1D06A

Structural basis of dimerization and sensory mechanisms of oxygen-sensing domain of rhizobium meliloti fixl determined at 1.4a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
GSHMLETEDVVRARDAHLRSILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sensory mechanism of oxygen sensor FixL from Rhizobium meliloti: crystallographic, mutagenesis and resonance Raman spectroscopic studies
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
molecule keywords nitrogen fixation regulatory protein fixL
total genus 38
structure length 130
sequence length 130
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d06A00
3UB8A 4F3LA 3SW1A 4HJ6A 3LIEA 4HI4A 3H7WA 3ULFA 4GHIB 4WLAA 2QJ5A 2PHYA 3A0SA 1LT0A 5HDCA 2YKFA 3VE3A 5J7EA 3NOTC 4I3JA 3F1OB 2HV1A 4WL9A 1WA9A 3F1OA 2JN7A 4HJ3A 4JGRA 4R70A 4EQ1A 2A24B 1D06A 3NHQA 4KUOA 1X0OA 2H28A 4MN6A 3P7NA 4I39A 3E4QA 1XJ6A 5IS1A 5G4YA 4YWZA 1VB6A 2VV7A 3HJKA 4KQDA 2VV8A 4I38A 4GHIA 4EEUA 1UGUA 3MR0A 3LIAA 3H82B 5I5LA 4GCZA 2D01A 2GJ3A 2Z6CA 4HP4A 5HD5A 3F1PA 2A24A 2QKPA 3LUQA 5HD3A 2ZBBA 4BBTA 1T1BA 1DP9A 3KX0X 4LRXC 3UMDA 1EW0A 3H82A 2PYRA 3BY9A 3CWFA 3LIBA 4NXGA 1T1AA 4JGQA 4L9FA 2WKQA 3H7WB 2WKPA 3LYXA 4M4XA 4PKYA 4JGOA 1TS7A 2JHEA 1LSVA 1N9LA 3MQQA 4H6JA 1TS6A 3FG8A 3UB7A 1OTDA 1GSXA 1TS8A 1LSWA 2P7JA 1OTIA 1S4RA 3A0VA 1S66L 3B33A 3F1PB 3GDIA 1DP8A 4WF0A 5DJTA 5DKLA 1KOUA 2V1AA 3G6OA 3H9WA 1LSXA 5HDDA 3LIDA 1S1YA 1T19A 3C8CA 4I3AA 5J3WA 3T50A 1DRMA 3K3DA 3MQOA 3A0RA 3NOUC 1UWPX 1OTAA 2QJ7A 1T1CA 2V9AA 3UMEA 3E4OA 4F3LB 2BASA 1T18A 4XT2B 3F1NA 3HJIA 4HH3A 3BY8A 5DJUA 5F6AA 3PHYA 5HWTA 1OT6A 5F68A 2L4RA 1GSVA 5TBMB 3VOLA 4EESA 1XJ2A 3CAXA 3LI9A 5A8BA 2PD8A 4BBVA 2KX6A 2K7SA 2KDKA 2R78A 2VLGA 1N9OA 4BBUA 2CMNA 1OTEA 1S4SA 3LICA 4HH2A 5F69A 1DP6A 2PR5A 4K08A 4DJ2A 5J4EA 2OWHA 2EA9A 1S1ZA 4LPZA 4B9OA 2YKHA 4I5SA 2L1MA 5IU1A 1F9IA 2J80A 2PR6A 3IS2A 2L0WA 4JGPA 5KIZA 4HY8A 3UB9A 4LRYC 5AVEA 3NJAA 1XFQA 1OTBA 1F98A 2PYPA 3OLOA 4GS9B 4HHDA 4EETB 3C2WA 2W27A 4L9GA 3RTYA 4GW9A 4EXOA 5HWVA 1NWZA 2ZOIA 5EFWA 3F1NB 3MFXA 5DKKA 3UE6A 5HSQA 3D72A 1XJ3A 3EEHA 1OT9A 1Y28A 3ZQ5A 2PDRA 1LL8A 3PYPA 2QWSA 4LLOB 2V0WA 3LI8A 1XFNA 4NXBA 3MJQA 1XJ4A 2INWA 2V1BA 3BWLA 3EWKA 5HWWA 2QHKA 4GS9A 2Z6DA 2VV6A 4HQAA 2D02A 4EW7A 2OWJA 2PD7A 3MXQA 1N9NA 1ODVA 1P0ZA 4HOIA 1MZUA 4EERA 5TBMA 3RH8B 4R38A 4DJ3A 3FC7A 4HIAA 2ZOHA 5HDSA 1TS0A 3VE4A 4HNBA 1BYWA 5G4ZA 3E4PA 1OJ5A 1V9YA 4XT2A 1OJGA 1V9ZA 2I9VA 1S67L 3CLOA 3NOPC 4KUKA 4H6JB 2M1CA 4RQ9A 1P97A 5AVFA 4HP9A 3UB6A 2WKRA 2OOLA 3IS2B 4NXFA 4E04A 4PKYG 1JNUA 3GECA 2W0NA 4MN5A 3ICYA 3LIFA 4R6LA 1UWNX 4WUJA 2B02A 4EEPA 4NXEA 4LRZE 5F5YA 3IBRA 4WN5A 5HZHA 4HJ4A 1GSWA 2VEAA 1D7EA 2V0UA 3K3CA 4I3IA 1G28A 4L9EA 4R3AA
chains in the Genus database with same CATH superfamily
4F3LA 3O5YA 5AJGA 4ARZA 3IX8A 2ACGA 3BRMA 3VP3A 1N4OA 3PBTA 5HDCA 3VE3A 2C5WB 4S2LA 3ITAA 3T4JA 3AGFA 3D3OA 5JYOA 3VOZA 3NI9A 1L3LA 2VA0A 4OVDA 1DP9A 1EI5A 2OSUA 1F5MA 1TS7A 2JHEA 1W8QA 1SCWA 1JWZA 2WAEA 1OTIA 3BM6A 2B5RA 2PBDP 2ZC6B 3H9WA 1J3WA 3RXXA 3T50A 3K3DA 3ZG8B 4CPKA 4F3LB 2BASA 1XKZA 2VGKA 4OQ0A 4CLCB 3UE3A 3LICA 4K08A 3MBZA 1K6RA 3HVFA 3CHWP 3NJAA 2PYPA 4O0PA 1XX2A 3N8LA 3MFXA 4KQQA 3A3FA 2VGJA 4PM6A 4B93A 4XUZA 3MXQA 4EUZA 3Q07A 3RH8B 2J3TD 2W3DA 5HDSA 4OOYA 2HDQA 3MKEA 1E25A 2WGWB 3GTCA 4P87A 4S2JA 4ETZA 3UE0A 3IXDA 2W0NA 3C38A 4P85A 4WUJA 4LRZE 5FASA 4HJ4A 1ZKJA 3BQAA 2EWVA 1NYYA 3H7WA 1M40A 1D1JA 3T12B 5K5BA 3IHBA 4KUOA 4UHUA 3P09A 2Y2GA 4R4SA 4B88A 1NYMA 3NC8A 3V3SA 2VV8A 3LY3A 5FSRA 1ZC2A 4N9KA 5M18A 3H82A 5HL6A 1PIOA 4ETXA 2WKPA 3S7PA 1RGYA 3MF0A 4FH2A 3UB7A 4KZ3A 1GSXA 3A0VA 1JTDA 1HLUP 3BYDA 1KOUA 4DKIA 1W63Q 4WZ4A 1YAXA 5CHJA 5AQ9A 1OTAA 5FI7A 3CI6A 3MZEA 4P6BA 3IHAA 3CAXA 4Y0TA 3T1QB 2XDMA 1YSQA 2RCXA 4HESA 3NY4A 3JPUA 3JVUA 4OPYA 1S1ZA 2HDSA 3HBRA 1Y4OA 3LCEA 1LL5A 1XFQA 5EVIC 3E0YA 2JC7A 5CHMA 3TW8A 4LV0A 3UE6A 4QWOA 2KOIA 3N8SA 3PYPA 2UWXA 4Y0OA 1BSGA 5HFOA 4OPRA 1MZUA 3N4IA 2W3HA 4KZ5A 4GLQA 2ZL1A 4DJ3A 1HTZA 3Q82A 1S0WA 3HLDA 3TE8A 1OJGA 3FKVA 3KSIA 3CPTA 3BQ8A 3A3JA 3CZDA 5DTSA 1HVBA 3ICYA 4WZ5A 3HLGA 3K3CA 3M2JA 3MZDA 3NBLA 4DE1A 3A0SA 1CI9A 1LT0A 1HZOA 4G3VA 2M7UA 2XSSA 5A92A 4DE3A 3E2LA 3V3RA 5G4YA 5L09A 3BFCA 3HJKA 1KDWA 1ZG4A 1MWSA 3LIAA 2GJ3A 4E3LA 3LUQA 3KO6A 1IYSA 1BLCA 3PBSA 1K57A 5E2HA 3SZTA 2WAFA 1WYBA 3LR4A 1H5XA 1CQAA 2P7JA 4WF0A 2EX9A 2V1AA 1P9WA 2FFFB 3FPVA 3R7WA 1S6RA 3ZNTA 1H8YA 1STZA 4R0QA 2ZC5B 1AXBA 2A3UA 4OQHA 1YMXA 5EVIA 3RJUA 3ZG9B 4MLLA 2IWDA 4ZJ2A 1I2SA 2B95A 2ZM8A 1O07A 4OP5A 4FTXA 4O8GA 3G30A 5HWVA 4RX3A 1YLTA 1FSWA 3FYZA 4R1GA 3IF6C 5FI2A 1LL8A 1GA0A 4X53A 5CHUA 1NZUA 3CITA 4GS9A 2D02A 3MFDA 3DW0A 4B4ZA 5FAOA 2W3FA 2Y8HA 3QP5A 1V9YA 3ZDJA 4QB8A 1MXOA 3PTEA 1SDEA 1UWNX 5KSCA 3ZG7B 4WN5A 1IEMA 2O99A 1L0DA 3UB8A 3SW1A 3WS5A 3S1YA 2QJ5A 2PHYA 4JXSA 2OLVA 2IWBA 3F1OB 1WA9A 4HJ3A 1MY8A 2H28A 4AFIA 4OLGA 4DXCA 5FQMA 3VFHA 4BMWA 4I38A 3GVBA 2PT7A 3H82B 3N7WA 2VKSA 1L0GA 3GMWA 3BEBA 4ZBEA 4ZAMA 1EW0A 5EOEA 4DRTA 3BY9A 3CWFA 4EBNA 3IX4A 1K55A 4GNUA 1YMSA 1JWVA 4P6ZS 2WK0A 4Y5FA 1YSPA 4QPRA 1C3BA 1L2SA 2HDUA 1GHIA 5CRFA 4DXBA 3IF5A 2EXAA 4PAUA 4XUXA 1DJCA 1PI5A 4Y13A 2EX6A 2CMNA 2VZWA 4GN2A 3VFFA 1S4SA 5F69A 5GHXA 5DF9A 4B9OA 3HLEA 3MS6A 2J7VA 3TG9A 5AVEA 3VSKA 2ZLYA 3VP0A 3LO7A 1K4FA 1PZPA 2HJEA 5DKKA 3T1SA 2PDRA 4RX2A 1FSYA 3MJQA 3BWLA 3HCYA 3E98A 5EVLA 5A90A 1N9NA 4LCLA 1SDNA 1VEUB 3DBAA 3V39A 2HP5A 1ESUA 1P97A 2Y2LA 4KZ8A 1IYOA 2FZ0A 4MN7A 3KSFA 1D7EA 2ZQAA 3DTEA 3FWLA 3EEAA 3UPPA 4ZJ3A 4JGRA 1L0EA 1WYCA 2FH5A 1NY0A 1XJ6A 1RCJA 4IHQA 4CLCC 4EBLA 1FR1A 4FH4A 2Y79A 4UQIM 2W3EA 4MMNA 4JGOA 4X69A 1P9RA 3L7HA 3ZG5A 2O9BA 3FG8A 2ZQ7A 3QHYA 1IYPA 3U2AA 3LIDA 2Y2OA 4X68A 5DTTA 3WS4A 4ID4A 4GDBA 3ISGA 4CLCA 1XJ2A 2EX8A 1H8MA 2GNXA 4GD6A 3IXGA 1N9OA 2L1MA 4HY8A 4MEZA 2MJ6A 2Y2NA 4S2PA 3W4PA 2H10A 5CGSA 3T4TA 5U47A 3A3EA 5DFYA 5HWWA 4HQAA 2ZD8A 2XEPA 4NKPA 3HREA 1BUEA 4JF6A 2LB5A 2ZOHA 3G34A 4EV4A 4E3MA 4U0TA 3SS4A 5GLDA 2JBFA 4R6LA 2XD1A 1GSWA 1IFQA 2ZQDA 2FFYA 3LIEA 1W8YA 4HI4A 1YLPA 2ZC4B 1MPLA 2VV7A 4GZBA 2ZQ8A 2ZJ9A 4UA9A 3UMDA 2PRFA 4BLMA 2ZQ9A 3H7WB 4M4XA 4KENB 3A3DA 2P74A 3QNCA 3T4SA 1ZHHB 4MDZA 5FAPA 3MQOA 3WS2A 3A0RA 3E4OA 3BY8A 3HLBA 2R9WA 5F6AA 2ZMFA 3IH8A 3UY6A 1PWCA 3UPNA 2O9AA 4KZ9A 1NZOA 1KGEA 4BBUA 4KQOA 2EXBA 5J4EA 2Z2LB 1ES4A 1K56A 4YOFA 5IU1A 4DE2A 5FDHA 3M6BA 5EE8A 3G32A 1XGJA 3O88A 3P01A 4E3JA 2W1RA 3D4FA 1OT9A 3CUEC 5GL9A 1VHMA 4EW7A 1YLJA 2OWJA 1JVJA 3UN7A 5G18A 1G6OA 4UEYA 3NOPC 4KUKA 5M1AA 2ZM0A 4NXFA 3IS2B 4MCWA 1Z09A 3TOIA 1VEUA 4I39A 1KE3A 1YM1A 1Q2QA 3PBRA 4KG5A 4EQ1A 1YLZA 1VB6A 3IWOA 4FUWA 3IT9A 5HD3A 4JXGA 4O7DA 5EOOA 1IYQA 4IVIA 1TS6A 3C30A 3BLMA 1TEMA 3EGXC 3GDIA 3VP4A 2X01A 1VQQA 3W4QA 3VP1A 1IKGA 1UWPX 3UMEA 4II7A 5EVID 3BW6A 3CMZA 4Y7PA 2H0TA 5DJUA 1OT6A 4MBKA 1CF0A 4M3KA 4DE0A 4BBVA 3OPLA 1MWRA 3BFFA 5EECA 3QP6A 1ES3A 4WEKA 5KIZA 4LRYC 1K55C 3OC2A 4HHDA 1BLSA 5HL1A 2KLIA 4P0MA 4B4XA 3EWKA 2QHKA 2BTFP 1G5UA 1P0ZA 3U4LP 3IXBA 2EFUA 4HIAA 3R4KA 5HX9A 2P04A 4N9LA 2OOLA 1H8ZA 5F83A 5FAQA 1PNEA 4Y15A 4DF6A 4R3AA 5E2GA 3MSHA 3MXRA 1J9MA 3L9KA 4PM7A 4ZTKA 1K6SA 3NHQA 4PMAA 3R7WB 4R23A 5E43A 5IS1A 1F2KA 4GJ4A 5IHVA 4EEUA 1TF1A 5I5LA 3KYEA 3IXHA 5AQAA 3QP4A 2JKRI 1SKOA 3UE1A 2PYRA 3QP2A 4X1MA 3HLWA 1H3QA 3MQQA 1IKIA 3Q1FA 1NRFA 4NK3A 1S1YA 3FKWA 3HUNA 3PBNA 3DWZA 3C7UA 4KZ7A 5C5KA 3HJIA 4S2KA 5F68A 1ZG6A 2Y2QA 2L4RA 5L8MA 4FOFA 2V2FF 3GRJA 3JYIA 4A5RA 3UPOA 2OWHA 5FATA 4NETA 4PPRA 1EROA 1LHYA 4WEJA 4JBFA 4GW9A 5EFWA 3PR6A 2HP9A 4YINA 4OQGA 2INWA 1MWUA 2E8IA 2JE5A 4PHTA 3IWQA 1PYYA 3UDXA 4HOIA 4S2OA 3HUOA 3UDFA 1ES5A 1OJ5A 1Q2PA 4KG2A 2G7UA 4H8RA 2XD5A 5FQIA 5L10A 2QMIA 4I3IA 4JKTA 1PFLA 1KGFA 5GHYA 4GHIB 3T1XA 4X25A 3N6IA 4I3JA 5HAPA 2HPBA 4WL9A 3QP1A 4R70A 3OZHA 1ONGA 4X6TA 1CK3A 4LFUA 4OPQA 4KQDA 1DJAA 4LV3A 4XXRA 3F1PA 3HL9A 2JKRM 1PZOA 1XPBA 3GQZA 3WS0A 4L9FA 1K56D 5CTNA 2Q9MA 4Y3IA 3T4OA 1MWTA 3UB5P 1TS8A 1S4RA 5DKLA 5DJTA 3DWKA 4N1HA 2VK3A 3D9YA 5HDDA 3C8CA 1NJ4A 3P98A 4XT2B 5HW3A 4Q0JA 5JYPA 4OONA 4PM9A 3VSLA 3ZG0A 1IELA 4ZDXA 4EBPA 1WE4A 1W5DA 4IVKA 5KMWA 5EM0A 4EUVA 2YKHA 2A2LA 2PR6A 3PAEA 2K2NA 5FA7A 2W1TA 1FOFA 1OTBA 4QY5A 3UDIA 3C2WA 3RTYA 1G68A 1RP5A 1K25A 3MZFA 4ZRRA 2JKGA 2WKEA 1BTLA 4H6JB 2M1CA 3UB6A 2Y2PA 2M7VA 4PKYG 4WBGA 1FIKA 3LR5A 2VEAA 2V0UA 3HUMA 1KE4A 2JKTM 5FI6A 5CEBA 2VGLS 4YWZA 4C75A 2G2WA 5A91A 3IWIA 4HP4A 2B18A 4S2NA 2QKPA 3CJMA 2Y2MA 3O3VA 3NULA 4PKYA 3LYXA 3FPWA 1K54C 2GZAA 1OTDA 1S66L 1KDSA 2AVXA 4FCFA 3DTKA 4CLCD 5HARA 1DRMA 3LGOA 1T1CA 3SH7A 1K0KA 4G3KA 1GSVA 4EESA 2WADA 3W4OA 4OLDA 3OCNA 4Z9QA 5HPFA 2ZM2A 3PBQA 4N1XA 1E3UA 3RFBA 3BJNA 3EQUA 3G4PA 3M6HA 4EETB 1Y54A 5DF7A 2PBYA 3S7OA 2ZL1B 1XJ3A 5F82A 1CJFA 4OH0A 2VJWA 3GR2A 4K91A 5J8XA 3Q7ZA 2VV6A 1FR6A 3NIAA 1EWZA 4ARZB 1PWGA 1I2WA 1TS0A 3TSGA 5AVFA 4E6WA 3WWXA 3AGEA 3EGDC 2B02A 3OPHA 2ZC3B 1RGZA 2BLSA 3LI8A 1ONHA 1FQGA 3W8KA 1U60A 4DN0A 3ZVWA 4G3WA 1X0OA 2ZMVA 2ZMAA 4E3NA 4R3BA 3HLCA 2C6WB 5FQJA 5HAIA 2Y4AA 1K54A 2DRWA 2XLNA 4Y17A 2RL3A 2ZBBA 1T1BA 3KX0X 1MC0A 1PW8A 2WKQA 4BD0A 3TJZC 5TJJA 4LCMA 1BLHA 4QHCA 3WS1A 3IBJA 1FCNA 3CUEA 1DY6A 3OBFA 4I3AA 4MBHA 1FCMA 1KVLA 4FSFA 1T18A 4Z1WA 3ZHHA 4LENA 5HWTA 3NCKA 1JTGA 5HAQA 4GB7A 3IX3A 1N9BA 1OTEA 3G31A 1M6KA 4DJ2A 4LPZA 4X55A 1F9IA 3LFVA 5E2EA 3VOYA 4EU0A 2OAP1 1BZAA 3T1RA 5A93A 3S7QA 1MKIA 1NWZA 2WUQA 2H0YA 2PU4A 1JWPA 2J9OA 2NUPC 1XJ4A 3PAGA 4GKUA 2WGVA 4DMZA 3ZCZA 1BYWA 4LV1A 2R9XA 4KQRA 3S4XA 3PBOA 4RQ9A 2XFTA 3I7JA 5DF8A 2IA2A 2WYXA 1KGGA 4JXWA 1K38A 3VE4A 4JXVA 4HJ6A 1GA9A 5J7EA 1OPXA 3F1OA 2E8JA 3V5MA 4NEED 1G6AA 1FCOA 5EV0A 3TRCA 3MR0A 4K0WA 2Y2JA 2QYBA 4FD8A 5DVAA 1ESIA 1LLBA 3LIBA 2BG1A 1T1AA 4KZ6A 2Z2MB 4ESPA 2DNSA 3QNBA 4C6YA 4E3OA 2OLUA 5FQ9A 4RYEA 4ME4A 1VM1A 1QMEA 2Y2HA 2P9VB 3Q7VB 3NOUC 3KYZA 2WGWA 4P6ZM 3SS3A 2Y2KA 4HH3A 3BFEA 1YLWA 3QP8A 4E6XA 3NECA 4EWFA 5HPIA 4GDNA 3WRZA 2K7SA 2VX8A 5FQKA 4GD8A 3C4OA 4MBFA 3LEQA 2X71A 1GCEA 4L9GA 5HSQA 5CX7A 3O86A 2Z6DA 3RXWA 2J3TC 2XRNA 1ODVA 4EERA 4S2IA 3BLSA 3FC7A 2XR0A 2WKRA 2Y91A 1ERQA 1LI9A 4E04A 1JNUA 3A3IA 2WKHA 3LIFA 2XGNA 4EQIA 1QMFA 3IBRA 4E3KA 3N8RA 3ZVTA 4OOMA 3IF6B 4Q0HA 4WM9A 1O7EA 3ZYTA 3S22A 1DJBA 2YKFA 3NOTC 2HV1A 4BD1A 5IT5A 3E2KA 1D06A 4UA6A 4S2MA 2HJ9C 3JVVA 1CEGA 1UGUA 2Z6CA 5HD5A 5L07A 4RA7A 4LRXC 1YLYA 1NLYA 5CERA 2W1TB 1Z6FA 4R3JA 4JGQA 5GLBA 4KZAA 4BL3A 1NLZA 1A0KA 2V9AA 1BLPA 2J3WA 3ZGAB 3O87A 3ZFZA 1E4DA 3PHYA 4GOGA 4U3TA 3OCLA 2ZC7A 3EOIA 2P08A 2EX2A 1MKMA 5MC7A 3SH9A 2PD8A 4WYYA 4CLCE 2O0YA 1SKFA 4LV2A 4OKPA 5EUAA 4DDYA 2QPNA 1XXMA 1W63M 3MMHA 1TVFA 5KZHA 3UO9A 3F1NB 5DFXA 3D72A 2V1ZA 4BJPA 4JPMA 4LLOB 1CEFA 2ZQCA 4NXBA 5EPHA 4QJGA 5F1FA 3HLFA 5TBMA 4R38A 3GV9A 2JKTI 4HNBA 3WRTA 2G2UA 2I9VA 4IUHA 2EWWA 4HP9A 4OQIA 4UA7A 1TDLA 3GECA 2JKFA 2Q0OA 4EEPA 2XFSA 4NXEA 1I5QA 5EVIB 1G28A 4L9EA 3K2NA 5GLAA 5DTKA 3G2YA 2HF6A 4U0XA 3C4PA 2OV5A 3MKFA 4KZ4A 1YPRA 3SS5A 1XA1A 1IOUA 4O01A 4GHIA 4IBXA 1VETA 2D01A 3T4QA 1LL9A 5CGXA 1LI0A 4NXGA 2V20A 1LSVA 1N9LA 3C5AA 3F1PB 1LSWA 2W3GA 3B33A 5M19A 3T4KA 4IEDA 1PRQA 2PAVP 2WZZA 3F1NA 2XA7M 2K31A 4WELA 4KG6A 5CEDA 1ZTUA 3VOLA 3T4LA 5A8BA 2UV0E 1PI4A 2R78A 2WZXA 4S2NC 5LBRA 3MXSA 2O9CA 4HH2A 2PR5A 4I5SA 4F94A 2HZ5A 4BENA 4JF5A 3OLOA 4GS9B 4IJGA 4QD4A 4EXOA 2ZOIA 5E2FA 3EEHA 1ACFA 1XGIA 1TDGA 2V8CA 5FQQA 1SZVA 1PW1A 3G35A 2IWCA 1GHPA 1K4EA 2JCHA 3M2KA 3E4PA 1E3UD 4XT2A 1V9ZA 2J8YA 3B47A 5TR7A 3CLOA 4OPZA 2Y2IA 2EFXA 1OMEA 4JF4A 2QZ6A 4WLAA 3SH8A 4UAAA 5TGFA 2JN7A 1MBLA 2A24B 4D2OA 2XK1A 4IBRA 5GLCA 3KYQA 3LR3A 1TD5A 1HD8A 4PM8A 4LGWA 2A24A 1KE0A 5I94A 4YFMA 1NRJA 1W79A 4H6JA 2OAQ1 3C7VA 1VETB 1CI8A 5J3WA 3VP2A 4IUKA 2QJ7A 2GDNA 2HGVA 2WKIA 3IF6A 2WGIA 4WMCA 3KSGA 4HBUA 3LI9A 3DTIA 4N92A 2KX6A 2KDKA 2XQZA 1ALQA 3OOVA 3B42A 4KZBA 2DMWA 2L0WA 4JGPA 1BT5A 2HDRA 3UB9A 5D3OA 3ITBA 4R4RA 4MNRA 3NDGA 4CJNA 4PM5A 3LR0A 1Y28A 4BL2A 4L0LA 5FEGA 2V0WA 1XFNA 2V1BA 4Q0IA 4YNRA 3LY4A 3NDEA 3UNWA 2NUTC 2DCFA 3Q81A 5TFQA 2VGLM 1L0FA 4HBTA 5FEFA 3BECA 5HZHA 1YKDA 5F1GA 4Y2FA 4HEFA 1XA7A 3KSHA 4C3QA 4DDSA 3Q7VA 3B3XA 2LB9A 3FZCA 2P9VA 3ULFA 1PWDA 2A49A 4X1LA 2PU2A 4Y0UA 4MN6A 3P7NA 3SOIA 3E4QA 4UQIS 2Q9NA 5AQBA 1SHVA 2XA7S 1K57C 2H5SA 3BFGA 4QU3A 3DAVA 3VV4A 2HP6A 2X02A 4D60A 5BOHA 5FDSA 3IH9A 4GCZA 5EM1A 4BBTA 3V50A 3AGDA 1YT4A 1BULA 1XP4A 5EVEA 1YQSA 3ZNYA 3CPTB 4QY6A 1ERMA 4OOLA 1DP8A 3G6OA 1LSXA 4OP8A 1T19A 4K0XA 4WMCD 2Y59A 2V8FA 1NXYA 2CC1A 3MQ0A 4BWIA 2XH9A 4WZ5C 5TBMB 4BQMA 4CQHA 1KVMA 3S7NA 2VLGA 2XF3A 5CXWA 1DP6A 2EA9A 4NG2A 2J80A 2GX5A 3IS2A 5CECA 3OPPA 3OPRA 1F98A 1GHMA 4RVAA 2Y55A 1SKOB 2W27A 4X56A 5GHZA 5KSHA 4JLFA 3V67A 5AQ7A 3FV7A 3IQAA 3EQVA 1ES2A 3ZQ5A 2XROA 2QWSA 4E3IA 3BFDA 2PD7A 3LEZA 1W7FA 1FILA 3VMAA 3DTMA 4Q8IA 1H0MA 3W2ZA 3GSGA 5CTMA 1AWIA 5G4ZA 3PXPA 1S67L 5CGWA 2J9PA 4MN5A 5FL3A 2I72A 5F5YA 4ZJ1A 3CG5A 5L2FA 3G2ZA
chains in the Genus database with same CATH topology
4F3LA 3O5YA 5AJGA 4ARZA 3ZYTA 4GHIB 3PBTA 3EEAA 5HDCA 2YKFA 3VE3A 3NOTC 4I3JA 2HV1A 4WL9A 5IT5A 4JGRA 4R70A 1D06A 3T4JA 2FH5A 2HJ9C 1XJ6A 3JVVA 3D3OA 4IHQA 4CLCC 4KQDA 1UGUA 2Z6CA 5HD5A 3F1PA 2VA0A 2Y79A 1DP9A 2JKRM 4LRXC 4UQIM 1NLYA 2W1TB 1F5MA 4JGQA 4L9FA 2W3EA 4MMNA 4JGOA 1TS7A 2JHEA 4Y3IA 1P9RA 3T4OA 2O9BA 3FG8A 1TS8A 1OTIA 1S4RA 5DKLA 5DJTA 3U2AA 3H9WA 5HDDA 3LIDA 1NLZA 3C8CA 3T50A 3K3DA 2V9AA 2J3WA 4F3LB 2BASA 4XT2B 3PHYA 3OCLA 4Q0JA 3EOIA 2P08A 4CLCA 1XJ2A 1MKMA 5MC7A 1H8MA 2PD8A 2GNXA 1N9OA 4CLCB 3UE3A 3LICA 4K08A 4CLCE 2O0YA 4EUVA 2YKHA 2L1MA 2A2LA 2PR6A 4HY8A 2K2NA 2MJ6A 3NJAA 2W1TA 1OTBA 1W63M 2PYPA 4O0PA 3MMHA 3C2WA 3RTYA 3T4TA 3F1NB 3MFXA 5DFXA 3D72A 4BJPA 4LLOB 4NXBA 5DFYA 5HWWA 4HQAA 4B93A 3MXQA 4NKPA 5TBMA 3RH8B 4R38A 2J3TD 2W3DA 2LB5A 2ZOHA 5HDSA 2JKTI 4HNBA 4ZRRA 2I9VA 4IUHA 4H6JB 2EWWA 2M1CA 3UB6A 4HP9A 4ETZA 2M7VA 4PKYG 3GECA 2W0NA 3C38A 4R6LA 4EEPA 4WUJA 4NXEA 4LRZE 3LR5A 4HJ4A 3BQAA 1GSWA 2VEAA 2V0UA 1G28A 4L9EA 3K2NA 1IFQA 2EWVA 3LIEA 4HI4A 3H7WA 2HF6A 2JKTM 5K5BA 4KUOA 2VGLS 1IOUA 4YWZA 2VV7A 4O01A 2VV8A 4GHIA 2D01A 4HP4A 3T4QA 2B18A 2QKPA 3UMDA 3H82A 5HL6A 4NXGA 4ETXA 4PKYA 3H7WB 2WKPA 3LYXA 4M4XA 3S7PA 3FPWA 1LSVA 3MF0A 1N9LA 3UB7A 2GZAA 1OTDA 1GSXA 3F1PB 1LSWA 3A0VA 3T4SA 1S66L 2W3GA 3B33A 1KOUA 3T4KA 4CLCD 1ZHHB 4MDZA 1DRMA 1W63Q 1YAXA 3MQOA 3A0RA 1OTAA 1T1CA 3E4OA 3F1NA 2XA7M 3BY8A 4G3KA 5F6AA 2K31A 4WELA 1ZTUA 3CI6A 2ZMFA 3VOLA 1GSVA 3T4LA 4EESA 3CAXA 5A8BA 3OCNA 2O9AA 1YSQA 2R78A 5LBRA 4BBUA 4KQOA 3JVUA 5HPFA 2O9CA 4HH2A 2PR5A 3PBQA 5J4EA 1S1ZA 4I5SA 4YOFA 5IU1A 3RFBA 3BJNA 3EQUA 1XFQA 3OLOA 3E0YA 4GS9B 4IJGA 4EETB 3P01A 4EXOA 2ZOIA 3TW8A 2W1RA 3S7OA 3UE6A 1XJ3A 3EEHA 1OT9A 2KOIA 3CUEC 2VJWA 3PYPA 1VHMA 2VV6A 4EW7A 2OWJA 1MZUA 4ARZB 2W3HA 4GLQA 4DJ3A 1TS0A 1G6OA 3E4PA 4XT2A 3TE8A 1OJGA 1V9ZA 3B47A 3KSIA 4UEYA 3CLOA 3NOPC 3BQ8A 4KUKA 5AVFA 4NXFA 3IS2B 3EGDC 3ICYA 4MCWA 2B02A 3K3CA 4I39A 3LI8A 4WLAA 3A0SA 1LT0A 4DN0A 4G3VA 2M7UA 2JN7A 3PBRA 2XSSA 4EQ1A 2A24B 4G3WA 1X0OA 2ZMVA 5G4YA 1VB6A 3KYQA 3HJKA 3LR3A 1TD5A 3LIAA 2GJ3A 2A24A 3LUQA 5HD3A 2ZBBA 1T1BA 3KO6A 3KX0X 3PBSA 1MC0A 2WKQA 1NRJA 3TJZC 3LR4A 5TJJA 4H6JA 3C30A 1TS6A 2OAQ1 2P7JA 3EGXC 3GDIA 4WF0A 3IBJA 2V1AA 3CUEA 3OBFA 4I3AA 5J3WA 1P9WA 4IUKA 3FPVA 1UWPX 2QJ7A 3R7WA 3UMEA 4II7A 4FSFA 1T18A 2HGVA 4Z1WA 3BW6A 1STZA 5DJUA 5HWTA 1OT6A 3KSGA 3LI9A 4BBVA 2KX6A 2KDKA 1OTEA 3OOVA 4DJ2A 3B42A 4LPZA 1F9IA 3LFVA 2DMWA 4WEKA 2L0WA 4JGPA 5KIZA 3UB9A 4LRYC 4EU0A 2OAP1 3OC2A 4HHDA 4O8GA 3S7QA 5HWVA 1NWZA 2KLIA 3LR0A 1Y28A 4L0LA 1LL8A 2NUPC 2V0WA 1XFNA 1XJ4A 2V1BA 3CITA 3EWKA 2QHKA 4GS9A 2D02A 4Q0IA 4YNRA 4DMZA 1P0ZA 2NUTC 4HIAA 2W3FA 3R4KA 2Y8HA 1BYWA 1V9YA 2VGLM 3PBOA 2P04A 4RQ9A 2OOLA 2IA2A 1UWNX 4WN5A 5HZHA 2O99A 1YKDA 4Y2FA 4R3AA 3VE4A 3UB8A 3SW1A 4HJ6A 3KSHA 3ULFA 2LB9A 2QJ5A 2PHYA 5J7EA 3F1OB 1OPXA 1WA9A 3F1OA 4HJ3A 3NHQA 2H28A 4MN6A 3P7NA 3R7WB 3E4QA 4NEED 4UQIS 4AFIA 5IS1A 2XA7S 4GJ4A 4BMWA 3VV4A 4I38A 3TRCA 4EEUA 3MR0A 1TF1A 2PT7A 3H82B 4GCZA 5I5LA 2VKSA 2JKRI 2QYBA 4BBTA 1EW0A 2PYRA 3BY9A 3CWFA 3LIBA 1T1AA 1H3QA 3MQQA 4P6ZS 4OOLA 1DP8A 3G6OA 4Y5FA 1YSPA 1LSXA 4ME4A 1S1YA 1T19A 3PBNA 4QPRA 3KYZA 3NOUC 3MQ0A 4P6ZM 4BWIA 5C5KA 3HJIA 4HH3A 5F68A 2L4RA 5L8MA 4FOFA 5TBMB 5HPIA 4PAUA 4CQHA 2K7SA 2VLGA 3S7NA 2CMNA 2VZWA 1S4SA 2VX8A 1DP6A 5F69A 2OWHA 2EA9A 5DF9A 4B9OA 2J80A 2GX5A 3IS2A 5AVEA 4WEJA 1F98A 2W27A 4L9GA 4GW9A 5KSHA 2HJEA 5EFWA 5DKKA 3V67A 5HSQA 3EQVA 3ZQ5A 2PDRA 3PR6A 2XROA 2QWSA 5CX7A 3MJQA 3BWLA 2INWA 3E98A 3HCYA 2Z6DA 4PHTA 2J3TC 2PD7A 2XRNA 1N9NA 1ODVA 4EERA 4HOIA 3FC7A 3W2ZA 3DBAA 5G4ZA 1OJ5A 3PXPA 1S67L 2G7UA 1P97A 2WKRA 4E04A 1JNUA 4MN5A 3LIFA 5FL3A 2FZ0A 5F5YA 3IBRA 4MN7A 3KSFA 1D7EA 4I3IA 4OOMA 4Q0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB8 A;  4F3L A;  3SW1 A;  4HJ6 A;  3LIE A;  4HI4 A;  3H7W A;  3ULF A;  4GHI B;  4WLA A;  2QJ5 A;  2PHY A;  3A0S A;  1LT0 A;  5HDC A;  2YKF A;  3VE3 A;  5J7E A;  3NOT C;  4I3J A;  3F1O B;  2HV1 A;  4WL9 A;  1WA9 A;  3F1O A;  2JN7 A;  4HJ3 A;  4JGR A;  4R70 A;  4EQ1 A;  2A24 B;  1D06 A;  3NHQ A;  4KUO A;  1X0O A;  2H28 A;  4MN6 A;  3P7N A;  4I39 A;  3E4Q A;  1XJ6 A;  5IS1 A;  5G4Y A;  4YWZ A;  1VB6 A;  2VV7 A;  3HJK A;  4KQD A;  2VV8 A;  4I38 A;  4GHI A;  4EEU A;  1UGU A;  3MR0 A;  3LIA A;  3H82 B;  5I5L A;  4GCZ A;  2D01 A;  2GJ3 A;  2Z6C A;  4HP4 A;  5HD5 A;  3F1P A;  2A24 A;  2QKP A;  3LUQ A;  5HD3 A;  2ZBB A;  4BBT A;  1T1B A;  1DP9 A;  3KX0 X;  4LRX C;  3UMD A;  1EW0 A;  3H82 A;  2PYR A;  3BY9 A;  3CWF A;  3LIB A;  4NXG A;  1T1A A;  4JGQ A;  4L9F A;  2WKQ A;  3H7W B;  2WKP A;  3LYX A;  4M4X A;  4PKY A;  4JGO A;  1TS7 A;  2JHE A;  1LSV A;  1N9L A;  3MQQ A;  4H6J A;  1TS6 A;  3FG8 A;  3UB7 A;  1OTD A;  1GSX A;  1TS8 A;  1LSW A;  2P7J A;  1OTI A;  1S4R A;  3A0V A;  1S66 L;  3B33 A;  3F1P B;  3GDI A;  1DP8 A;  4WF0 A;  5DJT A;  5DKL A;  1KOU A;  2V1A A;  3G6O A;  3H9W A;  1LSX A;  5HDD A;  3LID A;  1S1Y A;  1T19 A;  3C8C A;  4I3A A;  5J3W A;  3T50 A;  1DRM A;  3K3D A;  3MQO A;  3A0R A;  3NOU C;  1UWP X;  1OTA A;  2QJ7 A;  1T1C A;  2V9A A;  3UME A;  3E4O A;  4F3L B;  2BAS A;  1T18 A;  4XT2 B;  3F1N A;  3HJI A;  4HH3 A;  3BY8 A;  5DJU A;  5F6A A;  3PHY A;  5HWT A;  1OT6 A;  5F68 A;  2L4R A;  1GSV A;  5TBM B;  3VOL A;  4EES A;  1XJ2 A;  3CAX A;  3LI9 A;  5A8B A;  2PD8 A;  4BBV A;  2KX6 A;  2K7S A;  2KDK A;  2R78 A;  2VLG A;  1N9O A;  4BBU A;  2CMN A;  1OTE A;  1S4S A;  3LIC A;  4HH2 A;  5F69 A;  1DP6 A;  2PR5 A;  4K08 A;  4DJ2 A;  5J4E A;  2OWH A;  2EA9 A;  1S1Z A;  4LPZ A;  4B9O A;  2YKH A;  4I5S A;  2L1M A;  5IU1 A;  1F9I A;  2J80 A;  2PR6 A;  3IS2 A;  2L0W A;  4JGP A;  5KIZ A;  4HY8 A;  3UB9 A;  4LRY C;  5AVE A;  3NJA A;  1XFQ A;  1OTB A;  1F98 A;  2PYP A;  3OLO A;  4GS9 B;  4HHD A;  4EET B;  3C2W A;  2W27 A;  4L9G A;  3RTY A;  4GW9 A;  4EXO A;  5HWV A;  1NWZ A;  2ZOI A;  5EFW A;  3F1N B;  3MFX A;  5DKK A;  3UE6 A;  5HSQ A;  3D72 A;  1XJ3 A;  3EEH A;  1OT9 A;  1Y28 A;  3ZQ5 A;  2PDR A;  1LL8 A;  3PYP A;  2QWS A;  4LLO B;  2V0W A;  3LI8 A;  1XFN A;  4NXB A;  3MJQ A;  1XJ4 A;  2INW A;  2V1B A;  3BWL A;  3EWK A;  5HWW A;  2QHK A;  4GS9 A;  2Z6D A;  2VV6 A;  4HQA A;  2D02 A;  4EW7 A;  2OWJ A;  2PD7 A;  3MXQ A;  1N9N A;  1ODV A;  1P0Z A;  4HOI A;  1MZU A;  4EER A;  5TBM A;  3RH8 B;  4R38 A;  4DJ3 A;  3FC7 A;  4HIA A;  2ZOH A;  5HDS A;  1TS0 A;  3VE4 A;  4HNB A;  1BYW A;  5G4Z A;  3E4P A;  1OJ5 A;  1V9Y A;  4XT2 A;  1OJG A;  1V9Z A;  2I9V A;  1S67 L;  3CLO A;  3NOP C;  4KUK A;  4H6J B;  2M1C A;  4RQ9 A;  1P97 A;  5AVF A;  4HP9 A;  3UB6 A;  2WKR A;  2OOL A;  3IS2 B;  4NXF A;  4E04 A;  4PKY G;  1JNU A;  3GEC A;  2W0N A;  4MN5 A;  3ICY A;  3LIF A;  4R6L A;  1UWN X;  4WUJ A;  2B02 A;  4EEP A;  4NXE A;  4LRZ E;  5F5Y A;  3IBR A;  4WN5 A;  5HZH A;  4HJ4 A;  1GSW A;  2VEA A;  1D7E A;  2V0U A;  3K3C A;  4I3I A;  1G28 A;  4L9E A;  4R3A A; 
#chains in the Genus database with same CATH topology
 4F3L A;  3O5Y A;  5AJG A;  4ARZ A;  3IX8 A;  2ACG A;  3BRM A;  3VP3 A;  1N4O A;  3PBT A;  5HDC A;  3VE3 A;  2C5W B;  4S2L A;  3ITA A;  3T4J A;  3AGF A;  3D3O A;  5JYO A;  3VOZ A;  3NI9 A;  1L3L A;  2VA0 A;  4OVD A;  1DP9 A;  1EI5 A;  2OSU A;  1F5M A;  1TS7 A;  2JHE A;  1W8Q A;  1SCW A;  1JWZ A;  2WAE A;  1OTI A;  3BM6 A;  2B5R A;  2PBD P;  2ZC6 B;  3H9W A;  1J3W A;  3RXX A;  3T50 A;  3K3D A;  3ZG8 B;  4CPK A;  4F3L B;  2BAS A;  1XKZ A;  2VGK A;  4OQ0 A;  4CLC B;  3UE3 A;  3LIC A;  4K08 A;  3MBZ A;  1K6R A;  3HVF A;  3CHW P;  3NJA A;  2PYP A;  4O0P A;  1XX2 A;  3N8L A;  3MFX A;  4KQQ A;  3A3F A;  2VGJ A;  4PM6 A;  4B93 A;  4XUZ A;  3MXQ A;  4EUZ A;  3Q07 A;  3RH8 B;  2J3T D;  2W3D A;  5HDS A;  4OOY A;  2HDQ A;  3MKE A;  1E25 A;  2WGW B;  3GTC A;  4P87 A;  4S2J A;  4ETZ A;  3UE0 A;  3IXD A;  2W0N A;  3C38 A;  4P85 A;  4WUJ A;  4LRZ E;  5FAS A;  4HJ4 A;  1ZKJ A;  3BQA A;  2EWV A;  1NYY A;  3H7W A;  1M40 A;  1D1J A;  3T12 B;  5K5B A;  3IHB A;  4KUO A;  4UHU A;  3P09 A;  2Y2G A;  4R4S A;  4B88 A;  1NYM A;  3NC8 A;  3V3S A;  2VV8 A;  3LY3 A;  5FSR A;  1ZC2 A;  4N9K A;  5M18 A;  3H82 A;  5HL6 A;  1PIO A;  4ETX A;  2WKP A;  3S7P A;  1RGY A;  3MF0 A;  4FH2 A;  3UB7 A;  4KZ3 A;  1GSX A;  3A0V A;  1JTD A;  1HLU P;  3BYD A;  1KOU A;  4DKI A;  1W63 Q;  4WZ4 A;  1YAX A;  5CHJ A;  5AQ9 A;  1OTA A;  5FI7 A;  3CI6 A;  3MZE A;  4P6B A;  3IHA A;  3CAX A;  4Y0T A;  3T1Q B;  2XDM A;  1YSQ A;  2RCX A;  4HES A;  3NY4 A;  3JPU A;  3JVU A;  4OPY A;  1S1Z A;  2HDS A;  3HBR A;  1Y4O A;  3LCE A;  1LL5 A;  1XFQ A;  5EVI C;  3E0Y A;  2JC7 A;  5CHM A;  3TW8 A;  4LV0 A;  3UE6 A;  4QWO A;  2KOI A;  3N8S A;  3PYP A;  2UWX A;  4Y0O A;  1BSG A;  5HFO A;  4OPR A;  1MZU A;  3N4I A;  2W3H A;  4KZ5 A;  4GLQ A;  2ZL1 A;  4DJ3 A;  1HTZ A;  3Q82 A;  1S0W A;  3HLD A;  3TE8 A;  1OJG A;  3FKV A;  3KSI A;  3CPT A;  3BQ8 A;  3A3J A;  3CZD A;  5DTS A;  1HVB A;  3ICY A;  4WZ5 A;  3HLG A;  3K3C A;  3M2J A;  3MZD A;  3NBL A;  4DE1 A;  3A0S A;  1CI9 A;  1LT0 A;  1HZO A;  4G3V A;  2M7U A;  2XSS A;  5A92 A;  4DE3 A;  3E2L A;  3V3R A;  5G4Y A;  5L09 A;  3BFC A;  3HJK A;  1KDW A;  1ZG4 A;  1MWS A;  3LIA A;  2GJ3 A;  4E3L A;  3LUQ A;  3KO6 A;  1IYS A;  1BLC A;  3PBS A;  1K57 A;  5E2H A;  3SZT A;  2WAF A;  1WYB A;  3LR4 A;  1H5X A;  1CQA A;  2P7J A;  4WF0 A;  2EX9 A;  2V1A A;  1P9W A;  2FFF B;  3FPV A;  3R7W A;  1S6R A;  3ZNT A;  1H8Y A;  1STZ A;  4R0Q A;  2ZC5 B;  1AXB A;  2A3U A;  4OQH A;  1YMX A;  5EVI A;  3RJU A;  3ZG9 B;  4MLL A;  2IWD A;  4ZJ2 A;  1I2S A;  2B95 A;  2ZM8 A;  1O07 A;  4OP5 A;  4FTX A;  4O8G A;  3G30 A;  5HWV A;  4RX3 A;  1YLT A;  1FSW A;  3FYZ A;  4R1G A;  3IF6 C;  5FI2 A;  1LL8 A;  1GA0 A;  4X53 A;  5CHU A;  1NZU A;  3CIT A;  4GS9 A;  2D02 A;  3MFD A;  3DW0 A;  4B4Z A;  5FAO A;  2W3F A;  2Y8H A;  3QP5 A;  1V9Y A;  3ZDJ A;  4QB8 A;  1MXO A;  3PTE A;  1SDE A;  1UWN X;  5KSC A;  3ZG7 B;  4WN5 A;  1IEM A;  2O99 A;  1L0D A;  3UB8 A;  3SW1 A;  3WS5 A;  3S1Y A;  2QJ5 A;  2PHY A;  4JXS A;  2OLV A;  2IWB A;  3F1O B;  1WA9 A;  4HJ3 A;  1MY8 A;  2H28 A;  4AFI A;  4OLG A;  4DXC A;  5FQM A;  3VFH A;  4BMW A;  4I38 A;  3GVB A;  2PT7 A;  3H82 B;  3N7W A;  2VKS A;  1L0G A;  3GMW A;  3BEB A;  4ZBE A;  4ZAM A;  1EW0 A;  5EOE A;  4DRT A;  3BY9 A;  3CWF A;  4EBN A;  3IX4 A;  1K55 A;  4GNU A;  1YMS A;  1JWV A;  4P6Z S;  2WK0 A;  4Y5F A;  1YSP A;  4QPR A;  1C3B A;  1L2S A;  2HDU A;  1GHI A;  5CRF A;  4DXB A;  3IF5 A;  2EXA A;  4PAU A;  4XUX A;  1DJC A;  1PI5 A;  4Y13 A;  2EX6 A;  2CMN A;  2VZW A;  4GN2 A;  3VFF A;  1S4S A;  5F69 A;  5GHX A;  5DF9 A;  4B9O A;  3HLE A;  3MS6 A;  2J7V A;  3TG9 A;  5AVE A;  3VSK A;  2ZLY A;  3VP0 A;  3LO7 A;  1K4F A;  1PZP A;  2HJE A;  5DKK A;  3T1S A;  2PDR A;  4RX2 A;  1FSY A;  3MJQ A;  3BWL A;  3HCY A;  3E98 A;  5EVL A;  5A90 A;  1N9N A;  4LCL A;  1SDN A;  1VEU B;  3DBA A;  3V39 A;  2HP5 A;  1ESU A;  1P97 A;  2Y2L A;  4KZ8 A;  1IYO A;  2FZ0 A;  4MN7 A;  3KSF A;  1D7E A;  2ZQA A;  3DTE A;  3FWL A;  3EEA A;  3UPP A;  4ZJ3 A;  4JGR A;  1L0E A;  1WYC A;  2FH5 A;  1NY0 A;  1XJ6 A;  1RCJ A;  4IHQ A;  4CLC C;  4EBL A;  1FR1 A;  4FH4 A;  2Y79 A;  4UQI M;  2W3E A;  4MMN A;  4JGO A;  4X69 A;  1P9R A;  3L7H A;  3ZG5 A;  2O9B A;  3FG8 A;  2ZQ7 A;  3QHY A;  1IYP A;  3U2A A;  3LID A;  2Y2O A;  4X68 A;  5DTT A;  3WS4 A;  4ID4 A;  4GDB A;  3ISG A;  4CLC A;  1XJ2 A;  2EX8 A;  1H8M A;  2GNX A;  4GD6 A;  3IXG A;  1N9O A;  2L1M A;  4HY8 A;  4MEZ A;  2MJ6 A;  2Y2N A;  4S2P A;  3W4P A;  2H10 A;  5CGS A;  3T4T A;  5U47 A;  3A3E A;  5DFY A;  5HWW A;  4HQA A;  2ZD8 A;  2XEP A;  4NKP A;  3HRE A;  1BUE A;  4JF6 A;  2LB5 A;  2ZOH A;  3G34 A;  4EV4 A;  4E3M A;  4U0T A;  3SS4 A;  5GLD A;  2JBF A;  4R6L A;  2XD1 A;  1GSW A;  1IFQ A;  2ZQD A;  2FFY A;  3LIE A;  1W8Y A;  4HI4 A;  1YLP A;  2ZC4 B;  1MPL A;  2VV7 A;  4GZB A;  2ZQ8 A;  2ZJ9 A;  4UA9 A;  3UMD A;  2PRF A;  4BLM A;  2ZQ9 A;  3H7W B;  4M4X A;  4KEN B;  3A3D A;  2P74 A;  3QNC A;  3T4S A;  1ZHH B;  4MDZ A;  5FAP A;  3MQO A;  3WS2 A;  3A0R A;  3E4O A;  3BY8 A;  3HLB A;  2R9W A;  5F6A A;  2ZMF A;  3IH8 A;  3UY6 A;  1PWC A;  3UPN A;  2O9A A;  4KZ9 A;  1NZO A;  1KGE A;  4BBU A;  4KQO A;  2EXB A;  5J4E A;  2Z2L B;  1ES4 A;  1K56 A;  4YOF A;  5IU1 A;  4DE2 A;  5FDH A;  3M6B A;  5EE8 A;  3G32 A;  1XGJ A;  3O88 A;  3P01 A;  4E3J A;  2W1R A;  3D4F A;  1OT9 A;  3CUE C;  5GL9 A;  1VHM A;  4EW7 A;  1YLJ A;  2OWJ A;  1JVJ A;  3UN7 A;  5G18 A;  1G6O A;  4UEY A;  3NOP C;  4KUK A;  5M1A A;  2ZM0 A;  4NXF A;  3IS2 B;  4MCW A;  1Z09 A;  3TOI A;  1VEU A;  4I39 A;  1KE3 A;  1YM1 A;  1Q2Q A;  3PBR A;  4KG5 A;  4EQ1 A;  1YLZ A;  1VB6 A;  3IWO A;  4FUW A;  3IT9 A;  5HD3 A;  4JXG A;  4O7D A;  5EOO A;  1IYQ A;  4IVI A;  1TS6 A;  3C30 A;  3BLM A;  1TEM A;  3EGX C;  3GDI A;  3VP4 A;  2X01 A;  1VQQ A;  3W4Q A;  3VP1 A;  1IKG A;  1UWP X;  3UME A;  4II7 A;  5EVI D;  3BW6 A;  3CMZ A;  4Y7P A;  2H0T A;  5DJU A;  1OT6 A;  4MBK A;  1CF0 A;  4M3K A;  4DE0 A;  4BBV A;  3OPL A;  1MWR A;  3BFF A;  5EEC A;  3QP6 A;  1ES3 A;  4WEK A;  5KIZ A;  4LRY C;  1K55 C;  3OC2 A;  4HHD A;  1BLS A;  5HL1 A;  2KLI A;  4P0M A;  4B4X A;  3EWK A;  2QHK A;  2BTF P;  1G5U A;  1P0Z A;  3U4L P;  3IXB A;  2EFU A;  4HIA A;  3R4K A;  5HX9 A;  2P04 A;  4N9L A;  2OOL A;  1H8Z A;  5F83 A;  5FAQ A;  1PNE A;  4Y15 A;  4DF6 A;  4R3A A;  5E2G A;  3MSH A;  3MXR A;  1J9M A;  3L9K A;  4PM7 A;  4ZTK A;  1K6S A;  3NHQ A;  4PMA A;  3R7W B;  4R23 A;  5E43 A;  5IS1 A;  1F2K A;  4GJ4 A;  5IHV A;  4EEU A;  1TF1 A;  5I5L A;  3KYE A;  3IXH A;  5AQA A;  3QP4 A;  2JKR I;  1SKO A;  3UE1 A;  2PYR A;  3QP2 A;  4X1M A;  3HLW A;  1H3Q A;  3MQQ A;  1IKI A;  3Q1F A;  1NRF A;  4NK3 A;  1S1Y A;  3FKW A;  3HUN A;  3PBN A;  3DWZ A;  3C7U A;  4KZ7 A;  5C5K A;  3HJI A;  4S2K A;  5F68 A;  1ZG6 A;  2Y2Q A;  2L4R A;  5L8M A;  4FOF A;  2V2F F;  3GRJ A;  3JYI A;  4A5R A;  3UPO A;  2OWH A;  5FAT A;  4NET A;  4PPR A;  1ERO A;  1LHY A;  4WEJ A;  4JBF A;  4GW9 A;  5EFW A;  3PR6 A;  2HP9 A;  4YIN A;  4OQG A;  2INW A;  1MWU A;  2E8I A;  2JE5 A;  4PHT A;  3IWQ A;  1PYY A;  3UDX A;  4HOI A;  4S2O A;  3HUO A;  3UDF A;  1ES5 A;  1OJ5 A;  1Q2P A;  4KG2 A;  2G7U A;  4H8R A;  2XD5 A;  5FQI A;  5L10 A;  2QMI A;  4I3I A;  4JKT A;  1PFL A;  1KGF A;  5GHY A;  4GHI B;  3T1X A;  4X25 A;  3N6I A;  4I3J A;  5HAP A;  2HPB A;  4WL9 A;  3QP1 A;  4R70 A;  3OZH A;  1ONG A;  4X6T A;  1CK3 A;  4LFU A;  4OPQ A;  4KQD A;  1DJA A;  4LV3 A;  4XXR A;  3F1P A;  3HL9 A;  2JKR M;  1PZO A;  1XPB A;  3GQZ A;  3WS0 A;  4L9F A;  1K56 D;  5CTN A;  2Q9M A;  4Y3I A;  3T4O A;  1MWT A;  3UB5 P;  1TS8 A;  1S4R A;  5DKL A;  5DJT A;  3DWK A;  4N1H A;  2VK3 A;  3D9Y A;  5HDD A;  3C8C A;  1NJ4 A;  3P98 A;  4XT2 B;  5HW3 A;  4Q0J A;  5JYP A;  4OON A;  4PM9 A;  3VSL A;  3ZG0 A;  1IEL A;  4ZDX A;  4EBP A;  1WE4 A;  1W5D A;  4IVK A;  5KMW A;  5EM0 A;  4EUV A;  2YKH A;  2A2L A;  2PR6 A;  3PAE A;  2K2N A;  5FA7 A;  2W1T A;  1FOF A;  1OTB A;  4QY5 A;  3UDI A;  3C2W A;  3RTY A;  1G68 A;  1RP5 A;  1K25 A;  3MZF A;  4ZRR A;  2JKG A;  2WKE A;  1BTL A;  4H6J B;  2M1C A;  3UB6 A;  2Y2P A;  2M7V A;  4PKY G;  4WBG A;  1FIK A;  3LR5 A;  2VEA A;  2V0U A;  3HUM A;  1KE4 A;  2JKT M;  5FI6 A;  5CEB A;  2VGL S;  4YWZ A;  4C75 A;  2G2W A;  5A91 A;  3IWI A;  4HP4 A;  2B18 A;  4S2N A;  2QKP A;  3CJM A;  2Y2M A;  3O3V A;  3NUL A;  4PKY A;  3LYX A;  3FPW A;  1K54 C;  2GZA A;  1OTD A;  1S66 L;  1KDS A;  2AVX A;  4FCF A;  3DTK A;  4CLC D;  5HAR A;  1DRM A;  3LGO A;  1T1C A;  3SH7 A;  1K0K A;  4G3K A;  1GSV A;  4EES A;  2WAD A;  3W4O A;  4OLD A;  3OCN A;  4Z9Q A;  5HPF A;  2ZM2 A;  3PBQ A;  4N1X A;  1E3U A;  3RFB A;  3BJN A;  3EQU A;  3G4P A;  3M6H A;  4EET B;  1Y54 A;  5DF7 A;  2PBY A;  3S7O A;  2ZL1 B;  1XJ3 A;  5F82 A;  1CJF A;  4OH0 A;  2VJW A;  3GR2 A;  4K91 A;  5J8X A;  3Q7Z A;  2VV6 A;  1FR6 A;  3NIA A;  1EWZ A;  4ARZ B;  1PWG A;  1I2W A;  1TS0 A;  3TSG A;  5AVF A;  4E6W A;  3WWX A;  3AGE A;  3EGD C;  2B02 A;  3OPH A;  2ZC3 B;  1RGZ A;  2BLS A;  3LI8 A;  1ONH A;  1FQG A;  3W8K A;  1U60 A;  4DN0 A;  3ZVW A;  4G3W A;  1X0O A;  2ZMV A;  2ZMA A;  4E3N A;  4R3B A;  3HLC A;  2C6W B;  5FQJ A;  5HAI A;  2Y4A A;  1K54 A;  2DRW A;  2XLN A;  4Y17 A;  2RL3 A;  2ZBB A;  1T1B A;  3KX0 X;  1MC0 A;  1PW8 A;  2WKQ A;  4BD0 A;  3TJZ C;  5TJJ A;  4LCM A;  1BLH A;  4QHC A;  3WS1 A;  3IBJ A;  1FCN A;  3CUE A;  1DY6 A;  3OBF A;  4I3A A;  4MBH A;  1FCM A;  1KVL A;  4FSF A;  1T18 A;  4Z1W A;  3ZHH A;  4LEN A;  5HWT A;  3NCK A;  1JTG A;  5HAQ A;  4GB7 A;  3IX3 A;  1N9B A;  1OTE A;  3G31 A;  1M6K A;  4DJ2 A;  4LPZ A;  4X55 A;  1F9I A;  3LFV A;  5E2E A;  3VOY A;  4EU0 A;  2OAP 1;  1BZA A;  3T1R A;  5A93 A;  3S7Q A;  1MKI A;  1NWZ A;  2WUQ A;  2H0Y A;  2PU4 A;  1JWP A;  2J9O A;  2NUP C;  1XJ4 A;  3PAG A;  4GKU A;  2WGV A;  4DMZ A;  3ZCZ A;  1BYW A;  4LV1 A;  2R9X A;  4KQR A;  3S4X A;  3PBO A;  4RQ9 A;  2XFT A;  3I7J A;  5DF8 A;  2IA2 A;  2WYX A;  1KGG A;  4JXW A;  1K38 A;  3VE4 A;  4JXV A;  4HJ6 A;  1GA9 A;  5J7E A;  1OPX A;  3F1O A;  2E8J A;  3V5M A;  4NEE D;  1G6A A;  1FCO A;  5EV0 A;  3TRC A;  3MR0 A;  4K0W A;  2Y2J A;  2QYB A;  4FD8 A;  5DVA A;  1ESI A;  1LLB A;  3LIB A;  2BG1 A;  1T1A A;  4KZ6 A;  2Z2M B;  4ESP A;  2DNS A;  3QNB A;  4C6Y A;  4E3O A;  2OLU A;  5FQ9 A;  4RYE A;  4ME4 A;  1VM1 A;  1QME A;  2Y2H A;  2P9V B;  3Q7V B;  3NOU C;  3KYZ A;  2WGW A;  4P6Z M;  3SS3 A;  2Y2K A;  4HH3 A;  3BFE A;  1YLW A;  3QP8 A;  4E6X A;  3NEC A;  4EWF A;  5HPI A;  4GDN A;  3WRZ A;  2K7S A;  2VX8 A;  5FQK A;  4GD8 A;  3C4O A;  4MBF A;  3LEQ A;  2X71 A;  1GCE A;  4L9G A;  5HSQ A;  5CX7 A;  3O86 A;  2Z6D A;  3RXW A;  2J3T C;  2XRN A;  1ODV A;  4EER A;  4S2I A;  3BLS A;  3FC7 A;  2XR0 A;  2WKR A;  2Y91 A;  1ERQ A;  1LI9 A;  4E04 A;  1JNU A;  3A3I A;  2WKH A;  3LIF A;  2XGN A;  4EQI A;  1QMF A;  3IBR A;  4E3K A;  3N8R A;  3ZVT A;  4OOM A;  3IF6 B;  4Q0H A;  4WM9 A;  1O7E A;  3ZYT A;  3S22 A;  1DJB A;  2YKF A;  3NOT C;  2HV1 A;  4BD1 A;  5IT5 A;  3E2K A;  1D06 A;  4UA6 A;  4S2M A;  2HJ9 C;  3JVV A;  1CEG A;  1UGU A;  2Z6C A;  5HD5 A;  5L07 A;  4RA7 A;  4LRX C;  1YLY A;  1NLY A;  5CER A;  2W1T B;  1Z6F A;  4R3J A;  4JGQ A;  5GLB A;  4KZA A;  4BL3 A;  1NLZ A;  1A0K A;  2V9A A;  1BLP A;  2J3W A;  3ZGA B;  3O87 A;  3ZFZ A;  1E4D A;  3PHY A;  4GOG A;  4U3T A;  3OCL A;  2ZC7 A;  3EOI A;  2P08 A;  2EX2 A;  1MKM A;  5MC7 A;  3SH9 A;  2PD8 A;  4WYY A;  4CLC E;  2O0Y A;  1SKF A;  4LV2 A;  4OKP A;  5EUA A;  4DDY A;  2QPN A;  1XXM A;  1W63 M;  3MMH A;  1TVF A;  5KZH A;  3UO9 A;  3F1N B;  5DFX A;  3D72 A;  2V1Z A;  4BJP A;  4JPM A;  4LLO B;  1CEF A;  2ZQC A;  4NXB A;  5EPH A;  4QJG A;  5F1F A;  3HLF A;  5TBM A;  4R38 A;  3GV9 A;  2JKT I;  4HNB A;  3WRT A;  2G2U A;  2I9V A;  4IUH A;  2EWW A;  4HP9 A;  4OQI A;  4UA7 A;  1TDL A;  3GEC A;  2JKF A;  2Q0O A;  4EEP A;  2XFS A;  4NXE A;  1I5Q A;  5EVI B;  1G28 A;  4L9E A;  3K2N A;  5GLA A;  5DTK A;  3G2Y A;  2HF6 A;  4U0X A;  3C4P A;  2OV5 A;  3MKF A;  4KZ4 A;  1YPR A;  3SS5 A;  1XA1 A;  1IOU A;  4O01 A;  4GHI A;  4IBX A;  1VET A;  2D01 A;  3T4Q A;  1LL9 A;  5CGX A;  1LI0 A;  4NXG A;  2V20 A;  1LSV A;  1N9L A;  3C5A A;  3F1P B;  1LSW A;  2W3G A;  3B33 A;  5M19 A;  3T4K A;  4IED A;  1PRQ A;  2PAV P;  2WZZ A;  3F1N A;  2XA7 M;  2K31 A;  4WEL A;  4KG6 A;  5CED A;  1ZTU A;  3VOL A;  3T4L A;  5A8B A;  2UV0 E;  1PI4 A;  2R78 A;  2WZX A;  4S2N C;  5LBR A;  3MXS A;  2O9C A;  4HH2 A;  2PR5 A;  4I5S A;  4F94 A;  2HZ5 A;  4BEN A;  4JF5 A;  3OLO A;  4GS9 B;  4IJG A;  4QD4 A;  4EXO A;  2ZOI A;  5E2F A;  3EEH A;  1ACF A;  1XGI A;  1TDG A;  2V8C A;  5FQQ A;  1SZV A;  1PW1 A;  3G35 A;  2IWC A;  1GHP A;  1K4E A;  2JCH A;  3M2K A;  3E4P A;  1E3U D;  4XT2 A;  1V9Z A;  2J8Y A;  3B47 A;  5TR7 A;  3CLO A;  4OPZ A;  2Y2I A;  2EFX A;  1OME A;  4JF4 A;  2QZ6 A;  4WLA A;  3SH8 A;  4UAA A;  5TGF A;  2JN7 A;  1MBL A;  2A24 B;  4D2O A;  2XK1 A;  4IBR A;  5GLC A;  3KYQ A;  3LR3 A;  1TD5 A;  1HD8 A;  4PM8 A;  4LGW A;  2A24 A;  1KE0 A;  5I94 A;  4YFM A;  1NRJ A;  1W79 A;  4H6J A;  2OAQ 1;  3C7V A;  1VET B;  1CI8 A;  5J3W A;  3VP2 A;  4IUK A;  2QJ7 A;  2GDN A;  2HGV A;  2WKI A;  3IF6 A;  2WGI A;  4WMC A;  3KSG A;  4HBU A;  3LI9 A;  3DTI A;  4N92 A;  2KX6 A;  2KDK A;  2XQZ A;  1ALQ A;  3OOV A;  3B42 A;  4KZB A;  2DMW A;  2L0W A;  4JGP A;  1BT5 A;  2HDR A;  3UB9 A;  5D3O A;  3ITB A;  4R4R A;  4MNR A;  3NDG A;  4CJN A;  4PM5 A;  3LR0 A;  1Y28 A;  4BL2 A;  4L0L A;  5FEG A;  2V0W A;  1XFN A;  2V1B A;  4Q0I A;  4YNR A;  3LY4 A;  3NDE A;  3UNW A;  2NUT C;  2DCF A;  3Q81 A;  5TFQ A;  2VGL M;  1L0F A;  4HBT A;  5FEF A;  3BEC A;  5HZH A;  1YKD A;  5F1G A;  4Y2F A;  4HEF A;  1XA7 A;  3KSH A;  4C3Q A;  4DDS A;  3Q7V A;  3B3X A;  2LB9 A;  3FZC A;  2P9V A;  3ULF A;  1PWD A;  2A49 A;  4X1L A;  2PU2 A;  4Y0U A;  4MN6 A;  3P7N A;  3SOI A;  3E4Q A;  4UQI S;  2Q9N A;  5AQB A;  1SHV A;  2XA7 S;  1K57 C;  2H5S A;  3BFG A;  4QU3 A;  3DAV A;  3VV4 A;  2HP6 A;  2X02 A;  4D60 A;  5BOH A;  5FDS A;  3IH9 A;  4GCZ A;  5EM1 A;  4BBT A;  3V50 A;  3AGD A;  1YT4 A;  1BUL A;  1XP4 A;  5EVE A;  1YQS A;  3ZNY A;  3CPT B;  4QY6 A;  1ERM A;  4OOL A;  1DP8 A;  3G6O A;  1LSX A;  4OP8 A;  1T19 A;  4K0X A;  4WMC D;  2Y59 A;  2V8F A;  1NXY A;  2CC1 A;  3MQ0 A;  4BWI A;  2XH9 A;  4WZ5 C;  5TBM B;  4BQM A;  4CQH A;  1KVM A;  3S7N A;  2VLG A;  2XF3 A;  5CXW A;  1DP6 A;  2EA9 A;  4NG2 A;  2J80 A;  2GX5 A;  3IS2 A;  5CEC A;  3OPP A;  3OPR A;  1F98 A;  1GHM A;  4RVA A;  2Y55 A;  1SKO B;  2W27 A;  4X56 A;  5GHZ A;  5KSH A;  4JLF A;  3V67 A;  5AQ7 A;  3FV7 A;  3IQA A;  3EQV A;  1ES2 A;  3ZQ5 A;  2XRO A;  2QWS A;  4E3I A;  3BFD A;  2PD7 A;  3LEZ A;  1W7F A;  1FIL A;  3VMA A;  3DTM A;  4Q8I A;  1H0M A;  3W2Z A;  3GSG A;  5CTM A;  1AWI A;  5G4Z A;  3PXP A;  1S67 L;  5CGW A;  2J9P A;  4MN5 A;  5FL3 A;  2I72 A;  5F5Y A;  4ZJ1 A;  3CG5 A;  5L2F A;  3G2Z A; 
#chains in the Genus database with same CATH homology
 4F3L A;  3O5Y A;  5AJG A;  4ARZ A;  3ZYT A;  4GHI B;  3PBT A;  3EEA A;  5HDC A;  2YKF A;  3VE3 A;  3NOT C;  4I3J A;  2HV1 A;  4WL9 A;  5IT5 A;  4JGR A;  4R70 A;  1D06 A;  3T4J A;  2FH5 A;  2HJ9 C;  1XJ6 A;  3JVV A;  3D3O A;  4IHQ A;  4CLC C;  4KQD A;  1UGU A;  2Z6C A;  5HD5 A;  3F1P A;  2VA0 A;  2Y79 A;  1DP9 A;  2JKR M;  4LRX C;  4UQI M;  1NLY A;  2W1T B;  1F5M A;  4JGQ A;  4L9F A;  2W3E A;  4MMN A;  4JGO A;  1TS7 A;  2JHE A;  4Y3I A;  1P9R A;  3T4O A;  2O9B A;  3FG8 A;  1TS8 A;  1OTI A;  1S4R A;  5DKL A;  5DJT A;  3U2A A;  3H9W A;  5HDD A;  3LID A;  1NLZ A;  3C8C A;  3T50 A;  3K3D A;  2V9A A;  2J3W A;  4F3L B;  2BAS A;  4XT2 B;  3PHY A;  3OCL A;  4Q0J A;  3EOI A;  2P08 A;  4CLC A;  1XJ2 A;  1MKM A;  5MC7 A;  1H8M A;  2PD8 A;  2GNX A;  1N9O A;  4CLC B;  3UE3 A;  3LIC A;  4K08 A;  4CLC E;  2O0Y A;  4EUV A;  2YKH A;  2L1M A;  2A2L A;  2PR6 A;  4HY8 A;  2K2N A;  2MJ6 A;  3NJA A;  2W1T A;  1OTB A;  1W63 M;  2PYP A;  4O0P A;  3MMH A;  3C2W A;  3RTY A;  3T4T A;  3F1N B;  3MFX A;  5DFX A;  3D72 A;  4BJP A;  4LLO B;  4NXB A;  5DFY A;  5HWW A;  4HQA A;  4B93 A;  3MXQ A;  4NKP A;  5TBM A;  3RH8 B;  4R38 A;  2J3T D;  2W3D A;  2LB5 A;  2ZOH A;  5HDS A;  2JKT I;  4HNB A;  4ZRR A;  2I9V A;  4IUH A;  4H6J B;  2EWW A;  2M1C A;  3UB6 A;  4HP9 A;  4ETZ A;  2M7V A;  4PKY G;  3GEC A;  2W0N A;  3C38 A;  4R6L A;  4EEP A;  4WUJ A;  4NXE A;  4LRZ E;  3LR5 A;  4HJ4 A;  3BQA A;  1GSW A;  2VEA A;  2V0U A;  1G28 A;  4L9E A;  3K2N A;  1IFQ A;  2EWV A;  3LIE A;  4HI4 A;  3H7W A;  2HF6 A;  2JKT M;  5K5B A;  4KUO A;  2VGL S;  1IOU A;  4YWZ A;  2VV7 A;  4O01 A;  2VV8 A;  4GHI A;  2D01 A;  4HP4 A;  3T4Q A;  2B18 A;  2QKP A;  3UMD A;  3H82 A;  5HL6 A;  4NXG A;  4ETX A;  4PKY A;  3H7W B;  2WKP A;  3LYX A;  4M4X A;  3S7P A;  3FPW A;  1LSV A;  3MF0 A;  1N9L A;  3UB7 A;  2GZA A;  1OTD A;  1GSX A;  3F1P B;  1LSW A;  3A0V A;  3T4S A;  1S66 L;  2W3G A;  3B33 A;  1KOU A;  3T4K A;  4CLC D;  1ZHH B;  4MDZ A;  1DRM A;  1W63 Q;  1YAX A;  3MQO A;  3A0R A;  1OTA A;  1T1C A;  3E4O A;  3F1N A;  2XA7 M;  3BY8 A;  4G3K A;  5F6A A;  2K31 A;  4WEL A;  1ZTU A;  3CI6 A;  2ZMF A;  3VOL A;  1GSV A;  3T4L A;  4EES A;  3CAX A;  5A8B A;  3OCN A;  2O9A A;  1YSQ A;  2R78 A;  5LBR A;  4BBU A;  4KQO A;  3JVU A;  5HPF A;  2O9C A;  4HH2 A;  2PR5 A;  3PBQ A;  5J4E A;  1S1Z A;  4I5S A;  4YOF A;  5IU1 A;  3RFB A;  3BJN A;  3EQU A;  1XFQ A;  3OLO A;  3E0Y A;  4GS9 B;  4IJG A;  4EET B;  3P01 A;  4EXO A;  2ZOI A;  3TW8 A;  2W1R A;  3S7O A;  3UE6 A;  1XJ3 A;  3EEH A;  1OT9 A;  2KOI A;  3CUE C;  2VJW A;  3PYP A;  1VHM A;  2VV6 A;  4EW7 A;  2OWJ A;  1MZU A;  4ARZ B;  2W3H A;  4GLQ A;  4DJ3 A;  1TS0 A;  1G6O A;  3E4P A;  4XT2 A;  3TE8 A;  1OJG A;  1V9Z A;  3B47 A;  3KSI A;  4UEY A;  3CLO A;  3NOP C;  3BQ8 A;  4KUK A;  5AVF A;  4NXF A;  3IS2 B;  3EGD C;  3ICY A;  4MCW A;  2B02 A;  3K3C A;  4I39 A;  3LI8 A;  4WLA A;  3A0S A;  1LT0 A;  4DN0 A;  4G3V A;  2M7U A;  2JN7 A;  3PBR A;  2XSS A;  4EQ1 A;  2A24 B;  4G3W A;  1X0O A;  2ZMV A;  5G4Y A;  1VB6 A;  3KYQ A;  3HJK A;  3LR3 A;  1TD5 A;  3LIA A;  2GJ3 A;  2A24 A;  3LUQ A;  5HD3 A;  2ZBB A;  1T1B A;  3KO6 A;  3KX0 X;  3PBS A;  1MC0 A;  2WKQ A;  1NRJ A;  3TJZ C;  3LR4 A;  5TJJ A;  4H6J A;  3C30 A;  1TS6 A;  2OAQ 1;  2P7J A;  3EGX C;  3GDI A;  4WF0 A;  3IBJ A;  2V1A A;  3CUE A;  3OBF A;  4I3A A;  5J3W A;  1P9W A;  4IUK A;  3FPV A;  1UWP X;  2QJ7 A;  3R7W A;  3UME A;  4II7 A;  4FSF A;  1T18 A;  2HGV A;  4Z1W A;  3BW6 A;  1STZ A;  5DJU A;  5HWT A;  1OT6 A;  3KSG A;  3LI9 A;  4BBV A;  2KX6 A;  2KDK A;  1OTE A;  3OOV A;  4DJ2 A;  3B42 A;  4LPZ A;  1F9I A;  3LFV A;  2DMW A;  4WEK A;  2L0W A;  4JGP A;  5KIZ A;  3UB9 A;  4LRY C;  4EU0 A;  2OAP 1;  3OC2 A;  4HHD A;  4O8G A;  3S7Q A;  5HWV A;  1NWZ A;  2KLI A;  3LR0 A;  1Y28 A;  4L0L A;  1LL8 A;  2NUP C;  2V0W A;  1XFN A;  1XJ4 A;  2V1B A;  3CIT A;  3EWK A;  2QHK A;  4GS9 A;  2D02 A;  4Q0I A;  4YNR A;  4DMZ A;  1P0Z A;  2NUT C;  4HIA A;  2W3F A;  3R4K A;  2Y8H A;  1BYW A;  1V9Y A;  2VGL M;  3PBO A;  2P04 A;  4RQ9 A;  2OOL A;  2IA2 A;  1UWN X;  4WN5 A;  5HZH A;  2O99 A;  1YKD A;  4Y2F A;  4R3A A;  3VE4 A;  3UB8 A;  3SW1 A;  4HJ6 A;  3KSH A;  3ULF A;  2LB9 A;  2QJ5 A;  2PHY A;  5J7E A;  3F1O B;  1OPX A;  1WA9 A;  3F1O A;  4HJ3 A;  3NHQ A;  2H28 A;  4MN6 A;  3P7N A;  3R7W B;  3E4Q A;  4NEE D;  4UQI S;  4AFI A;  5IS1 A;  2XA7 S;  4GJ4 A;  4BMW A;  3VV4 A;  4I38 A;  3TRC A;  4EEU A;  3MR0 A;  1TF1 A;  2PT7 A;  3H82 B;  4GCZ A;  5I5L A;  2VKS A;  2JKR I;  2QYB A;  4BBT A;  1EW0 A;  2PYR A;  3BY9 A;  3CWF A;  3LIB A;  1T1A A;  1H3Q A;  3MQQ A;  4P6Z S;  4OOL A;  1DP8 A;  3G6O A;  4Y5F A;  1YSP A;  1LSX A;  4ME4 A;  1S1Y A;  1T19 A;  3PBN A;  4QPR A;  3KYZ A;  3NOU C;  3MQ0 A;  4P6Z M;  4BWI A;  5C5K A;  3HJI A;  4HH3 A;  5F68 A;  2L4R A;  5L8M A;  4FOF A;  5TBM B;  5HPI A;  4PAU A;  4CQH A;  2K7S A;  2VLG A;  3S7N A;  2CMN A;  2VZW A;  1S4S A;  2VX8 A;  1DP6 A;  5F69 A;  2OWH A;  2EA9 A;  5DF9 A;  4B9O A;  2J80 A;  2GX5 A;  3IS2 A;  5AVE A;  4WEJ A;  1F98 A;  2W27 A;  4L9G A;  4GW9 A;  5KSH A;  2HJE A;  5EFW A;  5DKK A;  3V67 A;  5HSQ A;  3EQV A;  3ZQ5 A;  2PDR A;  3PR6 A;  2XRO A;  2QWS A;  5CX7 A;  3MJQ A;  3BWL A;  2INW A;  3E98 A;  3HCY A;  2Z6D A;  4PHT A;  2J3T C;  2PD7 A;  2XRN A;  1N9N A;  1ODV A;  4EER A;  4HOI A;  3FC7 A;  3W2Z A;  3DBA A;  5G4Z A;  1OJ5 A;  3PXP A;  1S67 L;  2G7U A;  1P97 A;  2WKR A;  4E04 A;  1JNU A;  4MN5 A;  3LIF A;  5FL3 A;  2FZ0 A;  5F5Y A;  3IBR A;  4MN7 A;  3KSF A;  1D7E A;  4I3I A;  4OOM A;  4Q0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...