1D06A

Structural basis of dimerization and sensory mechanisms of oxygen-sensing domain of rhizobium meliloti fixl determined at 1.4a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
GSHMLETEDVVRARDAHLRSILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nitrogen fixation regulatory protein fixL
publication title Sensory mechanism of oxygen sensor FixL from Rhizobium meliloti: crystallographic, mutagenesis and resonance Raman spectroscopic studies
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
total genus 38
structure length 130
sequence length 130
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d06A00
1D06A 4L9EA 4YWZA 1EW0A 3BWLA 2V0WA 2J80A 3NHQA 1N9OA 5HDSA 2H28A 3PYPA 3F1OB 2BASA 4I38A 4NXBA 1WA9A 2D01A 3LYXA 4DJ3A 4HH3A 4H6JA 1UWNX 3FC7A 4LRYC 1KOUA 4XT2A 4EEUA 2ZOIA 5G4YA 1N9NA 3D72A 4F3LB 1NWZA 1UWPX 1XJ6A 3KX0X 4GHIB 2KDKA 1TS7A 2A24B 4GW9A 5F69A 3A0VA 4KQDA 4MN5A 4R3AA 1LSVA 3HJIA 3E4QA 5TBMB 1UGUA 4NXFA 4EQ1A 2YKHA 1XJ4A 3P7NA 3F1OA 2V9AA 4L9FA 3ULFA 3LI9A 3G6OA 1P0ZA 2WKPA 3EEHA 1T18A 4PKYG 3H82B 4BBTA 1BYWA 2JN7A 3MQQA 4HIAA 4WLAA 1LSWA 2HV1A 3CAXA 2JHEA 5HWWA 3C8CA 3HJKA 4WL9A 2GJ3A 3NOPC 5J4EA 4KUOA 3IS2A 2PD7A 4JGOA 2QWSA 4EXOA 3F1PB 2QJ5A 3RTYA 3RH8B 4R70A 4RQ9A 3H7WA 2ZOHA 5F5YA 5I5LA 2QKPA 5F68A 2V0UA 3UB7A 1JNUA 1T19A 3UB6A 1TS0A 2K7SA 1OT9A 1S1ZA 3H82A 3VOLA 5DKLA 4WF0A 1D7EA 4HP4A 3OLOA 4HJ6A 4LPZA 5EFWA 4GCZA 2L4RA 5KIZA 1DRMA 4I3AA 4EW7A 3ICYA 5DJUA 2QJ7A 4MN6A 3LICA 4EERA 4WUJA 2WKQA 4EEPA 3F1PA 2CMNA 1S4SA 1XFQA 1G28A 1VB6A 2WKRA 2VV6A 3C2WA 5HDDA 1LL8A 4HH2A 4E04A 1Y28A 2M1CA 1V9YA 1OTIA 4I39A 2OWJA 3CLOA 3GDIA 1OJ5A 3F1NB 4HJ3A 1TS6A 1OJGA 3LIBA 3E4PA 4K08A 4JGPA 2INWA 5DJTA 4EETB 1F98A 4HOIA 4B9OA 2W0NA 1F9IA 1V9ZA 1XJ2A 1MZUA 4HI4A 3LIFA 3MXQA 5HWTA 3UB9A 2L1MA 5HD5A 2VLGA 4F3LA 1OTDA 4M4XA 1X0OA 2VEAA 1T1AA 5HSQA 3EWKA 5IU1A 4HNBA 4GHIA 2B02A 3VE3A 4H6JB 2A24A 5DKKA 4KUKA 4XT2B 1GSWA 5TBMA 4L9GA 5HD3A 3F1NA 4GS9B 3MQOA 4EESA 2PYRA 5J3WA 4NXGA 1DP6A 5AVEA 2R78A 1GSXA 1S4RA 1OTEA 3NJAA 1S1YA 4HY8A 3UMEA 3BY8A 3LI8A 4PKYA 3UMDA 5HZHA 2Z6CA 5HWVA 2PYPA 3B33A 2W27A 1S66L 4I3JA 3GECA 3VE4A 3T50A 4I5SA 4GS9A 4I3IA 3IBRA 1GSVA 1XJ3A 2YKFA 3BY9A 1LT0A 2V1AA 5F6AA 1N9LA 2PHYA 2Z6DA 4BBUA 5A8BA 2PDRA 3K3DA 4DJ2A 4WN5A 3NOTC 2OOLA 2PR6A 1ODVA 2OWHA 3IS2B 4HJ4A 1DP9A 3FG8A 3LIAA 2EA9A 3K3CA 3LIEA 5J7EA 2PD8A 3MR0A 5AVFA 3H7WB 1TS8A 5HDCA 1OT6A 3LUQA 4LRZE 3A0RA 3ZQ5A 4LLOB 4JGRA 3PHYA 4HQAA 1T1CA 2I9VA 5IS1A 3MJQA 2KX6A 4BBVA 5G4ZA 1T1BA 4NXEA 4JGQA 4HP9A 2ZBBA 1S67L 2L0WA 4R6LA 3UB8A 2VV8A 3UE6A 1XFNA 3H9WA 2V1BA 3SW1A 3LIDA 2P7JA 3NOUC 4LRXC 3E4OA 3A0SA 1LSXA 2QHKA 3CWFA 1OTAA 1DP8A 3MFXA 1P97A 2PR5A 4HHDA 1OTBA 2D02A 2VV7A 4R38A
chains in the Genus database with same CATH superfamily
2C5WB 1YLTA 2HJ9C 4YWZA 3Q81A 2V0WA 1M40A 3NC8A 3PYPA 5GLBA 3F1OB 3DW0A 1K54A 5FAQA 2JKFA 1WA9A 3NDEA 4WBGA 2PU2A 1K55A 3LYXA 4DJ3A 4JLFA 2FFYA 1W79A 4YNRA 5EE8A 1FSWA 2ZQCA 3CZDA 2QMIA 3QHYA 1YMSA 2ZOIA 3TG9A 3OC2A 4X6TA 5CGXA 5G4YA 4GJ4A 2JKGA 4WEJA 5CHJA 1IKIA 4Q0IA 1W8QA 2J3WA 1G6AA 3GV9A 4Y3IA 1XJ6A 4EUZA 2KDKA 2J7VA 2ZJ9A 5F69A 3A0VA 4KQDA 4MN5A 1LLBA 4R3AA 1FOFA 4UA6A 3VSLA 3NDGA 3LR4A 4C6YA 4NXFA 3E98A 3GVBA 2XH9A 1H0MA 3P7NA 2WZXA 5FQIA 3T1QB 4FCFA 2JKTM 3ZG5A 2LB9A 2V8CA 4UA9A 4X53A 1HVBA 2VKSA 1P0ZA 3PBRA 1MXOA 1T18A 4PKYG 5CX7A 1LHYA 1NLZA 1BYWA 1EROA 5GLCA 3O88A 3HLFA 4HIAA 1LSWA 2HV1A 3CAXA 3S7NA 4OH0A 4EU0A 3RJUA 3BEBA 2JHEA 3C8CA 1TF1A 4IBRA 2B5RA 1BULA 5CHMA 3S1YA 4KUOA 4KZAA 2PD7A 1KDWA 2QWSA 3Q82A 4Y7PA 2G2UA 4R70A 4CLCE 4RQ9A 2WADA 2Z2MB 4LCMA 5L8MA 4EV4A 5I5LA 3IF5A 1QMFA 3UE0A 4PHTA 3E2KA 1JNUA 1KGFA 4R0QA 1EWZA 1XGJA 3Q7VB 1CEFA 3H82A 3NY4A 4OQGA 4N1HA 1PZPA 4YFMA 1VEUB 3NIAA 3VP2A 1FCMA 4GCZA 3DWKA 3PBQA 4I3AA 3ICYA 4DMZA 3LR3A 1L0GA 5FAOA 4FH4A 4WUJA 4HEFA 5CTNA 5FQQA 2DMWA 2QYBA 3UPOA 2WUQA 4DE3A 1FILA 3UE3A 3ZCZA 5EVLA 2Q0OA 3ZG0A 1MWUA 4OP5A 3GTCA 2XD5A 1NLYA 1G28A 5IT5A 4EBNA 2W3EA 2BTFP 5HDDA 4MDZA 5GLDA 5AJGA 2E8JA 2M1CA 4UQIM 5JYOA 1YLYA 3GDIA 2CC1A 2HDQA 3VP1A 2V8FA 4XUZA 3SZTA 4LV3A 3HUMA 5M18A 4B9OA 4MMNA 3CITA 3IX3A 4RYEA 2W0NA 4BQMA 3MZFA 4BMWA 3DWZA 3VFFA 4JXGA 1CK3A 2ZQAA 5FDHA 3UB9A 2BLSA 4WMCD 2PT7A 2WAFA 1H5XA 3GRJA 4F3LA 3BRMA 2OV5A 2GDNA 2NUTC 5A92A 2W3HA 5HSQA 1OPXA 1YSPA 3EWKA 3QP2A 2Y2GA 4GD6A 4E3KA 4GHIA 2HZ5A 2H0TA 1CF0A 3LGOA 3IXGA 5FQMA 1BZAA 3PTEA 1ZG6A 4YOFA 1BUEA 3TSGA 5HD3A 5FI7A 1MC0A 2VA0A 3K2NA 2IWDA 2K31A 3MQOA 3KSIA 3D9YA 2GNXA 4KZ9A 1PNEA 4NXGA 2Y2PA 3W4QA 1S4RA 1G68A 5L09A 2JE5A 1OTEA 1DJAA 5I94A 1IFQA 3NJAA 4P87A 3T4OA 4HY8A 1YLZA 2UWXA 3PAEA 4D2OA 3M2KA 1MKMA 4PKYA 3MKFA 1JWPA 1XP4A 5HWVA 2PYPA 1SKFA 4R4SA 1H8MA 2WKIA 1D1JA 2IWBA 3MBZA 4S2JA 4S2KA 5AQAA 4ME4A 4KQRA 3ZG9B 4ZTKA 2HP9A 3VE4A 1W5DA 3WRZA 3T50A 2OAQ1 2ZD8A 5F1GA 2HPBA 4GS9A 3IBRA 2WYXA 1GSVA 1XJ3A 1ES4A 4S2NA 4X69A 5F6AA 4JXVA 1N9LA 2PHYA 1KDSA 5EM0A 1K25A 3NOTC 1HD8A 3UDFA 1ODVA 2QZ6A 1TD5A 3FG8A 1Q2PA 3LIEA 2O9BA 3V50A 5J7EA 2ZQDA 3MR0A 3AGFA 4GDBA 4N9LA 2GX5A 1SDEA 5HDCA 3HLWA 3MS6A 2JBFA 4E3JA 4LRZE 3A0RA 3OCLA 2ZMFA 3SS4A 1KE0A 5HL6A 3PHYA 5JYPA 1K56D 2I9VA 3MJQA 5D3OA 3IF6C 4R3BA 5G4ZA 4OLDA 4JGQA 3ZYTA 3GQZA 3KYEA 2L0WA 2VV8A 2XRNA 4NKPA 2W3GA 4WZ5C 4E3MA 4ZDXA 4K0XA 4LRXC 3RXXA 3WS5A 4R3JA 2QHKA 1K55C 4OLGA 1E4DA 1OTAA 1P97A 1WE4A 4N92A 5GHXA 5A91A 1Y54A 2OSUA 3IWIA 3VOZA 2HP6A 4N1XA 4ZBEA 1S6RA 1YSQA 3UPPA 1KE3A 4MCWA 4XUXA 4KQOA 3Q1FA 1I2WA 3B42A 2H28A 1MWSA 2BASA 4I38A 4NXBA 1JWZA 4JBFA 4H6JA 1UWNX 1PI4A 4DE0A 4JXWA 1MWRA 1H3QA 5GLAA 3EQUA 1J9MA 1JWVA 1N9NA 3TW8A 4C3QA 3GMWA 1KVLA 3LY4A 1VETA 4F3LB 1CJFA 3NI9A 4OOMA 1NZOA 4GHIB 3M2JA 4DN0A 4GW9A 4OONA 3R7WA 5FEFA 2XSSA 1W7FA 1LSVA 1FR1A 1ONGA 1K6SA 4DRTA 4DXCA 2XQZA 4L9FA 5DF8A 3IXHA 4WMCA 3LY3A 2WKPA 1YLJA 3T4LA 3SOIA 3FPVA 2A2LA 4X68A 2E8IA 5TFQA 3MQQA 4OPYA 4DDSA 3LR5A 1HZOA 3DTEA 4B93A 1NJ4A 5HWWA 1PZOA 1BTLA 2WGWA 3OPRA 3G31A 3UY6A 2ZC7A 3NOPC 1HTZA 3IS2A 1YAXA 2HJEA 4JGOA 4EXOA 3IF6A 1WYBA 2J8YA 3FWLA 4Z9QA 4LV1A 3G2YA 2ZM0A 3G34A 3NULA 4PAUA 5FQJA 2HP5A 5F68A 4GD8A 3MXSA 3IH9A 4GLQA 2O99A 3HLCA 1OMEA 2WKEA 3JVVA 3O87A 3A3EA 4WZ5A 1HLUP 2J3TD 2K7SA 2A49A 2JKTI 1YMXA 5DKLA 2B95A 1KGGA 4EBLA 1XPBA 3EEAA 5EFWA 2L4RA 1DRMA 3IWOA 4EW7A 1MWTA 1PI5A 4MN6A 3MMHA 4OQHA 5GHYA 3HLDA 2ZLYA 3HUOA 3E2LA 4EEPA 3F1PA 5CGWA 2ZQ9A 2WKHA 2I72A 3C38A 1FR6A 5FQKA 4O01A 1BSGA 2X02A 4E04A 2ZC5B 1YM1A 4FTXA 2OAP1 1OTIA 4I39A 2OWJA 1K57C 4II7A 1OJ5A 4Q0HA 1TS6A 3LIBA 2Z2LB 3BFCA 2G7UA 1ERQA 4JGPA 2XLNA 1L2SA 1G6OA 2JKRM 4DF6A 3GR2A 4XXRA 2Y2KA 3OPHA 5DF9A 4HOIA 1ZTUA 1LL5A 3MSHA 1E25A 3BFDA 1XJ2A 2Y8HA 4Q8IA 4HI4A 1E3UA 4R23A 5GL9A 5HX9A 3PAGA 4OP8A 3MZEA 1A0KA 3UB5P 3ZG8B 2L1MA 4PMAA 5HD5A 1OTDA 4M4XA 1X0OA 2WZZA 4AFIA 1T1AA 3SH9A 3C30A 4FH2A 5DTKA 2O9AA 3BQ8A 2HGVA 1PRQA 2J9PA 3ITAA 5MC7A 4HNBA 4JF4A 3VE3A 4H6JB 4JKTA 1W8YA 2A24A 5C5KA 1XXMA 4DDYA 4IUHA 1IOUA 3C5AA 3S7QA 4L9GA 3F1NA 1F5MA 2M7VA 1IEMA 3G32A 3SH8A 1L0DA 1VETB 2EWVA 4D60A 1KGEA 3UN7A 3QNBA 2DCFA 1W63Q 4NG2A 2ZMVA 3L9KA 3NCKA 4KZBA 3T1RA 4S2NC 4O0PA 3R7WB 4CPKA 5IHVA 3KSFA 4PPRA 3LI8A 3IHBA 5DTTA 1DJCA 5HZHA 3IX4A 3WS1A 3OZHA 1IYOA 4LGWA 1Z09A 1NYMA 3CG5A 5DTSA 1ESIA 3ZNYA 4OOLA 3GECA 1YLPA 1JTGA 1VM1A 1ALQA 3C4PA 2VGKA 4CJNA 4UEYA 5FI6A 3KSHA 1EI5A 3BY9A 5HARA 3VOYA 4BBUA 2PDRA 2WGWB 3ZG7B 2VK3A 1N9BA 5FASA 3HCYA 2DNSA 3IS2B 4HJ4A 1PYYA 2Y79A 2NUPC 3K3CA 3QP8A 1FCNA 3IF6B 5L07A 3W8KA 1ES5A 2Y2NA 4G3KA 1I5QA 5AVFA 2C6WB 2KLIA 3JPUA 3ZDJA 3BJNA 3FYZA 4WYYA 3ZQ5A 5F1FA 4JGRA 4P85A 3IHAA 3B47A 5EV0A 3FPWA 4FOFA 4BBVA 1K57A 4NXEA 1ZKJA 2P08A 4R6LA 4S2IA 3UB8A 3ZVWA 4CLCD 1TDGA 5M19A 3CUEC 2W1RA 1F2KA 3T4SA 4ID4A 2V1BA 3LIDA 3T12B 3DTIA 3EGXC 2A3UA 2IA2A 2P7JA 2PBDP 3NOUC 3JVUA 3N8RA 4IVIA 4P6BA 5FATA 4PM8A 2V20A 3KYZA 4FD8A 2VGLM 1DP8A 4QWOA 4E6WA 5FAPA 3P98A 1OTBA 2D02A 4UQIS 2ZC6B 5K5BA 3N8LA 2R9XA 4KZ4A 4MN7A 5L10A 1D06A 5FQ9A 3BWLA 5HPFA 3TJZC 1FCOA 2J80A 3NHQA 1N9OA 1XA7A 2P9VA 4X25A 3CHWP 3HREA 4WELA 4BL2A 3DTKA 4EQIA 1K38A 4HH3A 3T4QA 4FSFA 4O8GA 4RX3A 4LRYC 5AQ7A 5HAQA 1K6RA 3R4KA 4IBXA 4S2MA 3A3FA 2W1TA 3HLGA 3V39A 5EUAA 3D72A 1MY8A 3V3SA 5G18A 2FZ0A 1PW8A 1AWIA 5TR7A 3M6HA 3MXRA 1Q2QA 4EWFA 3OPLA 3KX0X 4CLCC 2A24B 4X55A 3HJIA 3E4QA 3RFBA 3BQAA 1XJ4A 2ZM8A 3F1OA 3IX8A 2XA7M 3ULFA 4GN2A 3G6OA 2EFXA 3KO6A 3BECA 3CJMA 1PWGA 2Y59A 4PM7A 2PU4A 3EEHA 3H82B 3WRTA 2VJWA 3BLMA 5EECA 4WEKA 4DE1A 3IXDA 1LL9A 2HDRA 2P74A 1XA1A 2Y4AA 4Y2FA 1GA0A 1O07A 4Y0TA 3JYIA 3HUNA 3QP5A 5J4EA 5BOHA 2Y2IA 5KSHA 2XDMA 4EUVA 1SZVA 2QJ5A 4GB7A 4NETA 4HESA 2ZOHA 3D3OA 4OPQA 1DJBA 4QY6A 4GDNA 5CEBA 1RCJA 3BFEA 2QKPA 2EX8A 2V0UA 4KZ8A 3CUEA 5DFYA 1IYQA 1T19A 3UB6A 1TS0A 3S7PA 3B3XA 1SKOA 5E2HA 3VV4A 4MBHA 3WWXA 4PM6A 1JTDA 1GA9A 3OLOA 1W63M 4HJ6A 4QU3A 4X56A 4LPZA 3CMZA 4BL3A 2XEPA 4QJGA 5EVID 5KIZA 4LENA 3N6IA 3LO7A 2QJ7A 4KQQA 4Y15A 5DJUA 1Y4OA 4EERA 1NRJA 4KZ7A 2J9OA 1NZUA 2CMNA 4K91A 3MF0A 3ZHHA 4G3VA 2WKRA 3C2WA 1ZG4A 4RA7A 4HH2A 4BLMA 1Y28A 5CXWA 1BLSA 5CTMA 1ES2A 1V9YA 4DKIA 5EOOA 1TDLA 4Q0JA 3VFHA 4DXBA 3UDXA 4K08A 3DTMA 3ZNTA 3GSGA 4KG6A 4FUWA 5DJTA 2ACGA 5HAIA 4EETB 2VZWA 1L0EA 2OLUA 1LI9A 1V9ZA 3BFGA 1MZUA 2X01A 4BWIA 3BFFA 4CLCA 2JC7A 3W4PA 1MKIA 3AGEA 3MXQA 2R9WA 2Y91A 1H8YA 2VLGA 1TVFA 2P9VB 1PIOA 2VEAA 3A3IA 2MJ6A 5FL3A 1XGIA 1I2SA 3V5MA 4WM9A 4X1MA 1O7EA 5IU1A 5E43A 2B02A 3DBAA 5EVIC 5DKKA 1GSWA 4N9KA 5TBMA 1FQGA 2W1TB 4MEZA 4Y13A 4LV0A 3T4KA 4GS9B 2WK0A 4U0XA 3OCNA 4GNUA 5DFXA 2WGVA 5AVEA 1ZC2A 4E6XA 3LR0A 4YINA 2R78A 4Y0UA 5CECA 2XGNA 2HF6A 2JKRI 4NK3A 4X1LA 4BENA 4KG5A 3C4OA 4LCLA 3ITBA 3RXWA 3EOIA 2XD1A 1SDNA 5EM1A 2XROA 1RP5A 4Z1WA 3FV7A 4E3LA 2Z6CA 2W3FA 4KENB 3B33A 1YPRA 3NBLA 3MQ0A 4QHCA 4ZJ2A 2W27A 1LI0A 3IBJA 4IUKA 3Q07A 3ISGA 3MKEA 1YT4A 4HBTA 3SS3A 5DVAA 4BJPA 4I3IA 5CHUA 3AGDA 1LT0A 4KZ3A 2O0YA 2V1AA 4ZRRA 2Z6DA 1VQQA 5A8BA 3K3DA 4DJ2A 2PR6A 2OWHA 5A90A 1XX2A 1K56A 3TOIA 4DE2A 4S2OA 1DP9A 2FH5A 2EA9A 4BD1A 3ZVTA 4UAAA 5U47A 4CQHA 1GCEA 2ZMAA 5HFOA 2RCXA 2O9CA 4ZJ1A 3S4XA 4KZ5A 3VP3A 2J3TC 3PBTA 5DF7A 5IS1A 2KX6A 2ZL1A 4PM5A 3A3DA 3S22A 1NRFA 1CI8A 1PFLA 3C7UA 1SKOB 1MPLA 1T1BA 2ZQ8A 3BLSA 4Y0OA 4ARZA 1XFNA 1S0WA 3LFVA 3SW1A 1FIKA 4QB8A 4ETXA 4PM9A 1STZA 3E4OA 4E3NA 3A0SA 3CWFA 1AXBA 3QNCA 1ESUA 5KMWA 4HBUA 5F82A 4HHDA 2GZAA 3V3RA 3FZCA 2Y55A 2EXBA 3IH8A 4R38A 4P6ZM 3LEQA 4G3WA 4L9EA 1EW0A 5EVIA 5M1AA 1TEMA 5HDSA 2IWCA 2LB5A 4LV2A 3PR6A 4RX2A 3W4OA 1WYCA 2D01A 5TGFA 4F94A 3IWQA 3FC7A 4R4RA 1ERMA 1Z6FA 1KOUA 2UV0E 4XT2A 4EEUA 1PW1A 2KOIA 2H10A 4CLCB 1BLHA 3P01A 3LEZA 4U3TA 2ZC4B 3CPTA 2EX2A 1IELA 2EFUA 1J3WA 4IHQA 2B18A 1NWZA 1UWPX 2V2FF 5FI2A 4GKUA 2XR0A 1KVMA 3FKWA 4LFUA 1YQSA 1SHVA 2VX8A 1TS7A 4OPRA 4JPMA 3N4IA 3T1SA 2WGIA 3VSKA 5TBMB 1UGUA 5HAPA 4EQ1A 2YKHA 5FEGA 1NYYA 3PBSA 2WAEA 3T1XA 2V9AA 3LI9A 1IYSA 1DY6A 4P6ZS 4H8RA 4MNRA 1NXYA 4ZJ3A 5AQBA 2BG1A 4BBTA 2JN7A 3QP4A 5E2GA 3D4FA 4WLAA 1PWCA 1BLPA 3OBFA 3HJKA 3FKVA 4IJGA 4OQIA 1K4EA 4KG2A 4WL9A 3QP6A 2Y2QA 2Q9NA 3V67A 1P9RA 2GJ3A 4E3OA 1U60A 1RGYA 1MBLA 3VMAA 2Q9MA 1C3BA 3G35A 3E0YA 3EQVA 4ZAMA 3HBRA 3F1PB 1GHMA 2XF3A 3RTYA 5HL1A 3RH8B 2W3DA 2Y2MA 1L3LA 1GHPA 3H7WA 3M6BA 4UHUA 5F5YA 1YKDA 4JXSA 3UB7A 3ZGAB 4L0LA 3U2AA 2Y2OA 5E2EA 1OT9A 1S1ZA 1IKGA 2PBYA 1XKZA 3VOLA 4B88A 4K0WA 4WF0A 2HDUA 1D7EA 5KSCA 4HP4A 3L7HA 5TJJA 5A93A 3OOVA 2XFSA 1P9WA 2K2NA 3LICA 2G2WA 4B4ZA 1H8ZA 2ZL1B 5FSRA 2WKQA 4P0MA 3WS0A 1YLWA 4ETZA 5GHZA 1S4SA 1XFQA 1VB6A 3UNWA 3OPPA 3N7WA 3MFDA 1K4FA 4ARZB 4EBPA 3LCEA 2VV6A 2EWWA 1LL8A 3C7VA 3SS5A 2H0YA 1BLCA 2H5SA 2VGLS 3CLOA 3O5YA 3CI6A 3F1NB 4HJ3A 1OJGA 4U0TA 3E4PA 1VHMA 2EX9A 4GOGA 2INWA 1SCWA 5F83A 1F98A 1N4OA 3KSGA 1FSYA 3N8SA 1F9IA 2VGJA 3HL9A 4Y17A 3DAVA 3T4TA 2EXAA 1PWDA 3O86A 3LIFA 4GZBA 5EVIB 1ACFA 3PBOA 2FFFB 5HWTA 1GHIA 3TE8A 1IYPA 5FA7A 3I7JA 3EGDC 4RVAA 5CGSA 2AVXA 3KYQA 1E3UD 3U4LP 4OVDA 3G4PA 2Y2HA 4KUKA 4XT2B 3WS2A 1CI9A 3A3JA 4BD0A 4WZ4A 1K54C 5EVEA 4OQ0A 3HVFA 4S2PA 3CPTB 5CEDA 1KE4A 4EESA 2PRFA 5J8XA 1RGZA 1CEGA 4ESPA 2PYRA 4QY5A 5J3WA 1DP6A 4OPZA 3UO9A 3WS4A 1GSXA 3MZDA 2XA7S 1S1YA 3UMEA 2ZC3B 4O7DA 1QMEA 4JF6A 2OLVA 3BY8A 2ZQ7A 3PXPA 3W2ZA 3HLEA 3UMDA 1CQAA 5LBRA 3G30A 4M3KA 3IXBA 1ONHA 2X71A 5HPIA 4MLLA 3HLBA 4JF5A 4KZ6A 4UA7A 1S66L 4OOYA 4I3JA 3UPNA 2HDSA 3P09A 1JVJA 5EPHA 4I5SA 1BT5A 3VP0A 4E3IA 5L2FA 2YKFA 4C75A 3TRCA 5HW3A 2ZM2A 3UDIA 3IT9A 4NEED 2V1ZA 3IQAA 4R1GA 3Q7VA 4WN5A 2OOLA 4MBKA 3QP1A 3SH7A 3PBNA 2XK1A 3LIAA 1VEUA 5CERA 2PD8A 2DRWA 1ZHHB 2M7UA 3H7WB 1TS8A 1NY0A 1OT6A 5EOEA 3LUQA 3T4JA 1G5UA 4LLOB 4HQAA 1T1CA 3BYDA 4Y5FA 2Y2JA 3S7OA 2PAVP 4HP9A 2ZBBA 1S67L 4B4XA 5AQ9A 3O3VA 5KZHA 3VP4A 3UE6A 1L0FA 3H9WA 2QPNA 5E2FA 3BW6A 3Q7ZA 2JCHA 1M6KA 4QPRA 2RL3A 1ES3A 5FDSA 4IEDA 3UE1A 1LSXA 3G2ZA 2P04A 4S2LA 2XFTA 3MFXA 3ZFZA 3BM6A 4A5RA 4MBFA 2PR5A 1K0KA 5CRFA 3NECA 2EX6A 2Y2LA 2VV7A 4IVKA 4QD4A 4OKPA
chains in the Genus database with same CATH topology
2HJ9C 4MN7A 4G3WA 1D06A 4L9EA 4YWZA 1EW0A 3BWLA 5HPFA 2V0WA 3TJZC 1YSQA 2J80A 4MCWA 3NHQA 1N9OA 4KQOA 3B42A 2H28A 3PYPA 5HDSA 3F1OB 2BASA 2LB5A 3PR6A 4I38A 4NXBA 4WELA 1WA9A 2D01A 3LYXA 4DJ3A 4HH3A 3T4QA 4FSFA 4O8GA 4H6JA 1UWNX 4YNRA 3FC7A 4LRYC 1KOUA 4XT2A 4EEUA 2ZOIA 2KOIA 1H3QA 3R4KA 3OC2A 3EQUA 4CLCB 5G4YA 2W1TA 3P01A 4GJ4A 3TW8A 1N9NA 4WEJA 3D72A 2FZ0A 4F3LB 4IHQA 2B18A 1NWZA 1UWPX 4Q0IA 4OOMA 2J3WA 4Y3IA 1XJ6A 3KX0X 4CLCC 2VX8A 4GHIB 2KDKA 1TS7A 4DN0A 2A24B 4GW9A 5F69A 3A0VA 4KQDA 4MN5A 3R7WA 4R3AA 2XSSA 1LSVA 3HJIA 3E4QA 5TBMB 3RFBA 3LR4A 1UGUA 3BQAA 4NXFA 3E98A 4EQ1A 2YKHA 1XJ4A 3P7NA 3F1OA 3PBSA 2XA7M 2V9AA 4L9FA 3ULFA 3LI9A 3G6OA 2JKTM 2LB9A 3KO6A 2VKSA 1P0ZA 3PBRA 4P6ZS 2WKPA 3T4LA 3EEHA 1T18A 4PKYG 3H82B 4BBTA 2VJWA 5CX7A 3FPVA 1NLZA 1BYWA 2A2LA 4WEKA 2JN7A 3MQQA 3LR5A 4HIAA 4WLAA 1LSWA 2HV1A 3CAXA 3S7NA 3OBFA 4Y2FA 4EU0A 4B93A 2JHEA 5HWWA 3C8CA 1TF1A 3HJKA 4IJGA 4WL9A 3V67A 1P9RA 2GJ3A 3NOPC 5J4EA 4KUOA 3IS2A 5KSHA 1YAXA 2HJEA 2PD7A 3E0YA 4EUVA 4JGOA 3EQVA 2QWSA 4EXOA 3F1PB 2QJ5A 3RTYA 3RH8B 2W3DA 4R70A 4CLCE 4RQ9A 3H7WA 2ZOHA 3D3OA 5F5YA 1YKDA 5L8MA 4PAUA 5I5LA 2QKPA 5F68A 2V0UA 3UB7A 3CUEA 4GLQA 2O99A 4PHTA 4L0LA 3JVVA 5DFYA 1JNUA 1T19A 3U2AA 3UB6A 1TS0A 2J3TD 3S7PA 2K7SA 1OT9A 1S1ZA 3H82A 2JKTI 3VV4A 3VOLA 5DKLA 4WF0A 1D7EA 4HP4A 3OLOA 1W63M 4HJ6A 4LPZA 5TJJA 3EEAA 5EFWA 4GCZA 3PBQA 2L4RA 3OOVA 5KIZA 1P9WA 1DRMA 4I3AA 4EW7A 2K2NA 3ICYA 4DMZA 5DJUA 2QJ7A 3LR3A 4MN6A 3LICA 3MMHA 4EERA 4WUJA 1NRJA 2WKQA 2DMWA 4EEPA 2QYBA 3F1PA 4ETZA 3UE3A 2CMNA 3C38A 3MF0A 1S4SA 1NLYA 1XFQA 1G28A 5IT5A 4G3VA 1VB6A 4O01A 2W3EA 4ARZB 2WKRA 2VV6A 3C2WA 2EWWA 1LL8A 4MDZA 5HDDA 4HH2A 4E04A 1Y28A 5AJGA 2OAP1 2M1CA 1V9YA 1OTIA 4I39A 4UQIM 2OWJA 2VGLS 3CLOA 4II7A 3GDIA 3O5YA 1OJ5A 3CI6A 3F1NB 4HJ3A 4Q0HA 1TS6A 1OJGA 3LIBA 3E4PA 4Q0JA 2G7UA 4K08A 4JGPA 1G6OA 2INWA 2JKRM 5DJTA 4EETB 5DF9A 1F98A 4HOIA 2VZWA 1ZTUA 4B9OA 4MMNA 3KSGA 3CITA 2W0NA 1F9IA 4BMWA 3T4TA 1V9ZA 1XJ2A 1MZUA 2Y8HA 4BWIA 4HI4A 4CLCA 3LIFA 3PBOA 3MXQA 5HWTA 3UB9A 2L1MA 3TE8A 5HD5A 2PT7A 2VLGA 4F3LA 1OTDA 4M4XA 1X0OA 2VEAA 4AFIA 2MJ6A 5FL3A 1T1AA 2NUTC 3C30A 2O9AA 3EGDC 2W3HA 3BQ8A 2HGVA 5HSQA 1OPXA 1YSPA 3EWKA 5MC7A 5IU1A 4HNBA 3KYQA 4GHIA 2B02A 3VE3A 3DBAA 4H6JB 2A24A 5C5KA 5DKKA 4KUKA 4XT2B 1GSWA 5TBMA 4IUHA 1IOUA 4YOFA 3S7QA 4L9GA 5HD3A 3F1NA 1F5MA 1MC0A 2VA0A 2W1TB 3K2NA 2M7VA 2K31A 3T4KA 4GS9B 3MQOA 4EESA 3KSIA 3OCNA 2GNXA 2EWVA 5DFXA 2PYRA 5J3WA 4NXGA 1DP6A 5AVEA 3LR0A 2R78A 1GSXA 1W63Q 1S4RA 2HF6A 2ZMVA 2JKRI 1OTEA 1IFQA 3NJAA 3T4OA 2XA7S 1S1YA 4HY8A 4O0PA 3UMEA 3R7WB 3BY8A 3PXPA 3W2ZA 3EOIA 3KSFA 1MKMA 3LI8A 4PKYA 3UMDA 2XROA 4Z1WA 5LBRA 5HZHA 2Z6CA 5HWVA 2PYPA 2W3FA 3B33A 1H8MA 3MQ0A 5HPIA 4ME4A 2W27A 4OOLA 3IBJA 4IUKA 1S66L 4I3JA 3GECA 3VE4A 3T50A 2OAQ1 4UEYA 4BJPA 3KSHA 4GS9A 4I5SA 4I3IA 3IBRA 1GSVA 1XJ3A 2YKFA 3BY9A 1LT0A 2O0YA 2V1AA 5F6AA 3TRCA 4ZRRA 1N9LA 2PHYA 2Z6DA 4BBUA 5A8BA 2PDRA 3K3DA 4NEED 4DJ2A 4WN5A 3NOTC 2OOLA 2PR6A 1ODVA 3HCYA 2OWHA 3IS2B 3PBNA 4HJ4A 1TD5A 3FG8A 1DP9A 2FH5A 2Y79A 2EA9A 3K3CA 3LIAA 2NUPC 3LIEA 2O9BA 5J7EA 2PD8A 3MR0A 4CQHA 1ZHHB 4G3KA 2M7UA 5AVFA 3H7WB 2GX5A 1TS8A 2KLIA 3BJNA 5HDCA 2O9CA 1OT6A 3LUQA 4LRZE 3T4JA 3A0RA 3ZQ5A 3OCLA 2ZMFA 5HL6A 4LLOB 4JGRA 3PHYA 4HQAA 2J3TC 3PBTA 1T1CA 3B47A 2I9VA 5IS1A 3MJQA 2KX6A 4Y5FA 3FPWA 3S7OA 4FOFA 4BBVA 5G4ZA 1T1BA 4NXEA 4JGQA 4HP9A 2ZBBA 1S67L 2P08A 3ZYTA 2L0WA 4R6LA 3UB8A 2VV8A 4CLCD 3UE6A 4ARZA 1XFNA 3CUEC 2W1RA 2XRNA 4NKPA 2W3GA 3H9WA 3T4SA 3LFVA 2V1BA 3SW1A 3LIDA 4ETXA 3EGXC 2P7JA 2IA2A 3NOUC 3BW6A 3JVUA 4LRXC 4QPRA 1STZA 3E4OA 3A0SA 1LSXA 2QHKA 2P04A 3CWFA 3KYZA 1OTAA 2VGLM 1DP8A 3MFXA 1P97A 2PR5A 4HHDA 1OTBA 2D02A 4UQIS 2GZAA 2VV7A 4R38A 1VHMA 5K5BA 4P6ZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D06 A;  4L9E A;  4YWZ A;  1EW0 A;  3BWL A;  2V0W A;  2J80 A;  3NHQ A;  1N9O A;  5HDS A;  2H28 A;  3PYP A;  3F1O B;  2BAS A;  4I38 A;  4NXB A;  1WA9 A;  2D01 A;  3LYX A;  4DJ3 A;  4HH3 A;  4H6J A;  1UWN X;  3FC7 A;  4LRY C;  1KOU A;  4XT2 A;  4EEU A;  2ZOI A;  5G4Y A;  1N9N A;  3D72 A;  4F3L B;  1NWZ A;  1UWP X;  1XJ6 A;  3KX0 X;  4GHI B;  2KDK A;  1TS7 A;  2A24 B;  4GW9 A;  5F69 A;  3A0V A;  4KQD A;  4MN5 A;  4R3A A;  1LSV A;  3HJI A;  3E4Q A;  5TBM B;  1UGU A;  4NXF A;  4EQ1 A;  2YKH A;  1XJ4 A;  3P7N A;  3F1O A;  2V9A A;  4L9F A;  3ULF A;  3LI9 A;  3G6O A;  1P0Z A;  2WKP A;  3EEH A;  1T18 A;  4PKY G;  3H82 B;  4BBT A;  1BYW A;  2JN7 A;  3MQQ A;  4HIA A;  4WLA A;  1LSW A;  2HV1 A;  3CAX A;  2JHE A;  5HWW A;  3C8C A;  3HJK A;  4WL9 A;  2GJ3 A;  3NOP C;  5J4E A;  4KUO A;  3IS2 A;  2PD7 A;  4JGO A;  2QWS A;  4EXO A;  3F1P B;  2QJ5 A;  3RTY A;  3RH8 B;  4R70 A;  4RQ9 A;  3H7W A;  2ZOH A;  5F5Y A;  5I5L A;  2QKP A;  5F68 A;  2V0U A;  3UB7 A;  1JNU A;  1T19 A;  3UB6 A;  1TS0 A;  2K7S A;  1OT9 A;  1S1Z A;  3H82 A;  3VOL A;  5DKL A;  4WF0 A;  1D7E A;  4HP4 A;  3OLO A;  4HJ6 A;  4LPZ A;  5EFW A;  4GCZ A;  2L4R A;  5KIZ A;  1DRM A;  4I3A A;  4EW7 A;  3ICY A;  5DJU A;  2QJ7 A;  4MN6 A;  3LIC A;  4EER A;  4WUJ A;  2WKQ A;  4EEP A;  3F1P A;  2CMN A;  1S4S A;  1XFQ A;  1G28 A;  1VB6 A;  2WKR A;  2VV6 A;  3C2W A;  5HDD A;  1LL8 A;  4HH2 A;  4E04 A;  1Y28 A;  2M1C A;  1V9Y A;  1OTI A;  4I39 A;  2OWJ A;  3CLO A;  3GDI A;  1OJ5 A;  3F1N B;  4HJ3 A;  1TS6 A;  1OJG A;  3LIB A;  3E4P A;  4K08 A;  4JGP A;  2INW A;  5DJT A;  4EET B;  1F98 A;  4HOI A;  4B9O A;  2W0N A;  1F9I A;  1V9Z A;  1XJ2 A;  1MZU A;  4HI4 A;  3LIF A;  3MXQ A;  5HWT A;  3UB9 A;  2L1M A;  5HD5 A;  2VLG A;  4F3L A;  1OTD A;  4M4X A;  1X0O A;  2VEA A;  1T1A A;  5HSQ A;  3EWK A;  5IU1 A;  4HNB A;  4GHI A;  2B02 A;  3VE3 A;  4H6J B;  2A24 A;  5DKK A;  4KUK A;  4XT2 B;  1GSW A;  5TBM A;  4L9G A;  5HD3 A;  3F1N A;  4GS9 B;  3MQO A;  4EES A;  2PYR A;  5J3W A;  4NXG A;  1DP6 A;  5AVE A;  2R78 A;  1GSX A;  1S4R A;  1OTE A;  3NJA A;  1S1Y A;  4HY8 A;  3UME A;  3BY8 A;  3LI8 A;  4PKY A;  3UMD A;  5HZH A;  2Z6C A;  5HWV A;  2PYP A;  3B33 A;  2W27 A;  1S66 L;  4I3J A;  3GEC A;  3VE4 A;  3T50 A;  4I5S A;  4GS9 A;  4I3I A;  3IBR A;  1GSV A;  1XJ3 A;  2YKF A;  3BY9 A;  1LT0 A;  2V1A A;  5F6A A;  1N9L A;  2PHY A;  2Z6D A;  4BBU A;  5A8B A;  2PDR A;  3K3D A;  4DJ2 A;  4WN5 A;  3NOT C;  2OOL A;  2PR6 A;  1ODV A;  2OWH A;  3IS2 B;  4HJ4 A;  1DP9 A;  3FG8 A;  3LIA A;  2EA9 A;  3K3C A;  3LIE A;  5J7E A;  2PD8 A;  3MR0 A;  5AVF A;  3H7W B;  1TS8 A;  5HDC A;  1OT6 A;  3LUQ A;  4LRZ E;  3A0R A;  3ZQ5 A;  4LLO B;  4JGR A;  3PHY A;  4HQA A;  1T1C A;  2I9V A;  5IS1 A;  3MJQ A;  2KX6 A;  4BBV A;  5G4Z A;  1T1B A;  4NXE A;  4JGQ A;  4HP9 A;  2ZBB A;  1S67 L;  2L0W A;  4R6L A;  3UB8 A;  2VV8 A;  3UE6 A;  1XFN A;  3H9W A;  2V1B A;  3SW1 A;  3LID A;  2P7J A;  3NOU C;  4LRX C;  3E4O A;  3A0S A;  1LSX A;  2QHK A;  3CWF A;  1OTA A;  1DP8 A;  3MFX A;  1P97 A;  2PR5 A;  4HHD A;  1OTB A;  2D02 A;  2VV7 A;  4R38 A; 
#chains in the Genus database with same CATH topology
 2C5W B;  1YLT A;  2HJ9 C;  4YWZ A;  3Q81 A;  2V0W A;  1M40 A;  3NC8 A;  3PYP A;  5GLB A;  3F1O B;  3DW0 A;  1K54 A;  5FAQ A;  2JKF A;  1WA9 A;  3NDE A;  4WBG A;  2PU2 A;  1K55 A;  3LYX A;  4DJ3 A;  4JLF A;  2FFY A;  1W79 A;  4YNR A;  5EE8 A;  1FSW A;  2ZQC A;  3CZD A;  2QMI A;  3QHY A;  1YMS A;  2ZOI A;  3TG9 A;  3OC2 A;  4X6T A;  5CGX A;  5G4Y A;  4GJ4 A;  2JKG A;  4WEJ A;  5CHJ A;  1IKI A;  4Q0I A;  1W8Q A;  2J3W A;  1G6A A;  3GV9 A;  4Y3I A;  1XJ6 A;  4EUZ A;  2KDK A;  2J7V A;  2ZJ9 A;  5F69 A;  3A0V A;  4KQD A;  4MN5 A;  1LLB A;  4R3A A;  1FOF A;  4UA6 A;  3VSL A;  3NDG A;  3LR4 A;  4C6Y A;  4NXF A;  3E98 A;  3GVB A;  2XH9 A;  1H0M A;  3P7N A;  2WZX A;  5FQI A;  3T1Q B;  4FCF A;  2JKT M;  3ZG5 A;  2LB9 A;  2V8C A;  4UA9 A;  4X53 A;  1HVB A;  2VKS A;  1P0Z A;  3PBR A;  1MXO A;  1T18 A;  4PKY G;  5CX7 A;  1LHY A;  1NLZ A;  1BYW A;  1ERO A;  5GLC A;  3O88 A;  3HLF A;  4HIA A;  1LSW A;  2HV1 A;  3CAX A;  3S7N A;  4OH0 A;  4EU0 A;  3RJU A;  3BEB A;  2JHE A;  3C8C A;  1TF1 A;  4IBR A;  2B5R A;  1BUL A;  5CHM A;  3S1Y A;  4KUO A;  4KZA A;  2PD7 A;  1KDW A;  2QWS A;  3Q82 A;  4Y7P A;  2G2U A;  4R70 A;  4CLC E;  4RQ9 A;  2WAD A;  2Z2M B;  4LCM A;  5L8M A;  4EV4 A;  5I5L A;  3IF5 A;  1QMF A;  3UE0 A;  4PHT A;  3E2K A;  1JNU A;  1KGF A;  4R0Q A;  1EWZ A;  1XGJ A;  3Q7V B;  1CEF A;  3H82 A;  3NY4 A;  4OQG A;  4N1H A;  1PZP A;  4YFM A;  1VEU B;  3NIA A;  3VP2 A;  1FCM A;  4GCZ A;  3DWK A;  3PBQ A;  4I3A A;  3ICY A;  4DMZ A;  3LR3 A;  1L0G A;  5FAO A;  4FH4 A;  4WUJ A;  4HEF A;  5CTN A;  5FQQ A;  2DMW A;  2QYB A;  3UPO A;  2WUQ A;  4DE3 A;  1FIL A;  3UE3 A;  3ZCZ A;  5EVL A;  2Q0O A;  3ZG0 A;  1MWU A;  4OP5 A;  3GTC A;  2XD5 A;  1NLY A;  1G28 A;  5IT5 A;  4EBN A;  2W3E A;  2BTF P;  5HDD A;  4MDZ A;  5GLD A;  5AJG A;  2E8J A;  2M1C A;  4UQI M;  5JYO A;  1YLY A;  3GDI A;  2CC1 A;  2HDQ A;  3VP1 A;  2V8F A;  4XUZ A;  3SZT A;  4LV3 A;  3HUM A;  5M18 A;  4B9O A;  4MMN A;  3CIT A;  3IX3 A;  4RYE A;  2W0N A;  4BQM A;  3MZF A;  4BMW A;  3DWZ A;  3VFF A;  4JXG A;  1CK3 A;  2ZQA A;  5FDH A;  3UB9 A;  2BLS A;  4WMC D;  2PT7 A;  2WAF A;  1H5X A;  3GRJ A;  4F3L A;  3BRM A;  2OV5 A;  2GDN A;  2NUT C;  5A92 A;  2W3H A;  5HSQ A;  1OPX A;  1YSP A;  3EWK A;  3QP2 A;  2Y2G A;  4GD6 A;  4E3K A;  4GHI A;  2HZ5 A;  2H0T A;  1CF0 A;  3LGO A;  3IXG A;  5FQM A;  1BZA A;  3PTE A;  1ZG6 A;  4YOF A;  1BUE A;  3TSG A;  5HD3 A;  5FI7 A;  1MC0 A;  2VA0 A;  3K2N A;  2IWD A;  2K31 A;  3MQO A;  3KSI A;  3D9Y A;  2GNX A;  4KZ9 A;  1PNE A;  4NXG A;  2Y2P A;  3W4Q A;  1S4R A;  1G68 A;  5L09 A;  2JE5 A;  1OTE A;  1DJA A;  5I94 A;  1IFQ A;  3NJA A;  4P87 A;  3T4O A;  4HY8 A;  1YLZ A;  2UWX A;  3PAE A;  4D2O A;  3M2K A;  1MKM A;  4PKY A;  3MKF A;  1JWP A;  1XP4 A;  5HWV A;  2PYP A;  1SKF A;  4R4S A;  1H8M A;  2WKI A;  1D1J A;  2IWB A;  3MBZ A;  4S2J A;  4S2K A;  5AQA A;  4ME4 A;  4KQR A;  3ZG9 B;  4ZTK A;  2HP9 A;  3VE4 A;  1W5D A;  3WRZ A;  3T50 A;  2OAQ 1;  2ZD8 A;  5F1G A;  2HPB A;  4GS9 A;  3IBR A;  2WYX A;  1GSV A;  1XJ3 A;  1ES4 A;  4S2N A;  4X69 A;  5F6A A;  4JXV A;  1N9L A;  2PHY A;  1KDS A;  5EM0 A;  1K25 A;  3NOT C;  1HD8 A;  3UDF A;  1ODV A;  2QZ6 A;  1TD5 A;  3FG8 A;  1Q2P A;  3LIE A;  2O9B A;  3V50 A;  5J7E A;  2ZQD A;  3MR0 A;  3AGF A;  4GDB A;  4N9L A;  2GX5 A;  1SDE A;  5HDC A;  3HLW A;  3MS6 A;  2JBF A;  4E3J A;  4LRZ E;  3A0R A;  3OCL A;  2ZMF A;  3SS4 A;  1KE0 A;  5HL6 A;  3PHY A;  5JYP A;  1K56 D;  2I9V A;  3MJQ A;  5D3O A;  3IF6 C;  4R3B A;  5G4Z A;  4OLD A;  4JGQ A;  3ZYT A;  3GQZ A;  3KYE A;  2L0W A;  2VV8 A;  2XRN A;  4NKP A;  2W3G A;  4WZ5 C;  4E3M A;  4ZDX A;  4K0X A;  4LRX C;  3RXX A;  3WS5 A;  4R3J A;  2QHK A;  1K55 C;  4OLG A;  1E4D A;  1OTA A;  1P97 A;  1WE4 A;  4N92 A;  5GHX A;  5A91 A;  1Y54 A;  2OSU A;  3IWI A;  3VOZ A;  2HP6 A;  4N1X A;  4ZBE A;  1S6R A;  1YSQ A;  3UPP A;  1KE3 A;  4MCW A;  4XUX A;  4KQO A;  3Q1F A;  1I2W A;  3B42 A;  2H28 A;  1MWS A;  2BAS A;  4I38 A;  4NXB A;  1JWZ A;  4JBF A;  4H6J A;  1UWN X;  1PI4 A;  4DE0 A;  4JXW A;  1MWR A;  1H3Q A;  5GLA A;  3EQU A;  1J9M A;  1JWV A;  1N9N A;  3TW8 A;  4C3Q A;  3GMW A;  1KVL A;  3LY4 A;  1VET A;  4F3L B;  1CJF A;  3NI9 A;  4OOM A;  1NZO A;  4GHI B;  3M2J A;  4DN0 A;  4GW9 A;  4OON A;  3R7W A;  5FEF A;  2XSS A;  1W7F A;  1LSV A;  1FR1 A;  1ONG A;  1K6S A;  4DRT A;  4DXC A;  2XQZ A;  4L9F A;  5DF8 A;  3IXH A;  4WMC A;  3LY3 A;  2WKP A;  1YLJ A;  3T4L A;  3SOI A;  3FPV A;  2A2L A;  4X68 A;  2E8I A;  5TFQ A;  3MQQ A;  4OPY A;  4DDS A;  3LR5 A;  1HZO A;  3DTE A;  4B93 A;  1NJ4 A;  5HWW A;  1PZO A;  1BTL A;  2WGW A;  3OPR A;  3G31 A;  3UY6 A;  2ZC7 A;  3NOP C;  1HTZ A;  3IS2 A;  1YAX A;  2HJE A;  4JGO A;  4EXO A;  3IF6 A;  1WYB A;  2J8Y A;  3FWL A;  4Z9Q A;  4LV1 A;  3G2Y A;  2ZM0 A;  3G34 A;  3NUL A;  4PAU A;  5FQJ A;  2HP5 A;  5F68 A;  4GD8 A;  3MXS A;  3IH9 A;  4GLQ A;  2O99 A;  3HLC A;  1OME A;  2WKE A;  3JVV A;  3O87 A;  3A3E A;  4WZ5 A;  1HLU P;  2J3T D;  2K7S A;  2A49 A;  2JKT I;  1YMX A;  5DKL A;  2B95 A;  1KGG A;  4EBL A;  1XPB A;  3EEA A;  5EFW A;  2L4R A;  1DRM A;  3IWO A;  4EW7 A;  1MWT A;  1PI5 A;  4MN6 A;  3MMH A;  4OQH A;  5GHY A;  3HLD A;  2ZLY A;  3HUO A;  3E2L A;  4EEP A;  3F1P A;  5CGW A;  2ZQ9 A;  2WKH A;  2I72 A;  3C38 A;  1FR6 A;  5FQK A;  4O01 A;  1BSG A;  2X02 A;  4E04 A;  2ZC5 B;  1YM1 A;  4FTX A;  2OAP 1;  1OTI A;  4I39 A;  2OWJ A;  1K57 C;  4II7 A;  1OJ5 A;  4Q0H A;  1TS6 A;  3LIB A;  2Z2L B;  3BFC A;  2G7U A;  1ERQ A;  4JGP A;  2XLN A;  1L2S A;  1G6O A;  2JKR M;  4DF6 A;  3GR2 A;  4XXR A;  2Y2K A;  3OPH A;  5DF9 A;  4HOI A;  1ZTU A;  1LL5 A;  3MSH A;  1E25 A;  3BFD A;  1XJ2 A;  2Y8H A;  4Q8I A;  4HI4 A;  1E3U A;  4R23 A;  5GL9 A;  5HX9 A;  3PAG A;  4OP8 A;  3MZE A;  1A0K A;  3UB5 P;  3ZG8 B;  2L1M A;  4PMA A;  5HD5 A;  1OTD A;  4M4X A;  1X0O A;  2WZZ A;  4AFI A;  1T1A A;  3SH9 A;  3C30 A;  4FH2 A;  5DTK A;  2O9A A;  3BQ8 A;  2HGV A;  1PRQ A;  2J9P A;  3ITA A;  5MC7 A;  4HNB A;  4JF4 A;  3VE3 A;  4H6J B;  4JKT A;  1W8Y A;  2A24 A;  5C5K A;  1XXM A;  4DDY A;  4IUH A;  1IOU A;  3C5A A;  3S7Q A;  4L9G A;  3F1N A;  1F5M A;  2M7V A;  1IEM A;  3G32 A;  3SH8 A;  1L0D A;  1VET B;  2EWV A;  4D60 A;  1KGE A;  3UN7 A;  3QNB A;  2DCF A;  1W63 Q;  4NG2 A;  2ZMV A;  3L9K A;  3NCK A;  4KZB A;  3T1R A;  4S2N C;  4O0P A;  3R7W B;  4CPK A;  5IHV A;  3KSF A;  4PPR A;  3LI8 A;  3IHB A;  5DTT A;  1DJC A;  5HZH A;  3IX4 A;  3WS1 A;  3OZH A;  1IYO A;  4LGW A;  1Z09 A;  1NYM A;  3CG5 A;  5DTS A;  1ESI A;  3ZNY A;  4OOL A;  3GEC A;  1YLP A;  1JTG A;  1VM1 A;  1ALQ A;  3C4P A;  2VGK A;  4CJN A;  4UEY A;  5FI6 A;  3KSH A;  1EI5 A;  3BY9 A;  5HAR A;  3VOY A;  4BBU A;  2PDR A;  2WGW B;  3ZG7 B;  2VK3 A;  1N9B A;  5FAS A;  3HCY A;  2DNS A;  3IS2 B;  4HJ4 A;  1PYY A;  2Y79 A;  2NUP C;  3K3C A;  3QP8 A;  1FCN A;  3IF6 B;  5L07 A;  3W8K A;  1ES5 A;  2Y2N A;  4G3K A;  1I5Q A;  5AVF A;  2C6W B;  2KLI A;  3JPU A;  3ZDJ A;  3BJN A;  3FYZ A;  4WYY A;  3ZQ5 A;  5F1F A;  4JGR A;  4P85 A;  3IHA A;  3B47 A;  5EV0 A;  3FPW A;  4FOF A;  4BBV A;  1K57 A;  4NXE A;  1ZKJ A;  2P08 A;  4R6L A;  4S2I A;  3UB8 A;  3ZVW A;  4CLC D;  1TDG A;  5M19 A;  3CUE C;  2W1R A;  1F2K A;  3T4S A;  4ID4 A;  2V1B A;  3LID A;  3T12 B;  3DTI A;  3EGX C;  2A3U A;  2IA2 A;  2P7J A;  2PBD P;  3NOU C;  3JVU A;  3N8R A;  4IVI A;  4P6B A;  5FAT A;  4PM8 A;  2V20 A;  3KYZ A;  4FD8 A;  2VGL M;  1DP8 A;  4QWO A;  4E6W A;  5FAP A;  3P98 A;  1OTB A;  2D02 A;  4UQI S;  2ZC6 B;  5K5B A;  3N8L A;  2R9X A;  4KZ4 A;  4MN7 A;  5L10 A;  1D06 A;  5FQ9 A;  3BWL A;  5HPF A;  3TJZ C;  1FCO A;  2J80 A;  3NHQ A;  1N9O A;  1XA7 A;  2P9V A;  4X25 A;  3CHW P;  3HRE A;  4WEL A;  4BL2 A;  3DTK A;  4EQI A;  1K38 A;  4HH3 A;  3T4Q A;  4FSF A;  4O8G A;  4RX3 A;  4LRY C;  5AQ7 A;  5HAQ A;  1K6R A;  3R4K A;  4IBX A;  4S2M A;  3A3F A;  2W1T A;  3HLG A;  3V39 A;  5EUA A;  3D72 A;  1MY8 A;  3V3S A;  5G18 A;  2FZ0 A;  1PW8 A;  1AWI A;  5TR7 A;  3M6H A;  3MXR A;  1Q2Q A;  4EWF A;  3OPL A;  3KX0 X;  4CLC C;  2A24 B;  4X55 A;  3HJI A;  3E4Q A;  3RFB A;  3BQA A;  1XJ4 A;  2ZM8 A;  3F1O A;  3IX8 A;  2XA7 M;  3ULF A;  4GN2 A;  3G6O A;  2EFX A;  3KO6 A;  3BEC A;  3CJM A;  1PWG A;  2Y59 A;  4PM7 A;  2PU4 A;  3EEH A;  3H82 B;  3WRT A;  2VJW A;  3BLM A;  5EEC A;  4WEK A;  4DE1 A;  3IXD A;  1LL9 A;  2HDR A;  2P74 A;  1XA1 A;  2Y4A A;  4Y2F A;  1GA0 A;  1O07 A;  4Y0T A;  3JYI A;  3HUN A;  3QP5 A;  5J4E A;  5BOH A;  2Y2I A;  5KSH A;  2XDM A;  4EUV A;  1SZV A;  2QJ5 A;  4GB7 A;  4NET A;  4HES A;  2ZOH A;  3D3O A;  4OPQ A;  1DJB A;  4QY6 A;  4GDN A;  5CEB A;  1RCJ A;  3BFE A;  2QKP A;  2EX8 A;  2V0U A;  4KZ8 A;  3CUE A;  5DFY A;  1IYQ A;  1T19 A;  3UB6 A;  1TS0 A;  3S7P A;  3B3X A;  1SKO A;  5E2H A;  3VV4 A;  4MBH A;  3WWX A;  4PM6 A;  1JTD A;  1GA9 A;  3OLO A;  1W63 M;  4HJ6 A;  4QU3 A;  4X56 A;  4LPZ A;  3CMZ A;  4BL3 A;  2XEP A;  4QJG A;  5EVI D;  5KIZ A;  4LEN A;  3N6I A;  3LO7 A;  2QJ7 A;  4KQQ A;  4Y15 A;  5DJU A;  1Y4O A;  4EER A;  1NRJ A;  4KZ7 A;  2J9O A;  1NZU A;  2CMN A;  4K91 A;  3MF0 A;  3ZHH A;  4G3V A;  2WKR A;  3C2W A;  1ZG4 A;  4RA7 A;  4HH2 A;  4BLM A;  1Y28 A;  5CXW A;  1BLS A;  5CTM A;  1ES2 A;  1V9Y A;  4DKI A;  5EOO A;  1TDL A;  4Q0J A;  3VFH A;  4DXB A;  3UDX A;  4K08 A;  3DTM A;  3ZNT A;  3GSG A;  4KG6 A;  4FUW A;  5DJT A;  2ACG A;  5HAI A;  4EET B;  2VZW A;  1L0E A;  2OLU A;  1LI9 A;  1V9Z A;  3BFG A;  1MZU A;  2X01 A;  4BWI A;  3BFF A;  4CLC A;  2JC7 A;  3W4P A;  1MKI A;  3AGE A;  3MXQ A;  2R9W A;  2Y91 A;  1H8Y A;  2VLG A;  1TVF A;  2P9V B;  1PIO A;  2VEA A;  3A3I A;  2MJ6 A;  5FL3 A;  1XGI A;  1I2S A;  3V5M A;  4WM9 A;  4X1M A;  1O7E A;  5IU1 A;  5E43 A;  2B02 A;  3DBA A;  5EVI C;  5DKK A;  1GSW A;  4N9K A;  5TBM A;  1FQG A;  2W1T B;  4MEZ A;  4Y13 A;  4LV0 A;  3T4K A;  4GS9 B;  2WK0 A;  4U0X A;  3OCN A;  4GNU A;  5DFX A;  2WGV A;  5AVE A;  1ZC2 A;  4E6X A;  3LR0 A;  4YIN A;  2R78 A;  4Y0U A;  5CEC A;  2XGN A;  2HF6 A;  2JKR I;  4NK3 A;  4X1L A;  4BEN A;  4KG5 A;  3C4O A;  4LCL A;  3ITB A;  3RXW A;  3EOI A;  2XD1 A;  1SDN A;  5EM1 A;  2XRO A;  1RP5 A;  4Z1W A;  3FV7 A;  4E3L A;  2Z6C A;  2W3F A;  4KEN B;  3B33 A;  1YPR A;  3NBL A;  3MQ0 A;  4QHC A;  4ZJ2 A;  2W27 A;  1LI0 A;  3IBJ A;  4IUK A;  3Q07 A;  3ISG A;  3MKE A;  1YT4 A;  4HBT A;  3SS3 A;  5DVA A;  4BJP A;  4I3I A;  5CHU A;  3AGD A;  1LT0 A;  4KZ3 A;  2O0Y A;  2V1A A;  4ZRR A;  2Z6D A;  1VQQ A;  5A8B A;  3K3D A;  4DJ2 A;  2PR6 A;  2OWH A;  5A90 A;  1XX2 A;  1K56 A;  3TOI A;  4DE2 A;  4S2O A;  1DP9 A;  2FH5 A;  2EA9 A;  4BD1 A;  3ZVT A;  4UAA A;  5U47 A;  4CQH A;  1GCE A;  2ZMA A;  5HFO A;  2RCX A;  2O9C A;  4ZJ1 A;  3S4X A;  4KZ5 A;  3VP3 A;  2J3T C;  3PBT A;  5DF7 A;  5IS1 A;  2KX6 A;  2ZL1 A;  4PM5 A;  3A3D A;  3S22 A;  1NRF A;  1CI8 A;  1PFL A;  3C7U A;  1SKO B;  1MPL A;  1T1B A;  2ZQ8 A;  3BLS A;  4Y0O A;  4ARZ A;  1XFN A;  1S0W A;  3LFV A;  3SW1 A;  1FIK A;  4QB8 A;  4ETX A;  4PM9 A;  1STZ A;  3E4O A;  4E3N A;  3A0S A;  3CWF A;  1AXB A;  3QNC A;  1ESU A;  5KMW A;  4HBU A;  5F82 A;  4HHD A;  2GZA A;  3V3R A;  3FZC A;  2Y55 A;  2EXB A;  3IH8 A;  4R38 A;  4P6Z M;  3LEQ A;  4G3W A;  4L9E A;  1EW0 A;  5EVI A;  5M1A A;  1TEM A;  5HDS A;  2IWC A;  2LB5 A;  4LV2 A;  3PR6 A;  4RX2 A;  3W4O A;  1WYC A;  2D01 A;  5TGF A;  4F94 A;  3IWQ A;  3FC7 A;  4R4R A;  1ERM A;  1Z6F A;  1KOU A;  2UV0 E;  4XT2 A;  4EEU A;  1PW1 A;  2KOI A;  2H10 A;  4CLC B;  1BLH A;  3P01 A;  3LEZ A;  4U3T A;  2ZC4 B;  3CPT A;  2EX2 A;  1IEL A;  2EFU A;  1J3W A;  4IHQ A;  2B18 A;  1NWZ A;  1UWP X;  2V2F F;  5FI2 A;  4GKU A;  2XR0 A;  1KVM A;  3FKW A;  4LFU A;  1YQS A;  1SHV A;  2VX8 A;  1TS7 A;  4OPR A;  4JPM A;  3N4I A;  3T1S A;  2WGI A;  3VSK A;  5TBM B;  1UGU A;  5HAP A;  4EQ1 A;  2YKH A;  5FEG A;  1NYY A;  3PBS A;  2WAE A;  3T1X A;  2V9A A;  3LI9 A;  1IYS A;  1DY6 A;  4P6Z S;  4H8R A;  4MNR A;  1NXY A;  4ZJ3 A;  5AQB A;  2BG1 A;  4BBT A;  2JN7 A;  3QP4 A;  5E2G A;  3D4F A;  4WLA A;  1PWC A;  1BLP A;  3OBF A;  3HJK A;  3FKV A;  4IJG A;  4OQI A;  1K4E A;  4KG2 A;  4WL9 A;  3QP6 A;  2Y2Q A;  2Q9N A;  3V67 A;  1P9R A;  2GJ3 A;  4E3O A;  1U60 A;  1RGY A;  1MBL A;  3VMA A;  2Q9M A;  1C3B A;  3G35 A;  3E0Y A;  3EQV A;  4ZAM A;  3HBR A;  3F1P B;  1GHM A;  2XF3 A;  3RTY A;  5HL1 A;  3RH8 B;  2W3D A;  2Y2M A;  1L3L A;  1GHP A;  3H7W A;  3M6B A;  4UHU A;  5F5Y A;  1YKD A;  4JXS A;  3UB7 A;  3ZGA B;  4L0L A;  3U2A A;  2Y2O A;  5E2E A;  1OT9 A;  1S1Z A;  1IKG A;  2PBY A;  1XKZ A;  3VOL A;  4B88 A;  4K0W A;  4WF0 A;  2HDU A;  1D7E A;  5KSC A;  4HP4 A;  3L7H A;  5TJJ A;  5A93 A;  3OOV A;  2XFS A;  1P9W A;  2K2N A;  3LIC A;  2G2W A;  4B4Z A;  1H8Z A;  2ZL1 B;  5FSR A;  2WKQ A;  4P0M A;  3WS0 A;  1YLW A;  4ETZ A;  5GHZ A;  1S4S A;  1XFQ A;  1VB6 A;  3UNW A;  3OPP A;  3N7W A;  3MFD A;  1K4F A;  4ARZ B;  4EBP A;  3LCE A;  2VV6 A;  2EWW A;  1LL8 A;  3C7V A;  3SS5 A;  2H0Y A;  1BLC A;  2H5S A;  2VGL S;  3CLO A;  3O5Y A;  3CI6 A;  3F1N B;  4HJ3 A;  1OJG A;  4U0T A;  3E4P A;  1VHM A;  2EX9 A;  4GOG A;  2INW A;  1SCW A;  5F83 A;  1F98 A;  1N4O A;  3KSG A;  1FSY A;  3N8S A;  1F9I A;  2VGJ A;  3HL9 A;  4Y17 A;  3DAV A;  3T4T A;  2EXA A;  1PWD A;  3O86 A;  3LIF A;  4GZB A;  5EVI B;  1ACF A;  3PBO A;  2FFF B;  5HWT A;  1GHI A;  3TE8 A;  1IYP A;  5FA7 A;  3I7J A;  3EGD C;  4RVA A;  5CGS A;  2AVX A;  3KYQ A;  1E3U D;  3U4L P;  4OVD A;  3G4P A;  2Y2H A;  4KUK A;  4XT2 B;  3WS2 A;  1CI9 A;  3A3J A;  4BD0 A;  4WZ4 A;  1K54 C;  5EVE A;  4OQ0 A;  3HVF A;  4S2P A;  3CPT B;  5CED A;  1KE4 A;  4EES A;  2PRF A;  5J8X A;  1RGZ A;  1CEG A;  4ESP A;  2PYR A;  4QY5 A;  5J3W A;  1DP6 A;  4OPZ A;  3UO9 A;  3WS4 A;  1GSX A;  3MZD A;  2XA7 S;  1S1Y A;  3UME A;  2ZC3 B;  4O7D A;  1QME A;  4JF6 A;  2OLV A;  3BY8 A;  2ZQ7 A;  3PXP A;  3W2Z A;  3HLE A;  3UMD A;  1CQA A;  5LBR A;  3G30 A;  4M3K A;  3IXB A;  1ONH A;  2X71 A;  5HPI A;  4MLL A;  3HLB A;  4JF5 A;  4KZ6 A;  4UA7 A;  1S66 L;  4OOY A;  4I3J A;  3UPN A;  2HDS A;  3P09 A;  1JVJ A;  5EPH A;  4I5S A;  1BT5 A;  3VP0 A;  4E3I A;  5L2F A;  2YKF A;  4C75 A;  3TRC A;  5HW3 A;  2ZM2 A;  3UDI A;  3IT9 A;  4NEE D;  2V1Z A;  3IQA A;  4R1G A;  3Q7V A;  4WN5 A;  2OOL A;  4MBK A;  3QP1 A;  3SH7 A;  3PBN A;  2XK1 A;  3LIA A;  1VEU A;  5CER A;  2PD8 A;  2DRW A;  1ZHH B;  2M7U A;  3H7W B;  1TS8 A;  1NY0 A;  1OT6 A;  5EOE A;  3LUQ A;  3T4J A;  1G5U A;  4LLO B;  4HQA A;  1T1C A;  3BYD A;  4Y5F A;  2Y2J A;  3S7O A;  2PAV P;  4HP9 A;  2ZBB A;  1S67 L;  4B4X A;  5AQ9 A;  3O3V A;  5KZH A;  3VP4 A;  3UE6 A;  1L0F A;  3H9W A;  2QPN A;  5E2F A;  3BW6 A;  3Q7Z A;  2JCH A;  1M6K A;  4QPR A;  2RL3 A;  1ES3 A;  5FDS A;  4IED A;  3UE1 A;  1LSX A;  3G2Z A;  2P04 A;  4S2L A;  2XFT A;  3MFX A;  3ZFZ A;  3BM6 A;  4A5R A;  4MBF A;  2PR5 A;  1K0K A;  5CRF A;  3NEC A;  2EX6 A;  2Y2L A;  2VV7 A;  4IVK A;  4QD4 A;  4OKP A; 
#chains in the Genus database with same CATH homology
 2HJ9 C;  4MN7 A;  4G3W A;  1D06 A;  4L9E A;  4YWZ A;  1EW0 A;  3BWL A;  5HPF A;  2V0W A;  3TJZ C;  1YSQ A;  2J80 A;  4MCW A;  3NHQ A;  1N9O A;  4KQO A;  3B42 A;  2H28 A;  3PYP A;  5HDS A;  3F1O B;  2BAS A;  2LB5 A;  3PR6 A;  4I38 A;  4NXB A;  4WEL A;  1WA9 A;  2D01 A;  3LYX A;  4DJ3 A;  4HH3 A;  3T4Q A;  4FSF A;  4O8G A;  4H6J A;  1UWN X;  4YNR A;  3FC7 A;  4LRY C;  1KOU A;  4XT2 A;  4EEU A;  2ZOI A;  2KOI A;  1H3Q A;  3R4K A;  3OC2 A;  3EQU A;  4CLC B;  5G4Y A;  2W1T A;  3P01 A;  4GJ4 A;  3TW8 A;  1N9N A;  4WEJ A;  3D72 A;  2FZ0 A;  4F3L B;  4IHQ A;  2B18 A;  1NWZ A;  1UWP X;  4Q0I A;  4OOM A;  2J3W A;  4Y3I A;  1XJ6 A;  3KX0 X;  4CLC C;  2VX8 A;  4GHI B;  2KDK A;  1TS7 A;  4DN0 A;  2A24 B;  4GW9 A;  5F69 A;  3A0V A;  4KQD A;  4MN5 A;  3R7W A;  4R3A A;  2XSS A;  1LSV A;  3HJI A;  3E4Q A;  5TBM B;  3RFB A;  3LR4 A;  1UGU A;  3BQA A;  4NXF A;  3E98 A;  4EQ1 A;  2YKH A;  1XJ4 A;  3P7N A;  3F1O A;  3PBS A;  2XA7 M;  2V9A A;  4L9F A;  3ULF A;  3LI9 A;  3G6O A;  2JKT M;  2LB9 A;  3KO6 A;  2VKS A;  1P0Z A;  3PBR A;  4P6Z S;  2WKP A;  3T4L A;  3EEH A;  1T18 A;  4PKY G;  3H82 B;  4BBT A;  2VJW A;  5CX7 A;  3FPV A;  1NLZ A;  1BYW A;  2A2L A;  4WEK A;  2JN7 A;  3MQQ A;  3LR5 A;  4HIA A;  4WLA A;  1LSW A;  2HV1 A;  3CAX A;  3S7N A;  3OBF A;  4Y2F A;  4EU0 A;  4B93 A;  2JHE A;  5HWW A;  3C8C A;  1TF1 A;  3HJK A;  4IJG A;  4WL9 A;  3V67 A;  1P9R A;  2GJ3 A;  3NOP C;  5J4E A;  4KUO A;  3IS2 A;  5KSH A;  1YAX A;  2HJE A;  2PD7 A;  3E0Y A;  4EUV A;  4JGO A;  3EQV A;  2QWS A;  4EXO A;  3F1P B;  2QJ5 A;  3RTY A;  3RH8 B;  2W3D A;  4R70 A;  4CLC E;  4RQ9 A;  3H7W A;  2ZOH A;  3D3O A;  5F5Y A;  1YKD A;  5L8M A;  4PAU A;  5I5L A;  2QKP A;  5F68 A;  2V0U A;  3UB7 A;  3CUE A;  4GLQ A;  2O99 A;  4PHT A;  4L0L A;  3JVV A;  5DFY A;  1JNU A;  1T19 A;  3U2A A;  3UB6 A;  1TS0 A;  2J3T D;  3S7P A;  2K7S A;  1OT9 A;  1S1Z A;  3H82 A;  2JKT I;  3VV4 A;  3VOL A;  5DKL A;  4WF0 A;  1D7E A;  4HP4 A;  3OLO A;  1W63 M;  4HJ6 A;  4LPZ A;  5TJJ A;  3EEA A;  5EFW A;  4GCZ A;  3PBQ A;  2L4R A;  3OOV A;  5KIZ A;  1P9W A;  1DRM A;  4I3A A;  4EW7 A;  2K2N A;  3ICY A;  4DMZ A;  5DJU A;  2QJ7 A;  3LR3 A;  4MN6 A;  3LIC A;  3MMH A;  4EER A;  4WUJ A;  1NRJ A;  2WKQ A;  2DMW A;  4EEP A;  2QYB A;  3F1P A;  4ETZ A;  3UE3 A;  2CMN A;  3C38 A;  3MF0 A;  1S4S A;  1NLY A;  1XFQ A;  1G28 A;  5IT5 A;  4G3V A;  1VB6 A;  4O01 A;  2W3E A;  4ARZ B;  2WKR A;  2VV6 A;  3C2W A;  2EWW A;  1LL8 A;  4MDZ A;  5HDD A;  4HH2 A;  4E04 A;  1Y28 A;  5AJG A;  2OAP 1;  2M1C A;  1V9Y A;  1OTI A;  4I39 A;  4UQI M;  2OWJ A;  2VGL S;  3CLO A;  4II7 A;  3GDI A;  3O5Y A;  1OJ5 A;  3CI6 A;  3F1N B;  4HJ3 A;  4Q0H A;  1TS6 A;  1OJG A;  3LIB A;  3E4P A;  4Q0J A;  2G7U A;  4K08 A;  4JGP A;  1G6O A;  2INW A;  2JKR M;  5DJT A;  4EET B;  5DF9 A;  1F98 A;  4HOI A;  2VZW A;  1ZTU A;  4B9O A;  4MMN A;  3KSG A;  3CIT A;  2W0N A;  1F9I A;  4BMW A;  3T4T A;  1V9Z A;  1XJ2 A;  1MZU A;  2Y8H A;  4BWI A;  4HI4 A;  4CLC A;  3LIF A;  3PBO A;  3MXQ A;  5HWT A;  3UB9 A;  2L1M A;  3TE8 A;  5HD5 A;  2PT7 A;  2VLG A;  4F3L A;  1OTD A;  4M4X A;  1X0O A;  2VEA A;  4AFI A;  2MJ6 A;  5FL3 A;  1T1A A;  2NUT C;  3C30 A;  2O9A A;  3EGD C;  2W3H A;  3BQ8 A;  2HGV A;  5HSQ A;  1OPX A;  1YSP A;  3EWK A;  5MC7 A;  5IU1 A;  4HNB A;  3KYQ A;  4GHI A;  2B02 A;  3VE3 A;  3DBA A;  4H6J B;  2A24 A;  5C5K A;  5DKK A;  4KUK A;  4XT2 B;  1GSW A;  5TBM A;  4IUH A;  1IOU A;  4YOF A;  3S7Q A;  4L9G A;  5HD3 A;  3F1N A;  1F5M A;  1MC0 A;  2VA0 A;  2W1T B;  3K2N A;  2M7V A;  2K31 A;  3T4K A;  4GS9 B;  3MQO A;  4EES A;  3KSI A;  3OCN A;  2GNX A;  2EWV A;  5DFX A;  2PYR A;  5J3W A;  4NXG A;  1DP6 A;  5AVE A;  3LR0 A;  2R78 A;  1GSX A;  1W63 Q;  1S4R A;  2HF6 A;  2ZMV A;  2JKR I;  1OTE A;  1IFQ A;  3NJA A;  3T4O A;  2XA7 S;  1S1Y A;  4HY8 A;  4O0P A;  3UME A;  3R7W B;  3BY8 A;  3PXP A;  3W2Z A;  3EOI A;  3KSF A;  1MKM A;  3LI8 A;  4PKY A;  3UMD A;  2XRO A;  4Z1W A;  5LBR A;  5HZH A;  2Z6C A;  5HWV A;  2PYP A;  2W3F A;  3B33 A;  1H8M A;  3MQ0 A;  5HPI A;  4ME4 A;  2W27 A;  4OOL A;  3IBJ A;  4IUK A;  1S66 L;  4I3J A;  3GEC A;  3VE4 A;  3T50 A;  2OAQ 1;  4UEY A;  4BJP A;  3KSH A;  4GS9 A;  4I5S A;  4I3I A;  3IBR A;  1GSV A;  1XJ3 A;  2YKF A;  3BY9 A;  1LT0 A;  2O0Y A;  2V1A A;  5F6A A;  3TRC A;  4ZRR A;  1N9L A;  2PHY A;  2Z6D A;  4BBU A;  5A8B A;  2PDR A;  3K3D A;  4NEE D;  4DJ2 A;  4WN5 A;  3NOT C;  2OOL A;  2PR6 A;  1ODV A;  3HCY A;  2OWH A;  3IS2 B;  3PBN A;  4HJ4 A;  1TD5 A;  3FG8 A;  1DP9 A;  2FH5 A;  2Y79 A;  2EA9 A;  3K3C A;  3LIA A;  2NUP C;  3LIE A;  2O9B A;  5J7E A;  2PD8 A;  3MR0 A;  4CQH A;  1ZHH B;  4G3K A;  2M7U A;  5AVF A;  3H7W B;  2GX5 A;  1TS8 A;  2KLI A;  3BJN A;  5HDC A;  2O9C A;  1OT6 A;  3LUQ A;  4LRZ E;  3T4J A;  3A0R A;  3ZQ5 A;  3OCL A;  2ZMF A;  5HL6 A;  4LLO B;  4JGR A;  3PHY A;  4HQA A;  2J3T C;  3PBT A;  1T1C A;  3B47 A;  2I9V A;  5IS1 A;  3MJQ A;  2KX6 A;  4Y5F A;  3FPW A;  3S7O A;  4FOF A;  4BBV A;  5G4Z A;  1T1B A;  4NXE A;  4JGQ A;  4HP9 A;  2ZBB A;  1S67 L;  2P08 A;  3ZYT A;  2L0W A;  4R6L A;  3UB8 A;  2VV8 A;  4CLC D;  3UE6 A;  4ARZ A;  1XFN A;  3CUE C;  2W1R A;  2XRN A;  4NKP A;  2W3G A;  3H9W A;  3T4S A;  3LFV A;  2V1B A;  3SW1 A;  3LID A;  4ETX A;  3EGX C;  2P7J A;  2IA2 A;  3NOU C;  3BW6 A;  3JVU A;  4LRX C;  4QPR A;  1STZ A;  3E4O A;  3A0S A;  1LSX A;  2QHK A;  2P04 A;  3CWF A;  3KYZ A;  1OTA A;  2VGL M;  1DP8 A;  3MFX A;  1P97 A;  2PR5 A;  4HHD A;  1OTB A;  2D02 A;  4UQI S;  2GZA A;  2VV7 A;  4R38 A;  1VHM A;  5K5B A;  4P6Z M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...