  3A21 A;  5DN2 A;  1UYY A;  3IAQ A;  2ZEX A;  4XZU G;  1EUU A;  2VCA A;  2BZD A;  4JX0 A;  5EJZ B;  4ZZ8 A;  1KEX A;  5DQ0 A;  3T09 A;  1JHJ A;  1WKY A;  1JZ6 A;  2W92 A;  2JE8 A;  5HPO A;  1D7P M;  2Y8K A;  3PUH A;  3WF0 A;  2C4X A;  2Y64 A;  3GXU A;  4P02 B;  5CZK A;  1UX7 A;  2W1Q A;  4E8D A;  5F7U A;  4OYU A;  3MV1 1;  1F4A A;  3MO4 A;  3IDA A;  4YPJ A;  2Y6K A;  1JYX A;  3HNY M;  1JI6 A;  4DXS A;  3CQO A;  3I2I A;  2W5F A;  3SEE A;  4TTG A;  2RVA A;  2VL4 A;  4DUV A;  3AC0 A;  3ACH A;  1K45 A;  3W5N A;  3C7F A;  3BN6 A;  3VD3 A;  1W9W A;  3WF1 A;  4GZ9 A;  4DEQ A;  2WQ8 A;  1GNY A;  3HN3 A;  2XOM A;  1JZ2 A;  3ECQ A;  2VQU A;  1UMI A;  1KGY A;  2DDU A;  4QX0 A;  3OGR A;  2HYX A;  4P08 A;  4JHZ A;  3CMG A;  4M4R A;  3MUZ 1;  2W1S A;  4QB6 A;  2W47 A;  2R7E B;  2YB7 A;  1PX3 A;  3D3A A;  5EIY B;  3CDZ B;  3I3D A;  2JD9 A;  2VMF A;  4JKM A;  1R64 A;  4MGS A;  4KWU A;  2WO3 A;  3I3E A;  2V72 A;  1UXX X;  4P5Y A;  4A42 A;  4ZZ5 A;  1US3 A;  2VC9 A;  3WF3 A;  5B4N A;  1TVG A;  5G04 L;  3WNL A;  3LPF A;  3I2H A;  3VDB A;  4FI9 A;  3NQH A;  1O59 A;  1GUI A;  2E26 A;  4TXW A;  3WEZ A;  4OUE A;  3I2K A;  3ZM8 A;  3WF2 A;  4BXS V;  3THC A;  1UMH A;  4DUX A;  3VD5 A;  3OB8 A;  3DYM A;  5J1X A;  2QQJ A;  4W4Z A;  4LHS A;  2YG0 A;  2Z4F A;  1CIY A;  1OD3 A;  4ZY9 A;  1ULP A;  4OMC A;  4IUG A;  4LQR A;  3W5M A;  2ZXQ A;  1OH4 A;  4UI9 L;  1NAE A;  2B9V A;  2YC2 A;  3OGS A;  2LW8 A;  1XNA A;  2VCC A;  2QQK A;  1UY1 A;  2VZO A;  2VME A;  3T2O A;  5LCW L;  4UOJ A;  3PUI A;  2J1T A;  1CX1 A;  1PX4 A;  3CZU A;  2WAA A;  3VD9 A;  1J84 A;  1NKG A;  3OGV A;  1UY0 A;  1GMM A;  2JDA A;  2W1U A;  2Y6J A;  4XUR A;  2XQX A;  2WUH A;  3FN9 A;  2VZS A;  2WZE A;  4QX2 A;  3T08 A;  3NJV A;  2VMC A;  4DXR A;  2W94 A;  4CUC A;  1JYN A;  2VZR A;  1UY3 A;  4XUO A;  3OEA A;  4XVH A;  3FL7 A;  3III A;  2WN3 A;  4E8C A;  2VZQ A;  3K4Z A;  1W9T A;  4XUT A;  3HPN A;  4MAD A;  2YC4 A;  4OZO A;  1BHG A;  2BGO A;  4L0P A;  3VD4 A;  3NNG A;  2ORX A;  3GGL A;  1SG3 A;  2WZ8 A;  4A41 A;  4MO3 M;  5JXH A;  2HLE A;  1JU3 A;  2WYS A;  2CDP A;  3K77 A;  3T2Q A;  1MPX A;  4QDS A;  2X10 A;  2WN2 A;  5C7G A;  4CU6 A;  2ZEW A;  3I2F A;  2ZEY A;  4GWJ A;  4BJ0 A;  2VZ1 A;  5JXI A;  1OT5 A;  4DXT A;  1XPW A;  2X05 A;  1GOG A;  2J1A A;  2EIC A;  1GU3 A;  4AG4 A;  3ACF A;  3LQC A;  2QBX A;  2YFZ A;  1GOF A;  2Y6L A;  3C8X A;  3HEI A;  5G05 L;  1W0N A;  1O8P A;  1UY4 A;  5DMY A;  3THD A;  2WAB A;  4JKL A;  2W46 A;  3LPG A;  3C7O A;  2B4K A;  3WNN A;  4ARY A;  1JZ7 A;  2CDO A;  1W8N A;  3LEG A;  3VDA A;  4OMD A;  3BGA A;  4QDR A;  4D0Q A;  3ACI A;  5FUI A;  3HJR A;  3CZJ A;  5LA1 A;  2RV9 A;  1LNS A;  2VMD A;  2JKX A;  1PMJ X;  4QB1 A;  5I0D A;  2BGP A;  1K12 A;  1XC6 A;  5HXM A;  2VZT A;  4P00 B;  1OF3 A;  3GDB A;  3A22 A;  3MBW A;  3VD7 A;  2V4V A;  4Z2A A;  5EJ1 B;  3E1F 1;  3C7H A;  5LA0 A;  1UZ0 A;  2VZU A;  2W87 A;  2EIB A;  1W8O A;  2J1S A;  2QQI A;  5IYY A;  4RN5 A;  1CZS A;  4UAP A;  4BK4 A;  2QQN A;  1US2 A;  3A7Q A;  1DLC A;  2QQL A;  2VM9 A;  1CZT A;  4QX1 A;  5JUV A;  4CU9 A;  4XUN A;  1HN1 A;  3ACG A;  4MOA A;  4CU7 A;  1IQD C;  4QPW A;  3LE0 A;  2EID A;  2E31 A;  3FHA A;  3OG2 A;  1UYX A;  1YQ2 A;  4ZXE A;  2QQO A;  3UET A;  3WNO A;  5JMO A;  5C71 A;  4W50 A;  2E33 A;  3K46 A;  5JXG A;  1JZ5 A;  3A23 A;  1XNT A;  2VR4 A;  3IAP A;  1WCQ A;  3LEK A;  4DEV A;  5IFT A;  1GOH A;  1K3I A;  3F2Z A;  4BK5 A;  1CZV A;  1DYO A;  3DYO A;  1UWW A;  1ULO A;  2LS6 A;  2W3J A;  2VQT A;  1JYV A;  1JYW A;  3SEP A;  5IHR A;  1J83 A;  3EYP A;  1K42 A;  3SKJ E;  1I5P A;  1RYY A;  2OKX A;  4DUW A;  3WQB A;  1NX9 A;  3WNM A;  2XHN A;  4M4P A;  1W99 A;  3UNP A;  3WF4 A;  2VJX A;  1EUT A;  2WDB A;  1UXZ A;  4KI5 M;  4D8M A;  2RJ2 A;  2ORZ A;  3K4D A;  3IB3 A;  2WBK A;  2WO2 A;  4GWI A;  1L7R A;  2BBA A;  4PT6 A;  4A3Z A;  2J1E A;  1DP0 A;  4QB2 A;  5IJR A;  1JZ8 A;  1O8S A;  2XON A;  2VO5 A;  1TG7 A;  4PQQ A;  3I2J A;  2V5D A;  4CUA A;  2C26 A;  4ARX A;  1H6Y A;  4XUQ A;  1PMH X;  1H6X A;  3MUY 1;  2VTF A;  3ABZ A;  2W91 A;  3LEI A;  4RYD A;  4A6O A;  2W95 A;  4A44 A;  3OBA A;  4QAW A;  3T0B A;  4JKK A;  4HG6 B;  1UY2 A;  3CKH A;  3MV0 1;  2VCB A;  5A1A A;  3C7G A;  1SDD B;  4LPL A;  2VOT A;  3T0A A;  4AAX A;  2Y6H A;  1JZ3 A;  4A4A A;  3HNM A;  5DPN A;  3T0D A;  3OEB A;  3I2G A;  4QX3 A;  2VZ3 A;  3VDC A;  2J7M A;  5JXJ A;  1OF4 A;  2W9X A;  2WO1 A;  2J22 A;  2WAO A;  1UYZ A;  3WSO A;  3FHQ A;  2PQS A;  4PF1 A;  2QQM A;  3P1I A;  3I3B A;  3WNP A;  1NUK A;  4CUB A;  4CVU A;  5LA2 A;  4XUP A;  3NRU A;  3HNB M;  4MGQ A;  2BER A;  3HOB A;  3JXS A;  2Y6G A;  2YFU A;  4QDQ A;  1GQP A;  4CU8 A;  2EIE A;  3DEC A;  2J1U A;  2X09 A;  3J7H A;  3SKV A;  3DYP A;  3P6B A;  5IFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...