1CZWA

Structure of the w34a mutant of shiga-like toxin i b subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A native structure of the W34A mutant at 2.5 A
rcsb
source organism Phage h30
molecule tags Toxin
molecule keywords SHIGA TOXIN B-CHAIN
total genus 18
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 1999-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1czwA00
1QNUA 1C4QA 1BOSA 1CZWA 2XSCA 2C5CA 4M1UB 1QOHA 2GA4B 2BOSA 1R4QB 1CQFA 1D1KA 1CZGA 4P2CB 1R4PB 1DM0B 1D1IA 4ULLA 1C48A 3MXGA
chains in the Genus database with same CATH superfamily
3DUZA 4L5TA 1HNZL 4JBMA 1M4VA 4KV6A 5JJKA 1V8QA 2L55A 4WRDA 2Z6KC 2QGQA 4PZ8A 1IL8A 3MAQA 3PF5A 4JK1C 2F0MA 2CW0C 1FL0A 4P74A 2C35B 2D9UA 2KEEA 3C1FA 4XQJA 1W2BA 4FVMA 2O5IC 1LACA 2AKWB 1X6OA 2ATWA 1N8RC 3ND9A 4A3BB 2Z8LA 3TEHB 4GOPA 4RCOA 1ILPA 1SRUA 2OT2A 4HSPA 4BY7G 5EQ0A 3A55A 2KVMA 3SE0A 1YNJD 2A74C 1MKHA 2A68D 1FR3A 3MEFA 3KLSX 3PIO3 2MQHA 1SSOA 3RZDH 2K50A 3HP3A 4BBSB 3I56A 1SDFA 1LUZA 2PZWA 3C46A 4JI8Q 1EY8A 2N78A 4YCUA 1YNJC 5KNCA 1I4RA 3K58A 2EY5A 5IGFA 3FEWX 3C3LA 1JWMD 5D14A 2UU9L 2I07B 4AYBG 2O5JC 1C9OA 1TWAH 4QF4A 4LF4L 1N36Q 4A3CH 3N6RA 5LMNW 4H13C 4LFAQ 3RD4A 1B8AA 5JAVA 4C3JG 4RGTA 3CCVA 1GUTA 2RDFA 1EZ6A 3CQZB 5AJ3Q 1X56A 4JI4Q 4GKJL 1ZKOA 1BBUA 2PCFB 3BYYB 4KHPL 1S5ED 1YJWA 2IW3A 2VY3A 1BCPC 4DAYA 3OIQA 4WFN3 3J80E 4A3EB 1EQQA 2JA6G 4H02A 1K3RA 1DOMA 3S14H 5LMUQ 1OXUA 1GM5A 3J81E 4MTNA 5CGKA 4OWWB 1N32L 2RF4A 2B2VC 3E9HA 4C3IB 1SFOB 2F0WA 1HRJA 1ICWA 1GHJA 2KOLA 1PRTD 2L1BA 3ERSX 2JA7G 1J5EL 1DONA 3PO3H 3EROA 1SLJA 3FPPA 2NYZD 4QCLA 3L3OC 4EQPA 2HCCA 2Z9HA 2PNRC 1EFID 2B63B 2NZHA 2EXZA 4QMGA 1IBKL 3C2PA 1TWCB 1BO0A 2E2JH 1TWAB 2ASBA 1A2UA 2JA5H 3FKIH 2L11A 2NN6I 1SXTA 2EJMA 1Q3LA 2RVLA 5A2QE 5EBDA 1F9RA 1RF2D 3B6YA 3TN2A 3Q6SA 1IKLA 2UXCL 3BZDB 3W1GA 4BS9A 1GO3E 3LGJA 4A3MG 3QB3A 3VA5A 5IT9c 1SNQA 2VNUD 4A93B 1Z6HA 2WV6D 2CH4W 3GV6A 4LFAL 2LFNA 3R2IA 4AQYL 3U58A 3KYHC 3G7LA 2QEXA 3VYSA 4JI5L 2GN5A 2HD3A 2JK8A 3AEVA 4DV2L 3MXGA 1XWEA 2B2TC 4DGZA 1VQIA 4LUZA 2MO0A 3L0OA 4M1UB 2WKCA 4LFCQ 4OGQC 1QZGA 1WJJA 2C9OA 1X54A 2ZJPA 1K8OA 3HOWB 1XTDA 3ULPA 1KC8C 4FF1A 2L5TA 3H09A 3A7AB 4A3GB 1YNND 1L2FA 2XNAC 5BR8L 3HOVH 3HKZB 3T1YQ 4LF7L 4BA2I 2D0OA 1WCMH 3GTGH 2D2CC 4BY7B 1GJXA 2ZTEA 4G57A 1BCPF 4LFCL 1GKHA 4RAUC 1FGUA 1HTLD 3NPPA 1PH2A 4DFAA 1OXVA 4IUPA 1VQLA 5C4ZA 2CKZB 4HR7B 3RN2A 5EKLA 3D6CA 3HOUB 2DY8A 1NR2A 3L7ZC 1B1ZA 4P71A 2F4VQ 2A68C 1ESFA 3DLLA 2L15A 2A69C 5K36H 2PQAB 4ILWA 3H0GB 3T1YL 3BVGA 4JYAQ 3HOWG 2KECA 3J81i 4AH6A 4LF8L 5G3LD 3H15A 4X64L 2I0QA 1A3VA 1R4PB 1QUQB 4A3JB 3KF8B 1KABA 5FO7B 4DF7A 4J15A 1C0AA 4ZKBB 1PH5A 2EOTA 1T5XD 1JJCB 2B2UA 4X3TA 1EOVA 2EZVA 1TY0A 2PQEA 2SOBA 2L4NA 3ONAB 4C3JH 4ZUJA 3RLOA 3MWYW 4JG2A 4GKKQ 1L1OA 3S24A 3MXNA 3M3YH 1DCZA 1Q86C 1CKMA 4DAVA 2K5WA 5KYIA 5HURA 2F1MA 2ZJRA 2RCNA 4F7XA 3HKZE 1B3AA 3GTMB 1HZ9A 3PQIA 3T1HL 2BH2A 3PO3B 1HA6A 1YIJA 4RMFA 3UDXA 2E2HB 1BNZA 1SE4A 1CKNB 3M4YA 2OF1A 4GKJQ 4IUQA 3F2BA 4GZYC 4FF2A 3HOYB 3WWVA 1TR5A 3GD7A 4A3FG 3H3VI 4OO1H 5LHY1 4KHVA 2NVQB 4OL7A 2L0CA 2WKDA 4O2DA 3OMCA 5ELDA 3QR8A 3Q23A 3CCMA 3S9WA 4DNTB 4NPSA 1CA5A 1B9NA 2K33A 1O78A 3UE0A 1J8IA 4YWLA 1BF4A 4X3UA 1ZYRC 4CDEC 2KCCA 2XSCA 2CCZA 1U4LA 4GOPC 1JB7A 2VB2X 5KIXA 1FVIA 1BR9A 3J7A5 1SNMA 2A69D 1SYDA 3T13A 3HOXG 1SE2A 1Z47A 4JBWA 1SYGA 1WTHA 2M9VA 2OXPA 3E9IA 5M3MB 3D4WA 5LMNL 2JA8B 1TIID 2OEOA 3RLFA 3DMUA 1E3PA 1II3A 1K8MA 3VA7A 1I4QA 2K7VA 1MGSA 2SEBD 2UUCQ 2MPMA 5CR3A 5IYBH 3CRKC 1XPUA 1EUJA 3HEJA 4H0LC 2E5LQ 3K5LA 4X3SA 3HOVB 3UDFA 3GTOH 1CSQA 3GTLB 3BVZA 4KK7A 4ID6A 4JI2L 4YHHQ 4A3MH 4B3MQ 3CCUA 2E2DC 3CC7A 1SMYD 1VQJA 1T5EA 2VZAA 5D3DA 4A3BH 2Q2HA 3IL8A 1TQOA 3CKIB 3M85A 1QNUA 3FKIG 4JVZA 2VL6A 2UU9Q 3NXWA 1S5BD 1F2LA 1H9JA 1PYBA 2V4DA 1EY7A 5T1IA 1PFSA 5I6YA 2RHQB 4U673 1U0LA 2R93G 2B8GA 1HXYD 2Q8RE 4POFA 1N34Q 3A5ZB 3K80C 1CM9A 1EU3A 3PV0A 3VDYA 5JPNC 1K0RA 1R9TH 4JW0A 1VQMA 1D6EC 3HG9A 3G71A 4JI0Q 2HQLA 3MA2B 2KA7A 1Y14B 1EY0A 5DAUA 2R7ZB 2JA8H 1PTOD 4BWGB 1PXUA 4DXFA 1G6ZA 1FNVA 1OO9B 4K8IA 3SK8A 3LX0A 1IBMQ 3S15B 4KKTA 1EYDA 2R6GA 3J80i 1LTRD 2D62A 4MN3A 2F0DA 3M4OB 1XPRA 1RKNA 3PIPA 3D4RA 1VQKA 1LTLA 3CRLC 3I90A 4JBKA 1WTRA 1TS2A 4KJOA 2K75A 1QVFA 2XGTA 1G91A 2R92H 1LABA 1ENFA 4IFDI 4K5XA 3I7FA 4K2KA 3CU7A 3I73A 4RWSC 1HNWQ 2B2YA 5C4JB 5EPKA 4LUVA 2WAQG 3U4VA 1G2TA 1ENAA 3NTHA 5CV5A 4L5SA 1PFBA 4XQNA 1SMYC 3J80c 5C44G 1D5MC 4G7HC 1SJED 1CFMA 1JWUD 3G4SA 4LF9Q 1HZCA 1CKNA 1I3QH 1BDOA 3CCEA 2K01A 2UUBQ 5M5XB 4QUFA 1Y1WH 4R9WA 3QOJA 4L8JA 1IBLQ 2ZXPA 1VQNA 4JI8L 5LL6X 3K0YA 2B2YC 3OW7A 2E75C 1P8LA 3KFUA 2QEJC 2F52A 2ZTCA 4L5RC 2H1EA 1X3GA 4RKLA 3VR4A 3IAYA 2K32A 1XPOA 3L2PA 2BE5D 5DM63 4A3LG 1V9PA 1I4HA 3NTIA 3I4NB 1SROA 3PUZA 2K5QA 4DV2Q 1QILA 3AB9A 4A3CG 1A63A 4I7AA 5J22A 3I2ZA 4XYOA 4RKBA 3CPWA 4KKSA 3J81L 1FNWA 3AFPA 2BE5C 3HS0C 2SNSA 1QE6A 5IY0A 2PMZE 4A3JH 2QA4A 4KN4C 5CMDA 3A8IE 4DR1L 2AHOB 2NTTA 2A5HA 1FJGQ 1WTOA 1HNWL 1QB5D 1PFMA 1GXDC 1D8LA 4C3IG 4UAIA 1HFGA 4L5QA 5C3WA 2B8FA 1STGA 4KY5A 5I2XA 5CBAE 2O4XA 3MVVA 1DD2A 3HOVG 2CQOA 1DGSA 3OWFA 5DNFA 2CVRA 3GTJB 2MGSA 1Q8KA 2IJ0A 1BBXC 5IGCA 5CV6A 4OX9L 2LY7A 4ZAIA 5I6WA 3CXCA 3RZDB 4Q5VA 1PH9A 4Y7NH 4J1MA 1E2WA 5IOCA 3GTKB 3J7AV 3D3RA 2F0TA 3TS0A 3TQYA 3F1ZA 2E74C 2L12A 1JOKA 3JAML 4TQUS 1QOHA 4CDFC 1GUSA 1S4ZA 4RFBA 4AYBE 5KEEA 5JEAG 1NJIC 3IFTA 4X66L 2UXDL 3U50C 1AP0A 1L1OB 1TWFB 1NCVA 3KJOA 1Z7TA 5CBEE 1E2VA 4CDCC 1B7YB 3BG3A 2F0PA 2CFMA 5C3EG 2NZ1D 4G4KA 1PRTC 1CZWA 4C2MH 3D4DA 3I4MG 1ENCA 4G7ZC 2VUMG 5AJ3L 1GUNA 4GLXA 3S15H 4C3HH 2MO1A 1YI2A 2PZUA 1D2BA 2A73B 2KCTA 1WTPA 4OEMB 4DV7Q 1NBWA 4P75A 4A3GG 1ICFB 1K83B 2K1BA 5GAGC 1N33L 1VF5C 2G9HD 3NE5B 1K73C 4IFDH 4XDXA 4DAYB 3LWEA 1TWHH 3OSOA 4JI1Q 3M7GA 1MJCA 1YJNA 4CKEA 1GUWA 1H95A 3D8GA 2A8VA 3G6JB 2F0JA 5LMNQ 4FF4A 1O80A 4NXML 1FNUA 3MFGA 1KRTA 3GTOB 1PRTB 2Y0SE 3P75A 2WP8J 2CWPA 1XYIA 2DNEA 1SAPA 2B63H 1CQVA 3HZXA 2SDFA 1WI5A 3NSWA 1PTOB 4WJWA 2VQEQ 4LAAA 1I6HB 1VQ8A 4Y7NB 3J80L 2KCMA 4KHPQ 4DXGA 1C4QA 4JI7Q 4KMUC 4DV7L 1E22A 1KL9A 4CJ0B 3J81c 4B3TQ 2YTXA 2NVYB 2F0QA 3GTKH 1HR0L 4GOPB 4QIWE 2OQ0A 4PZ7A 4B3RL 1TY2A 1CQFA 3NK9A 1QCBD 2EJFC 5ELCA 4G7OC 1WFQA 3EN2A 2JQOA 2ZM6L 4ZLTF 2OTJA 4LMQD 4DV4L 1SE8A 5C4JH 3GTPH 1EYCA 3LNNA 3SVMA 1KXLA 1ASZA 4CKCA 5GADC 3BDOA 3D6WA 3JAME 2FXQA 3A56A 4HJ5A 4JI7L 1PH1A 1HNZQ 2A6HD 1BBWA 3H3VC 2NVXB 3K7UC 2VQEL 2R61A 4CJ1B 4OHJA 3NHHA 3GP7A 4KLKA 1CA6A 1O7ZA 1UEBA 1OTCA 2ZT9C 1LYLA 2Q2IA 1RCVD 2XN9C 1DOLA 3S1QB 1KAWA 3STBC 3DWAA 3KJPA 5J3BA 3T53B 5C0XH 4F87A 4DR2Q 4IPGA 1F9PA 4FNFA 4IZ8A 5H1SE 1G2SA 1DYQA 1PZKD 2Z4HA 2WAQE 3KLSA 1CHPD 3IKJA 4JI1L 3OTOQ 3I4NH 1EL0A 3GTPB 4Q0FA 2F0KA 3NBHA 3I3CA 3HKSA 2KHSA 2YTYA 5CV4A 1IW7D 3F2UA 3CQZH 4OXPA 1I94Q 1LT6D 3VR5A 1F2YA 2OCEA 2B2VA 4C3JB 2VUMH 4K5WA 1JQYD 2AUKA 4K6DA 1YNNC 2VQFL 4OELB 3SK6A 4MTKA 4DV6L 2WIIB 3M4QA 4V190 3TZDA 2R92G 1EWCA 1XTCD 4LFBL 1P16A 1PH4A 3GTLH 4DR4L 3S1MH 5M3FB 4DU9A 1IXRA 4F8MA 1R4QB 1LO5D 5JEAH 1XMQQ 4DR6Q 4IPCA 1Q1BA 4CKBA 4PNYA 4GNXC 1HHVA 1X3QA 1FGBD 2B2TA 4KHZA 5BN4A 4A3KG 1LT3D 4MNOA 4TVAB 5I4DA 1A0IA 1ILQA 1VQ5A 1PTOF 3D0FA 5IGBA 1F9QA 1QVGA 5CV9A 4HJ8A 4K8JA 4DAMA 2UUAL 4DR7Q 4J6HA 4IN3A 5BN3A 5IYBG 4HCEA 1EIHA 3CMAA 1N34L 3S1MB 4X6AH 1N32Q 2K14A 4BY1H 3UDIA 4DR6L 3FKIB 3LWUA 3I70A 4NXNQ 1WD0A 2IHFA 3S17B 1B50A 4GN4B 1A15A 2TMPA 3I8ZA 4A93G 2YV5A 3DM3A 2PZTA 4EQ5A 3EIVA 5DEHA 4R8NA 3PSIA 4DK3C 2RHSB 3RR5A 4DKAC 4WORA 1XJVA 2Z0SA 1HQRD 1G6PA 4L6TB 2O2LD 4IJLA 1O7LA 2EYFA 2N8NA 1C7YA 4FXDA 1PZJD 3ITPA 1A6XA 1VQ7A 1I50H 2HCIA 3ICEA 4ZRZA 2EPBA 4LF5L 5M5XH 1IW7C 4AYBB 4DV3Q 2KQ3A 1TKWB 1ASYA 2KHIA 4DV0Q 3GO5A 3TS2A 1SJHD 4BXXH 5IP7H 3HOYG 5JJLA 3BU2A 5I2YA 4JI0L 5K5PA 3QWNA 4QGUA 4QL5A 4HMIA 4DUYL 2N88A 4ZYSA 4KY7A 4C1NK 1CTMA 4GN3B 1Q7YC 5NUCA 5IODA 5JJIA 2B2UC 4PV1C 1XMOL 3KK7A 1VCIA 2F0GA 3KUPA 2LXKA 5J39A 2EYOA 3ND8A 1IYUA 2LKVA 4CDDC 5E4WC 1MSHA 2MUYA 3K6OA 1S5FD 2B3GA 4X64Q 3Q22A 2IL8A 2AQ1B 5M3MG 1HR0Q 1SFOH 1GOZA 1GHKA 2B2WA 5JVG3 1VQ6A 1VQ4A 5C3EB 1MJEA 2NN6G 2NVYH 4KY6A 4HJ9A 4O1NA 3KF8A 2EYPA 3E0EA 5IP9H 1PTOC 5BN5A 2PNHA 4NDXA 4GNXB 4DNIA 2F4VL 3PF4A 5E7NA 5AFWA 5C44H 4JI6L 2WFWA 2KJXA 4HJ7A 2WB1E 3SEBA 5KNDA 1EY4A 5IYCH 2BA1A 1IBLL 3TP6A 4K6LA 1VQDA 3J7AF 1BOSA 1KDBA 3PGZA 1BUVT 5E1FA 5HY6A 3R93A 2F0NA 2V1CC 1BVSA 1RDPD 1HNXQ 5E3FA 2HDMA 2BOSA 3RUZA 1IZ6A 3VR6A 2F0OA 2VXWA 2OTLA 1KQSA 3K5MA 1HJPA 2KENA 4OIKA 4CGYB 1S72A 4UY8C 4HTHA 4A3KB 3KF6A 5FO8B 1Q8IA 1VQEA 4JI4L 4B08A 2QCPX 4HIMA 4GNXA 3VR3A 5GAHC 2PPBC 4IUUA 1Y1VH 2XTIA 2F0UA 3H91A 2EDGA 2PO4A 4X65Q 2KHJA 1FJGL 3W3AA 4CJ2C 1B44D 3E3XA 5LL6S 4P2CB 4TKOB 4FYDA 1VS0A 1A8VA 3F8TA 3OOCA 3QG1A 1M90C 5JVH3 4ULLA 3HKZG 1EYAA 1ZYRD 4FP5D 1LV9A 2DGYA 3T1HQ 1DXMA 3DXJC 2HT1A 5FOBB 2EVBA 1EIFA 2KBNA 1VQPA 1KTKA 3IFDA 3K81C 2K28A 3T51B 5KRUA 1AZPA 5C4XG 2PQAA 4R4QA 3KLRA 4HAEA 2WAQB 5FLMH 4GLAC 4OWXB 1Y1VB 4K2LA 3PIOA 3HOYH 1UE5A 1Y8OB 4JYAL 1U9RA 5M5YB 4DA2A 1KLUD 1A62A 1QUQA 1UE1A 2JYOA 3KDFA 2IX3A 3C1EA 1YZ6A 3A54A 1EZ8A 3WDNA 4ZCKA 4E6IA 1B2TA 4DR4Q 4OO1G 4WJ4A 5I9PA 3F2CA 1JOQA 3CD6A 2ID0A 4FXKC 1PTOH 1XMQL 5EPLA 2B63G 4U68A 4R4IA 1TU2B 2JEBI 4DV1Q 1CUKA 3Q24A 3CCRA 3PUWA 4MZ9A 1CSPA 3GTQB 2J0TD 4MHEA 2XRSD 4F88A 3MTSA 3AU7A 5CC4A 4B9XA 4EVOA 3KBXA 1HZAA 3QO2A 3EQLC 3TRZA 1GVPA 4QUCA 1TS5A 1JE4A 2ALYB 2J7ZA 2K03A 2UXBQ 2EJGC 4X65L 4H44C 2GA4B 5ELOA 2NB0A 3NWSA 2JA6H 3CW2C 1A2TA 1V1OA 4DV5Q 1TWGB 4KTAA 2JXMB 1STNA 1AEXA 5M5WH 4DK1A 2SNMA 5FKAC 4C3HG 1H9SB 4A3EH 3A0JA 1EFWA 5IT9E 2K5VA 3PCOB 3GV3A 3U9SA 1XMOQ 1Q82C 1FYCA 5DLQE 4JV5L 1Q1EA 1Z9FA 1EIGA 2R7ZG 4DUYQ 1T9HA 2F0FA 1PYSB 4IUNA 2K4KA 5EPJA 3SGIA 4DV5L 2E76C 4R4TA 3NQIA 2QF7A 2I5MX 2ZJQA 3NBIA 2XVSA 3T16A 1AH9A 3HOZG 3BJUA 4OWTB 2K5DA 4JBJA 3I4OA 5IGGA 4X3KA 1ML0D 3S14B 3TMEA 4DV4Q 2KUMA 3S16B 1SNPA 4A3EG 2R7DA 3KF6B 4BBSH 1I94L 1D5XC 2X6LA 3S1NB 2UXCQ 1E1OA 1H9SA 2Z6KA 4NKLA 1SNOA 2F0HA 1HH2P 4C3HB 4MIUA 3G48A 1K9MC 3OW2A 1IBKQ 4OIJA 1K83H 5TSSA 3CCLA 2JA7B 1MI2A 1D5ZC 1HCZA 5C6AA 4DR2L 5M3FH 4LF9L 4LW1A 1QWYA 2YYZA 3PIP3 3S1NH 1V1PA 1I6VC 3VYRA 4A3JG 2MP1A 1V43A 2AMCB 2ENBA 3R2TA 1WCMB 1EWIA 2DY7A 2GVBA 3HOZH 2G5DA 2R7FA 2Z4IA 4K5VA 2RSNA 4BY7H 4A3GH 1NAPA 2ZM6Q 1AE3A 1TS4A 1MIUA 1NTGA 3H6MA 4UDUC 3T56B 1EQRA 4FXGC 5D65A 3BS1A 2EXDA 3GDEA 4IQZA 5FLXL 5IYDH 2AQ3B 3STBD 3HOUH 2R93B 2EYMA 4JPBW 4EGVA 1M8AA 1OXXK 3MEHA 4A3DB 3PO2G 1XX8A 3SDZA 4J8QA 1SR3A 2PMZB 2Q8TA 1SEBD 3CP0A 4XYQA 1XNRL 2FMMA 1TS3A 2BDNA 3QOLA 4R4CA 4P73A 2A6ED 1YEZA 4BA1I 2D5DA 5ELBA 4CBVA 1WTVA 1SN8A 4LNQA 3FDTA 1CI3M 1HFNA 1VQOA 2QDBA 3DWPA 4A3FB 2F03A 5GAEC 3I72A 1TWCH 2E2JB 2NVTH 2JA7H 2MNAA 4LJZC 1KLGD 2XWBB 4DR3Q 1NE3A 2WACA 5FLXc 1BKBA 2CW0D 2QILA 3S1QH 4OO1I 3R3OA 3K0XA 1LM0A 5FO9B 1DJRD 4RA8A 3HRZC 3U4ZA 3TSSA 1EY6A 1JWSD 1LTID 3RMHA 2UXBL 2A19A 5JJZA 2B29A 2JA8G 1B4OA 1QG7A 2H5XA 4PMWA 5C0XG 5EKKA 4RCNA 1YJ9A 2FJ2A 2ZXRA 2XRQD 2C5CA 2XIWA 1I3QB 4V0BA 2VUMB 4RGNA 1E2ZA 1HUMA 3DHQA 5IGDA 3CCSA 3H0GG 3GTJH 3O13A 5F2DA 3QJYA 1Q46A 1SYBA 3TBIB 4DV6Q 2FHTA 2M2LA 2R93H 3HFZB 3D31A 4POGA 1NUCA 3E6ZX 1H9KA 1J5EQ 5C3XA 1N36L 2F0IA 5FJ8H 5E4XA 4KJNA 1LTSD 4I65A 2I5HA 3M3YB 1VQHA 3P20A 3EFXD 4QB4A 3A8KE 4LUOA 5M5WB 5ELNA 4HEDA 4FO2A 2DJGC 1IKMA 1FD7D 3FP9A 4JV5Q 4KI0A 1N33Q 5M3FG 5IT9L 4A75A 1YVCA 2ZTDA 2UUAQ 1NMGA 4DR7L 3W1BA 5A35A 1Y1VG 1Y1WG 5ISRA 1DM0B 3KOJA 1SNDA 3P1HA 3H3VH 2X69A 2AWNA 4A3IB 1VDZA 1ET9A 1NMFA 5FJ8G 4IPHA 1JICA 4R8IA 1CT1D 1RHPA 1EYGA 1GD7A 3U9OA 4BY1B 1EY5A 5IE8A 4LK1C 2VS1A 3EJIA 2JJQA 1UE6A 4O42A 3X3MA 1LTBD 3VYUA 1JOOA 2EYJA 3S17H 1JJ2A 3OYYA 1TWHB 2GVAA 4DK0A 1S5DD 4BXXG 2MJ8A 4HIOA 2JEAI 2LXJA 1EWHA 3CMEA 4KD3A 2JP1A 4NP5A 2NTSA 1PRTF 2F0VA 3PUYA 1IBML 3K57A 4JI2Q 3CCQA 4LF6Q 1I4GA 5A2QL 4C56C 4LF7Q 2E5LL 2XWJB 3DEPA 2HHHL 1PH8A 2PYKA 2JA5B 2P5ZX 4A4IA 2FFKB 3S2HB 2AWOA 3F2DA 5IP9G 2FINB 1A3TA 4A3DG 1TWFH 4CHTB 4C2MB 1KIXA 3PO2B 4C1NI 1C48A 1UE7A 4YWKA 5C3EH 3S2DH 1EOTA 2CHBD 4A93H 1SYEA 4QQBX 3I91A 3A74A 4PG3A 1HR0W 1EU4A 1HQMC 3ZYYX 3V05A 1ET6A 3GQBA 4IFDG 3SK4A 4BBRB 1OXSC 4BY1G 1L0XB 1STHA 4UP9A 1NR4A 1TT2A 4L63B 4DR1Q 2LMCB 3MHBA 1N9WA 3L9AX 4RHRA 5EKIA 3SHLA 1S40A 4A3BG 4A3IH 3SK5A 4K0KL 2NVXH 4JI6Q 1YNXA 3MZ5A 4YIJA 5GROA 4B9WA 1EQVA 1JORA 3NP8A 3OPOA 4HSVA 5JOBA 2F0EA 1EEFD 3I4MH 2K05A 5GQOA 3SXHA 4QY7A 1J9OA 3MXUA 4B3RQ 5C4XB 1LT4D 1U4RA 3CAMA 3DWQA 3AQQA 3RLNA 1E7ZA 3MC0B 4Z9CB 3OTOL 5D3IB 4A3KH 1F77A 2WINB 4QJFA 4HIDA 1YHQA 1UNSA 4GN5A 2EY1A 3EBEA 3BDCA 2CWAA 3MXPA 4P72A 3GTMH 5C5MA 1IYJB 4HJAA 5K36G 5FLMG 4BBRG 2ICIA 2IHEA 2EYLA 2E2IH 3UI2A 1BCPB 1VQCA 4XQQA 3URYA 1W6KA 1XXGA 3JC66 3K7AB 4B3SQ 4NW2A 4DUZQ 1I4PA 2Q2TA 2N49A 3J81j 1V1PB 2WB1G 3VYTA 2AQ2B 4YWMA 2BDOA 1D7QA 1G51A 4DV3L 4HCSA 3H94A 4GLVB 3GTGB 1PDQA 4AIMA 1X9NA 2R3ZA 2VB3X 1STBA 2DJFC 1XNQQ 5G3LF 5C0XJ 2F0SA 4Y52H 1M1KC 3HOXB 1SBBB 4YHHL 1HZBA 1Y1WB 4B3ML 3HOUG 1K0SA 3TP7A 3FVQA 4IALA 1X32A 1G8ZD 3NQTA 5C4XH 1WTXA 1R9TB 3KBGA 2UXDQ 3I4MB 1WOCA 5JEAJ 1MHWC 1EY9A 4JOIC 4QIWB 1Y8PB 1HA5A 3TP5A 3NTKA 1JJGA 4X66Q 1D1KA 2CQAA 3AFQA 3J7ZC 2RQXA 1CZGA 3H0GH 4S3SA 1I5FA 2MFIA 1IHZA 1STAA 3TREA 4GKKL 1KDAA 4YY3L 4H7BA 1D1IA 1YITA 3NBHB 1JMCA 4N9PA 3HOZB 1QVCA 4N8X1 3ULLA 2UUBL 1E1TA 1KHIA 3JAMc 1X55A 4OX9Q 1NNXA 5C0XI 1C8CA 1JT8A 1E0BA 2JA5G 1AFPA 1PH3A 4XT3B 4PMCA 3W5OA 4LF5Q 1B3QA 5ELEA 2MHVA 2NBFA 2Z6BA 4LF6L 3E0JA 1J6QA 1SYFA 4YCVA 1SYCA 1F2ZA 2YTVA 3PO3G 4GS3A 2ZXOA 4K0KQ 1S5CD 2PW5A 3AYHB 2Z1CA 4PZ6A 2Q8IB 4APVA 2EIFA 3TP8A 1RODA 5I9OA 3OIPA 1UWVA 2CH4A 1I4XA 1E24A 3BVMA 5C4HA 1MBYA 5KYLA 1PLFA 4WJ3M 2IX0A 1TWGH 4RGMA 5IYCG 2LS01 1L0YB 3S16H 1WCMG 3WOFA 1VQBA 3NEMA 1MD2D 1ZEQX 3OWEB 3M9BA 3PO2H 2Y0SG 3CPFA 3I55A 3DEOA 2EE1A 3NWTA 2HQEA 5IYDG 5CV7A 1WYDA 2IWHA 5IP7G 5EGTA 1B70B 2A6HC 3RNUA 5M3MH 4LF8Q 4B3SL 4ZK9B 3EA6A 1RTNA 4YY3Q 5C44B 2BCOA 2F3IA 4NXMQ 4FF3A 4KD4A 1IL2A 4N9TA 1WTWA 2N3SA 3IRBA 4NMZA 4RHSA 5HGQA 5IWAQ 2EY2A 4IUTA 1O7IA 2LSSA 4AQYQ 2F3WA 2K04A 3OMGA 1KNAA 5CV8A 4JI5Q 1Q81C 1Y69U 2DNCA 4IOCA 3S1RB 3AMUA 1KD1C 2Q2UA 3SR1A 3FPUB 4DN4M 1KAAA 4DR5Q 1Q12A 3QIAA 4ZKCB 4JC0A 5IIFA 1H9RA 2ES2A 4XXEA 1LTGD 4PMBA 5IWAL 2B39A 4I7ZC 5EJWA 1KDCA 3KLWA 1PZID 2DN8A 4A76A 4XTCS 4XIGS 1U5KA 3N52A 1WVLA 4C3IH 1I50B 5BR8Q 3BZCA 1OXTA 1VF7A 4YCWA 4UP7A 1I6HH 2F3VA 4BBSG 3ULJA 3RN5A 4X62L 4OONA 3NENA 3PUXA 3MXNB 1RIPA 1ONLA 2M00A 1B53A 3W2DA 1HNXL 1VQ9A 4ABNA 1NY4A 1PA6A 5CYUA 3NELA 3ZJYC 3G6EA 4LWCA 1PYWD 4ODGA 4UHVA 1HTPA 1X65A 1O7YA 1NSNS 4IJHA 4XT1B 2HIXA 5M5YH 2NVTB 1BXTA 1IYVA 2HUGA 1H9MA 1SE3A 1Q90A 2KCNA 3P7JA 2EY6A 1JE5A 4A3LH 2NWGA 1XNRQ 1PVOA 3TDQA 2R7ZH 3BZKA 3CF5A 4IPDA 3R8BA 1WD1A 3S1RH 2NZOA 3EVQA 1XNQL 1UUPA 3ER0A 3Q8DA 1SNCA 4HMJA 3M4OH 3OHXC 3CCJA 1CHQD 2DUDA 4IO9A 4A3DH 2EYHA 3PUVA 3RZOH 1RTOA 2UUCL 4PQXA 1HUNA 1K3BC 3HOWH 1Y8NB 4DAPA 2K52A 3JAMi 4ZUIA 3M4PA 4ME3A 1DOKA 1EQTA 2HDLA 1BQQT 4RH6A 5T1GA 1VQAA 5M9OA 3K59A 2E8GA 1AE2A 1V1QA 1W6JA 3V2TA 4DR3L 3S2DB 1X3FA 2YU9H 2RCFA 4R1JA 2G9DA 2PI2A 2A1AA 4DUZL 3NUCA 2JE6I 4EQNA 3BDLA 5LMUL 1B9MA 4ALPA 5EAYA 2L9HA 1QZHA 1A3UA 2FMCA 2A6EC 2IX1A 1GUOA 1DZ1A 2EQSA 1PV4A 2BA0A 4TSSA 4LFBQ 1AZQA 1W3SA 2JSOA 1JB3A 2I5LX 4RG1A 2N55A 4DV0L 1UEAB 2QDLA 4HIKA 1K8GA 2YU9B 3ERQA 5KGUA 2PI2E 2Y0SB 3WOEA 3K8AA 4KN7C 1MSGA 1JR0D 4HN7A 1LT5D 3UE1A 1K8AC 2RDGA 5FLXE 1X3PA 4M8AA 1PMRA 1U4MA 2RKSA 4DV1L 1L0WA 2F0LA 2F4IA 3T4AC 4DR5L 4LF4Q 2IPKD 2VW9A 2RA4A 5HGTA 4R4OA 1YHAA 3FHWA 5CORA 4IOAA 2OQKA 5COYA 1YHBA 2D0PA 4EQOA 3E5SA 5JPMC 1K28A 5KNBA 1YBYA 3DM1A 1QNKA 4KKUA 5J1ZA 1AW7A 2H4OA 4X62Q 2AUJD 4DNRB 1EIYB 2HIVA 3K5OA 1F9SA 1BCPD 3FMCA 5FK9C 2I46A 3KDFB 2TSSA 1STYA 2HHHQ 3BYTB 3TZUA 1QJOA 1TVXA 3UDGA 2RBMA 3X3NA 2BH8A 3VR2A 4EX5A 3CC2A 3M7NA 3HGBA 4TRDA 4RGOS 1CK1A 3K7AH 4NB3A 3CC4A 1RD9D 1SMXA 5IGEA 4FDBA 2E2IB 1RJTA 1PFNA 1LTAD 3I4LA 3A8JE 4UP8A 2JA6B 1PHJA 3MFYA 1F2MA 2B2WC 3HOXH 4B3TL 2OWOA 4IURA 1AN8A 3FRPB 4BBRH 3Q0AA 1WTQA 2J4XA 2VQFQ 1KNEA 2K6AA 2ICEC 2KEDA 4ZQ3A 4A3IG 2IY5B 4JOIA 4DK6C 4NXNL 3GTQH 1VMCA 1VQFA 1JC7A 1HPCA 2IT1A 4O0AA 4K14A 1STEA 4UPAA 1LLRD 3A7LA 1CKOA 4N8FA 1L1OC 5L37A 2JN4A 3S2HH 4JCVE 2NVQH 1S3OA 2K5NA 4IFDJ 1KRSA 2RDHA 2PW7A 2X6GA 1JCKB 4A3FH 2JA9A 3K5NA 3I4NG 1EEID 2E2HH 2RSOA 4IUVA 4JI3Q 2QW7A 2WB1B 3V96A 3RZOB 2NN6H 1TXYA 1UAPA 3A5UA 2R92B 4A3MB 5DM73 2NUCA 1GUGA 1G291 1VMPA 5ELFA 5C5LA 4JI3L 3J7YW 1X3EA 1VQGA 2QKIC 3PMFA 1PH6A 4DPGA 1U4PA 4ME5A 5EBCA 1LTTD 2K5HA 1RL2A 1ESRA 1ZXTA 1PH7A 3CHBD
chains in the Genus database with same CATH topology
3DUZA 1M4VA 4KV6A 1V8QA 2L55A 4WRDA 1IL8A 3MAQA 4JK1C 2F0MA 2CW0C 2D9UA 2KEEA 3C1FA 4XQJA 4FVMA 2O5IC 1LACA 3ND9A 4A3BB 2Z8LA 4RCOA 1ILPA 2OT2A 4HSPA 5EQ0A 3A55A 2KVMA 3SE0A 1YNJD 2A74C 2A68D 1FR3A 3KLSX 3PIO3 1SSOA 3HP3A 4BBSB 1SDFA 2PZWA 3C46A 1EY8A 1YNJC 5KNCA 1I4RA 3K58A 2EY5A 5IGFA 3FEWX 3C3LA 1JWMD 5D14A 2I07B 2O5JC 4QF4A 3N6RA 4H13C 3RD4A 5JAVA 4C3JG 4RGTA 1GUTA 2RDFA 1EZ6A 3CQZB 1ZKOA 2PCFB 3BYYB 1S5ED 2IW3A 1BCPC 4DAYA 3OIQA 4WFN3 3J80E 4A3EB 1DOMA 1OXUA 3J81E 5CGKA 2B2VC 4C3IB 1SFOB 2F0WA 1HRJA 1ICWA 1GHJA 2KOLA 1PRTD 2L1BA 1DONA 3EROA 3FPPA 2NYZD 4QCLA 3L3OC 4EQPA 2HCCA 2PNRC 1EFID 2B63B 2EXZA 4QMGA 3C2PA 1TWCB 1BO0A 1TWAB 1A2UA 2L11A 2NN6I 1SXTA 2EJMA 1Q3LA 2RVLA 5A2QE 5EBDA 1F9RA 1RF2D 3TN2A 3Q6SA 1IKLA 3BZDB 4BS9A 3QB3A 3VA5A 1SNQA 2VNUD 4A93B 1Z6HA 2WV6D 3GV6A 2LFNA 3R2IA 3G7LA 3VYSA 3MXGA 1XWEA 2B2TC 4DGZA 4M1UB 2WKCA 4OGQC 2C9OA 1K8OA 3HOWB 4FF1A 2L5TA 3H09A 3A7AB 4A3GB 1YNND 2XNAC 3HKZB 4BA2I 2D2CC 4BY7B 1GJXA 4G57A 1BCPF 4RAUC 1HTLD 3NPPA 4DFAA 1OXVA 4IUPA 5C4ZA 4HR7B 5EKLA 3D6CA 3HOUB 2DY8A 1NR2A 3L7ZC 1B1ZA 2A68C 1ESFA 2A69C 5K36H 4ILWA 3H0GB 3BVGA 2KECA 5G3LD 1A3VA 1R4PB 4A3JB 1KABA 5FO7B 4DF7A 4ZKBB 2EOTA 1T5XD 2B2UA 4X3TA 2EZVA 1TY0A 2PQEA 2SOBA 2L4NA 3ONAB 4ZUJA 3MWYW 3MXNA 1DCZA 4DAVA 2K5WA 5KYIA 5HURA 2F1MA 4F7XA 1B3AA 3GTMB 3PO3B 1HA6A 2E2HB 1BNZA 1SE4A 3M4YA 2OF1A 4GZYC 4IUQA 4FF2A 3HOYB 1TR5A 3GD7A 4OO1H 5LHY1 4KHVA 2NVQB 4OL7A 2L0CA 2WKDA 5ELDA 3OMCA 3Q23A 3S9WA 4DNTB 1CA5A 1B9NA 2K33A 1O78A 1J8IA 1BF4A 4X3UA 1ZYRC 2KCCA 2XSCA 1U4LA 2VB2X 5KIXA 1BR9A 1SNMA 2A69D 1SYDA 3T13A 1SE2A 1Z47A 1SYGA 2M9VA 4JBWA 2OXPA 5M3MB 3D4WA 2JA8B 1TIID 2OEOA 3RLFA 3DMUA 1II3A 1K8MA 3VA7A 1I4QA 2K7VA 1MGSA 2SEBD 2MPMA 5CR3A 3CRKC 3HEJA 4H0LC 3K5LA 4X3SA 3HOVB 3GTLB 3BVZA 4KK7A 4ID6A 2E2DC 1SMYD 1T5EA 5D3DA 3IL8A 1TQOA 3M85A 3CKIB 1QNUA 3NXWA 1S5BD 1F2LA 1H9JA 2V4DA 1EY7A 5T1IA 5I6YA 4U673 2B8GA 1HXYD 2Q8RE 1CM9A 1EU3A 3PV0A 5JPNC 1D6EC 3HG9A 3MA2B 2KA7A 1EY0A 5DAUA 2R7ZB 1PTOD 4BWGB 1PXUA 4DXFA 1G6ZA 1FNVA 1OO9B 4K8IA 3SK8A 3LX0A 3S15B 1EYDA 2R6GA 4KKTA 1LTRD 2D62A 4MN3A 2F0DA 3M4OB 1RKNA 3D4RA 3CRLC 3I90A 1WTRA 1TS2A 4KJOA 1G91A 1LABA 1ENFA 4IFDI 4K5XA 4K2KA 3CU7A 3I73A 4RWSC 2B2YA 5C4JB 5EPKA 1G2TA 1ENAA 3NTHA 5CV5A 1PFBA 4XQNA 1SMYC 1D5MC 4G7HC 1SJED 1CFMA 1JWUD 1BDOA 2K01A 5M5XB 4QUFA 4R9WA 3QOJA 4L8JA 2ZXPA 5LL6X 3K0YA 2B2YC 3OW7A 2E75C 2QEJC 2H1EA 3IAYA 4RKLA 3VR4A 2K32A 2BE5D 5DM63 1I4HA 3NTIA 3I4NB 3PUZA 2K5QA 1QILA 3AB9A 5J22A 4XYOA 4RKBA 4KKSA 3J81L 1FNWA 2BE5C 3HS0C 2SNSA 1QE6A 4KN4C 5CMDA 3A8IE 2NTTA 2A5HA 1WTOA 1QB5D 1PFMA 1GXDC 4C3IG 4UAIA 1HFGA 5C3WA 2B8FA 1STGA 4KY5A 5I2XA 5CBAE 2O4XA 3MVVA 1DD2A 3OWFA 5DNFA 2CVRA 3GTJB 2MGSA 2IJ0A 1BBXC 5IGCA 5CV6A 2LY7A 4ZAIA 5I6WA 3RZDB 4Q5VA 4J1MA 1E2WA 5IOCA 3GTKB 3J7AV 3D3RA 2F0TA 2E74C 2L12A 1JOKA 3JAML 4TQUS 1QOHA 1GUSA 1S4ZA 4RFBA 5KEEA 5JEAG 3IFTA 1AP0A 1TWFB 1NCVA 1Z7TA 5CBEE 1E2VA 3BG3A 2F0PA 2NZ1D 4G4KA 1PRTC 1CZWA 3D4DA 1ENCA 4G7ZC 1GUNA 2PZUA 1D2BA 2A73B 1WTPA 1K83B 2K1BA 1VF5C 2G9HD 3NE5B 4IFDH 4XDXA 3LWEA 3OSOA 3M7GA 4CKEA 1GUWA 3D8GA 3G6JB 2F0JA 4FF4A 1O80A 1FNUA 3MFGA 3GTOB 1PRTB 3P75A 2WP8J 1XYIA 2DNEA 1SAPA 1CQVA 3HZXA 2SDFA 3NSWA 1PTOB 4WJWA 4LAAA 1I6HB 4Y7NB 3J80L 4DXGA 1C4QA 4KMUC 4CJ0B 2NVYB 2F0QA 1TY2A 1CQFA 3NK9A 1QCBD 2EJFC 5ELCA 4G7OC 4ZLTF 4LMQD 1EYCA 3LNNA 3SVMA 4CKCA 3BDOA 3D6WA 3JAME 3A56A 2A6HD 3H3VC 2NVXB 2R61A 4CJ1B 4OHJA 3NHHA 3GP7A 1CA6A 1O7ZA 2ZT9C 1RCVD 2XN9C 1DOLA 3S1QB 3DWAA 3T53B 5C0XH 4F87A 1F9PA 4FNFA 4IZ8A 1G2SA 1DYQA 1PZKD 2Z4HA 1CHPD 3IKJA 3KLSA 1EL0A 3GTPB 4Q0FA 2F0KA 3NBHA 3I3CA 2KHSA 5CV4A 1IW7D 3F2UA 1LT6D 3VR5A 1F2YA 4C3JB 2B2VA 4K5WA 1JQYD 2AUKA 4K6DA 1YNNC 3SK6A 2WIIB 4V190 3TZDA 1EWCA 1XTCD 5M3FB 4DU9A 4F8MA 1R4QB 1LO5D 5JEAH 4CKBA 1Q1BA 4PNYA 1HHVA 1X3QA 1FGBD 2B2TA 4KHZA 5BN4A 1LT3D 5I4DA 1ILQA 1PTOF 5IGBA 1F9QA 5CV9A 4K8JA 4J6HA 4IN3A 5BN3A 4HCEA 1EIHA 3S1MB 3FKIB 3LWUA 3I70A 1WD0A 3S17B 1B50A 1A15A 2TMPA 3I8ZA 2PZTA 5DEHA 4R8NA 4WORA 1HQRD 4L6TB 2O2LD 1O7LA 2EYFA 4FXDA 1PZJD 3ITPA 1A6XA 2HCIA 4ZRZA 2EPBA 1IW7C 4AYBB 2KQ3A 1TKWB 3GO5A 1SJHD 5I2YA 5K5PA 3QWNA 4HMIA 2N88A 4ZYSA 4KY7A 4C1NK 1CTMA 5IODA 5NUCA 2B2UC 4PV1C 3KK7A 1VCIA 2F0GA 3KUPA 5J39A 2EYOA 3ND8A 1IYUA 2LKVA 5E4WC 1MSHA 2MUYA 3K6OA 1S5FD 3Q22A 2IL8A 2AQ1B 1GOZA 1GHKA 2B2WA 5JVG3 5C3EB 2NN6G 4KY6A 4O1NA 3KF8A 2EYPA 1PTOC 5BN5A 4NDXA 5AFWA 2KJXA 3SEBA 5KNDA 1EY4A 2BA1A 3TP6A 4K6LA 3J7AF 1BOSA 1KDBA 1BUVT 5E1FA 3R93A 2F0NA 1RDPD 5E3FA 2HDMA 2BOSA 3RUZA 3VR6A 2F0OA 2VXWA 3K5MA 4OIKA 4CGYB 4HTHA 4A3KB 5FO8B 1Q8IA 4B08A 2QCPX 3VR3A 2PPBC 4IUUA 2F0UA 3H91A 2EDGA 2PO4A 3W3AA 4CJ2C 1B44D 5LL6S 4P2CB 4TKOB 4FYDA 3OOCA 3QG1A 5JVH3 4ULLA 1EYAA 1ZYRD 4FP5D 1LV9A 1DXMA 3DXJC 5FOBB 2EVBA 1KTKA 3IFDA 3T51B 2K28A 5KRUA 1AZPA 3KLRA 4HAEA 2WAQB 1Y1VB 4K2LA 1Y8OB 1U9RA 5M5YB 4DA2A 1KLUD 2JYOA 2IX3A 3C1EA 3A54A 3WDNA 1EZ8A 4E6IA 1B2TA 4OO1G 5I9PA 1JOQA 2ID0A 4FXKC 1PTOH 5EPLA 4U68A 1TU2B 2JEBI 3Q24A 3PUWA 3GTQB 2J0TD 4MHEA 2XRSD 4F88A 3MTSA 3AU7A 5CC4A 4B9XA 4EVOA 3KBXA 3QO2A 3EQLC 4QUCA 1TS5A 1JE4A 2J7ZA 2K03A 2EJGC 4H44C 2GA4B 2NB0A 3NWSA 1A2TA 1V1OA 1TWGB 4KTAA 2JXMB 1STNA 1AEXA 4DK1A 2SNMA 5FKAC 4C3HG 1H9SB 5IT9E 3GV3A 3U9SA 1FYCA 1Q1EA 1EIGA 2F0FA 4IUNA 5EPJA 2E76C 3NQIA 2QF7A 3NBIA 2XVSA 3T16A 2K5DA 5IGGA 4X3KA 1ML0D 3S14B 3TMEA 2KUMA 3S16B 1SNPA 1D5XC 2X6LA 3S1NB 1H9SA 4NKLA 1SNOA 2F0HA 4C3HB 4MIUA 4OIJA 5TSSA 2JA7B 1MI2A 1D5ZC 1HCZA 5C6AA 1QWYA 2YYZA 3PIP3 1V1PA 1I6VC 3VYRA 2MP1A 1V43A 2ENBA 3R2TA 1WCMB 2DY7A 2Z4IA 4K5VA 2RSNA 1NAPA 1TS4A 3H6MA 3T56B 4UDUC 4FXGC 5D65A 3BS1A 4IQZA 5FLXL 2AQ3B 2R93B 2EYMA 4EGVA 1M8AA 1OXXK 3MEHA 4A3DB 1XX8A 3SDZA 4J8QA 2PMZB 2Q8TA 1SEBD 4XYQA 2FMMA 1TS3A 2BDNA 3QOLA 2A6ED 4BA1I 2D5DA 5ELBA 4CBVA 1WTVA 3FDTA 1CI3M 1HFNA 2QDBA 3DWPA 4A3FB 2F03A 3I72A 2E2JB 4LJZC 1KLGD 2XWBB 2WACA 2CW0D 2QILA 4OO1I 3R3OA 5FO9B 1DJRD 4RA8A 3HRZC 3TSSA 1EY6A 1JWSD 1LTID 3RMHA 5JJZA 1B4OA 1QG7A 4PMWA 5C0XG 5EKKA 4RCNA 2FJ2A 2ZXRA 2XRQD 2C5CA 2XIWA 1I3QB 4V0BA 2VUMB 4RGNA 1E2ZA 1HUMA 3DHQA 5IGDA 3O13A 5F2DA 3QJYA 1SYBA 3TBIB 2FHTA 2M2LA 3D31A 1NUCA 3E6ZX 1H9KA 5C3XA 2F0IA 5E4XA 4KJNA 1LTSD 4I65A 3M3YB 3P20A 3EFXD 4QB4A 3A8KE 5M5WB 4HEDA 4FO2A 1IKMA 1FD7D 4KI0A 5IT9L 5A35A 5ISRA 1DM0B 1SNDA 3P1HA 2X69A 2AWNA 4A3IB 1VDZA 1ET9A 1JICA 4R8IA 1CT1D 1RHPA 3U9OA 4BY1B 1EY5A 4LK1C 3EJIA 4O42A 3X3MA 1LTBD 3VYUA 1JOOA 2EYJA 1TWHB 4DK0A 1S5DD 2MJ8A 2JEAI 1EWHA 4KD3A 2JP1A 4NP5A 2NTSA 1PRTF 2F0VA 3PUYA 3K57A 1I4GA 5A2QL 4C56C 2XWJB 3DEPA 2PYKA 2JA5B 2FFKB 3S2HB 2AWOA 2FINB 1A3TA 4CHTB 4C2MB 3PO2B 4C1NI 1C48A 1EOTA 2CHBD 1SYEA 3I91A 1EU4A 1HQMC 3ZYYX 3V05A 1ET6A 3GQBA 4IFDG 3SK4A 4BBRB 1OXSC 1L0XB 1STHA 1NR4A 1TT2A 4L63B 2LMCB 3MHBA 3L9AX 4RHRA 5EKIA 3SHLA 3SK5A 3MZ5A 4YIJA 4B9WA 1EQVA 1JORA 3NP8A 3OPOA 4HSVA 5JOBA 2F0EA 1EEFD 2K05A 3SXHA 1J9OA 3MXUA 5C4XB 1LT4D 1U4RA 3DWQA 3MC0B 4Z9CB 5D3IB 1F77A 2WINB 1UNSA 2EY1A 3BDCA 3MXPA 5C5MA 5K36G 2ICIA 2EYLA 3UI2A 1BCPB 4XQQA 3URYA 1W6KA 1XXGA 3K7AB 4NW2A 1I4PA 1V1PB 3VYTA 2AQ2B 2BDOA 4HCSA 3H94A 3GTGB 1PDQA 2R3ZA 2VB3X 1STBA 5G3LF 5C0XJ 2F0SA 3HOXB 1SBBB 1Y1WB 3TP7A 3FVQA 4IALA 1X32A 1G8ZD 3NQTA 1WTXA 1R9TB 3KBGA 3I4MB 5JEAJ 1EY9A 4QIWB 1Y8PB 1HA5A 3TP5A 3NTKA 1D1KA 2CQAA 2RQXA 1CZGA 4S3SA 1IHZA 1STAA 1KDAA 4H7BA 1D1IA 4N9PA 3HOZB 5C0XI 1C8CA 1E0BA 1AFPA 4XT3B 4PMCA 5ELEA 2MHVA 2NBFA 3E0JA 1SYFA 1SYCA 1F2ZA 2ZXOA 1S5CD 2PW5A 2Z1CA 2Q8IB 3TP8A 1RODA 5I9OA 3OIPA 1I4XA 3BVMA 5C4HA 1MBYA 5KYLA 1PLFA 2IX0A 4RGMA 2LS01 1L0YB 3WOFA 1MD2D 1ZEQX 3OWEB 3DEOA 2EE1A 3NWTA 2HQEA 5CV7A 2IWHA 5EGTA 2A6HC 4ZK9B 3EA6A 1RTNA 5C44B 2BCOA 4FF3A 4KD4A 4N9TA 1WTWA 4NMZA 4RHSA 2EY2A 4IUTA 2F3WA 2K04A 3OMGA 1KNAA 5CV8A 1Y69U 2DNCA 3S1RB 3AMUA 3SR1A 3FPUB 4DN4M 1KAAA 1Q12A 3QIAA 4ZKCB 5IIFA 1H9RA 4XXEA 1LTGD 4PMBA 2B39A 4I7ZC 5EJWA 1KDCA 1PZID 2DN8A 4XTCS 4XIGS 3N52A 1WVLA 1I50B 1OXTA 1VF7A 2F3VA 3PUXA 1ONLA 2M00A 1B53A 3W2DA 4ABNA 5CYUA 1PYWD 4ODGA 1HTPA 1O7YA 1NSNS 4XT1B 2NVTB 1BXTA 1IYVA 2HUGA 1H9MA 1SE3A 1Q90A 2KCNA 3P7JA 2EY6A 2NWGA 3TDQA 3R8BA 1WD1A 3EVQA 1UUPA 1SNCA 4HMJA 3OHXC 1CHQD 2EYHA 3PUVA 1RTOA 4PQXA 1HUNA 1Y8NB 4DAPA 4ZUIA 1DOKA 1EQTA 2HDLA 1BQQT 4RH6A 5T1GA 5M9OA 3K59A 1W6JA 3V2TA 3S2DB 2G9DA 3NUCA 2JE6I 4EQNA 3BDLA 1B9MA 2L9HA 1A3UA 2FMCA 2A6EC 2IX1A 1GUOA 1DZ1A 2BA0A 4TSSA 1AZQA 2JSOA 1JB3A 2N55A 1UEAB 2YU9B 3ERQA 5KGUA 2Y0SB 3WOEA 4KN7C 1MSGA 1JR0D 4HN7A 1LT5D 2RDGA 5FLXE 1X3PA 4M8AA 1PMRA 1U4MA 2RKSA 2F0LA 2F4IA 3T4AC 2IPKD 2RA4A 5HGTA 5CORA 5COYA 4EQOA 3E5SA 5JPMC 5KNBA 3DM1A 1QNKA 4KKUA 5J1ZA 1AW7A 2H4OA 2AUJD 4DNRB 3K5OA 1F9SA 1BCPD 3FMCA 5FK9C 2I46A 2TSSA 1STYA 3BYTB 3TZUA 1QJOA 1TVXA 2RBMA 3X3NA 3M7NA 3VR2A 3HGBA 4TRDA 4RGOS 1CK1A 1RD9D 5IGEA 2E2IB 1RJTA 1PFNA 1LTAD 3I4LA 3A8JE 2JA6B 3MFYA 1F2MA 2B2WC 4IURA 1AN8A 3FRPB 3Q0AA 1WTQA 2J4XA 1KNEA 2K6AA 2ICEC 2KEDA 4ZQ3A 1VMCA 1JC7A 1HPCA 2IT1A 4K14A 1STEA 1LLRD 3A7LA 4IFDJ 2RDHA 2PW7A 2X6GA 1JCKB 3K5NA 1EEID 2RSOA 4IUVA 2WB1B 3V96A 3RZOB 2NN6H 1UAPA 2R92B 4A3MB 5DM73 2NUCA 1GUGA 1G291 1VMPA 5ELFA 5C5LA 3J7YW 2QKIC 3PMFA 1U4PA 4ME5A 5EBCA 1LTTD 1ESRA 1ZXTA 3CHBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNU A;  1C4Q A;  1BOS A;  1CZW A;  2XSC A;  2C5C A;  4M1U B;  1QOH A;  2GA4 B;  2BOS A;  1R4Q B;  1CQF A;  1D1K A;  1CZG A;  4P2C B;  1R4P B;  1DM0 B;  1D1I A;  4ULL A;  1C48 A;  3MXG A; 
#chains in the Genus database with same CATH topology
 3DUZ A;  4L5T A;  1HNZ L;  4JBM A;  1M4V A;  4KV6 A;  5JJK A;  1V8Q A;  2L55 A;  4WRD A;  2Z6K C;  2QGQ A;  4PZ8 A;  1IL8 A;  3MAQ A;  3PF5 A;  4JK1 C;  2F0M A;  2CW0 C;  1FL0 A;  4P74 A;  2C35 B;  2D9U A;  2KEE A;  3C1F A;  4XQJ A;  1W2B A;  4FVM A;  2O5I C;  1LAC A;  2AKW B;  1X6O A;  2ATW A;  1N8R C;  3ND9 A;  4A3B B;  2Z8L A;  3TEH B;  4GOP A;  4RCO A;  1ILP A;  1SRU A;  2OT2 A;  4HSP A;  4BY7 G;  5EQ0 A;  3A55 A;  2KVM A;  3SE0 A;  1YNJ D;  2A74 C;  1MKH A;  2A68 D;  1FR3 A;  3MEF A;  3KLS X;  3PIO 3;  2MQH A;  1SSO A;  3RZD H;  2K50 A;  3HP3 A;  4BBS B;  3I56 A;  1SDF A;  1LUZ A;  2PZW A;  3C46 A;  4JI8 Q;  1EY8 A;  2N78 A;  4YCU A;  1YNJ C;  5KNC A;  1I4R A;  3K58 A;  2EY5 A;  5IGF A;  3FEW X;  3C3L A;  1JWM D;  5D14 A;  2UU9 L;  2I07 B;  4AYB G;  2O5J C;  1C9O A;  1TWA H;  4QF4 A;  4LF4 L;  1N36 Q;  4A3C H;  3N6R A;  5LMN W;  4H13 C;  4LFA Q;  3RD4 A;  1B8A A;  5JAV A;  4C3J G;  4RGT A;  3CCV A;  1GUT A;  2RDF A;  1EZ6 A;  3CQZ B;  5AJ3 Q;  1X56 A;  4JI4 Q;  4GKJ L;  1ZKO A;  1BBU A;  2PCF B;  3BYY B;  4KHP L;  1S5E D;  1YJW A;  2IW3 A;  2VY3 A;  1BCP C;  4DAY A;  3OIQ A;  4WFN 3;  3J80 E;  4A3E B;  1EQQ A;  2JA6 G;  4H02 A;  1K3R A;  1DOM A;  3S14 H;  5LMU Q;  1OXU A;  1GM5 A;  3J81 E;  4MTN A;  5CGK A;  4OWW B;  1N32 L;  2RF4 A;  2B2V C;  3E9H A;  4C3I B;  1SFO B;  2F0W A;  1HRJ A;  1ICW A;  1GHJ A;  2KOL A;  1PRT D;  2L1B A;  3ERS X;  2JA7 G;  1J5E L;  1DON A;  3PO3 H;  3ERO A;  1SLJ A;  3FPP A;  2NYZ D;  4QCL A;  3L3O C;  4EQP A;  2HCC A;  2Z9H A;  2PNR C;  1EFI D;  2B63 B;  2NZH A;  2EXZ A;  4QMG A;  1IBK L;  3C2P A;  1TWC B;  1BO0 A;  2E2J H;  1TWA B;  2ASB A;  1A2U A;  2JA5 H;  3FKI H;  2L11 A;  2NN6 I;  1SXT A;  2EJM A;  1Q3L A;  2RVL A;  5A2Q E;  5EBD A;  1F9R A;  1RF2 D;  3B6Y A;  3TN2 A;  3Q6S A;  1IKL A;  2UXC L;  3BZD B;  3W1G A;  4BS9 A;  1GO3 E;  3LGJ A;  4A3M G;  3QB3 A;  3VA5 A;  5IT9 c;  1SNQ A;  2VNU D;  4A93 B;  1Z6H A;  2WV6 D;  2CH4 W;  3GV6 A;  4LFA L;  2LFN A;  3R2I A;  4AQY L;  3U58 A;  3KYH C;  3G7L A;  2QEX A;  3VYS A;  4JI5 L;  2GN5 A;  2HD3 A;  2JK8 A;  3AEV A;  4DV2 L;  3MXG A;  1XWE A;  2B2T C;  4DGZ A;  1VQI A;  4LUZ A;  2MO0 A;  3L0O A;  4M1U B;  2WKC A;  4LFC Q;  4OGQ C;  1QZG A;  1WJJ A;  2C9O A;  1X54 A;  2ZJP A;  1K8O A;  3HOW B;  1XTD A;  3ULP A;  1KC8 C;  4FF1 A;  2L5T A;  3H09 A;  3A7A B;  4A3G B;  1YNN D;  1L2F A;  2XNA C;  5BR8 L;  3HOV H;  3HKZ B;  3T1Y Q;  4LF7 L;  4BA2 I;  2D0O A;  1WCM H;  3GTG H;  2D2C C;  4BY7 B;  1GJX A;  2ZTE A;  4G57 A;  1BCP F;  4LFC L;  1GKH A;  4RAU C;  1FGU A;  1HTL D;  3NPP A;  1PH2 A;  4DFA A;  1OXV A;  4IUP A;  1VQL A;  5C4Z A;  2CKZ B;  4HR7 B;  3RN2 A;  5EKL A;  3D6C A;  3HOU B;  2DY8 A;  1NR2 A;  3L7Z C;  1B1Z A;  4P71 A;  2F4V Q;  2A68 C;  1ESF A;  3DLL A;  2L15 A;  2A69 C;  5K36 H;  2PQA B;  4ILW A;  3H0G B;  3T1Y L;  3BVG A;  4JYA Q;  3HOW G;  2KEC A;  3J81 i;  4AH6 A;  4LF8 L;  5G3L D;  3H15 A;  4X64 L;  2I0Q A;  1A3V A;  1R4P B;  1QUQ B;  4A3J B;  3KF8 B;  1KAB A;  5FO7 B;  4DF7 A;  4J15 A;  1C0A A;  4ZKB B;  1PH5 A;  2EOT A;  1T5X D;  1JJC B;  2B2U A;  4X3T A;  1EOV A;  2EZV A;  1TY0 A;  2PQE A;  2SOB A;  2L4N A;  3ONA B;  4C3J H;  4ZUJ A;  3RLO A;  3MWY W;  4JG2 A;  4GKK Q;  1L1O A;  3S24 A;  3MXN A;  3M3Y H;  1DCZ A;  1Q86 C;  1CKM A;  4DAV A;  2K5W A;  5KYI A;  5HUR A;  2F1M A;  2ZJR A;  2RCN A;  4F7X A;  3HKZ E;  1B3A A;  3GTM B;  1HZ9 A;  3PQI A;  3T1H L;  2BH2 A;  3PO3 B;  1HA6 A;  1YIJ A;  4RMF A;  3UDX A;  2E2H B;  1BNZ A;  1SE4 A;  1CKN B;  3M4Y A;  2OF1 A;  4GKJ Q;  4IUQ A;  3F2B A;  4GZY C;  4FF2 A;  3HOY B;  3WWV A;  1TR5 A;  3GD7 A;  4A3F G;  3H3V I;  4OO1 H;  5LHY 1;  4KHV A;  2NVQ B;  4OL7 A;  2L0C A;  2WKD A;  4O2D A;  3OMC A;  5ELD A;  3QR8 A;  3Q23 A;  3CCM A;  3S9W A;  4DNT B;  4NPS A;  1CA5 A;  1B9N A;  2K33 A;  1O78 A;  3UE0 A;  1J8I A;  4YWL A;  1BF4 A;  4X3U A;  1ZYR C;  4CDE C;  2KCC A;  2XSC A;  2CCZ A;  1U4L A;  4GOP C;  1JB7 A;  2VB2 X;  5KIX A;  1FVI A;  1BR9 A;  3J7A 5;  1SNM A;  2A69 D;  1SYD A;  3T13 A;  3HOX G;  1SE2 A;  1Z47 A;  4JBW A;  1SYG A;  1WTH A;  2M9V A;  2OXP A;  3E9I A;  5M3M B;  3D4W A;  5LMN L;  2JA8 B;  1TII D;  2OEO A;  3RLF A;  3DMU A;  1E3P A;  1II3 A;  1K8M A;  3VA7 A;  1I4Q A;  2K7V A;  1MGS A;  2SEB D;  2UUC Q;  2MPM A;  5CR3 A;  5IYB H;  3CRK C;  1XPU A;  1EUJ A;  3HEJ A;  4H0L C;  2E5L Q;  3K5L A;  4X3S A;  3HOV B;  3UDF A;  3GTO H;  1CSQ A;  3GTL B;  3BVZ A;  4KK7 A;  4ID6 A;  4JI2 L;  4YHH Q;  4A3M H;  4B3M Q;  3CCU A;  2E2D C;  3CC7 A;  1SMY D;  1VQJ A;  1T5E A;  2VZA A;  5D3D A;  4A3B H;  2Q2H A;  3IL8 A;  1TQO A;  3CKI B;  3M85 A;  1QNU A;  3FKI G;  4JVZ A;  2VL6 A;  2UU9 Q;  3NXW A;  1S5B D;  1F2L A;  1H9J A;  1PYB A;  2V4D A;  1EY7 A;  5T1I A;  1PFS A;  5I6Y A;  2RHQ B;  4U67 3;  1U0L A;  2R93 G;  2B8G A;  1HXY D;  2Q8R E;  4POF A;  1N34 Q;  3A5Z B;  3K80 C;  1CM9 A;  1EU3 A;  3PV0 A;  3VDY A;  5JPN C;  1K0R A;  1R9T H;  4JW0 A;  1VQM A;  1D6E C;  3HG9 A;  3G71 A;  4JI0 Q;  2HQL A;  3MA2 B;  2KA7 A;  1Y14 B;  1EY0 A;  5DAU A;  2R7Z B;  2JA8 H;  1PTO D;  4BWG B;  1PXU A;  4DXF A;  1G6Z A;  1FNV A;  1OO9 B;  4K8I A;  3SK8 A;  3LX0 A;  1IBM Q;  3S15 B;  4KKT A;  1EYD A;  2R6G A;  3J80 i;  1LTR D;  2D62 A;  4MN3 A;  2F0D A;  3M4O B;  1XPR A;  1RKN A;  3PIP A;  3D4R A;  1VQK A;  1LTL A;  3CRL C;  3I90 A;  4JBK A;  1WTR A;  1TS2 A;  4KJO A;  2K75 A;  1QVF A;  2XGT A;  1G91 A;  2R92 H;  1LAB A;  1ENF A;  4IFD I;  4K5X A;  3I7F A;  4K2K A;  3CU7 A;  3I73 A;  4RWS C;  1HNW Q;  2B2Y A;  5C4J B;  5EPK A;  4LUV A;  2WAQ G;  3U4V A;  1G2T A;  1ENA A;  3NTH A;  5CV5 A;  4L5S A;  1PFB A;  4XQN A;  1SMY C;  3J80 c;  5C44 G;  1D5M C;  4G7H C;  1SJE D;  1CFM A;  1JWU D;  3G4S A;  4LF9 Q;  1HZC A;  1CKN A;  1I3Q H;  1BDO A;  3CCE A;  2K01 A;  2UUB Q;  5M5X B;  4QUF A;  1Y1W H;  4R9W A;  3QOJ A;  4L8J A;  1IBL Q;  2ZXP A;  1VQN A;  4JI8 L;  5LL6 X;  3K0Y A;  2B2Y C;  3OW7 A;  2E75 C;  1P8L A;  3KFU A;  2QEJ C;  2F52 A;  2ZTC A;  4L5R C;  2H1E A;  1X3G A;  4RKL A;  3VR4 A;  3IAY A;  2K32 A;  1XPO A;  3L2P A;  2BE5 D;  5DM6 3;  4A3L G;  1V9P A;  1I4H A;  3NTI A;  3I4N B;  1SRO A;  3PUZ A;  2K5Q A;  4DV2 Q;  1QIL A;  3AB9 A;  4A3C G;  1A63 A;  4I7A A;  5J22 A;  3I2Z A;  4XYO A;  4RKB A;  3CPW A;  4KKS A;  3J81 L;  1FNW A;  3AFP A;  2BE5 C;  3HS0 C;  2SNS A;  1QE6 A;  5IY0 A;  2PMZ E;  4A3J H;  2QA4 A;  4KN4 C;  5CMD A;  3A8I E;  4DR1 L;  2AHO B;  2NTT A;  2A5H A;  1FJG Q;  1WTO A;  1HNW L;  1QB5 D;  1PFM A;  1GXD C;  1D8L A;  4C3I G;  4UAI A;  1HFG A;  4L5Q A;  5C3W A;  2B8F A;  1STG A;  4KY5 A;  5I2X A;  5CBA E;  2O4X A;  3MVV A;  1DD2 A;  3HOV G;  2CQO A;  1DGS A;  3OWF A;  5DNF A;  2CVR A;  3GTJ B;  2MGS A;  1Q8K A;  2IJ0 A;  1BBX C;  5IGC A;  5CV6 A;  4OX9 L;  2LY7 A;  4ZAI A;  5I6W A;  3CXC A;  3RZD B;  4Q5V A;  1PH9 A;  4Y7N H;  4J1M A;  1E2W A;  5IOC A;  3GTK B;  3J7A V;  3D3R A;  2F0T A;  3TS0 A;  3TQY A;  3F1Z A;  2E74 C;  2L12 A;  1JOK A;  3JAM L;  4TQU S;  1QOH A;  4CDF C;  1GUS A;  1S4Z A;  4RFB A;  4AYB E;  5KEE A;  5JEA G;  1NJI C;  3IFT A;  4X66 L;  2UXD L;  3U50 C;  1AP0 A;  1L1O B;  1TWF B;  1NCV A;  3KJO A;  1Z7T A;  5CBE E;  1E2V A;  4CDC C;  1B7Y B;  3BG3 A;  2F0P A;  2CFM A;  5C3E G;  2NZ1 D;  4G4K A;  1PRT C;  1CZW A;  4C2M H;  3D4D A;  3I4M G;  1ENC A;  4G7Z C;  2VUM G;  5AJ3 L;  1GUN A;  4GLX A;  3S15 H;  4C3H H;  2MO1 A;  1YI2 A;  2PZU A;  1D2B A;  2A73 B;  2KCT A;  1WTP A;  4OEM B;  4DV7 Q;  1NBW A;  4P75 A;  4A3G G;  1ICF B;  1K83 B;  2K1B A;  5GAG C;  1N33 L;  1VF5 C;  2G9H D;  3NE5 B;  1K73 C;  4IFD H;  4XDX A;  4DAY B;  3LWE A;  1TWH H;  3OSO A;  4JI1 Q;  3M7G A;  1MJC A;  1YJN A;  4CKE A;  1GUW A;  1H95 A;  3D8G A;  2A8V A;  3G6J B;  2F0J A;  5LMN Q;  4FF4 A;  1O80 A;  4NXM L;  1FNU A;  3MFG A;  1KRT A;  3GTO B;  1PRT B;  2Y0S E;  3P75 A;  2WP8 J;  2CWP A;  1XYI A;  2DNE A;  1SAP A;  2B63 H;  1CQV A;  3HZX A;  2SDF A;  1WI5 A;  3NSW A;  1PTO B;  4WJW A;  2VQE Q;  4LAA A;  1I6H B;  1VQ8 A;  4Y7N B;  3J80 L;  2KCM A;  4KHP Q;  4DXG A;  1C4Q A;  4JI7 Q;  4KMU C;  4DV7 L;  1E22 A;  1KL9 A;  4CJ0 B;  3J81 c;  4B3T Q;  2YTX A;  2NVY B;  2F0Q A;  3GTK H;  1HR0 L;  4GOP B;  4QIW E;  2OQ0 A;  4PZ7 A;  4B3R L;  1TY2 A;  1CQF A;  3NK9 A;  1QCB D;  2EJF C;  5ELC A;  4G7O C;  1WFQ A;  3EN2 A;  2JQO A;  2ZM6 L;  4ZLT F;  2OTJ A;  4LMQ D;  4DV4 L;  1SE8 A;  5C4J H;  3GTP H;  1EYC A;  3LNN A;  3SVM A;  1KXL A;  1ASZ A;  4CKC A;  5GAD C;  3BDO A;  3D6W A;  3JAM E;  2FXQ A;  3A56 A;  4HJ5 A;  4JI7 L;  1PH1 A;  1HNZ Q;  2A6H D;  1BBW A;  3H3V C;  2NVX B;  3K7U C;  2VQE L;  2R61 A;  4CJ1 B;  4OHJ A;  3NHH A;  3GP7 A;  4KLK A;  1CA6 A;  1O7Z A;  1UEB A;  1OTC A;  2ZT9 C;  1LYL A;  2Q2I A;  1RCV D;  2XN9 C;  1DOL A;  3S1Q B;  1KAW A;  3STB C;  3DWA A;  3KJP A;  5J3B A;  3T53 B;  5C0X H;  4F87 A;  4DR2 Q;  4IPG A;  1F9P A;  4FNF A;  4IZ8 A;  5H1S E;  1G2S A;  1DYQ A;  1PZK D;  2Z4H A;  2WAQ E;  3KLS A;  1CHP D;  3IKJ A;  4JI1 L;  3OTO Q;  3I4N H;  1EL0 A;  3GTP B;  4Q0F A;  2F0K A;  3NBH A;  3I3C A;  3HKS A;  2KHS A;  2YTY A;  5CV4 A;  1IW7 D;  3F2U A;  3CQZ H;  4OXP A;  1I94 Q;  1LT6 D;  3VR5 A;  1F2Y A;  2OCE A;  2B2V A;  4C3J B;  2VUM H;  4K5W A;  1JQY D;  2AUK A;  4K6D A;  1YNN C;  2VQF L;  4OEL B;  3SK6 A;  4MTK A;  4DV6 L;  2WII B;  3M4Q A;  4V19 0;  3TZD A;  2R92 G;  1EWC A;  1XTC D;  4LFB L;  1P16 A;  1PH4 A;  3GTL H;  4DR4 L;  3S1M H;  5M3F B;  4DU9 A;  1IXR A;  4F8M A;  1R4Q B;  1LO5 D;  5JEA H;  1XMQ Q;  4DR6 Q;  4IPC A;  1Q1B A;  4CKB A;  4PNY A;  4GNX C;  1HHV A;  1X3Q A;  1FGB D;  2B2T A;  4KHZ A;  5BN4 A;  4A3K G;  1LT3 D;  4MNO A;  4TVA B;  5I4D A;  1A0I A;  1ILQ A;  1VQ5 A;  1PTO F;  3D0F A;  5IGB A;  1F9Q A;  1QVG A;  5CV9 A;  4HJ8 A;  4K8J A;  4DAM A;  2UUA L;  4DR7 Q;  4J6H A;  4IN3 A;  5BN3 A;  5IYB G;  4HCE A;  1EIH A;  3CMA A;  1N34 L;  3S1M B;  4X6A H;  1N32 Q;  2K14 A;  4BY1 H;  3UDI A;  4DR6 L;  3FKI B;  3LWU A;  3I70 A;  4NXN Q;  1WD0 A;  2IHF A;  3S17 B;  1B50 A;  4GN4 B;  1A15 A;  2TMP A;  3I8Z A;  4A93 G;  2YV5 A;  3DM3 A;  2PZT A;  4EQ5 A;  3EIV A;  5DEH A;  4R8N A;  3PSI A;  4DK3 C;  2RHS B;  3RR5 A;  4DKA C;  4WOR A;  1XJV A;  2Z0S A;  1HQR D;  1G6P A;  4L6T B;  2O2L D;  4IJL A;  1O7L A;  2EYF A;  2N8N A;  1C7Y A;  4FXD A;  1PZJ D;  3ITP A;  1A6X A;  1VQ7 A;  1I50 H;  2HCI A;  3ICE A;  4ZRZ A;  2EPB A;  4LF5 L;  5M5X H;  1IW7 C;  4AYB B;  4DV3 Q;  2KQ3 A;  1TKW B;  1ASY A;  2KHI A;  4DV0 Q;  3GO5 A;  3TS2 A;  1SJH D;  4BXX H;  5IP7 H;  3HOY G;  5JJL A;  3BU2 A;  5I2Y A;  4JI0 L;  5K5P A;  3QWN A;  4QGU A;  4QL5 A;  4HMI A;  4DUY L;  2N88 A;  4ZYS A;  4KY7 A;  4C1N K;  1CTM A;  4GN3 B;  1Q7Y C;  5NUC A;  5IOD A;  5JJI A;  2B2U C;  4PV1 C;  1XMO L;  3KK7 A;  1VCI A;  2F0G A;  3KUP A;  2LXK A;  5J39 A;  2EYO A;  3ND8 A;  1IYU A;  2LKV A;  4CDD C;  5E4W C;  1MSH A;  2MUY A;  3K6O A;  1S5F D;  2B3G A;  4X64 Q;  3Q22 A;  2IL8 A;  2AQ1 B;  5M3M G;  1HR0 Q;  1SFO H;  1GOZ A;  1GHK A;  2B2W A;  5JVG 3;  1VQ6 A;  1VQ4 A;  5C3E B;  1MJE A;  2NN6 G;  2NVY H;  4KY6 A;  4HJ9 A;  4O1N A;  3KF8 A;  2EYP A;  3E0E A;  5IP9 H;  1PTO C;  5BN5 A;  2PNH A;  4NDX A;  4GNX B;  4DNI A;  2F4V L;  3PF4 A;  5E7N A;  5AFW A;  5C44 H;  4JI6 L;  2WFW A;  2KJX A;  4HJ7 A;  2WB1 E;  3SEB A;  5KND A;  1EY4 A;  5IYC H;  2BA1 A;  1IBL L;  3TP6 A;  4K6L A;  1VQD A;  3J7A F;  1BOS A;  1KDB A;  3PGZ A;  1BUV T;  5E1F A;  5HY6 A;  3R93 A;  2F0N A;  2V1C C;  1BVS A;  1RDP D;  1HNX Q;  5E3F A;  2HDM A;  2BOS A;  3RUZ A;  1IZ6 A;  3VR6 A;  2F0O A;  2VXW A;  2OTL A;  1KQS A;  3K5M A;  1HJP A;  2KEN A;  4OIK A;  4CGY B;  1S72 A;  4UY8 C;  4HTH A;  4A3K B;  3KF6 A;  5FO8 B;  1Q8I A;  1VQE A;  4JI4 L;  4B08 A;  2QCP X;  4HIM A;  4GNX A;  3VR3 A;  5GAH C;  2PPB C;  4IUU A;  1Y1V H;  2XTI A;  2F0U A;  3H91 A;  2EDG A;  2PO4 A;  4X65 Q;  2KHJ A;  1FJG L;  3W3A A;  4CJ2 C;  1B44 D;  3E3X A;  5LL6 S;  4P2C B;  4TKO B;  4FYD A;  1VS0 A;  1A8V A;  3F8T A;  3OOC A;  3QG1 A;  1M90 C;  5JVH 3;  4ULL A;  3HKZ G;  1EYA A;  1ZYR D;  4FP5 D;  1LV9 A;  2DGY A;  3T1H Q;  1DXM A;  3DXJ C;  2HT1 A;  5FOB B;  2EVB A;  1EIF A;  2KBN A;  1VQP A;  1KTK A;  3IFD A;  3K81 C;  2K28 A;  3T51 B;  5KRU A;  1AZP A;  5C4X G;  2PQA A;  4R4Q A;  3KLR A;  4HAE A;  2WAQ B;  5FLM H;  4GLA C;  4OWX B;  1Y1V B;  4K2L A;  3PIO A;  3HOY H;  1UE5 A;  1Y8O B;  4JYA L;  1U9R A;  5M5Y B;  4DA2 A;  1KLU D;  1A62 A;  1QUQ A;  1UE1 A;  2JYO A;  3KDF A;  2IX3 A;  3C1E A;  1YZ6 A;  3A54 A;  1EZ8 A;  3WDN A;  4ZCK A;  4E6I A;  1B2T A;  4DR4 Q;  4OO1 G;  4WJ4 A;  5I9P A;  3F2C A;  1JOQ A;  3CD6 A;  2ID0 A;  4FXK C;  1PTO H;  1XMQ L;  5EPL A;  2B63 G;  4U68 A;  4R4I A;  1TU2 B;  2JEB I;  4DV1 Q;  1CUK A;  3Q24 A;  3CCR A;  3PUW A;  4MZ9 A;  1CSP A;  3GTQ B;  2J0T D;  4MHE A;  2XRS D;  4F88 A;  3MTS A;  3AU7 A;  5CC4 A;  4B9X A;  4EVO A;  3KBX A;  1HZA A;  3QO2 A;  3EQL C;  3TRZ A;  1GVP A;  4QUC A;  1TS5 A;  1JE4 A;  2ALY B;  2J7Z A;  2K03 A;  2UXB Q;  2EJG C;  4X65 L;  4H44 C;  2GA4 B;  5ELO A;  2NB0 A;  3NWS A;  2JA6 H;  3CW2 C;  1A2T A;  1V1O A;  4DV5 Q;  1TWG B;  4KTA A;  2JXM B;  1STN A;  1AEX A;  5M5W H;  4DK1 A;  2SNM A;  5FKA C;  4C3H G;  1H9S B;  4A3E H;  3A0J A;  1EFW A;  5IT9 E;  2K5V A;  3PCO B;  3GV3 A;  3U9S A;  1XMO Q;  1Q82 C;  1FYC A;  5DLQ E;  4JV5 L;  1Q1E A;  1Z9F A;  1EIG A;  2R7Z G;  4DUY Q;  1T9H A;  2F0F A;  1PYS B;  4IUN A;  2K4K A;  5EPJ A;  3SGI A;  4DV5 L;  2E76 C;  4R4T A;  3NQI A;  2QF7 A;  2I5M X;  2ZJQ A;  3NBI A;  2XVS A;  3T16 A;  1AH9 A;  3HOZ G;  3BJU A;  4OWT B;  2K5D A;  4JBJ A;  3I4O A;  5IGG A;  4X3K A;  1ML0 D;  3S14 B;  3TME A;  4DV4 Q;  2KUM A;  3S16 B;  1SNP A;  4A3E G;  2R7D A;  3KF6 B;  4BBS H;  1I94 L;  1D5X C;  2X6L A;  3S1N B;  2UXC Q;  1E1O A;  1H9S A;  2Z6K A;  4NKL A;  1SNO A;  2F0H A;  1HH2 P;  4C3H B;  4MIU A;  3G48 A;  1K9M C;  3OW2 A;  1IBK Q;  4OIJ A;  1K83 H;  5TSS A;  3CCL A;  2JA7 B;  1MI2 A;  1D5Z C;  1HCZ A;  5C6A A;  4DR2 L;  5M3F H;  4LF9 L;  4LW1 A;  1QWY A;  2YYZ A;  3PIP 3;  3S1N H;  1V1P A;  1I6V C;  3VYR A;  4A3J G;  2MP1 A;  1V43 A;  2AMC B;  2ENB A;  3R2T A;  1WCM B;  1EWI A;  2DY7 A;  2GVB A;  3HOZ H;  2G5D A;  2R7F A;  2Z4I A;  4K5V A;  2RSN A;  4BY7 H;  4A3G H;  1NAP A;  2ZM6 Q;  1AE3 A;  1TS4 A;  1MIU A;  1NTG A;  3H6M A;  4UDU C;  3T56 B;  1EQR A;  4FXG C;  5D65 A;  3BS1 A;  2EXD A;  3GDE A;  4IQZ A;  5FLX L;  5IYD H;  2AQ3 B;  3STB D;  3HOU H;  2R93 B;  2EYM A;  4JPB W;  4EGV A;  1M8A A;  1OXX K;  3MEH A;  4A3D B;  3PO2 G;  1XX8 A;  3SDZ A;  4J8Q A;  1SR3 A;  2PMZ B;  2Q8T A;  1SEB D;  3CP0 A;  4XYQ A;  1XNR L;  2FMM A;  1TS3 A;  2BDN A;  3QOL A;  4R4C A;  4P73 A;  2A6E D;  1YEZ A;  4BA1 I;  2D5D A;  5ELB A;  4CBV A;  1WTV A;  1SN8 A;  4LNQ A;  3FDT A;  1CI3 M;  1HFN A;  1VQO A;  2QDB A;  3DWP A;  4A3F B;  2F03 A;  5GAE C;  3I72 A;  1TWC H;  2E2J B;  2NVT H;  2JA7 H;  2MNA A;  4LJZ C;  1KLG D;  2XWB B;  4DR3 Q;  1NE3 A;  2WAC A;  5FLX c;  1BKB A;  2CW0 D;  2QIL A;  3S1Q H;  4OO1 I;  3R3O A;  3K0X A;  1LM0 A;  5FO9 B;  1DJR D;  4RA8 A;  3HRZ C;  3U4Z A;  3TSS A;  1EY6 A;  1JWS D;  1LTI D;  3RMH A;  2UXB L;  2A19 A;  5JJZ A;  2B29 A;  2JA8 G;  1B4O A;  1QG7 A;  2H5X A;  4PMW A;  5C0X G;  5EKK A;  4RCN A;  1YJ9 A;  2FJ2 A;  2ZXR A;  2XRQ D;  2C5C A;  2XIW A;  1I3Q B;  4V0B A;  2VUM B;  4RGN A;  1E2Z A;  1HUM A;  3DHQ A;  5IGD A;  3CCS A;  3H0G G;  3GTJ H;  3O13 A;  5F2D A;  3QJY A;  1Q46 A;  1SYB A;  3TBI B;  4DV6 Q;  2FHT A;  2M2L A;  2R93 H;  3HFZ B;  3D31 A;  4POG A;  1NUC A;  3E6Z X;  1H9K A;  1J5E Q;  5C3X A;  1N36 L;  2F0I A;  5FJ8 H;  5E4X A;  4KJN A;  1LTS D;  4I65 A;  2I5H A;  3M3Y B;  1VQH A;  3P20 A;  3EFX D;  4QB4 A;  3A8K E;  4LUO A;  5M5W B;  5ELN A;  4HED A;  4FO2 A;  2DJG C;  1IKM A;  1FD7 D;  3FP9 A;  4JV5 Q;  4KI0 A;  1N33 Q;  5M3F G;  5IT9 L;  4A75 A;  1YVC A;  2ZTD A;  2UUA Q;  1NMG A;  4DR7 L;  3W1B A;  5A35 A;  1Y1V G;  1Y1W G;  5ISR A;  1DM0 B;  3KOJ A;  1SND A;  3P1H A;  3H3V H;  2X69 A;  2AWN A;  4A3I B;  1VDZ A;  1ET9 A;  1NMF A;  5FJ8 G;  4IPH A;  1JIC A;  4R8I A;  1CT1 D;  1RHP A;  1EYG A;  1GD7 A;  3U9O A;  4BY1 B;  1EY5 A;  5IE8 A;  4LK1 C;  2VS1 A;  3EJI A;  2JJQ A;  1UE6 A;  4O42 A;  3X3M A;  1LTB D;  3VYU A;  1JOO A;  2EYJ A;  3S17 H;  1JJ2 A;  3OYY A;  1TWH B;  2GVA A;  4DK0 A;  1S5D D;  4BXX G;  2MJ8 A;  4HIO A;  2JEA I;  2LXJ A;  1EWH A;  3CME A;  4KD3 A;  2JP1 A;  4NP5 A;  2NTS A;  1PRT F;  2F0V A;  3PUY A;  1IBM L;  3K57 A;  4JI2 Q;  3CCQ A;  4LF6 Q;  1I4G A;  5A2Q L;  4C56 C;  4LF7 Q;  2E5L L;  2XWJ B;  3DEP A;  2HHH L;  1PH8 A;  2PYK A;  2JA5 B;  2P5Z X;  4A4I A;  2FFK B;  3S2H B;  2AWO A;  3F2D A;  5IP9 G;  2FIN B;  1A3T A;  4A3D G;  1TWF H;  4CHT B;  4C2M B;  1KIX A;  3PO2 B;  4C1N I;  1C48 A;  1UE7 A;  4YWK A;  5C3E H;  3S2D H;  1EOT A;  2CHB D;  4A93 H;  1SYE A;  4QQB X;  3I91 A;  3A74 A;  4PG3 A;  1HR0 W;  1EU4 A;  1HQM C;  3ZYY X;  3V05 A;  1ET6 A;  3GQB A;  4IFD G;  3SK4 A;  4BBR B;  1OXS C;  4BY1 G;  1L0X B;  1STH A;  4UP9 A;  1NR4 A;  1TT2 A;  4L63 B;  4DR1 Q;  2LMC B;  3MHB A;  1N9W A;  3L9A X;  4RHR A;  5EKI A;  3SHL A;  1S40 A;  4A3B G;  4A3I H;  3SK5 A;  4K0K L;  2NVX H;  4JI6 Q;  1YNX A;  3MZ5 A;  4YIJ A;  5GRO A;  4B9W A;  1EQV A;  1JOR A;  3NP8 A;  3OPO A;  4HSV A;  5JOB A;  2F0E A;  1EEF D;  3I4M H;  2K05 A;  5GQO A;  3SXH A;  4QY7 A;  1J9O A;  3MXU A;  4B3R Q;  5C4X B;  1LT4 D;  1U4R A;  3CAM A;  3DWQ A;  3AQQ A;  3RLN A;  1E7Z A;  3MC0 B;  4Z9C B;  3OTO L;  5D3I B;  4A3K H;  1F77 A;  2WIN B;  4QJF A;  4HID A;  1YHQ A;  1UNS A;  4GN5 A;  2EY1 A;  3EBE A;  3BDC A;  2CWA A;  3MXP A;  4P72 A;  3GTM H;  5C5M A;  1IYJ B;  4HJA A;  5K36 G;  5FLM G;  4BBR G;  2ICI A;  2IHE A;  2EYL A;  2E2I H;  3UI2 A;  1BCP B;  1VQC A;  4XQQ A;  3URY A;  1W6K A;  1XXG A;  3JC6 6;  3K7A B;  4B3S Q;  4NW2 A;  4DUZ Q;  1I4P A;  2Q2T A;  2N49 A;  3J81 j;  1V1P B;  2WB1 G;  3VYT A;  2AQ2 B;  4YWM A;  2BDO A;  1D7Q A;  1G51 A;  4DV3 L;  4HCS A;  3H94 A;  4GLV B;  3GTG B;  1PDQ A;  4AIM A;  1X9N A;  2R3Z A;  2VB3 X;  1STB A;  2DJF C;  1XNQ Q;  5G3L F;  5C0X J;  2F0S A;  4Y52 H;  1M1K C;  3HOX B;  1SBB B;  4YHH L;  1HZB A;  1Y1W B;  4B3M L;  3HOU G;  1K0S A;  3TP7 A;  3FVQ A;  4IAL A;  1X32 A;  1G8Z D;  3NQT A;  5C4X H;  1WTX A;  1R9T B;  3KBG A;  2UXD Q;  3I4M B;  1WOC A;  5JEA J;  1MHW C;  1EY9 A;  4JOI C;  4QIW B;  1Y8P B;  1HA5 A;  3TP5 A;  3NTK A;  1JJG A;  4X66 Q;  1D1K A;  2CQA A;  3AFQ A;  3J7Z C;  2RQX A;  1CZG A;  3H0G H;  4S3S A;  1I5F A;  2MFI A;  1IHZ A;  1STA A;  3TRE A;  4GKK L;  1KDA A;  4YY3 L;  4H7B A;  1D1I A;  1YIT A;  3NBH B;  1JMC A;  4N9P A;  3HOZ B;  1QVC A;  4N8X 1;  3ULL A;  2UUB L;  1E1T A;  1KHI A;  3JAM c;  1X55 A;  4OX9 Q;  1NNX A;  5C0X I;  1C8C A;  1JT8 A;  1E0B A;  2JA5 G;  1AFP A;  1PH3 A;  4XT3 B;  4PMC A;  3W5O A;  4LF5 Q;  1B3Q A;  5ELE A;  2MHV A;  2NBF A;  2Z6B A;  4LF6 L;  3E0J A;  1J6Q A;  1SYF A;  4YCV A;  1SYC A;  1F2Z A;  2YTV A;  3PO3 G;  4GS3 A;  2ZXO A;  4K0K Q;  1S5C D;  2PW5 A;  3AYH B;  2Z1C A;  4PZ6 A;  2Q8I B;  4APV A;  2EIF A;  3TP8 A;  1ROD A;  5I9O A;  3OIP A;  1UWV A;  2CH4 A;  1I4X A;  1E24 A;  3BVM A;  5C4H A;  1MBY A;  5KYL A;  1PLF A;  4WJ3 M;  2IX0 A;  1TWG H;  4RGM A;  5IYC G;  2LS0 1;  1L0Y B;  3S16 H;  1WCM G;  3WOF A;  1VQB A;  3NEM A;  1MD2 D;  1ZEQ X;  3OWE B;  3M9B A;  3PO2 H;  2Y0S G;  3CPF A;  3I55 A;  3DEO A;  2EE1 A;  3NWT A;  2HQE A;  5IYD G;  5CV7 A;  1WYD A;  2IWH A;  5IP7 G;  5EGT A;  1B70 B;  2A6H C;  3RNU A;  5M3M H;  4LF8 Q;  4B3S L;  4ZK9 B;  3EA6 A;  1RTN A;  4YY3 Q;  5C44 B;  2BCO A;  2F3I A;  4NXM Q;  4FF3 A;  4KD4 A;  1IL2 A;  4N9T A;  1WTW A;  2N3S A;  3IRB A;  4NMZ A;  4RHS A;  5HGQ A;  5IWA Q;  2EY2 A;  4IUT A;  1O7I A;  2LSS A;  4AQY Q;  2F3W A;  2K04 A;  3OMG A;  1KNA A;  5CV8 A;  4JI5 Q;  1Q81 C;  1Y69 U;  2DNC A;  4IOC A;  3S1R B;  3AMU A;  1KD1 C;  2Q2U A;  3SR1 A;  3FPU B;  4DN4 M;  1KAA A;  4DR5 Q;  1Q12 A;  3QIA A;  4ZKC B;  4JC0 A;  5IIF A;  1H9R A;  2ES2 A;  4XXE A;  1LTG D;  4PMB A;  5IWA L;  2B39 A;  4I7Z C;  5EJW A;  1KDC A;  3KLW A;  1PZI D;  2DN8 A;  4A76 A;  4XTC S;  4XIG S;  1U5K A;  3N52 A;  1WVL A;  4C3I H;  1I50 B;  5BR8 Q;  3BZC A;  1OXT A;  1VF7 A;  4YCW A;  4UP7 A;  1I6H H;  2F3V A;  4BBS G;  3ULJ A;  3RN5 A;  4X62 L;  4OON A;  3NEN A;  3PUX A;  3MXN B;  1RIP A;  1ONL A;  2M00 A;  1B53 A;  3W2D A;  1HNX L;  1VQ9 A;  4ABN A;  1NY4 A;  1PA6 A;  5CYU A;  3NEL A;  3ZJY C;  3G6E A;  4LWC A;  1PYW D;  4ODG A;  4UHV A;  1HTP A;  1X65 A;  1O7Y A;  1NSN S;  4IJH A;  4XT1 B;  2HIX A;  5M5Y H;  2NVT B;  1BXT A;  1IYV A;  2HUG A;  1H9M A;  1SE3 A;  1Q90 A;  2KCN A;  3P7J A;  2EY6 A;  1JE5 A;  4A3L H;  2NWG A;  1XNR Q;  1PVO A;  3TDQ A;  2R7Z H;  3BZK A;  3CF5 A;  4IPD A;  3R8B A;  1WD1 A;  3S1R H;  2NZO A;  3EVQ A;  1XNQ L;  1UUP A;  3ER0 A;  3Q8D A;  1SNC A;  4HMJ A;  3M4O H;  3OHX C;  3CCJ A;  1CHQ D;  2DUD A;  4IO9 A;  4A3D H;  2EYH A;  3PUV A;  3RZO H;  1RTO A;  2UUC L;  4PQX A;  1HUN A;  1K3B C;  3HOW H;  1Y8N B;  4DAP A;  2K52 A;  3JAM i;  4ZUI A;  3M4P A;  4ME3 A;  1DOK A;  1EQT A;  2HDL A;  1BQQ T;  4RH6 A;  5T1G A;  1VQA A;  5M9O A;  3K59 A;  2E8G A;  1AE2 A;  1V1Q A;  1W6J A;  3V2T A;  4DR3 L;  3S2D B;  1X3F A;  2YU9 H;  2RCF A;  4R1J A;  2G9D A;  2PI2 A;  2A1A A;  4DUZ L;  3NUC A;  2JE6 I;  4EQN A;  3BDL A;  5LMU L;  1B9M A;  4ALP A;  5EAY A;  2L9H A;  1QZH A;  1A3U A;  2FMC A;  2A6E C;  2IX1 A;  1GUO A;  1DZ1 A;  2EQS A;  1PV4 A;  2BA0 A;  4TSS A;  4LFB Q;  1AZQ A;  1W3S A;  2JSO A;  1JB3 A;  2I5L X;  4RG1 A;  2N55 A;  4DV0 L;  1UEA B;  2QDL A;  4HIK A;  1K8G A;  2YU9 B;  3ERQ A;  5KGU A;  2PI2 E;  2Y0S B;  3WOE A;  3K8A A;  4KN7 C;  1MSG A;  1JR0 D;  4HN7 A;  1LT5 D;  3UE1 A;  1K8A C;  2RDG A;  5FLX E;  1X3P A;  4M8A A;  1PMR A;  1U4M A;  2RKS A;  4DV1 L;  1L0W A;  2F0L A;  2F4I A;  3T4A C;  4DR5 L;  4LF4 Q;  2IPK D;  2VW9 A;  2RA4 A;  5HGT A;  4R4O A;  1YHA A;  3FHW A;  5COR A;  4IOA A;  2OQK A;  5COY A;  1YHB A;  2D0P A;  4EQO A;  3E5S A;  5JPM C;  1K28 A;  5KNB A;  1YBY A;  3DM1 A;  1QNK A;  4KKU A;  5J1Z A;  1AW7 A;  2H4O A;  4X62 Q;  2AUJ D;  4DNR B;  1EIY B;  2HIV A;  3K5O A;  1F9S A;  1BCP D;  3FMC A;  5FK9 C;  2I46 A;  3KDF B;  2TSS A;  1STY A;  2HHH Q;  3BYT B;  3TZU A;  1QJO A;  1TVX A;  3UDG A;  2RBM A;  3X3N A;  2BH8 A;  3VR2 A;  4EX5 A;  3CC2 A;  3M7N A;  3HGB A;  4TRD A;  4RGO S;  1CK1 A;  3K7A H;  4NB3 A;  3CC4 A;  1RD9 D;  1SMX A;  5IGE A;  4FDB A;  2E2I B;  1RJT A;  1PFN A;  1LTA D;  3I4L A;  3A8J E;  4UP8 A;  2JA6 B;  1PHJ A;  3MFY A;  1F2M A;  2B2W C;  3HOX H;  4B3T L;  2OWO A;  4IUR A;  1AN8 A;  3FRP B;  4BBR H;  3Q0A A;  1WTQ A;  2J4X A;  2VQF Q;  1KNE A;  2K6A A;  2ICE C;  2KED A;  4ZQ3 A;  4A3I G;  2IY5 B;  4JOI A;  4DK6 C;  4NXN L;  3GTQ H;  1VMC A;  1VQF A;  1JC7 A;  1HPC A;  2IT1 A;  4O0A A;  4K14 A;  1STE A;  4UPA A;  1LLR D;  3A7L A;  1CKO A;  4N8F A;  1L1O C;  5L37 A;  2JN4 A;  3S2H H;  4JCV E;  2NVQ H;  1S3O A;  2K5N A;  4IFD J;  1KRS A;  2RDH A;  2PW7 A;  2X6G A;  1JCK B;  4A3F H;  2JA9 A;  3K5N A;  3I4N G;  1EEI D;  2E2H H;  2RSO A;  4IUV A;  4JI3 Q;  2QW7 A;  2WB1 B;  3V96 A;  3RZO B;  2NN6 H;  1TXY A;  1UAP A;  3A5U A;  2R92 B;  4A3M B;  5DM7 3;  2NUC A;  1GUG A;  1G29 1;  1VMP A;  5ELF A;  5C5L A;  4JI3 L;  3J7Y W;  1X3E A;  1VQG A;  2QKI C;  3PMF A;  1PH6 A;  4DPG A;  1U4P A;  4ME5 A;  5EBC A;  1LTT D;  2K5H A;  1RL2 A;  1ESR A;  1ZXT A;  1PH7 A;  3CHB D; 
#chains in the Genus database with same CATH homology
 3DUZ A;  1M4V A;  4KV6 A;  1V8Q A;  2L55 A;  4WRD A;  1IL8 A;  3MAQ A;  4JK1 C;  2F0M A;  2CW0 C;  2D9U A;  2KEE A;  3C1F A;  4XQJ A;  4FVM A;  2O5I C;  1LAC A;  3ND9 A;  4A3B B;  2Z8L A;  4RCO A;  1ILP A;  2OT2 A;  4HSP A;  5EQ0 A;  3A55 A;  2KVM A;  3SE0 A;  1YNJ D;  2A74 C;  2A68 D;  1FR3 A;  3KLS X;  3PIO 3;  1SSO A;  3HP3 A;  4BBS B;  1SDF A;  2PZW A;  3C46 A;  1EY8 A;  1YNJ C;  5KNC A;  1I4R A;  3K58 A;  2EY5 A;  5IGF A;  3FEW X;  3C3L A;  1JWM D;  5D14 A;  2I07 B;  2O5J C;  4QF4 A;  3N6R A;  4H13 C;  3RD4 A;  5JAV A;  4C3J G;  4RGT A;  1GUT A;  2RDF A;  1EZ6 A;  3CQZ B;  1ZKO A;  2PCF B;  3BYY B;  1S5E D;  2IW3 A;  1BCP C;  4DAY A;  3OIQ A;  4WFN 3;  3J80 E;  4A3E B;  1DOM A;  1OXU A;  3J81 E;  5CGK A;  2B2V C;  4C3I B;  1SFO B;  2F0W A;  1HRJ A;  1ICW A;  1GHJ A;  2KOL A;  1PRT D;  2L1B A;  1DON A;  3ERO A;  3FPP A;  2NYZ D;  4QCL A;  3L3O C;  4EQP A;  2HCC A;  2PNR C;  1EFI D;  2B63 B;  2EXZ A;  4QMG A;  3C2P A;  1TWC B;  1BO0 A;  1TWA B;  1A2U A;  2L11 A;  2NN6 I;  1SXT A;  2EJM A;  1Q3L A;  2RVL A;  5A2Q E;  5EBD A;  1F9R A;  1RF2 D;  3TN2 A;  3Q6S A;  1IKL A;  3BZD B;  4BS9 A;  3QB3 A;  3VA5 A;  1SNQ A;  2VNU D;  4A93 B;  1Z6H A;  2WV6 D;  3GV6 A;  2LFN A;  3R2I A;  3G7L A;  3VYS A;  3MXG A;  1XWE A;  2B2T C;  4DGZ A;  4M1U B;  2WKC A;  4OGQ C;  2C9O A;  1K8O A;  3HOW B;  4FF1 A;  2L5T A;  3H09 A;  3A7A B;  4A3G B;  1YNN D;  2XNA C;  3HKZ B;  4BA2 I;  2D2C C;  4BY7 B;  1GJX A;  4G57 A;  1BCP F;  4RAU C;  1HTL D;  3NPP A;  4DFA A;  1OXV A;  4IUP A;  5C4Z A;  4HR7 B;  5EKL A;  3D6C A;  3HOU B;  2DY8 A;  1NR2 A;  3L7Z C;  1B1Z A;  2A68 C;  1ESF A;  2A69 C;  5K36 H;  4ILW A;  3H0G B;  3BVG A;  2KEC A;  5G3L D;  1A3V A;  1R4P B;  4A3J B;  1KAB A;  5FO7 B;  4DF7 A;  4ZKB B;  2EOT A;  1T5X D;  2B2U A;  4X3T A;  2EZV A;  1TY0 A;  2PQE A;  2SOB A;  2L4N A;  3ONA B;  4ZUJ A;  3MWY W;  3MXN A;  1DCZ A;  4DAV A;  2K5W A;  5KYI A;  5HUR A;  2F1M A;  4F7X A;  1B3A A;  3GTM B;  3PO3 B;  1HA6 A;  2E2H B;  1BNZ A;  1SE4 A;  3M4Y A;  2OF1 A;  4GZY C;  4IUQ A;  4FF2 A;  3HOY B;  1TR5 A;  3GD7 A;  4OO1 H;  5LHY 1;  4KHV A;  2NVQ B;  4OL7 A;  2L0C A;  2WKD A;  5ELD A;  3OMC A;  3Q23 A;  3S9W A;  4DNT B;  1CA5 A;  1B9N A;  2K33 A;  1O78 A;  1J8I A;  1BF4 A;  4X3U A;  1ZYR C;  2KCC A;  2XSC A;  1U4L A;  2VB2 X;  5KIX A;  1BR9 A;  1SNM A;  2A69 D;  1SYD A;  3T13 A;  1SE2 A;  1Z47 A;  1SYG A;  2M9V A;  4JBW A;  2OXP A;  5M3M B;  3D4W A;  2JA8 B;  1TII D;  2OEO A;  3RLF A;  3DMU A;  1II3 A;  1K8M A;  3VA7 A;  1I4Q A;  2K7V A;  1MGS A;  2SEB D;  2MPM A;  5CR3 A;  3CRK C;  3HEJ A;  4H0L C;  3K5L A;  4X3S A;  3HOV B;  3GTL B;  3BVZ A;  4KK7 A;  4ID6 A;  2E2D C;  1SMY D;  1T5E A;  5D3D A;  3IL8 A;  1TQO A;  3M85 A;  3CKI B;  1QNU A;  3NXW A;  1S5B D;  1F2L A;  1H9J A;  2V4D A;  1EY7 A;  5T1I A;  5I6Y A;  4U67 3;  2B8G A;  1HXY D;  2Q8R E;  1CM9 A;  1EU3 A;  3PV0 A;  5JPN C;  1D6E C;  3HG9 A;  3MA2 B;  2KA7 A;  1EY0 A;  5DAU A;  2R7Z B;  1PTO D;  4BWG B;  1PXU A;  4DXF A;  1G6Z A;  1FNV A;  1OO9 B;  4K8I A;  3SK8 A;  3LX0 A;  3S15 B;  1EYD A;  2R6G A;  4KKT A;  1LTR D;  2D62 A;  4MN3 A;  2F0D A;  3M4O B;  1RKN A;  3D4R A;  3CRL C;  3I90 A;  1WTR A;  1TS2 A;  4KJO A;  1G91 A;  1LAB A;  1ENF A;  4IFD I;  4K5X A;  4K2K A;  3CU7 A;  3I73 A;  4RWS C;  2B2Y A;  5C4J B;  5EPK A;  1G2T A;  1ENA A;  3NTH A;  5CV5 A;  1PFB A;  4XQN A;  1SMY C;  1D5M C;  4G7H C;  1SJE D;  1CFM A;  1JWU D;  1BDO A;  2K01 A;  5M5X B;  4QUF A;  4R9W A;  3QOJ A;  4L8J A;  2ZXP A;  5LL6 X;  3K0Y A;  2B2Y C;  3OW7 A;  2E75 C;  2QEJ C;  2H1E A;  3IAY A;  4RKL A;  3VR4 A;  2K32 A;  2BE5 D;  5DM6 3;  1I4H A;  3NTI A;  3I4N B;  3PUZ A;  2K5Q A;  1QIL A;  3AB9 A;  5J22 A;  4XYO A;  4RKB A;  4KKS A;  3J81 L;  1FNW A;  2BE5 C;  3HS0 C;  2SNS A;  1QE6 A;  4KN4 C;  5CMD A;  3A8I E;  2NTT A;  2A5H A;  1WTO A;  1QB5 D;  1PFM A;  1GXD C;  4C3I G;  4UAI A;  1HFG A;  5C3W A;  2B8F A;  1STG A;  4KY5 A;  5I2X A;  5CBA E;  2O4X A;  3MVV A;  1DD2 A;  3OWF A;  5DNF A;  2CVR A;  3GTJ B;  2MGS A;  2IJ0 A;  1BBX C;  5IGC A;  5CV6 A;  2LY7 A;  4ZAI A;  5I6W A;  3RZD B;  4Q5V A;  4J1M A;  1E2W A;  5IOC A;  3GTK B;  3J7A V;  3D3R A;  2F0T A;  2E74 C;  2L12 A;  1JOK A;  3JAM L;  4TQU S;  1QOH A;  1GUS A;  1S4Z A;  4RFB A;  5KEE A;  5JEA G;  3IFT A;  1AP0 A;  1TWF B;  1NCV A;  1Z7T A;  5CBE E;  1E2V A;  3BG3 A;  2F0P A;  2NZ1 D;  4G4K A;  1PRT C;  1CZW A;  3D4D A;  1ENC A;  4G7Z C;  1GUN A;  2PZU A;  1D2B A;  2A73 B;  1WTP A;  1K83 B;  2K1B A;  1VF5 C;  2G9H D;  3NE5 B;  4IFD H;  4XDX A;  3LWE A;  3OSO A;  3M7G A;  4CKE A;  1GUW A;  3D8G A;  3G6J B;  2F0J A;  4FF4 A;  1O80 A;  1FNU A;  3MFG A;  3GTO B;  1PRT B;  3P75 A;  2WP8 J;  1XYI A;  2DNE A;  1SAP A;  1CQV A;  3HZX A;  2SDF A;  3NSW A;  1PTO B;  4WJW A;  4LAA A;  1I6H B;  4Y7N B;  3J80 L;  4DXG A;  1C4Q A;  4KMU C;  4CJ0 B;  2NVY B;  2F0Q A;  1TY2 A;  1CQF A;  3NK9 A;  1QCB D;  2EJF C;  5ELC A;  4G7O C;  4ZLT F;  4LMQ D;  1EYC A;  3LNN A;  3SVM A;  4CKC A;  3BDO A;  3D6W A;  3JAM E;  3A56 A;  2A6H D;  3H3V C;  2NVX B;  2R61 A;  4CJ1 B;  4OHJ A;  3NHH A;  3GP7 A;  1CA6 A;  1O7Z A;  2ZT9 C;  1RCV D;  2XN9 C;  1DOL A;  3S1Q B;  3DWA A;  3T53 B;  5C0X H;  4F87 A;  1F9P A;  4FNF A;  4IZ8 A;  1G2S A;  1DYQ A;  1PZK D;  2Z4H A;  1CHP D;  3IKJ A;  3KLS A;  1EL0 A;  3GTP B;  4Q0F A;  2F0K A;  3NBH A;  3I3C A;  2KHS A;  5CV4 A;  1IW7 D;  3F2U A;  1LT6 D;  3VR5 A;  1F2Y A;  4C3J B;  2B2V A;  4K5W A;  1JQY D;  2AUK A;  4K6D A;  1YNN C;  3SK6 A;  2WII B;  4V19 0;  3TZD A;  1EWC A;  1XTC D;  5M3F B;  4DU9 A;  4F8M A;  1R4Q B;  1LO5 D;  5JEA H;  4CKB A;  1Q1B A;  4PNY A;  1HHV A;  1X3Q A;  1FGB D;  2B2T A;  4KHZ A;  5BN4 A;  1LT3 D;  5I4D A;  1ILQ A;  1PTO F;  5IGB A;  1F9Q A;  5CV9 A;  4K8J A;  4J6H A;  4IN3 A;  5BN3 A;  4HCE A;  1EIH A;  3S1M B;  3FKI B;  3LWU A;  3I70 A;  1WD0 A;  3S17 B;  1B50 A;  1A15 A;  2TMP A;  3I8Z A;  2PZT A;  5DEH A;  4R8N A;  4WOR A;  1HQR D;  4L6T B;  2O2L D;  1O7L A;  2EYF A;  4FXD A;  1PZJ D;  3ITP A;  1A6X A;  2HCI A;  4ZRZ A;  2EPB A;  1IW7 C;  4AYB B;  2KQ3 A;  1TKW B;  3GO5 A;  1SJH D;  5I2Y A;  5K5P A;  3QWN A;  4HMI A;  2N88 A;  4ZYS A;  4KY7 A;  4C1N K;  1CTM A;  5IOD A;  5NUC A;  2B2U C;  4PV1 C;  3KK7 A;  1VCI A;  2F0G A;  3KUP A;  5J39 A;  2EYO A;  3ND8 A;  1IYU A;  2LKV A;  5E4W C;  1MSH A;  2MUY A;  3K6O A;  1S5F D;  3Q22 A;  2IL8 A;  2AQ1 B;  1GOZ A;  1GHK A;  2B2W A;  5JVG 3;  5C3E B;  2NN6 G;  4KY6 A;  4O1N A;  3KF8 A;  2EYP A;  1PTO C;  5BN5 A;  4NDX A;  5AFW A;  2KJX A;  3SEB A;  5KND A;  1EY4 A;  2BA1 A;  3TP6 A;  4K6L A;  3J7A F;  1BOS A;  1KDB A;  1BUV T;  5E1F A;  3R93 A;  2F0N A;  1RDP D;  5E3F A;  2HDM A;  2BOS A;  3RUZ A;  3VR6 A;  2F0O A;  2VXW A;  3K5M A;  4OIK A;  4CGY B;  4HTH A;  4A3K B;  5FO8 B;  1Q8I A;  4B08 A;  2QCP X;  3VR3 A;  2PPB C;  4IUU A;  2F0U A;  3H91 A;  2EDG A;  2PO4 A;  3W3A A;  4CJ2 C;  1B44 D;  5LL6 S;  4P2C B;  4TKO B;  4FYD A;  3OOC A;  3QG1 A;  5JVH 3;  4ULL A;  1EYA A;  1ZYR D;  4FP5 D;  1LV9 A;  1DXM A;  3DXJ C;  5FOB B;  2EVB A;  1KTK A;  3IFD A;  3T51 B;  2K28 A;  5KRU A;  1AZP A;  3KLR A;  4HAE A;  2WAQ B;  1Y1V B;  4K2L A;  1Y8O B;  1U9R A;  5M5Y B;  4DA2 A;  1KLU D;  2JYO A;  2IX3 A;  3C1E A;  3A54 A;  3WDN A;  1EZ8 A;  4E6I A;  1B2T A;  4OO1 G;  5I9P A;  1JOQ A;  2ID0 A;  4FXK C;  1PTO H;  5EPL A;  4U68 A;  1TU2 B;  2JEB I;  3Q24 A;  3PUW A;  3GTQ B;  2J0T D;  4MHE A;  2XRS D;  4F88 A;  3MTS A;  3AU7 A;  5CC4 A;  4B9X A;  4EVO A;  3KBX A;  3QO2 A;  3EQL C;  4QUC A;  1TS5 A;  1JE4 A;  2J7Z A;  2K03 A;  2EJG C;  4H44 C;  2GA4 B;  2NB0 A;  3NWS A;  1A2T A;  1V1O A;  1TWG B;  4KTA A;  2JXM B;  1STN A;  1AEX A;  4DK1 A;  2SNM A;  5FKA C;  4C3H G;  1H9S B;  5IT9 E;  3GV3 A;  3U9S A;  1FYC A;  1Q1E A;  1EIG A;  2F0F A;  4IUN A;  5EPJ A;  2E76 C;  3NQI A;  2QF7 A;  3NBI A;  2XVS A;  3T16 A;  2K5D A;  5IGG A;  4X3K A;  1ML0 D;  3S14 B;  3TME A;  2KUM A;  3S16 B;  1SNP A;  1D5X C;  2X6L A;  3S1N B;  1H9S A;  4NKL A;  1SNO A;  2F0H A;  4C3H B;  4MIU A;  4OIJ A;  5TSS A;  2JA7 B;  1MI2 A;  1D5Z C;  1HCZ A;  5C6A A;  1QWY A;  2YYZ A;  3PIP 3;  1V1P A;  1I6V C;  3VYR A;  2MP1 A;  1V43 A;  2ENB A;  3R2T A;  1WCM B;  2DY7 A;  2Z4I A;  4K5V A;  2RSN A;  1NAP A;  1TS4 A;  3H6M A;  3T56 B;  4UDU C;  4FXG C;  5D65 A;  3BS1 A;  4IQZ A;  5FLX L;  2AQ3 B;  2R93 B;  2EYM A;  4EGV A;  1M8A A;  1OXX K;  3MEH A;  4A3D B;  1XX8 A;  3SDZ A;  4J8Q A;  2PMZ B;  2Q8T A;  1SEB D;  4XYQ A;  2FMM A;  1TS3 A;  2BDN A;  3QOL A;  2A6E D;  4BA1 I;  2D5D A;  5ELB A;  4CBV A;  1WTV A;  3FDT A;  1CI3 M;  1HFN A;  2QDB A;  3DWP A;  4A3F B;  2F03 A;  3I72 A;  2E2J B;  4LJZ C;  1KLG D;  2XWB B;  2WAC A;  2CW0 D;  2QIL A;  4OO1 I;  3R3O A;  5FO9 B;  1DJR D;  4RA8 A;  3HRZ C;  3TSS A;  1EY6 A;  1JWS D;  1LTI D;  3RMH A;  5JJZ A;  1B4O A;  1QG7 A;  4PMW A;  5C0X G;  5EKK A;  4RCN A;  2FJ2 A;  2ZXR A;  2XRQ D;  2C5C A;  2XIW A;  1I3Q B;  4V0B A;  2VUM B;  4RGN A;  1E2Z A;  1HUM A;  3DHQ A;  5IGD A;  3O13 A;  5F2D A;  3QJY A;  1SYB A;  3TBI B;  2FHT A;  2M2L A;  3D31 A;  1NUC A;  3E6Z X;  1H9K A;  5C3X A;  2F0I A;  5E4X A;  4KJN A;  1LTS D;  4I65 A;  3M3Y B;  3P20 A;  3EFX D;  4QB4 A;  3A8K E;  5M5W B;  4HED A;  4FO2 A;  1IKM A;  1FD7 D;  4KI0 A;  5IT9 L;  5A35 A;  5ISR A;  1DM0 B;  1SND A;  3P1H A;  2X69 A;  2AWN A;  4A3I B;  1VDZ A;  1ET9 A;  1JIC A;  4R8I A;  1CT1 D;  1RHP A;  3U9O A;  4BY1 B;  1EY5 A;  4LK1 C;  3EJI A;  4O42 A;  3X3M A;  1LTB D;  3VYU A;  1JOO A;  2EYJ A;  1TWH B;  4DK0 A;  1S5D D;  2MJ8 A;  2JEA I;  1EWH A;  4KD3 A;  2JP1 A;  4NP5 A;  2NTS A;  1PRT F;  2F0V A;  3PUY A;  3K57 A;  1I4G A;  5A2Q L;  4C56 C;  2XWJ B;  3DEP A;  2PYK A;  2JA5 B;  2FFK B;  3S2H B;  2AWO A;  2FIN B;  1A3T A;  4CHT B;  4C2M B;  3PO2 B;  4C1N I;  1C48 A;  1EOT A;  2CHB D;  1SYE A;  3I91 A;  1EU4 A;  1HQM C;  3ZYY X;  3V05 A;  1ET6 A;  3GQB A;  4IFD G;  3SK4 A;  4BBR B;  1OXS C;  1L0X B;  1STH A;  1NR4 A;  1TT2 A;  4L63 B;  2LMC B;  3MHB A;  3L9A X;  4RHR A;  5EKI A;  3SHL A;  3SK5 A;  3MZ5 A;  4YIJ A;  4B9W A;  1EQV A;  1JOR A;  3NP8 A;  3OPO A;  4HSV A;  5JOB A;  2F0E A;  1EEF D;  2K05 A;  3SXH A;  1J9O A;  3MXU A;  5C4X B;  1LT4 D;  1U4R A;  3DWQ A;  3MC0 B;  4Z9C B;  5D3I B;  1F77 A;  2WIN B;  1UNS A;  2EY1 A;  3BDC A;  3MXP A;  5C5M A;  5K36 G;  2ICI A;  2EYL A;  3UI2 A;  1BCP B;  4XQQ A;  3URY A;  1W6K A;  1XXG A;  3K7A B;  4NW2 A;  1I4P A;  1V1P B;  3VYT A;  2AQ2 B;  2BDO A;  4HCS A;  3H94 A;  3GTG B;  1PDQ A;  2R3Z A;  2VB3 X;  1STB A;  5G3L F;  5C0X J;  2F0S A;  3HOX B;  1SBB B;  1Y1W B;  3TP7 A;  3FVQ A;  4IAL A;  1X32 A;  1G8Z D;  3NQT A;  1WTX A;  1R9T B;  3KBG A;  3I4M B;  5JEA J;  1EY9 A;  4QIW B;  1Y8P B;  1HA5 A;  3TP5 A;  3NTK A;  1D1K A;  2CQA A;  2RQX A;  1CZG A;  4S3S A;  1IHZ A;  1STA A;  1KDA A;  4H7B A;  1D1I A;  4N9P A;  3HOZ B;  5C0X I;  1C8C A;  1E0B A;  1AFP A;  4XT3 B;  4PMC A;  5ELE A;  2MHV A;  2NBF A;  3E0J A;  1SYF A;  1SYC A;  1F2Z A;  2ZXO A;  1S5C D;  2PW5 A;  2Z1C A;  2Q8I B;  3TP8 A;  1ROD A;  5I9O A;  3OIP A;  1I4X A;  3BVM A;  5C4H A;  1MBY A;  5KYL A;  1PLF A;  2IX0 A;  4RGM A;  2LS0 1;  1L0Y B;  3WOF A;  1MD2 D;  1ZEQ X;  3OWE B;  3DEO A;  2EE1 A;  3NWT A;  2HQE A;  5CV7 A;  2IWH A;  5EGT A;  2A6H C;  4ZK9 B;  3EA6 A;  1RTN A;  5C44 B;  2BCO A;  4FF3 A;  4KD4 A;  4N9T A;  1WTW A;  4NMZ A;  4RHS A;  2EY2 A;  4IUT A;  2F3W A;  2K04 A;  3OMG A;  1KNA A;  5CV8 A;  1Y69 U;  2DNC A;  3S1R B;  3AMU A;  3SR1 A;  3FPU B;  4DN4 M;  1KAA A;  1Q12 A;  3QIA A;  4ZKC B;  5IIF A;  1H9R A;  4XXE A;  1LTG D;  4PMB A;  2B39 A;  4I7Z C;  5EJW A;  1KDC A;  1PZI D;  2DN8 A;  4XTC S;  4XIG S;  3N52 A;  1WVL A;  1I50 B;  1OXT A;  1VF7 A;  2F3V A;  3PUX A;  1ONL A;  2M00 A;  1B53 A;  3W2D A;  4ABN A;  5CYU A;  1PYW D;  4ODG A;  1HTP A;  1O7Y A;  1NSN S;  4XT1 B;  2NVT B;  1BXT A;  1IYV A;  2HUG A;  1H9M A;  1SE3 A;  1Q90 A;  2KCN A;  3P7J A;  2EY6 A;  2NWG A;  3TDQ A;  3R8B A;  1WD1 A;  3EVQ A;  1UUP A;  1SNC A;  4HMJ A;  3OHX C;  1CHQ D;  2EYH A;  3PUV A;  1RTO A;  4PQX A;  1HUN A;  1Y8N B;  4DAP A;  4ZUI A;  1DOK A;  1EQT A;  2HDL A;  1BQQ T;  4RH6 A;  5T1G A;  5M9O A;  3K59 A;  1W6J A;  3V2T A;  3S2D B;  2G9D A;  3NUC A;  2JE6 I;  4EQN A;  3BDL A;  1B9M A;  2L9H A;  1A3U A;  2FMC A;  2A6E C;  2IX1 A;  1GUO A;  1DZ1 A;  2BA0 A;  4TSS A;  1AZQ A;  2JSO A;  1JB3 A;  2N55 A;  1UEA B;  2YU9 B;  3ERQ A;  5KGU A;  2Y0S B;  3WOE A;  4KN7 C;  1MSG A;  1JR0 D;  4HN7 A;  1LT5 D;  2RDG A;  5FLX E;  1X3P A;  4M8A A;  1PMR A;  1U4M A;  2RKS A;  2F0L A;  2F4I A;  3T4A C;  2IPK D;  2RA4 A;  5HGT A;  5COR A;  5COY A;  4EQO A;  3E5S A;  5JPM C;  5KNB A;  3DM1 A;  1QNK A;  4KKU A;  5J1Z A;  1AW7 A;  2H4O A;  2AUJ D;  4DNR B;  3K5O A;  1F9S A;  1BCP D;  3FMC A;  5FK9 C;  2I46 A;  2TSS A;  1STY A;  3BYT B;  3TZU A;  1QJO A;  1TVX A;  2RBM A;  3X3N A;  3M7N A;  3VR2 A;  3HGB A;  4TRD A;  4RGO S;  1CK1 A;  1RD9 D;  5IGE A;  2E2I B;  1RJT A;  1PFN A;  1LTA D;  3I4L A;  3A8J E;  2JA6 B;  3MFY A;  1F2M A;  2B2W C;  4IUR A;  1AN8 A;  3FRP B;  3Q0A A;  1WTQ A;  2J4X A;  1KNE A;  2K6A A;  2ICE C;  2KED A;  4ZQ3 A;  1VMC A;  1JC7 A;  1HPC A;  2IT1 A;  4K14 A;  1STE A;  1LLR D;  3A7L A;  4IFD J;  2RDH A;  2PW7 A;  2X6G A;  1JCK B;  3K5N A;  1EEI D;  2RSO A;  4IUV A;  2WB1 B;  3V96 A;  3RZO B;  2NN6 H;  1UAP A;  2R92 B;  4A3M B;  5DM7 3;  2NUC A;  1GUG A;  1G29 1;  1VMP A;  5ELF A;  5C5L A;  3J7Y W;  2QKI C;  3PMF A;  1U4P A;  4ME5 A;  5EBC A;  1LTT D;  1ESR A;  1ZXT A;  3CHB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...