1D06A

Structural basis of dimerization and sensory mechanisms of oxygen-sensing domain of rhizobium meliloti fixl determined at 1.4a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
GSHMLETEDVVRARDAHLRSILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sensory mechanism of oxygen sensor FixL from Rhizobium meliloti: crystallographic, mutagenesis and resonance Raman spectroscopic studies
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
molecule keywords nitrogen fixation regulatory protein fixL
total genus 38
structure length 130
sequence length 130
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d06A00
5IS1A 1BYWA 5F68A 5F6AA 2BASA 2VV8A 3IS2B 3IS2A 4HP4A 1OTDA 3LIDA 2L1MA 4MN5A 3BWLA 4BBTA 4EXOA 3F1PA 3BY8A 3LI8A 4GHIB 3LIBA 1ODVA 3VOLA 3F1NB 2JHEA 5HWWA 1UGUA 2QJ7A 3F1NA 4R6LA 3MXQA 4WL9A 1LL8A 4EW7A 3RTYA 4EETB 4K08A 4JGOA 2QWSA 1P97A 3C8CA 3K3DA 5F5YA 5J3WA 4F3LB 4KQDA 4F3LA 3GDIA 3CLOA 1LT0A 1T1CA 3RH8B 2L4RA 2J80A 1D06A 2QHKA 2ZOHA 4XT2A 3UB7A 4NXGA 1D7EA 2H28A 3ZQ5A 4WF0A 3BY9A 4LRYC 2A24B 1XJ2A 2ZBBA 3EWKA 1UWPX 1DP8A 3A0RA 2V0WA 5DKLA 1G28A 4HH2A 3C2WA 3P7NA 1V9ZA 1T1AA 4L9EA 1OTAA 2V1AA 3SW1A 5AVEA 2M1CA 2PR6A 5F69A 3G6OA 5HD3A 2Z6DA 3MFXA 5HWVA 2R78A 1P0ZA 5J4EA 3NOTC 4HOIA 1T19A 2PYRA 2JN7A 4L9GA 2OWHA 5HDSA 5DKKA 2D01A 1XFNA 1F9IA 2KDKA 1S4RA 3A0VA 3H82B 4H6JB 5EFWA 1GSWA 2B02A 1N9OA 5TBMB 1X0OA 4JGPA 1TS0A 3HJIA 2VV7A 2V1BA 2W0NA 3IBRA 3MJQA 3ULFA 3MQQA 4HY8A 1S1ZA 4MN6A 3UB9A 1S4SA 4NXFA 4WN5A 3NHQA 1S67L 5DJUA 5G4ZA 4BBUA 2P7JA 2WKQA 4E04A 4NXBA 2W27A 4I5SA 5HDCA 5AVFA 4GW9A 1OJ5A 4WUJA 1Y28A 3LICA 4R70A 3VE3A 3OLOA 1VB6A 1DP6A 1DRMA 5HDDA 5I5LA 4EERA 1XJ6A 1OT6A 3F1OA 4RQ9A 2PDRA 1OTBA 4B9OA 5KIZA 2YKFA 3T50A 1V9YA 4HQAA 2I9VA 3K3CA 1GSVA 2PYPA 2VV6A 1F98A 2KX6A 1GSXA 1LSVA 4LLOB 5HD5A 3UE6A 2K7SA 5HSQA 1LSXA 4HI4A 1JNUA 2WKRA 3H9WA 2D02A 1OTIA 1OJGA 3A0SA 2PD8A 3H7WB 4HHDA 4HP9A 3CWFA 3UMDA 4GS9B 1DP9A 1XJ3A 3NOPC 1OT9A 2Z6CA 4HIAA 4GS9A 5J7EA 3VE4A 4R38A 1TS7A 2OWJA 1NWZA 3LYXA 3NJAA 4I3AA 1T1BA 4HNBA 3KX0X 2INWA 3FG8A 1TS8A 4H6JA 1OTEA 4GHIA 4HH3A 3CAXA 3H82A 4I3IA 3LI9A 4KUKA 4PKYA 3UB6A 4KUOA 2QKPA 4EEUA 3UMEA 3F1OB 3H7WA 5TBMA 3LIAA 5A8BA 4LRXC 3EEHA 3GECA 3ICYA 3MR0A 1MZUA 1WA9A 3FC7A 4HJ4A 3NOUC 4I3JA 5G4YA 3PHYA 2L0WA 2VEAA 2HV1A 1LSWA 2WKPA 4NXEA 4R3AA 4WLAA 4BBVA 4EESA 1XFQA 3LIFA 3UB8A 4PKYG 5HWTA 4DJ3A 2ZOIA 1T18A 4DJ2A 5DJTA 1TS6A 4L9FA 4EQ1A 1EW0A 2YKHA 4XT2B 3PYPA 2GJ3A 2V9AA 3LIEA 5IU1A 3LUQA 5HZHA 4JGQA 4JGRA 2PD7A 2EA9A 2QJ5A 1N9NA 4I38A 3MQOA 4LPZA 1UWNX 1KOUA 2PHYA 1XJ4A 2A24A 2CMNA 3E4QA 3E4PA 2OOLA 4GCZA 4HJ3A 2V0UA 4HJ6A 4I39A 1S66L 3D72A 3B33A 1N9LA 4M4XA 3HJKA 3E4OA 2VLGA 2PR5A 4LRZE 4YWZA 1S1YA 4EEPA 3F1PB
chains in the Genus database with same CATH superfamily
3U2AA 1QMFA 3IS2B 4MN5A 3OPPA 2J3TC 2HP9A 4P85A 2J3WA 2JHEA 2VA0A 4K0XA 5FSRA 5FQQA 1PWDA 3Q07A 4LCLA 4MEZA 4JPMA 2DRWA 1LLBA 1F2KA 3G2YA 1FIKA 3G2ZA 3LEZA 1YLZA 3NY4A 2JKGA 1FR6A 2FH5A 5DTKA 3W4OA 2H0YA 3E2KA 1S4RA 4MMNA 4H6JB 1GSWA 5TBMB 1ERQA 4BENA 2V1BA 4BBVA 5FL3A 3UB9A 1VEUB 3DWKA 4WN5A 2WADA 1K4FA 3U4LP 4P6ZM 1KE4A 1XJ6A 3G32A 3NULA 2LB9A 4OPYA 5AQ9A 4E6XA 2WYXA 3RJUA 2Z6CA 1S6RA 4JKTA 1TS7A 4WZ4A 1PNEA 3FYZA 3QHYA 3FG8A 3QP2A 3UB6A 3LI9A 4OQIA 5L09A 2X71A 3MSHA 2WGVA 2BTFP 3P98A 3AGDA 3Q1FA 2HP6A 3D72A 1N9LA 3BFDA 2XD5A 4EBPA 5E2GA 3VSKA 3BY8A 1F5MA 4EW7A 3OOVA 4K08A 3T4LA 1FQGA 4IUKA 4KENB 3A0RA 1HD8A 1PI5A 4HH2A 4L9EA 3BQ8A 4ZJ3A 5EVIA 3IHBA 1SHVA 4GD8A 4L9GA 2ZL1B 3PBRA 3LR4A 3JVUA 4HBTA 2PRFA 5HAPA 3Q81A 5CECA 1N9OA 2G2WA 4KG5A 4UA7A 1ZHHB 5A91A 4BBUA 4OOLA 4OQ0A 3HLDA 4R70A 3LCEA 3WS1A 3IXDA 3T4OA 2P04A 5HX9A 3QNBA 5DTSA 3S7OA 1FCOA 2W3FA 3GVBA 2Y2KA 2ZMVA 3B42A 5TJJA 1YLYA 2DMWA 3LFVA 3VOZA 4O0PA 3KX0X 5IT5A 2NUPC 3P09A 3MFDA 3WS2A 5BOHA 4I3IA 3C5AA 3FZCA 3S7NA 4B4XA 1I2SA 3SOIA 2ZQ7A 4HJ4A 1WA9A 4DF6A 4CLCE 3E2LA 3GR2A 1DJCA 1BT5A 1BLCA 3V5MA 2PBDP 2GZAA 1PZOA 2EA9A 2HF6A 4EU0A 1PI4A 1S66L 4GDBA 4X1LA 2BASA 2JC7A 4EXOA 3ZVWA 1ZC2A 1PFLA 4S2MA 4X1MA 4F3LA 2B95A 3RH8B 3EGDC 4KZBA 5DFYA 3V3SA 1ERMA 4YFMA 5F69A 1H0MA 2R78A 2JN7A 5DKKA 4IEDA 1CK3A 1TS0A 4WBGA 1TD5A 1S67L 5EECA 4IHQA 3VFHA 4S2NC 2Y2MA 1FR1A 1OT6A 3BLMA 1OTBA 3T1SA 4JF6A 1NRJA 5HD5A 4R23A 3OCLA 2Y2IA 4QU3A 1LSXA 4RA7A 2HJ9C 1VETB 3CWFA 4O01A 5E43A 1CEFA 4X55A 2E8JA 1MPLA 4H6JA 4Y15A 4HH3A 1D1JA 5GLCA 1JTGA 3H7WA 3KO6A 3NBLA 3TSGA 5A8BA 3NOUC 4MBKA 2L0WA 3JVVA 2G2UA 2HV1A 2ZC3B 1J9MA 3E98A 4BD1A 1TS6A 3N4IA 5HAIA 3G35A 1KVLA 4KZ5A 1YAXA 1EROA 2XD1A 4UQIS 1XX2A 1ALQA 4GCZA 3WWXA 4LRZE 1FILA 2Q9MA 3ZNTA 1H3QA 5G18A 3HLFA 3F1NB 3FKWA 4K0WA 1NYYA 2VGKA 3N7WA 4PPRA 3CLOA 3UDXA 3HL9A 3WRZA 3O5YA 4NXGA 1KE0A 2ZC7A 3NDEA 5E2HA 1KE3A 1NY0A 3P7NA 2ZLYA 1T1AA 4ZDXA 2Z6DA 3CITA 4WMCA 1HVBA 3Q7ZA 4OOMA 4R4SA 1H8MA 1CF0A 3MQQA 5J8XA 4ARZB 5DJUA 3LEQA 1GCEA 3IXGA 5FI7A 2WKQA 2CC1A 5HDCA 4GJ4A 4WUJA 3OLOA 5KSHA 3T4SA 3HBRA 2AVXA 4PM7A 4OPZA 4HI4A 3HLCA 3R7WB 1JNUA 1OJGA 3RFBA 3V3RA 1HTZA 3MZEA 2UV0E 1TS8A 3NCKA 5A90A 4PHTA 3WRTA 4X69A 3P01A 5EPHA 3LIFA 1S0WA 2ZQAA 5HWTA 1NZOA 4NETA 2XH9A 2BG1A 1BLHA 1GHIA 4QJGA 5F1FA 3MQOA 4MNRA 4KQQA 2A3UA 3E4PA 5EOEA 3BECA 3IXHA 4HESA 4WEJA 3DWZA 2P74A 3F1PA 4K91A 1LI0A 5F83A 3PR6A 4WL9A 4DXBA 1FCMA 2XRNA 4CLCB 3UB7A 5GLBA 3ZFZA 1XJ2A 5DF7A 2WK0A 3N8LA 2XGNA 2Y2OA 5FAPA 1WYCA 3UY6A 3BW6A 1CI9A 4G3KA 2OWHA 2ZQ9A 2GNXA 3ITBA 3ZG0A 1F9IA 4N9LA 1H8ZA 4ESPA 1MBLA 1XGIA 4Z1WA 2IWDA 2P7JA 4JXGA 2HPBA 3NC8A 4GOGA 4OP8A 3VE3A 1DP6A 3M2KA 4S2JA 2Y2GA 3DAVA 4RQ9A 4B9OA 3FPWA 3K3CA 4E3JA 4UQIM 2P9VB 3T1QB 3ZGAB 3ZG5A 2EXAA 3IHAA 4JF5A 1NWZA 2A49A 3O87A 5GL9A 3KYZA 2EWWA 4KZ4A 2EWVA 1OTEA 4DE1A 4EUZA 1LL5A 2OLUA 3ZG8B 1RP5A 2Y2NA 1WYBA 5L10A 3L9KA 4LRXC 3GECA 3FC7A 3IT9A 4NKPA 1BTLA 2WKPA 5KZHA 3ZNYA 4CLCA 5HL1A 2M7VA 1A0KA 2Y91A 2J3TD 4HBUA 5TFQA 3UO9A 2ZM0A 5F6AA 2QMIA 4IBXA 4P6BA 1NJ4A 5IHVA 2Y2PA 1BLPA 5F5YA 1Q2PA 3VP4A 4UAAA 2PU2A 3V50A 2X02A 3PBTA 1U60A 1E3UA 3S7PA 4LCMA 2X01A 4ZRRA 1G28A 4QWOA 1V9ZA 5MC7A 2Y8HA 5CGXA 2E8IA 3G6OA 3Q82A 1HZOA 4PMAA 3T12B 4ZAMA 3C4PA 2QZ6A 3IX8A 2XROA 1LI9A 3H82B 2HDRA 2B02A 2WUQA 3VOYA 3IBRA 1XXMA 5A92A 2Y2HA 4B88A 4D60A 3IX3A 1L3LA 5CHJA 1IKGA 1VB6A 3BFEA 2O0YA 2PYPA 4LENA 1PWGA 4Q8IA 1MKIA 1MXOA 2FFYA 4PM9A 4OQHA 3LY3A 2J7VA 4LGWA 4X56A 3UNWA 3A3DA 3SH9A 4ID4A 2OLVA 3C7UA 1KVMA 3H82A 4EEUA 3C30A 5HFOA 1VEUA 4DE3A 4S2LA 2R9WA 5FDHA 2VEAA 3BQAA 4NXEA 3WS4A 1Q2QA 4DJ3A 1E3UD 4WYYA 3CJMA 5IU1A 2V9AA 3VFFA 4ETXA 4Y2FA 1GHPA 4EBLA 4I39A 2OAQ1 5EVIB 5DFXA 1JVJA 4O8GA 4OQGA 2PT7A 4LV2A 4N1XA 4Y3IA 1RGZA 1K6RA 3K3DA 1K54A 3VP3A 3ISGA 1DY6A 2UWXA 4C75A 3LGOA 2JBFA 4KQOA 4JF4A 1LHYA 1FOFA 3G4PA 4C6YA 1MC0A 5JYOA 4WMCD 3PBOA 2KDKA 2B5RA 1S1ZA 3NECA 5FATA 3TE8A 3KSHA 2W27A 1ZTUA 4ME4A 4M3KA 3W8KA 3DTKA 3DTMA 2ZM8A 1WE4A 2Y59A 1JWZA 3NI9A 1H5XA 1GSVA 2VV6A 4KZ8A 1F98A 4Y0UA 5CERA 5CRFA 3GV9A 2O99A 5HSQA 3A0SA 2O9AA 4BLMA 4DKIA 1SDEA 1G68A 3LR3A 1MWTA 1HLUP 4NK3A 2EXBA 1TVFA 1ES2A 3MXSA 3DW0A 1O7EA 4IVKA 5CTNA 5G4YA 2HDUA 4R1GA 4PKYG 4QD4A 4EQ1A 1EW0A 3IWQA 3QP6A 2J9PA 4ARZA 2EX6A 3GTCA 3E4OA 2JKTM 3A3IA 3CPTA 4GHIA 5GHXA 1BYWA 2ZQ8A 3FV7A 4WELA 3VP0A 2L1MA 3VOLA 4RX3A 2ZM2A 5EE8A 4KQDA 4PM5A 2EFUA 2J80A 2QHKA 3OPLA 2HJEA 3EWKA 5DKLA 4II7A 2Y2QA 4E3IA 3CHWP 3LR5A 5FQIA 4UA6A 4OH0A 4OLDA 2XF3A 2W3HA 3MJQA 4E04A 3M6HA 3MKFA 3SS3A 3OCNA 4BL2A 3IF6A 1TDGA 2Q9NA 3R7WA 3F1OA 3ZHHA 3UDFA 3ULFA 4X6TA 4LLOB 2KX6A 4MDZA 1GSXA 5FA7A 2QPNA 3SZTA 3MF0A 2R9XA 1OT9A 4HIAA 3HLGA 4YOFA 3EGXC 4YNRA 1IKIA 2WGWA 3CZDA 3LIAA 2PU4A 1W8QA 2P9VA 3QNCA 4Y5FA 4JXWA 2XA7S 4R3AA 4WLAA 2H0TA 5M18A 2V20A 5FQMA 5I94A 2K31A 3LIEA 4RYEA 3CUEA 4S2KA 2PHYA 4U0XA 4EEPA 5FQJA 2JCHA 2VV8A 4HP4A 1ODVA 1CJFA 3SS4A 2ZD8A 4JXSA 2QJ7A 3MKEA 1VM1A 5J3WA 4DE0A 1KGEA 5GLDA 4P87A 1T1CA 2ZOHA 1CI8A 2ZQCA 3TG9A 3IXBA 4PAUA 3MMHA 1SDNA 4OLGA 2PR6A 4EUVA 3BFGA 3EQVA 3D9YA 2WZZA 3A0VA 2IWBA 5DTTA 2VGJA 1SZVA 1O07A 2WGIA 1X0OA 1FSWA 3HJIA 4RVAA 3VMAA 4S2PA 5CX7A 1TEMA 4EBNA 1NXYA 2WAEA 4MN7A 1K55C 5FI6A 4EERA 1ONGA 1K57A 1L2SA 4BL3A 1V9YA 4P6ZS 4HQAA 3PAGA 5M19A 4CLCC 2MJ6A 1IYPA 2XQZA 5F1GA 2Y79A 4OVDA 3UPPA 2W1RA 1DJAA 1M40A 4UA9A 4OONA 3T4KA 4WZ5A 2LB5A 2W1TA 3W4QA 4KUOA 1YSQA 1YLTA 3KSGA 3HLWA 3EEHA 3MR0A 4IJGA 3G34A 5DVAA 3ZDJA 4FTXA 2GJ3A 2WKIA 3ZVTA 4I38A 2XEPA 4Q0IA 3WS0A 3I7JA 2WKHA 4H8RA 4R0QA 4DMZA 3S22A 4UEYA 3FKVA 4M4XA 2V8FA 5TR7A 5HZHA 1ZG6A 1SKOA 5HWWA 4WZ5C 3F1NA 4GNUA 1GHMA 4DE2A 3BEBA 1LT0A 1L0FA 3UPNA 2L4RA 1G6OA 1NRFA 3Q7VB 3T4JA 3FPVA 1UWPX 1DP8A 4A5RA 1ES5A 4FOFA 1IELA 2C6WB 4GZBA 2XK1A 3PBQA 2V1ZA 4EWFA 3BJNA 5HDSA 2V2FF 4OPRA 3IF5A 1XFNA 4FUWA 5HPFA 1FSYA 3SS5A 1K6SA 1YQSA 3T4QA 3UPOA 3CMZA 4NXFA 1W63M 5TGFA 1H8YA 3SH7A 4GW9A 4X53A 1P9RA 1BULA 1YSPA 2YKFA 1IOUA 2I72A 2ZC5B 3ZG9B 2K7SA 4DRTA 3H7WB 5FEFA 1PRQA 4HP9A 3HUMA 4GS9B 4Y13A 4R38A 4FCFA 4Y17A 3OPHA 1L0GA 3F1OB 1J3WA 2VK3A 3BFFA 3W2ZA 1I5QA 2VGLM 5AJGA 4NG2A 1XP4A 4LPZA 1XJ4A 1IYQA 1IYOA 3HUOA 4FH2A 2VLGA 1K0KA 4KZ6A 4OPQA 5CEBA 4GD6A 4R6LA 1LL8A 5U47A 4JGOA 1P97A 4QY5A 1AWIA 1L0DA 3C4OA 3GDIA 5HAQA 3BLSA 1K4EA 3ZG7B 2ZBBA 1K56D 5A93A 3B47A 2Y2LA 3T4TA 5EVLA 5EM1A 1P0ZA 3NOTC 1VQQA 4Y7PA 2EFXA 2H10A 5EV0A 3TRCA 5GHZA 2W3DA 2HDQA 2W3EA 5AQAA 3R4KA 1K38A 2HP5A 2GDNA 3M6BA 5D3OA 5L8MA 4KG6A 5HDDA 5I5LA 5EOOA 5C5KA 5KIZA 3T50A 1W79A 5KSCA 1LSVA 1W5DA 3HVFA 5CGWA 4HEFA 3PTEA 4E3OA 4EQIA 1YLPA 2ZC4B 3KYEA 3BYDA 1PIOA 4ZJ1A 3LYXA 1MWSA 4I3AA 1NYMA 2GX5A 1PYYA 3PAEA 4PKYA 1KGFA 4PM6A 2JKFA 1ONHA 4R4RA 5CHUA 2J9OA 4ETZA 4IBRA 1MY8A 1XGJA 3UE1A 5DJTA 3PYPA 2WKEA 2ZQDA 1YM1A 4JGRA 2QJ5A 1FCNA 1UWNX 2JE5A 3ITAA 1PW1A 2IA2A 4S2NA 2IWCA 3HJKA 3KSFA 1S1YA 3GMWA 3DTEA 3RXWA 4N1HA 3E0YA 3IS2A 2JKRM 5EVEA 4XUXA 4X68A 1W63Q 4DDYA 1UGUA 2H5SA 4GB7A 1I2WA 4EETB 1SCWA 4Y0OA 3ZQ5A 1D7EA 2H28A 4LRYC 3JYIA 4AFIA 2Y2JA 3MS6A 4Y0TA 2V0WA 4D2OA 3MXRA 4BQMA 3SW1A 3OBFA 5HWVA 1CEGA 1SKOB 5J4EA 4NEED 5CHMA 4O7DA 3HLBA 3CPTB 1IYSA 5GLAA 1BUEA 5L07A 2EX2A 2XFTA 2QYBA 4I5SA 4XUZA 1EI5A 4LV0A 2KLIA 3DBAA 5AQ7A 1OMEA 2ZMAA 4GN2A 5HL6A 5EVIC 1XJ3A 4OOYA 2W1TB 1ESUA 1K54C 3N6IA 2G7UA 3CUEC 2Y4AA 3MZFA 4B93A 2A2LA 3T1RA 3OC2A 4GDNA 1XKZA 4EESA 3GSGA 3B3XA 3NDGA 3A3EA 4DJ2A 4FD8A 2EX8A 4MCWA 2PD7A 1XPBA 2CMNA 3E4QA 2V0UA 3IWIA 5TBMA 2PR5A 5IS1A 3K2NA 3LIDA 4N9KA 4BBTA 4C3QA 4GHIB 2PBYA 3PBSA 3MXQA 5L2FA 4FH4A 4Q0HA 2QWSA 3S4XA 5CEDA 1D06A 4XT2A 3IF6C 3BY9A 4N92A 3G30A 2Y55A 3L7HA 4G3VA 4E6WA 1JTDA 2XR0A 1OTAA 3IH8A 4QY6A 1T19A 5CTMA 3BM6A 2O9BA 4G3WA 5EFWA 2FZ0A 3MQ0A 4JGPA 4LV1A 2VV7A 4KZ7A 5GHYA 1IFQA 4NXBA 3LICA 2M7UA 3S7QA 4DDSA 1K56A 1AXBA 4ZTKA 2C5WB 2W3GA 2I9VA 3AGEA 3O86A 3UE6A 4F94A 3O3VA 3HLEA 4ZJ2A 3H9WA 2WKRA 3QP4A 2WGWB 3UMDA 4E3NA 1TDLA 1VETA 3TW8A 4BMWA 4E3MA 1W8YA 5EVID 3MBZA 3QP8A 2Z2LB 1Y54A 4I3JA 1ZKJA 5LBRA 3TJZC 4IVIA 4CJNA 3W4PA 3CI6A 1STZA 1YMXA 4R3BA 4RX2A 1N9BA 1IEMA 1G5UA 2OOLA 2XFSA 3B33A 4U3TA 3IWOA 1EWZA 1VHMA 3PXPA 4X25A 3A3JA 2P08A 3BFCA 3IBJA 3VP1A 3C38A 3RTYA 1M6KA 4F3LB 5JYPA 3O88A 1P9WA 4E3KA 4WF0A 1QMEA 3M2JA 5EUAA 3IQAA 3C2WA 3PBNA 3C7VA 3VP2A 5AVEA 5E2EA 2EX9A 3MFXA 1KGGA 2J8YA 4MBFA 2D01A 2RCXA 2Z2MB 1YPRA 4XXRA 1KDSA 5HPIA 3DTIA 3HCYA 1JWPA 3ZYTA 4MN6A 1RCJA 5F82A 5HARA 1MWUA 4KZ9A 5G4ZA 4LV3A 4CLCD 5FEGA 1Y28A 3BRMA 4S2IA 3VSLA 3EEAA 1KDWA 3VV4A 3A3FA 1Z6FA 1ES4A 1PWCA 4CPKA 3N8RA 2RL3A 4OP5A 3IX4A 2VGLS 3NOPC 5J7EA 3VE4A 2NUTC 4Z9QA 1T1BA 4CQHA 5FAQA 4DN0A 3CAXA 1OPXA 1YMSA 4FSFA 4WEKA 3UMEA 3T1XA 5FQKA 3UB8A 5CXWA 1BSGA 5FQ9A 2YKHA 3EQUA 2ZL1A 2A24A 3OPRA 4HJ6A 4HJ3A 1PW8A 4YWZA 2W0NA 1ZG4A 4KG2A 1OTDA 4WM9A 3BWLA 2HZ5A 3LI8A 3Q7VA 1N4OA 2VX8A 1ACFA 2ZC6B 1BZAA 5E2FA 3C8CA 1Z09A 2WAFA 2DNSA 4GLQA 3KYQA 1YT4A 1K57C 2OSUA 2A24B 1YLWA 1K55A 5M1AA 3HREA 3HUNA 2B18A 4KZAA 2HDSA 4GKUA 2V1AA 1XA7A 2M1CA 3LY4A 5FDSA 4ZBEA 1GA9A 2JKRI 2OV5A 1C3BA 4HY8A 1S4SA 3LO7A 1ESIA 3NHQA 4JXVA 1NLZA 1OJ5A 1L0EA 1DRMA 2ZMFA 2DCFA 2V8CA 4UHUA 4PM8A 2ACGA 1OTIA 1W7FA 4Q0JA 1DP9A 3NIAA 1MKMA 1NZUA 4MBHA 4JBFA 2WZXA 3AGFA 5K5BA 5DF8A 1K25A 2VZWA 1E25A 3FWLA 1GA0A 3UN7A 5FAOA 3ICYA 3V39A 1RGYA 5DF9A 1Y4OA 3PHYA 1ES3A 3WS5A 4QPRA 1XFQA 2ZOIA 1T18A 4XT2B 2BLSA 3LUQA 4U0TA 2Q0OA 4JGQA 1N9NA 4BD0A 1KOUA 3UDIA 4YINA 3V67A 4MLLA 3ZCZA 3F1PB 3G31A 5F68A 2JKTI 1LL9A 1DJBA 3LIBA 3MZDA 1TF1A 2K2NA 3LR0A 4OKPA 5HW3A 5FI2A 1PZPA 4EV4A 5CGSA 3EOIA 4P0MA 4KQRA 3SH8A 4S2OA 2O9CA 4LFUA 3S1YA 3UE3A 5HD3A 2XSSA 2VKSA 1MWRA 4DXCA 4HOIA 2PYRA 4IUHA 2VJWA 3D4FA 4QHCA 3UB5P 4BWIA 1BLSA 3N8SA 3TOIA 5FASA 5EM0A 4B4ZA 5AVFA 1NLYA 4R3JA 1YLJA 3CG5A 2PDRA 3QP5A 2OAP1 4BJPA 2HGVA 4L0LA 3D3OA 3RXXA 4HHDA 2D02A 2PD8A 1XA1A 3KSIA 3GQZA 4GS9A 3IH9A 2OWJA 2XDMA 4E3LA 2XA7M 1JWVA 3JPUA 3NJAA 1E4DA 4HNBA 2INWA 1YKDA 5KMWA 1CQAA 4KUKA 2QKPA 4JLFA 3IF6B 1MZUA 2XLNA 2ZJ9A 1LSWA 3QP1A 5AQBA 4KZ3A 4L9FA 1SKFA 4QB8A 3UE0A 3OZHA 3GRJA 2FFFB 2PAVP 1G6AA 2KOIA
chains in the Genus database with same CATH topology
5IS1A 3U2AA 2VV8A 3IS2B 4HP4A 3K2NA 3LIDA 4MN5A 4BBTA 2J3TC 3F1PA 4GHIB 2J3WA 1ODVA 2JHEA 3PR6A 2QJ7A 2VA0A 3PBSA 3MXQA 4WL9A 4Q0HA 2QWSA 5J3WA 2XRNA 1T1CA 4CLCB 2ZOHA 3UB7A 1D06A 4XT2A 3BY9A 1XJ2A 4G3VA 4PAUA 3MMHA 1OTAA 2PR6A 4EUVA 3BW6A 1T19A 4G3KA 2FH5A 2OWHA 3EQVA 2GNXA 3A0VA 1F9IA 1S4RA 2O9BA 4G3WA 4MMNA 4H6JB 5EFWA 1GSWA 5TBMB 2FZ0A 1X0OA 3MQ0A 3HJIA 4JGPA 2VV7A 2V1BA 4BBVA 5FL3A 3UB9A 5CX7A 4WN5A 1IFQA 4Z1WA 2P7JA 4NXBA 3LICA 4MN7A 4P6ZM 3VE3A 2M7UA 1DP6A 3S7QA 4EERA 1XJ6A 4RQ9A 4B9OA 1V9YA 3FPWA 4HQAA 4P6ZS 2W3GA 2I9VA 2LB9A 3K3CA 4CLCC 3UE6A 2MJ6A 4UQIM 3H9WA 2WKRA 2Y79A 3UMDA 2W1RA 2Z6CA 1TS7A 1NWZA 3TW8A 4BMWA 3T4KA 3FG8A 3KYZA 2EWWA 2EWVA 1OTEA 2LB5A 2W1TA 3UB6A 3LI9A 4KUOA 1YSQA 3KSGA 4LRXC 3EEHA 3GECA 3MR0A 3FC7A 4I3JA 4IJGA 4NKPA 5LBRA 2WKPA 3TJZC 3CI6A 1STZA 4CLCA 2GJ3A 2M7VA 4I38A 4Q0IA 2J3TD 4DMZA 2OOLA 4UEYA 3D72A 3B33A 1N9LA 4M4XA 1VHMA 3PXPA 5F6AA 5HZHA 2P08A 3BY8A 1F5MA 5HWWA 3F1NA 3IBJA 4EW7A 3C38A 3OOVA 3RTYA 4K08A 4F3LB 5F5YA 3T4LA 4IUKA 1P9WA 1LT0A 2L4RA 3PBTA 4WF0A 1G6OA 3T4JA 3FPVA 1UWPX 1DP8A 3A0RA 3S7PA 4FOFA 4ZRRA 1G28A 4HH2A 3C2WA 1V9ZA 3PBNA 3BQ8A 4L9EA 2Y8HA 5MC7A 5AVEA 3G6OA 3MFXA 3PBQA 3BJNA 4L9GA 5HDSA 3PBRA 3LR4A 2D01A 3JVUA 1XFNA 5HPFA 2XROA 3H82B 2B02A 1N9OA 3T4QA 5HPIA 3IBRA 3HCYA 3ZYTA 4MN6A 4NXFA 1ZHHB 5G4ZA 4BBUA 4OOLA 4CLCD 1W63M 4GW9A 1Y28A 4R70A 1VB6A 3EEAA 1P9RA 1YSPA 3VV4A 3T4OA 2YKFA 2O0YA 2P04A 1IOUA 2PYPA 3S7OA 2K7SA 2W3FA 3H7WB 2ZMVA 4HP9A 2VGLS 3B42A 4GS9B 3NOPC 5TJJA 5J7EA 3VE4A 2DMWA 4R38A 2NUTC 3LFVA 1T1BA 4CQHA 4O0PA 3KX0X 5IT5A 2NUPC 4DN0A 3CAXA 1OPXA 3H82A 4I3IA 4FSFA 4EEUA 4WEKA 3S7NA 3UMEA 3C30A 3F1OB 4HJ4A 1WA9A 4CLCE 2VEAA 3BQAA 4NXEA 3UB8A 3W2ZA 4DJ3A 2VGLM 2GZAA 2YKHA 5IU1A 2V9AA 5AJGA 2EA9A 2HF6A 4LPZA 4EU0A 3EQUA 4ETXA 4Y2FA 1XJ4A 2A24A 4HJ6A 4HJ3A 4I39A 1S66L 2OAQ1 4YWZA 2VLGA 2W0NA 5DFXA 4O8GA 2BASA 4EXOA 1OTDA 3BWLA 3LI8A 2PT7A 2VX8A 4R6LA 1LL8A 4Y3IA 4JGOA 1P97A 3C8CA 3K3DA 4F3LA 3GDIA 4GLQA 3KYQA 3RH8B 3EGDC 5DFYA 2A24B 2ZBBA 4KQOA 2B18A 3B47A 2V1AA 3T4TA 1MC0A 2M1CA 5F69A 2R78A 1P0ZA 3NOTC 2JN7A 5DKKA 3TRCA 3PBOA 2KDKA 2W3DA 2JKRI 2W3EA 1TS0A 4HY8A 1S1ZA 1S4SA 1TD5A 3R4KA 3NHQA 1S67L 3TE8A 3KSHA 2W27A 5L8MA 1ZTUA 4IHQA 4ME4A 1NLZA 1OJ5A 1DRMA 5HDDA 5I5LA 5C5KA 1OT6A 2ZMFA 5KIZA 1OTBA 3T50A 1GSVA 1NRJA 2VV6A 1F98A 5HD5A 1LSVA 3OCLA 2O99A 5HSQA 1LSXA 2HJ9C 1OTIA 3A0SA 2O9AA 3CWFA 4O01A 4Q0JA 1DP9A 1MKMA 3LYXA 4I3AA 2GX5A 3LR3A 4H6JA 4PKYA 4HH3A 5K5BA 3H7WA 2VZWA 3KO6A 5A8BA 3ICYA 4ETZA 3NOUC 5G4YA 5DF9A 3PHYA 2L0WA 3JVVA 2HV1A 4QPRA 1XFQA 3E98A 4PKYG 2ZOIA 1T18A 5DJTA 1TS6A 4EQ1A 1EW0A 4XT2B 3PYPA 3LUQA 1YAXA 4JGQA 4JGRA 2QJ5A 1N9NA 4UQIS 4ARZA 1UWNX 1KOUA 4GCZA 3V67A 2IA2A 3KSFA 3HJKA 3E4OA 4LRZE 2JKTM 1S1YA 3F1PB 4GHIA 1BYWA 4WELA 2JKTI 5F68A 3E0YA 3IS2A 2L1MA 1H3QA 2JKRM 3LIBA 3VOLA 1W63Q 3F1NB 1TF1A 1UGUA 2K2NA 3LR0A 4EETB 4KQDA 3CLOA 2J80A 2QHKA 3O5YA 3ZQ5A 4NXGA 1D7EA 2H28A 3EOIA 4LRYC 4AFIA 2HJEA 3EWKA 2V0WA 5DKLA 3P7NA 2O9CA 1T1AA 4II7A 3UE3A 3SW1A 3OBFA 5HWVA 5HD3A 2Z6DA 2XSSA 3CITA 2VKSA 5J4EA 4HOIA 2PYRA 4NEED 3LR5A 4IUHA 2VJWA 4BWIA 4OOMA 1H8MA 2W3HA 3MJQA 3MQQA 4ARZB 5DJUA 4E04A 2WKQA 2QYBA 4I5SA 5HDCA 4GJ4A 3OCNA 1NLYA 5AVFA 4WUJA 3OLOA 2KLIA 3DBAA 3R7WA 3F1OA 3T4SA 5KSHA 2PDRA 2OAP1 4BJPA 2HGVA 3ULFA 4LLOB 2KX6A 4MDZA 1GSXA 4L0LA 3D3OA 4HI4A 3MF0A 1JNUA 4HHDA 3R7WB 2D02A 1OJGA 3RFBA 2PD8A 3KSIA 5HL6A 1XJ3A 1OT9A 2W1TB 4HIAA 4GS9A 2G7UA 2OWJA 4YOFA 2XA7M 3NJAA 3EGXC 4HNBA 2INWA 1YKDA 3CUEC 1TS8A 4KUKA 2QKPA 4YNRA 4PHTA 3LIAA 4B93A 2A2LA 1MZUA 3OC2A 3P01A 4Y5FA 1LSWA 4EESA 2XA7S 4R3AA 4WLAA 3LIFA 5HWTA 4DJ2A 4L9FA 2K31A 3LIEA 4MCWA 2PD7A 3CUEA 3MQOA 2PHYA 2CMNA 3E4QA 3E4PA 2V0UA 5TBMA 4EEPA 2PR5A 4WEJA 2KOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IS1 A;  1BYW A;  5F68 A;  5F6A A;  2BAS A;  2VV8 A;  3IS2 B;  3IS2 A;  4HP4 A;  1OTD A;  3LID A;  2L1M A;  4MN5 A;  3BWL A;  4BBT A;  4EXO A;  3F1P A;  3BY8 A;  3LI8 A;  4GHI B;  3LIB A;  1ODV A;  3VOL A;  3F1N B;  2JHE A;  5HWW A;  1UGU A;  2QJ7 A;  3F1N A;  4R6L A;  3MXQ A;  4WL9 A;  1LL8 A;  4EW7 A;  3RTY A;  4EET B;  4K08 A;  4JGO A;  2QWS A;  1P97 A;  3C8C A;  3K3D A;  5F5Y A;  5J3W A;  4F3L B;  4KQD A;  4F3L A;  3GDI A;  3CLO A;  1LT0 A;  1T1C A;  3RH8 B;  2L4R A;  2J80 A;  1D06 A;  2QHK A;  2ZOH A;  4XT2 A;  3UB7 A;  4NXG A;  1D7E A;  2H28 A;  3ZQ5 A;  4WF0 A;  3BY9 A;  4LRY C;  2A24 B;  1XJ2 A;  2ZBB A;  3EWK A;  1UWP X;  1DP8 A;  3A0R A;  2V0W A;  5DKL A;  1G28 A;  4HH2 A;  3C2W A;  3P7N A;  1V9Z A;  1T1A A;  4L9E A;  1OTA A;  2V1A A;  3SW1 A;  5AVE A;  2M1C A;  2PR6 A;  5F69 A;  3G6O A;  5HD3 A;  2Z6D A;  3MFX A;  5HWV A;  2R78 A;  1P0Z A;  5J4E A;  3NOT C;  4HOI A;  1T19 A;  2PYR A;  2JN7 A;  4L9G A;  2OWH A;  5HDS A;  5DKK A;  2D01 A;  1XFN A;  1F9I A;  2KDK A;  1S4R A;  3A0V A;  3H82 B;  4H6J B;  5EFW A;  1GSW A;  2B02 A;  1N9O A;  5TBM B;  1X0O A;  4JGP A;  1TS0 A;  3HJI A;  2VV7 A;  2V1B A;  2W0N A;  3IBR A;  3MJQ A;  3ULF A;  3MQQ A;  4HY8 A;  1S1Z A;  4MN6 A;  3UB9 A;  1S4S A;  4NXF A;  4WN5 A;  3NHQ A;  1S67 L;  5DJU A;  5G4Z A;  4BBU A;  2P7J A;  2WKQ A;  4E04 A;  4NXB A;  2W27 A;  4I5S A;  5HDC A;  5AVF A;  4GW9 A;  1OJ5 A;  4WUJ A;  1Y28 A;  3LIC A;  4R70 A;  3VE3 A;  3OLO A;  1VB6 A;  1DP6 A;  1DRM A;  5HDD A;  5I5L A;  4EER A;  1XJ6 A;  1OT6 A;  3F1O A;  4RQ9 A;  2PDR A;  1OTB A;  4B9O A;  5KIZ A;  2YKF A;  3T50 A;  1V9Y A;  4HQA A;  2I9V A;  3K3C A;  1GSV A;  2PYP A;  2VV6 A;  1F98 A;  2KX6 A;  1GSX A;  1LSV A;  4LLO B;  5HD5 A;  3UE6 A;  2K7S A;  5HSQ A;  1LSX A;  4HI4 A;  1JNU A;  2WKR A;  3H9W A;  2D02 A;  1OTI A;  1OJG A;  3A0S A;  2PD8 A;  3H7W B;  4HHD A;  4HP9 A;  3CWF A;  3UMD A;  4GS9 B;  1DP9 A;  1XJ3 A;  3NOP C;  1OT9 A;  2Z6C A;  4HIA A;  4GS9 A;  5J7E A;  3VE4 A;  4R38 A;  1TS7 A;  2OWJ A;  1NWZ A;  3LYX A;  3NJA A;  4I3A A;  1T1B A;  4HNB A;  3KX0 X;  2INW A;  3FG8 A;  1TS8 A;  4H6J A;  1OTE A;  4GHI A;  4HH3 A;  3CAX A;  3H82 A;  4I3I A;  3LI9 A;  4KUK A;  4PKY A;  3UB6 A;  4KUO A;  2QKP A;  4EEU A;  3UME A;  3F1O B;  3H7W A;  5TBM A;  3LIA A;  5A8B A;  4LRX C;  3EEH A;  3GEC A;  3ICY A;  3MR0 A;  1MZU A;  1WA9 A;  3FC7 A;  4HJ4 A;  3NOU C;  4I3J A;  5G4Y A;  3PHY A;  2L0W A;  2VEA A;  2HV1 A;  1LSW A;  2WKP A;  4NXE A;  4R3A A;  4WLA A;  4BBV A;  4EES A;  1XFQ A;  3LIF A;  3UB8 A;  4PKY G;  5HWT A;  4DJ3 A;  2ZOI A;  1T18 A;  4DJ2 A;  5DJT A;  1TS6 A;  4L9F A;  4EQ1 A;  1EW0 A;  2YKH A;  4XT2 B;  3PYP A;  2GJ3 A;  2V9A A;  3LIE A;  5IU1 A;  3LUQ A;  5HZH A;  4JGQ A;  4JGR A;  2PD7 A;  2EA9 A;  2QJ5 A;  1N9N A;  4I38 A;  3MQO A;  4LPZ A;  1UWN X;  1KOU A;  2PHY A;  1XJ4 A;  2A24 A;  2CMN A;  3E4Q A;  3E4P A;  2OOL A;  4GCZ A;  4HJ3 A;  2V0U A;  4HJ6 A;  4I39 A;  1S66 L;  3D72 A;  3B33 A;  1N9L A;  4M4X A;  3HJK A;  3E4O A;  2VLG A;  2PR5 A;  4LRZ E;  4YWZ A;  1S1Y A;  4EEP A;  3F1P B; 
#chains in the Genus database with same CATH topology
 3U2A A;  1QMF A;  3IS2 B;  4MN5 A;  3OPP A;  2J3T C;  2HP9 A;  4P85 A;  2J3W A;  2JHE A;  2VA0 A;  4K0X A;  5FSR A;  5FQQ A;  1PWD A;  3Q07 A;  4LCL A;  4MEZ A;  4JPM A;  2DRW A;  1LLB A;  1F2K A;  3G2Y A;  1FIK A;  3G2Z A;  3LEZ A;  1YLZ A;  3NY4 A;  2JKG A;  1FR6 A;  2FH5 A;  5DTK A;  3W4O A;  2H0Y A;  3E2K A;  1S4R A;  4MMN A;  4H6J B;  1GSW A;  5TBM B;  1ERQ A;  4BEN A;  2V1B A;  4BBV A;  5FL3 A;  3UB9 A;  1VEU B;  3DWK A;  4WN5 A;  2WAD A;  1K4F A;  3U4L P;  4P6Z M;  1KE4 A;  1XJ6 A;  3G32 A;  3NUL A;  2LB9 A;  4OPY A;  5AQ9 A;  4E6X A;  2WYX A;  3RJU A;  2Z6C A;  1S6R A;  4JKT A;  1TS7 A;  4WZ4 A;  1PNE A;  3FYZ A;  3QHY A;  3FG8 A;  3QP2 A;  3UB6 A;  3LI9 A;  4OQI A;  5L09 A;  2X71 A;  3MSH A;  2WGV A;  2BTF P;  3P98 A;  3AGD A;  3Q1F A;  2HP6 A;  3D72 A;  1N9L A;  3BFD A;  2XD5 A;  4EBP A;  5E2G A;  3VSK A;  3BY8 A;  1F5M A;  4EW7 A;  3OOV A;  4K08 A;  3T4L A;  1FQG A;  4IUK A;  4KEN B;  3A0R A;  1HD8 A;  1PI5 A;  4HH2 A;  4L9E A;  3BQ8 A;  4ZJ3 A;  5EVI A;  3IHB A;  1SHV A;  4GD8 A;  4L9G A;  2ZL1 B;  3PBR A;  3LR4 A;  3JVU A;  4HBT A;  2PRF A;  5HAP A;  3Q81 A;  5CEC A;  1N9O A;  2G2W A;  4KG5 A;  4UA7 A;  1ZHH B;  5A91 A;  4BBU A;  4OOL A;  4OQ0 A;  3HLD A;  4R70 A;  3LCE A;  3WS1 A;  3IXD A;  3T4O A;  2P04 A;  5HX9 A;  3QNB A;  5DTS A;  3S7O A;  1FCO A;  2W3F A;  3GVB A;  2Y2K A;  2ZMV A;  3B42 A;  5TJJ A;  1YLY A;  2DMW A;  3LFV A;  3VOZ A;  4O0P A;  3KX0 X;  5IT5 A;  2NUP C;  3P09 A;  3MFD A;  3WS2 A;  5BOH A;  4I3I A;  3C5A A;  3FZC A;  3S7N A;  4B4X A;  1I2S A;  3SOI A;  2ZQ7 A;  4HJ4 A;  1WA9 A;  4DF6 A;  4CLC E;  3E2L A;  3GR2 A;  1DJC A;  1BT5 A;  1BLC A;  3V5M A;  2PBD P;  2GZA A;  1PZO A;  2EA9 A;  2HF6 A;  4EU0 A;  1PI4 A;  1S66 L;  4GDB A;  4X1L A;  2BAS A;  2JC7 A;  4EXO A;  3ZVW A;  1ZC2 A;  1PFL A;  4S2M A;  4X1M A;  4F3L A;  2B95 A;  3RH8 B;  3EGD C;  4KZB A;  5DFY A;  3V3S A;  1ERM A;  4YFM A;  5F69 A;  1H0M A;  2R78 A;  2JN7 A;  5DKK A;  4IED A;  1CK3 A;  1TS0 A;  4WBG A;  1TD5 A;  1S67 L;  5EEC A;  4IHQ A;  3VFH A;  4S2N C;  2Y2M A;  1FR1 A;  1OT6 A;  3BLM A;  1OTB A;  3T1S A;  4JF6 A;  1NRJ A;  5HD5 A;  4R23 A;  3OCL A;  2Y2I A;  4QU3 A;  1LSX A;  4RA7 A;  2HJ9 C;  1VET B;  3CWF A;  4O01 A;  5E43 A;  1CEF A;  4X55 A;  2E8J A;  1MPL A;  4H6J A;  4Y15 A;  4HH3 A;  1D1J A;  5GLC A;  1JTG A;  3H7W A;  3KO6 A;  3NBL A;  3TSG A;  5A8B A;  3NOU C;  4MBK A;  2L0W A;  3JVV A;  2G2U A;  2HV1 A;  2ZC3 B;  1J9M A;  3E98 A;  4BD1 A;  1TS6 A;  3N4I A;  5HAI A;  3G35 A;  1KVL A;  4KZ5 A;  1YAX A;  1ERO A;  2XD1 A;  4UQI S;  1XX2 A;  1ALQ A;  4GCZ A;  3WWX A;  4LRZ E;  1FIL A;  2Q9M A;  3ZNT A;  1H3Q A;  5G18 A;  3HLF A;  3F1N B;  3FKW A;  4K0W A;  1NYY A;  2VGK A;  3N7W A;  4PPR A;  3CLO A;  3UDX A;  3HL9 A;  3WRZ A;  3O5Y A;  4NXG A;  1KE0 A;  2ZC7 A;  3NDE A;  5E2H A;  1KE3 A;  1NY0 A;  3P7N A;  2ZLY A;  1T1A A;  4ZDX A;  2Z6D A;  3CIT A;  4WMC A;  1HVB A;  3Q7Z A;  4OOM A;  4R4S A;  1H8M A;  1CF0 A;  3MQQ A;  5J8X A;  4ARZ B;  5DJU A;  3LEQ A;  1GCE A;  3IXG A;  5FI7 A;  2WKQ A;  2CC1 A;  5HDC A;  4GJ4 A;  4WUJ A;  3OLO A;  5KSH A;  3T4S A;  3HBR A;  2AVX A;  4PM7 A;  4OPZ A;  4HI4 A;  3HLC A;  3R7W B;  1JNU A;  1OJG A;  3RFB A;  3V3R A;  1HTZ A;  3MZE A;  2UV0 E;  1TS8 A;  3NCK A;  5A90 A;  4PHT A;  3WRT A;  4X69 A;  3P01 A;  5EPH A;  3LIF A;  1S0W A;  2ZQA A;  5HWT A;  1NZO A;  4NET A;  2XH9 A;  2BG1 A;  1BLH A;  1GHI A;  4QJG A;  5F1F A;  3MQO A;  4MNR A;  4KQQ A;  2A3U A;  3E4P A;  5EOE A;  3BEC A;  3IXH A;  4HES A;  4WEJ A;  3DWZ A;  2P74 A;  3F1P A;  4K91 A;  1LI0 A;  5F83 A;  3PR6 A;  4WL9 A;  4DXB A;  1FCM A;  2XRN A;  4CLC B;  3UB7 A;  5GLB A;  3ZFZ A;  1XJ2 A;  5DF7 A;  2WK0 A;  3N8L A;  2XGN A;  2Y2O A;  5FAP A;  1WYC A;  3UY6 A;  3BW6 A;  1CI9 A;  4G3K A;  2OWH A;  2ZQ9 A;  2GNX A;  3ITB A;  3ZG0 A;  1F9I A;  4N9L A;  1H8Z A;  4ESP A;  1MBL A;  1XGI A;  4Z1W A;  2IWD A;  2P7J A;  4JXG A;  2HPB A;  3NC8 A;  4GOG A;  4OP8 A;  3VE3 A;  1DP6 A;  3M2K A;  4S2J A;  2Y2G A;  3DAV A;  4RQ9 A;  4B9O A;  3FPW A;  3K3C A;  4E3J A;  4UQI M;  2P9V B;  3T1Q B;  3ZGA B;  3ZG5 A;  2EXA A;  3IHA A;  4JF5 A;  1NWZ A;  2A49 A;  3O87 A;  5GL9 A;  3KYZ A;  2EWW A;  4KZ4 A;  2EWV A;  1OTE A;  4DE1 A;  4EUZ A;  1LL5 A;  2OLU A;  3ZG8 B;  1RP5 A;  2Y2N A;  1WYB A;  5L10 A;  3L9K A;  4LRX C;  3GEC A;  3FC7 A;  3IT9 A;  4NKP A;  1BTL A;  2WKP A;  5KZH A;  3ZNY A;  4CLC A;  5HL1 A;  2M7V A;  1A0K A;  2Y91 A;  2J3T D;  4HBU A;  5TFQ A;  3UO9 A;  2ZM0 A;  5F6A A;  2QMI A;  4IBX A;  4P6B A;  1NJ4 A;  5IHV A;  2Y2P A;  1BLP A;  5F5Y A;  1Q2P A;  3VP4 A;  4UAA A;  2PU2 A;  3V50 A;  2X02 A;  3PBT A;  1U60 A;  1E3U A;  3S7P A;  4LCM A;  2X01 A;  4ZRR A;  1G28 A;  4QWO A;  1V9Z A;  5MC7 A;  2Y8H A;  5CGX A;  2E8I A;  3G6O A;  3Q82 A;  1HZO A;  4PMA A;  3T12 B;  4ZAM A;  3C4P A;  2QZ6 A;  3IX8 A;  2XRO A;  1LI9 A;  3H82 B;  2HDR A;  2B02 A;  2WUQ A;  3VOY A;  3IBR A;  1XXM A;  5A92 A;  2Y2H A;  4B88 A;  4D60 A;  3IX3 A;  1L3L A;  5CHJ A;  1IKG A;  1VB6 A;  3BFE A;  2O0Y A;  2PYP A;  4LEN A;  1PWG A;  4Q8I A;  1MKI A;  1MXO A;  2FFY A;  4PM9 A;  4OQH A;  3LY3 A;  2J7V A;  4LGW A;  4X56 A;  3UNW A;  3A3D A;  3SH9 A;  4ID4 A;  2OLV A;  3C7U A;  1KVM A;  3H82 A;  4EEU A;  3C30 A;  5HFO A;  1VEU A;  4DE3 A;  4S2L A;  2R9W A;  5FDH A;  2VEA A;  3BQA A;  4NXE A;  3WS4 A;  1Q2Q A;  4DJ3 A;  1E3U D;  4WYY A;  3CJM A;  5IU1 A;  2V9A A;  3VFF A;  4ETX A;  4Y2F A;  1GHP A;  4EBL A;  4I39 A;  2OAQ 1;  5EVI B;  5DFX A;  1JVJ A;  4O8G A;  4OQG A;  2PT7 A;  4LV2 A;  4N1X A;  4Y3I A;  1RGZ A;  1K6R A;  3K3D A;  1K54 A;  3VP3 A;  3ISG A;  1DY6 A;  2UWX A;  4C75 A;  3LGO A;  2JBF A;  4KQO A;  4JF4 A;  1LHY A;  1FOF A;  3G4P A;  4C6Y A;  1MC0 A;  5JYO A;  4WMC D;  3PBO A;  2KDK A;  2B5R A;  1S1Z A;  3NEC A;  5FAT A;  3TE8 A;  3KSH A;  2W27 A;  1ZTU A;  4ME4 A;  4M3K A;  3W8K A;  3DTK A;  3DTM A;  2ZM8 A;  1WE4 A;  2Y59 A;  1JWZ A;  3NI9 A;  1H5X A;  1GSV A;  2VV6 A;  4KZ8 A;  1F98 A;  4Y0U A;  5CER A;  5CRF A;  3GV9 A;  2O99 A;  5HSQ A;  3A0S A;  2O9A A;  4BLM A;  4DKI A;  1SDE A;  1G68 A;  3LR3 A;  1MWT A;  1HLU P;  4NK3 A;  2EXB A;  1TVF A;  1ES2 A;  3MXS A;  3DW0 A;  1O7E A;  4IVK A;  5CTN A;  5G4Y A;  2HDU A;  4R1G A;  4PKY G;  4QD4 A;  4EQ1 A;  1EW0 A;  3IWQ A;  3QP6 A;  2J9P A;  4ARZ A;  2EX6 A;  3GTC A;  3E4O A;  2JKT M;  3A3I A;  3CPT A;  4GHI A;  5GHX A;  1BYW A;  2ZQ8 A;  3FV7 A;  4WEL A;  3VP0 A;  2L1M A;  3VOL A;  4RX3 A;  2ZM2 A;  5EE8 A;  4KQD A;  4PM5 A;  2EFU A;  2J80 A;  2QHK A;  3OPL A;  2HJE A;  3EWK A;  5DKL A;  4II7 A;  2Y2Q A;  4E3I A;  3CHW P;  3LR5 A;  5FQI A;  4UA6 A;  4OH0 A;  4OLD A;  2XF3 A;  2W3H A;  3MJQ A;  4E04 A;  3M6H A;  3MKF A;  3SS3 A;  3OCN A;  4BL2 A;  3IF6 A;  1TDG A;  2Q9N A;  3R7W A;  3F1O A;  3ZHH A;  3UDF A;  3ULF A;  4X6T A;  4LLO B;  2KX6 A;  4MDZ A;  1GSX A;  5FA7 A;  2QPN A;  3SZT A;  3MF0 A;  2R9X A;  1OT9 A;  4HIA A;  3HLG A;  4YOF A;  3EGX C;  4YNR A;  1IKI A;  2WGW A;  3CZD A;  3LIA A;  2PU4 A;  1W8Q A;  2P9V A;  3QNC A;  4Y5F A;  4JXW A;  2XA7 S;  4R3A A;  4WLA A;  2H0T A;  5M18 A;  2V20 A;  5FQM A;  5I94 A;  2K31 A;  3LIE A;  4RYE A;  3CUE A;  4S2K A;  2PHY A;  4U0X A;  4EEP A;  5FQJ A;  2JCH A;  2VV8 A;  4HP4 A;  1ODV A;  1CJF A;  3SS4 A;  2ZD8 A;  4JXS A;  2QJ7 A;  3MKE A;  1VM1 A;  5J3W A;  4DE0 A;  1KGE A;  5GLD A;  4P87 A;  1T1C A;  2ZOH A;  1CI8 A;  2ZQC A;  3TG9 A;  3IXB A;  4PAU A;  3MMH A;  1SDN A;  4OLG A;  2PR6 A;  4EUV A;  3BFG A;  3EQV A;  3D9Y A;  2WZZ A;  3A0V A;  2IWB A;  5DTT A;  2VGJ A;  1SZV A;  1O07 A;  2WGI A;  1X0O A;  1FSW A;  3HJI A;  4RVA A;  3VMA A;  4S2P A;  5CX7 A;  1TEM A;  4EBN A;  1NXY A;  2WAE A;  4MN7 A;  1K55 C;  5FI6 A;  4EER A;  1ONG A;  1K57 A;  1L2S A;  4BL3 A;  1V9Y A;  4P6Z S;  4HQA A;  3PAG A;  5M19 A;  4CLC C;  2MJ6 A;  1IYP A;  2XQZ A;  5F1G A;  2Y79 A;  4OVD A;  3UPP A;  2W1R A;  1DJA A;  1M40 A;  4UA9 A;  4OON A;  3T4K A;  4WZ5 A;  2LB5 A;  2W1T A;  3W4Q A;  4KUO A;  1YSQ A;  1YLT A;  3KSG A;  3HLW A;  3EEH A;  3MR0 A;  4IJG A;  3G34 A;  5DVA A;  3ZDJ A;  4FTX A;  2GJ3 A;  2WKI A;  3ZVT A;  4I38 A;  2XEP A;  4Q0I A;  3WS0 A;  3I7J A;  2WKH A;  4H8R A;  4R0Q A;  4DMZ A;  3S22 A;  4UEY A;  3FKV A;  4M4X A;  2V8F A;  5TR7 A;  5HZH A;  1ZG6 A;  1SKO A;  5HWW A;  4WZ5 C;  3F1N A;  4GNU A;  1GHM A;  4DE2 A;  3BEB A;  1LT0 A;  1L0F A;  3UPN A;  2L4R A;  1G6O A;  1NRF A;  3Q7V B;  3T4J A;  3FPV A;  1UWP X;  1DP8 A;  4A5R A;  1ES5 A;  4FOF A;  1IEL A;  2C6W B;  4GZB A;  2XK1 A;  3PBQ A;  2V1Z A;  4EWF A;  3BJN A;  5HDS A;  2V2F F;  4OPR A;  3IF5 A;  1XFN A;  4FUW A;  5HPF A;  1FSY A;  3SS5 A;  1K6S A;  1YQS A;  3T4Q A;  3UPO A;  3CMZ A;  4NXF A;  1W63 M;  5TGF A;  1H8Y A;  3SH7 A;  4GW9 A;  4X53 A;  1P9R A;  1BUL A;  1YSP A;  2YKF A;  1IOU A;  2I72 A;  2ZC5 B;  3ZG9 B;  2K7S A;  4DRT A;  3H7W B;  5FEF A;  1PRQ A;  4HP9 A;  3HUM A;  4GS9 B;  4Y13 A;  4R38 A;  4FCF A;  4Y17 A;  3OPH A;  1L0G A;  3F1O B;  1J3W A;  2VK3 A;  3BFF A;  3W2Z A;  1I5Q A;  2VGL M;  5AJG A;  4NG2 A;  1XP4 A;  4LPZ A;  1XJ4 A;  1IYQ A;  1IYO A;  3HUO A;  4FH2 A;  2VLG A;  1K0K A;  4KZ6 A;  4OPQ A;  5CEB A;  4GD6 A;  4R6L A;  1LL8 A;  5U47 A;  4JGO A;  1P97 A;  4QY5 A;  1AWI A;  1L0D A;  3C4O A;  3GDI A;  5HAQ A;  3BLS A;  1K4E A;  3ZG7 B;  2ZBB A;  1K56 D;  5A93 A;  3B47 A;  2Y2L A;  3T4T A;  5EVL A;  5EM1 A;  1P0Z A;  3NOT C;  1VQQ A;  4Y7P A;  2EFX A;  2H10 A;  5EV0 A;  3TRC A;  5GHZ A;  2W3D A;  2HDQ A;  2W3E A;  5AQA A;  3R4K A;  1K38 A;  2HP5 A;  2GDN A;  3M6B A;  5D3O A;  5L8M A;  4KG6 A;  5HDD A;  5I5L A;  5EOO A;  5C5K A;  5KIZ A;  3T50 A;  1W79 A;  5KSC A;  1LSV A;  1W5D A;  3HVF A;  5CGW A;  4HEF A;  3PTE A;  4E3O A;  4EQI A;  1YLP A;  2ZC4 B;  3KYE A;  3BYD A;  1PIO A;  4ZJ1 A;  3LYX A;  1MWS A;  4I3A A;  1NYM A;  2GX5 A;  1PYY A;  3PAE A;  4PKY A;  1KGF A;  4PM6 A;  2JKF A;  1ONH A;  4R4R A;  5CHU A;  2J9O A;  4ETZ A;  4IBR A;  1MY8 A;  1XGJ A;  3UE1 A;  5DJT A;  3PYP A;  2WKE A;  2ZQD A;  1YM1 A;  4JGR A;  2QJ5 A;  1FCN A;  1UWN X;  2JE5 A;  3ITA A;  1PW1 A;  2IA2 A;  4S2N A;  2IWC A;  3HJK A;  3KSF A;  1S1Y A;  3GMW A;  3DTE A;  3RXW A;  4N1H A;  3E0Y A;  3IS2 A;  2JKR M;  5EVE A;  4XUX A;  4X68 A;  1W63 Q;  4DDY A;  1UGU A;  2H5S A;  4GB7 A;  1I2W A;  4EET B;  1SCW A;  4Y0O A;  3ZQ5 A;  1D7E A;  2H28 A;  4LRY C;  3JYI A;  4AFI A;  2Y2J A;  3MS6 A;  4Y0T A;  2V0W A;  4D2O A;  3MXR A;  4BQM A;  3SW1 A;  3OBF A;  5HWV A;  1CEG A;  1SKO B;  5J4E A;  4NEE D;  5CHM A;  4O7D A;  3HLB A;  3CPT B;  1IYS A;  5GLA A;  1BUE A;  5L07 A;  2EX2 A;  2XFT A;  2QYB A;  4I5S A;  4XUZ A;  1EI5 A;  4LV0 A;  2KLI A;  3DBA A;  5AQ7 A;  1OME A;  2ZMA A;  4GN2 A;  5HL6 A;  5EVI C;  1XJ3 A;  4OOY A;  2W1T B;  1ESU A;  1K54 C;  3N6I A;  2G7U A;  3CUE C;  2Y4A A;  3MZF A;  4B93 A;  2A2L A;  3T1R A;  3OC2 A;  4GDN A;  1XKZ A;  4EES A;  3GSG A;  3B3X A;  3NDG A;  3A3E A;  4DJ2 A;  4FD8 A;  2EX8 A;  4MCW A;  2PD7 A;  1XPB A;  2CMN A;  3E4Q A;  2V0U A;  3IWI A;  5TBM A;  2PR5 A;  5IS1 A;  3K2N A;  3LID A;  4N9K A;  4BBT A;  4C3Q A;  4GHI B;  2PBY A;  3PBS A;  3MXQ A;  5L2F A;  4FH4 A;  4Q0H A;  2QWS A;  3S4X A;  5CED A;  1D06 A;  4XT2 A;  3IF6 C;  3BY9 A;  4N92 A;  3G30 A;  2Y55 A;  3L7H A;  4G3V A;  4E6W A;  1JTD A;  2XR0 A;  1OTA A;  3IH8 A;  4QY6 A;  1T19 A;  5CTM A;  3BM6 A;  2O9B A;  4G3W A;  5EFW A;  2FZ0 A;  3MQ0 A;  4JGP A;  4LV1 A;  2VV7 A;  4KZ7 A;  5GHY A;  1IFQ A;  4NXB A;  3LIC A;  2M7U A;  3S7Q A;  4DDS A;  1K56 A;  1AXB A;  4ZTK A;  2C5W B;  2W3G A;  2I9V A;  3AGE A;  3O86 A;  3UE6 A;  4F94 A;  3O3V A;  3HLE A;  4ZJ2 A;  3H9W A;  2WKR A;  3QP4 A;  2WGW B;  3UMD A;  4E3N A;  1TDL A;  1VET A;  3TW8 A;  4BMW A;  4E3M A;  1W8Y A;  5EVI D;  3MBZ A;  3QP8 A;  2Z2L B;  1Y54 A;  4I3J A;  1ZKJ A;  5LBR A;  3TJZ C;  4IVI A;  4CJN A;  3W4P A;  3CI6 A;  1STZ A;  1YMX A;  4R3B A;  4RX2 A;  1N9B A;  1IEM A;  1G5U A;  2OOL A;  2XFS A;  3B33 A;  4U3T A;  3IWO A;  1EWZ A;  1VHM A;  3PXP A;  4X25 A;  3A3J A;  2P08 A;  3BFC A;  3IBJ A;  3VP1 A;  3C38 A;  3RTY A;  1M6K A;  4F3L B;  5JYP A;  3O88 A;  1P9W A;  4E3K A;  4WF0 A;  1QME A;  3M2J A;  5EUA A;  3IQA A;  3C2W A;  3PBN A;  3C7V A;  3VP2 A;  5AVE A;  5E2E A;  2EX9 A;  3MFX A;  1KGG A;  2J8Y A;  4MBF A;  2D01 A;  2RCX A;  2Z2M B;  1YPR A;  4XXR A;  1KDS A;  5HPI A;  3DTI A;  3HCY A;  1JWP A;  3ZYT A;  4MN6 A;  1RCJ A;  5F82 A;  5HAR A;  1MWU A;  4KZ9 A;  5G4Z A;  4LV3 A;  4CLC D;  5FEG A;  1Y28 A;  3BRM A;  4S2I A;  3VSL A;  3EEA A;  1KDW A;  3VV4 A;  3A3F A;  1Z6F A;  1ES4 A;  1PWC A;  4CPK A;  3N8R A;  2RL3 A;  4OP5 A;  3IX4 A;  2VGL S;  3NOP C;  5J7E A;  3VE4 A;  2NUT C;  4Z9Q A;  1T1B A;  4CQH A;  5FAQ A;  4DN0 A;  3CAX A;  1OPX A;  1YMS A;  4FSF A;  4WEK A;  3UME A;  3T1X A;  5FQK A;  3UB8 A;  5CXW A;  1BSG A;  5FQ9 A;  2YKH A;  3EQU A;  2ZL1 A;  2A24 A;  3OPR A;  4HJ6 A;  4HJ3 A;  1PW8 A;  4YWZ A;  2W0N A;  1ZG4 A;  4KG2 A;  1OTD A;  4WM9 A;  3BWL A;  2HZ5 A;  3LI8 A;  3Q7V A;  1N4O A;  2VX8 A;  1ACF A;  2ZC6 B;  1BZA A;  5E2F A;  3C8C A;  1Z09 A;  2WAF A;  2DNS A;  4GLQ A;  3KYQ A;  1YT4 A;  1K57 C;  2OSU A;  2A24 B;  1YLW A;  1K55 A;  5M1A A;  3HRE A;  3HUN A;  2B18 A;  4KZA A;  2HDS A;  4GKU A;  2V1A A;  1XA7 A;  2M1C A;  3LY4 A;  5FDS A;  4ZBE A;  1GA9 A;  2JKR I;  2OV5 A;  1C3B A;  4HY8 A;  1S4S A;  3LO7 A;  1ESI A;  3NHQ A;  4JXV A;  1NLZ A;  1OJ5 A;  1L0E A;  1DRM A;  2ZMF A;  2DCF A;  2V8C A;  4UHU A;  4PM8 A;  2ACG A;  1OTI A;  1W7F A;  4Q0J A;  1DP9 A;  3NIA A;  1MKM A;  1NZU A;  4MBH A;  4JBF A;  2WZX A;  3AGF A;  5K5B A;  5DF8 A;  1K25 A;  2VZW A;  1E25 A;  3FWL A;  1GA0 A;  3UN7 A;  5FAO A;  3ICY A;  3V39 A;  1RGY A;  5DF9 A;  1Y4O A;  3PHY A;  1ES3 A;  3WS5 A;  4QPR A;  1XFQ A;  2ZOI A;  1T18 A;  4XT2 B;  2BLS A;  3LUQ A;  4U0T A;  2Q0O A;  4JGQ A;  1N9N A;  4BD0 A;  1KOU A;  3UDI A;  4YIN A;  3V67 A;  4MLL A;  3ZCZ A;  3F1P B;  3G31 A;  5F68 A;  2JKT I;  1LL9 A;  1DJB A;  3LIB A;  3MZD A;  1TF1 A;  2K2N A;  3LR0 A;  4OKP A;  5HW3 A;  5FI2 A;  1PZP A;  4EV4 A;  5CGS A;  3EOI A;  4P0M A;  4KQR A;  3SH8 A;  4S2O A;  2O9C A;  4LFU A;  3S1Y A;  3UE3 A;  5HD3 A;  2XSS A;  2VKS A;  1MWR A;  4DXC A;  4HOI A;  2PYR A;  4IUH A;  2VJW A;  3D4F A;  4QHC A;  3UB5 P;  4BWI A;  1BLS A;  3N8S A;  3TOI A;  5FAS A;  5EM0 A;  4B4Z A;  5AVF A;  1NLY A;  4R3J A;  1YLJ A;  3CG5 A;  2PDR A;  3QP5 A;  2OAP 1;  4BJP A;  2HGV A;  4L0L A;  3D3O A;  3RXX A;  4HHD A;  2D02 A;  2PD8 A;  1XA1 A;  3KSI A;  3GQZ A;  4GS9 A;  3IH9 A;  2OWJ A;  2XDM A;  4E3L A;  2XA7 M;  1JWV A;  3JPU A;  3NJA A;  1E4D A;  4HNB A;  2INW A;  1YKD A;  5KMW A;  1CQA A;  4KUK A;  2QKP A;  4JLF A;  3IF6 B;  1MZU A;  2XLN A;  2ZJ9 A;  1LSW A;  3QP1 A;  5AQB A;  4KZ3 A;  4L9F A;  1SKF A;  4QB8 A;  3UE0 A;  3OZH A;  3GRJ A;  2FFF B;  2PAV P;  1G6A A;  2KOI A; 
#chains in the Genus database with same CATH homology
 5IS1 A;  3U2A A;  2VV8 A;  3IS2 B;  4HP4 A;  3K2N A;  3LID A;  4MN5 A;  4BBT A;  2J3T C;  3F1P A;  4GHI B;  2J3W A;  1ODV A;  2JHE A;  3PR6 A;  2QJ7 A;  2VA0 A;  3PBS A;  3MXQ A;  4WL9 A;  4Q0H A;  2QWS A;  5J3W A;  2XRN A;  1T1C A;  4CLC B;  2ZOH A;  3UB7 A;  1D06 A;  4XT2 A;  3BY9 A;  1XJ2 A;  4G3V A;  4PAU A;  3MMH A;  1OTA A;  2PR6 A;  4EUV A;  3BW6 A;  1T19 A;  4G3K A;  2FH5 A;  2OWH A;  3EQV A;  2GNX A;  3A0V A;  1F9I A;  1S4R A;  2O9B A;  4G3W A;  4MMN A;  4H6J B;  5EFW A;  1GSW A;  5TBM B;  2FZ0 A;  1X0O A;  3MQ0 A;  3HJI A;  4JGP A;  2VV7 A;  2V1B A;  4BBV A;  5FL3 A;  3UB9 A;  5CX7 A;  4WN5 A;  1IFQ A;  4Z1W A;  2P7J A;  4NXB A;  3LIC A;  4MN7 A;  4P6Z M;  3VE3 A;  2M7U A;  1DP6 A;  3S7Q A;  4EER A;  1XJ6 A;  4RQ9 A;  4B9O A;  1V9Y A;  3FPW A;  4HQA A;  4P6Z S;  2W3G A;  2I9V A;  2LB9 A;  3K3C A;  4CLC C;  3UE6 A;  2MJ6 A;  4UQI M;  3H9W A;  2WKR A;  2Y79 A;  3UMD A;  2W1R A;  2Z6C A;  1TS7 A;  1NWZ A;  3TW8 A;  4BMW A;  3T4K A;  3FG8 A;  3KYZ A;  2EWW A;  2EWV A;  1OTE A;  2LB5 A;  2W1T A;  3UB6 A;  3LI9 A;  4KUO A;  1YSQ A;  3KSG A;  4LRX C;  3EEH A;  3GEC A;  3MR0 A;  3FC7 A;  4I3J A;  4IJG A;  4NKP A;  5LBR A;  2WKP A;  3TJZ C;  3CI6 A;  1STZ A;  4CLC A;  2GJ3 A;  2M7V A;  4I38 A;  4Q0I A;  2J3T D;  4DMZ A;  2OOL A;  4UEY A;  3D72 A;  3B33 A;  1N9L A;  4M4X A;  1VHM A;  3PXP A;  5F6A A;  5HZH A;  2P08 A;  3BY8 A;  1F5M A;  5HWW A;  3F1N A;  3IBJ A;  4EW7 A;  3C38 A;  3OOV A;  3RTY A;  4K08 A;  4F3L B;  5F5Y A;  3T4L A;  4IUK A;  1P9W A;  1LT0 A;  2L4R A;  3PBT A;  4WF0 A;  1G6O A;  3T4J A;  3FPV A;  1UWP X;  1DP8 A;  3A0R A;  3S7P A;  4FOF A;  4ZRR A;  1G28 A;  4HH2 A;  3C2W A;  1V9Z A;  3PBN A;  3BQ8 A;  4L9E A;  2Y8H A;  5MC7 A;  5AVE A;  3G6O A;  3MFX A;  3PBQ A;  3BJN A;  4L9G A;  5HDS A;  3PBR A;  3LR4 A;  2D01 A;  3JVU A;  1XFN A;  5HPF A;  2XRO A;  3H82 B;  2B02 A;  1N9O A;  3T4Q A;  5HPI A;  3IBR A;  3HCY A;  3ZYT A;  4MN6 A;  4NXF A;  1ZHH B;  5G4Z A;  4BBU A;  4OOL A;  4CLC D;  1W63 M;  4GW9 A;  1Y28 A;  4R70 A;  1VB6 A;  3EEA A;  1P9R A;  1YSP A;  3VV4 A;  3T4O A;  2YKF A;  2O0Y A;  2P04 A;  1IOU A;  2PYP A;  3S7O A;  2K7S A;  2W3F A;  3H7W B;  2ZMV A;  4HP9 A;  2VGL S;  3B42 A;  4GS9 B;  3NOP C;  5TJJ A;  5J7E A;  3VE4 A;  2DMW A;  4R38 A;  2NUT C;  3LFV A;  1T1B A;  4CQH A;  4O0P A;  3KX0 X;  5IT5 A;  2NUP C;  4DN0 A;  3CAX A;  1OPX A;  3H82 A;  4I3I A;  4FSF A;  4EEU A;  4WEK A;  3S7N A;  3UME A;  3C30 A;  3F1O B;  4HJ4 A;  1WA9 A;  4CLC E;  2VEA A;  3BQA A;  4NXE A;  3UB8 A;  3W2Z A;  4DJ3 A;  2VGL M;  2GZA A;  2YKH A;  5IU1 A;  2V9A A;  5AJG A;  2EA9 A;  2HF6 A;  4LPZ A;  4EU0 A;  3EQU A;  4ETX A;  4Y2F A;  1XJ4 A;  2A24 A;  4HJ6 A;  4HJ3 A;  4I39 A;  1S66 L;  2OAQ 1;  4YWZ A;  2VLG A;  2W0N A;  5DFX A;  4O8G A;  2BAS A;  4EXO A;  1OTD A;  3BWL A;  3LI8 A;  2PT7 A;  2VX8 A;  4R6L A;  1LL8 A;  4Y3I A;  4JGO A;  1P97 A;  3C8C A;  3K3D A;  4F3L A;  3GDI A;  4GLQ A;  3KYQ A;  3RH8 B;  3EGD C;  5DFY A;  2A24 B;  2ZBB A;  4KQO A;  2B18 A;  3B47 A;  2V1A A;  3T4T A;  1MC0 A;  2M1C A;  5F69 A;  2R78 A;  1P0Z A;  3NOT C;  2JN7 A;  5DKK A;  3TRC A;  3PBO A;  2KDK A;  2W3D A;  2JKR I;  2W3E A;  1TS0 A;  4HY8 A;  1S1Z A;  1S4S A;  1TD5 A;  3R4K A;  3NHQ A;  1S67 L;  3TE8 A;  3KSH A;  2W27 A;  5L8M A;  1ZTU A;  4IHQ A;  4ME4 A;  1NLZ A;  1OJ5 A;  1DRM A;  5HDD A;  5I5L A;  5C5K A;  1OT6 A;  2ZMF A;  5KIZ A;  1OTB A;  3T50 A;  1GSV A;  1NRJ A;  2VV6 A;  1F98 A;  5HD5 A;  1LSV A;  3OCL A;  2O99 A;  5HSQ A;  1LSX A;  2HJ9 C;  1OTI A;  3A0S A;  2O9A A;  3CWF A;  4O01 A;  4Q0J A;  1DP9 A;  1MKM A;  3LYX A;  4I3A A;  2GX5 A;  3LR3 A;  4H6J A;  4PKY A;  4HH3 A;  5K5B A;  3H7W A;  2VZW A;  3KO6 A;  5A8B A;  3ICY A;  4ETZ A;  3NOU C;  5G4Y A;  5DF9 A;  3PHY A;  2L0W A;  3JVV A;  2HV1 A;  4QPR A;  1XFQ A;  3E98 A;  4PKY G;  2ZOI A;  1T18 A;  5DJT A;  1TS6 A;  4EQ1 A;  1EW0 A;  4XT2 B;  3PYP A;  3LUQ A;  1YAX A;  4JGQ A;  4JGR A;  2QJ5 A;  1N9N A;  4UQI S;  4ARZ A;  1UWN X;  1KOU A;  4GCZ A;  3V67 A;  2IA2 A;  3KSF A;  3HJK A;  3E4O A;  4LRZ E;  2JKT M;  1S1Y A;  3F1P B;  4GHI A;  1BYW A;  4WEL A;  2JKT I;  5F68 A;  3E0Y A;  3IS2 A;  2L1M A;  1H3Q A;  2JKR M;  3LIB A;  3VOL A;  1W63 Q;  3F1N B;  1TF1 A;  1UGU A;  2K2N A;  3LR0 A;  4EET B;  4KQD A;  3CLO A;  2J80 A;  2QHK A;  3O5Y A;  3ZQ5 A;  4NXG A;  1D7E A;  2H28 A;  3EOI A;  4LRY C;  4AFI A;  2HJE A;  3EWK A;  2V0W A;  5DKL A;  3P7N A;  2O9C A;  1T1A A;  4II7 A;  3UE3 A;  3SW1 A;  3OBF A;  5HWV A;  5HD3 A;  2Z6D A;  2XSS A;  3CIT A;  2VKS A;  5J4E A;  4HOI A;  2PYR A;  4NEE D;  3LR5 A;  4IUH A;  2VJW A;  4BWI A;  4OOM A;  1H8M A;  2W3H A;  3MJQ A;  3MQQ A;  4ARZ B;  5DJU A;  4E04 A;  2WKQ A;  2QYB A;  4I5S A;  5HDC A;  4GJ4 A;  3OCN A;  1NLY A;  5AVF A;  4WUJ A;  3OLO A;  2KLI A;  3DBA A;  3R7W A;  3F1O A;  3T4S A;  5KSH A;  2PDR A;  2OAP 1;  4BJP A;  2HGV A;  3ULF A;  4LLO B;  2KX6 A;  4MDZ A;  1GSX A;  4L0L A;  3D3O A;  4HI4 A;  3MF0 A;  1JNU A;  4HHD A;  3R7W B;  2D02 A;  1OJG A;  3RFB A;  2PD8 A;  3KSI A;  5HL6 A;  1XJ3 A;  1OT9 A;  2W1T B;  4HIA A;  4GS9 A;  2G7U A;  2OWJ A;  4YOF A;  2XA7 M;  3NJA A;  3EGX C;  4HNB A;  2INW A;  1YKD A;  3CUE C;  1TS8 A;  4KUK A;  2QKP A;  4YNR A;  4PHT A;  3LIA A;  4B93 A;  2A2L A;  1MZU A;  3OC2 A;  3P01 A;  4Y5F A;  1LSW A;  4EES A;  2XA7 S;  4R3A A;  4WLA A;  3LIF A;  5HWT A;  4DJ2 A;  4L9F A;  2K31 A;  3LIE A;  4MCW A;  2PD7 A;  3CUE A;  3MQO A;  2PHY A;  2CMN A;  3E4Q A;  3E4P A;  2V0U A;  5TBM A;  4EEP A;  2PR5 A;  4WEJ A;  2KOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...