1D06A

Structural basis of dimerization and sensory mechanisms of oxygen-sensing domain of rhizobium meliloti fixl determined at 1.4a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
GSHMLETEDVVRARDAHLRSILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sensory mechanism of oxygen sensor FixL from Rhizobium meliloti: crystallographic, mutagenesis and resonance Raman spectroscopic studies
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
molecule keywords nitrogen fixation regulatory protein fixL
total genus 38
structure length 130
sequence length 130
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d06A00
2PYPA 1TS6A 2H28A 1GSWA 4H6JB 4JGRA 4WLAA 1TS8A 2ZBBA 4L9GA 3IS2B 2PYRA 4MN6A 5G4YA 4EERA 1Y28A 4WF0A 2HV1A 1T18A 1LSXA 3A0RA 3H7WB 1T1CA 3BWLA 3LYXA 3GDIA 3T50A 3SW1A 2WKRA 1X0OA 2L0WA 5HWVA 4MN5A 3UMEA 1DP8A 3RTYA 3ULFA 3BY9A 4HNBA 3NOUC 3MFXA 1OTEA 3A0SA 4WN5A 1S1ZA 1EW0A 1WA9A 3K3CA 3E4PA 3P7NA 4R3AA 3LI9A 4JGQA 4NXFA 4KUOA 2QHKA 5DKLA 1OJGA 2PD7A 3MXQA 4JGPA 4NXEA 4BBVA 4R38A 5HWWA 4R6LA 3VOLA 2QKPA 3LUQA 4I38A 4HOIA 1F98A 4KUKA 4L9FA 4F3LA 2L1MA 4HP9A 2KX6A 1LT0A 2V0UA 1KOUA 3D72A 2A24B 2PDRA 3F1OA 3F1PA 3IBRA 4GHIA 2YKHA 1S4SA 2VEAA 1DRMA 1P97A 5HDCA 2VV6A 4H6JA 4NXGA 1F9IA 4BBUA 2D02A 1TS0A 4HP4A 4RQ9A 1N9OA 2V1AA 4XT2A 3B33A 3H82A 1LL8A 2EA9A 1N9LA 5F5YA 1OT6A 5TBMA 4EETB 5IS1A 4NXBA 3LICA 2J80A 3MJQA 1ODVA 5IU1A 3UMDA 2V9AA 2B02A 2YKFA 5J7EA 5A8BA 3UB7A 2I9VA 5DJUA 3LIBA 1XJ6A 2WKQA 4GW9A 3CWFA 3UB6A 3MQOA 3MQQA 4I3JA 5F6AA 2INWA 3H7WA 4DJ2A 3KX0X 2QWSA 3GECA 1XJ2A 3FG8A 1BYWA 2P7JA 5F69A 3H9WA 4HH3A 1V9YA 4KQDA 5AVEA 3PHYA 3E4OA 1VB6A 1N9NA 2V0WA 1UWNX 2WKPA 3HJKA 1OTDA 5F68A 2D01A 3ICYA 1OTBA 5G4ZA 4M4XA 3UB9A 4B9OA 2W0NA 4EEUA 5HSQA 3LI8A 3MR0A 4LLOB 2PHYA 4XT2B 3F1NA 4HH2A 4L9EA 2OOLA 3F1NB 1XFNA 2Z6CA 1S66L 2VV8A 3IS2A 4F3LB 4PKYG 4I3IA 5KIZA 2VV7A 3C2WA 4DJ3A 3CAXA 3BY8A 4HJ4A 4GS9A 1OJ5A 1S1YA 2GJ3A 4LRXC 4JGOA 5HD3A 1DP9A 3EWKA 2L4RA 2W27A 3VE4A 1XJ4A 2V1BA 3ZQ5A 4E04A 3LIAA 4EEPA 1T1AA 5J4EA 1P0ZA 2ZOHA 1S67L 5EFWA 2JN7A 3HJIA 4LRYC 4K08A 4HY8A 4I5SA 2PD8A 3LIFA 4LRZE 2A24A 3F1OB 4EW7A 3F1PB 4EXOA 3H82B 1D7EA 3E4QA 5HDSA 1OTAA 1JNUA 4I3AA 1UWPX 3K3DA 4R70A 2K7SA 4HIAA 5TBMB 2OWHA 1LSVA 3OLOA 3UB8A 3LIDA 5HWTA 1LSWA 1MZUA 4PKYA 5AVFA 5J3WA 3LIEA 2PR5A 2R78A 1T1BA 1GSVA 3C8CA 4GCZA 5DKKA 2M1CA 2JHEA 3RH8B 1OTIA 4BBTA 5HZHA 4GS9B 4YWZA 1T19A 1DP6A 1G28A 3NOPC 4HJ3A 4LPZA 2OWJA 3VE3A 4HHDA 1NWZA 2KDKA 4HI4A 1GSXA 1S4RA 5I5LA 1XFQA 1OT9A 4GHIB 4HQAA 5DJTA 1UGUA 2QJ5A 1D06A 2Z6DA 3A0VA 4EESA 4WUJA 2ZOIA 3PYPA 2VLGA 3NJAA 5HD5A 2PR6A 1XJ3A 3FC7A 2QJ7A 2BASA 3G6OA 3NHQA 4HJ6A 4I39A 5HDDA 3CLOA 4WL9A 3NOTC 1V9ZA 3UE6A 1TS7A 2CMNA 4EQ1A 3EEHA
chains in the Genus database with same CATH superfamily
2OSUA 3GVBA 1W63Q 3FWLA 3SW1A 2EWVA 3ZVTA 3BFGA 3MMHA 1PYYA 5FAPA 2ZC4B 2XSSA 2A24B 3F1PA 3MKEA 5E2EA 3LICA 2J80A 2XD1A 4JKTA 5A8BA 2ZQ9A 3FKWA 3CWFA 5HW3A 3VP3A 5TJJA 4CPKA 3LEZA 5CERA 2OAQ1 5AVEA 5DVAA 4FH4A 1N9NA 4RA7A 3VFHA 3QP4A 2Q0OA 4B9OA 1EI5A 4P85A 4PKYG 4DJ3A 1GHPA 3BY8A 3N8RA 2EXAA 4ZBEA 3NECA 4G3KA 2J8YA 4EBNA 3S7OA 2H10A 3VOYA 2O9BA 4IUHA 4N9KA 4LGWA 3UB8A 2V8CA 3Q07A 2NUPC 4OOLA 1TDLA 3VSKA 2EXBA 4QD4A 1V9ZA 3MKFA 1TS7A 3UDXA 1MPLA 3WRTA 2ZMAA 4UA7A 2Y2JA 4WEJA 4EU0A 4JGRA 2Y2OA 1VEUA 5HPIA 3H7WB 4NETA 1PWGA 4GDNA 2FFFB 1DP8A 2CC1A 4Q0HA 3UE3A 1QMFA 3WS5A 5I94A 4R3AA 4BLMA 5HWWA 2XFSA 2PAVP 1TF1A 3BFEA 4OQIA 3MBZA 2D02A 3HLEA 3M6BA 4G3WA 1ONGA 3UPOA 1ODVA 5K5BA 3AGEA 2YKFA 2ACGA 3KYEA 1MBLA 4DRTA 1DJAA 4EBPA 2JKGA 4I3JA 3SS3A 1L0EA 1XJ2A 3FG8A 4Q8IA 2OLVA 4C6YA 4S2JA 3IH8A 1MY8A 2ZQ8A 2DRWA 2P9VB 4L9EA 4Z1WA 2Y2GA 3PBSA 1VM1A 4WMCA 2VV7A 4ARZA 2NUTC 4KZ5A 2AVXA 4GS9A 2Z2LB 1K57A 1GHMA 2K31A 2L4RA 3VE4A 4O8GA 5GHXA 3E2KA 5EFWA 4UA9A 4S2NC 1S6RA 3BFCA 1BLPA 3WS1A 1ES3A 5J3WA 3C8CA 5DKKA 2JHEA 2ZL1B 1JVJA 5HFOA 2WGVA 1G6OA 2KDKA 4OH0A 1XJ3A 4Z9QA 3PBTA 1ERMA 5FAQA 1ES4A 3BJNA 3L9KA 4GOGA 5HAQA 1JWZA 3GDIA 2IA2A 1FSYA 4L0LA 5HWVA 1CEGA 1CJFA 4HEFA 1RGZA 4KZ7A 4OPZA 4GD8A 4HBUA 4OPYA 5IHVA 2V0UA 3D72A 1NZOA 3FKVA 2VEAA 5FEFA 1IYOA 4RQ9A 2J3WA 1VETA 3UMDA 2V9AA 1GCEA 3G32A 1ZG4A 5HARA 3B42A 5A92A 1G6AA 3QNBA 1L0FA 4JF6A 4HH3A 3WWXA 1XX2A 1K57C 2JKTI 3HCYA 5TR7A 1UWNX 2WK0A 1OTDA 1VEUB 3O86A 4JF5A 4PM7A 5L10A 1TVFA 1M40A 4QY6A 3IWQA 4LV0A 3HBRA 4R23A 4JBFA 1NYMA 1Z09A 3EWKA 3CUEA 2HZ5A 4LRYC 2PD8A 4P6ZM 4LRZE 5CEBA 2JKTM 4MMNA 4K0XA 2Y55A 5AQ7A 4RVAA 1GSVA 2WGWB 1MWRA 1NWZA 3T4KA 1N4OA 3PAGA 2QJ5A 4EESA 3UDIA 5JYOA 2V8FA 3PYPA 4DXCA 5EVIA 2ZMVA 1K6RA 1JWVA 4WMCD 1ESUA 1GHIA 3V50A 3IS2B 2WZXA 1RGYA 5FDHA 3HLBA 3S4XA 2HJ9C 4GD6A 2P74A 1FCOA 4Y7PA 3C4OA 4WN5A 3TW8A 1S1ZA 5CGSA 3O5YA 1OJGA 2PD7A 4E3LA 2XA7M 4NG2A 4OONA 1BZAA 2JC7A 3OC2A 1L2SA 4CJNA 4PHTA 4H6JA 4XT2A 5GHZA 3T1RA 3ZG9B 3CG5A 3P01A 5GLBA 1YLJA 1TD5A 4Y5FA 1W5DA 2WKQA 3QP6A 3MQQA 1YQSA 4X56A 2HDQA 2KOIA 5F1GA 1K38A 3CZDA 1XA1A 5F68A 3IWOA 4O0PA 1FOFA 4M4XA 3UB9A 1CI8A 3DW0A 3UN7A 4XT2B 1DJCA 3OPRA 1KGEA 1E4DA 3ZQ5A 3BQ8A 3LIAA 3IH9A 3RJUA 3SH7A 4R3BA 3LIFA 2UV0E 5FEGA 3LR5A 3PBQA 2B5RA 3VSLA 1F5MA 3TG9A 4WEKA 3MXRA 2ZC6B 3ZNYA 3RH8B 5EVEA 5D3OA 5L2FA 4FUWA 4HI4A 4DKIA 1S4RA 3MZEA 2W3HA 5MC7A 2PR6A 4FOFA 3B3XA 3F1NA 1ZC2A 4WLAA 1OMEA 1LSXA 3A0RA 3LYXA 4B4XA 1X0OA 2W1TB 4X53A 3ULFA 5DF8A 4OP8A 2UWXA 5DTKA 4LCLA 3OBFA 3T12B 2Y2LA 3EOIA 3SS4A 1VQQA 4NXGA 2EA9A 1N9LA 3V5MA 1SKOB 3MJQA 4X69A 1TDGA 2QPNA 2Y2PA 4O01A 2GDNA 4OPQA 2V2FF 2EX6A 3FPWA 2WAEA 4S2KA 1BLSA 4CLCB 2QZ6A 1I5QA 5L8MA 1K4FA 3MF0A 4JXVA 1XFNA 5FI6A 2G2UA 3JVUA 3C38A 3CAXA 4HJ4A 1PI4A 3MXSA 1FILA 3LR4A 2ZL1A 1K55A 4KG6A 1P0ZA 3TRCA 5A90A 4ZJ2A 2EFUA 1W79A 2PBDP 3NY4A 1PIOA 1JTGA 3V67A 3KYQA 1H8YA 1MZUA 2HDRA 3A3FA 5F83A 4QPRA 4S2PA 4MDZA 1K56A 4HQAA 1UGUA 2VGJA 3KSGA 2Z6DA 5FSRA 4DXBA 2GZAA 4I39A 1F2KA 3G6OA 4JLFA 3CITA 5C5KA 1J9MA 3T1SA 1WE4A 4X6TA 2HF6A 3HUOA 2ZBBA 4GB7A 5G4YA 3BFDA 4GLQA 4EUVA 1EROA 3ZFZA 1NLZA 3E0YA 4UA6A 3C4PA 4OPRA 4R38A 4I38A 3DWZA 4L9FA 2OV5A 1F9IA 2H5SA 3MZFA 3FV7A 4ZTKA 4DDYA 3LR0A 3BECA 3UO9A 2XLNA 3LIBA 4GW9A 2V1ZA 3M2JA 5BOHA 2OLUA 5E2FA 5F1FA 3KSFA 3NI9A 4LLOB 1STZA 1MC0A 4PPRA 2VV8A 1P9RA 3C7UA 5U47A 2FZ0A 2G7UA 3IBJA 4P0MA 2WGWA 3ITAA 3PAEA 1K54C 4E04A 2XRNA 4ZRRA 3HLWA 5DFYA 2ZQDA 2PBYA 3H82B 1D7EA 1NY0A 3E4QA 1YLPA 1OTAA 3S1YA 4KZ8A 3A3IA 4ZJ1A 4DDSA 3C5AA 4WZ4A 2B18A 4YWZA 1Z6FA 4HJ3A 4JF4A 4IEDA 4JPMA 5HPFA 1GSXA 4ETXA 3GQZA 2HGVA 2QJ7A 2BASA 2ZMFA 2IWBA 4D60A 2CMNA 4M3KA 2HP5A 3IXBA 2IWCA 4H6JB 3T4OA 2PYRA 1AXBA 1ONHA 5KSCA 1K6SA 3IT9A 2HJEA 3D4FA 3OPHA 3K3CA 2ZD8A 5EOEA 4JGPA 4BBVA 3AGFA 3HLGA 2L1MA 2WKHA 4KENB 1M6KA 5EVLA 3NULA 1PWCA 5TBMA 5KMWA 2J7VA 3P09A 1YM1A 2B02A 3BW6A 4MEZA 1PRQA 3NC8A 4B4ZA 1IYQA 2XROA 4BWIA 3QHYA 1XGIA 3RFBA 2WKEA 4NKPA 1VB6A 5HL1A 3BYDA 3IXGA 2J3TD 2Z2MB 3QP8A 4OVDA 4UQIM 3I7JA 3WS0A 3NDGA 4HH2A 2OOLA 2W1RA 5DFXA 5EOOA 1S66L 4I3IA 4LRXC 4NEED 4KZ9A 1XJ4A 4N1XA 1KDSA 1KE0A 1IKIA 3MS6A 3F1PB 3HUNA 4Y3IA 4EXOA 2EX2A 3E98A 4IJGA 2A2LA 2OWHA 3OLOA 4QJGA 2VGLM 4X1LA 2ZQ7A 4GS9B 4OP5A 3CPTA 3U2AA 2VLGA 4P6BA 5HD5A 3CLOA 4WL9A 3O88A 2H28A 1SHVA 1ES2A 1KVMA 1Y4OA 4KZ3A 4BD0A 2C5WB 3MSHA 3HVFA 4MLLA 4E3KA 2QHKA 5DKLA 3ZG5A 2Y59A 3LUQA 3M6HA 2ZQCA 1FSWA 2PDRA 3IBRA 1S4SA 1P97A 3DAVA 3WRZA 5CX7A 1PNEA 2PRFA 2Y2NA 1LL8A 3Q7VB 4N92A 3UE0A 1ZG6A 3IXHA 1XJ6A 3UB6A 1YLTA 4N9LA 5A93A 1CQAA 4YOFA 2JE5A 4XUXA 4JXGA 4C3QA 1K4EA 3E4OA 2Y2MA 5EVIB 1YT4A 1QMEA 5G4ZA 4S2MA 2MJ6A 3FYZA 1ERQA 1BSGA 3PTEA 3IS2A 1BULA 1OJ5A 1S1YA 2GX5A 3QP1A 3LY4A 1T1AA 5CXWA 4HY8A 4EQIA 4K91A 4KG5A 2FFYA 3DTEA 3G4PA 3A3DA 4H8RA 4FH2A 5FQKA 2H0TA 3OPPA 4E3OA 1YLZA 3IF5A 5G18A 4LPZA 3UE1A 4B88A 3VFFA 5I5LA 1OT9A 3JVVA 4E3MA 3OCLA 1N9BA 1GA0A 4RX2A 1LL5A 2HDUA 4WF0A 2HV1A 3IX8A 3DTIA 2V20A 1CI9A 1AWIA 4P87A 1MWTA 3V39A 1DJBA 1DY6A 3LI9A 3MXQA 3VOLA 4MNRA 2H0YA 4HP9A 4LCMA 1LT0A 1KOUA 1LHYA 4EBLA 3UE6A 1HZOA 4HP4A 2PU4A 1N9OA 4WYYA 1SKFA 4DE3A 1W8YA 5TFQA 3VP2A 2ZC5B 2QWSA 2BG1A 1ES5A 3B47A 2QMIA 4PM6A 3D3OA 2ZJ9A 1K54A 4EV4A 1BT5A 2V0WA 1NLYA 2D01A 3ZG7B 5FI7A 3M2KA 4UHUA 5GHYA 5CGXA 4S2NA 2P04A 1YAXA 1L3LA 4OLDA 4IHQA 4EEPA 4DMZA 3UY6A 3HJIA 2LB5A 4WBGA 4PM5A 3IX3A 1MWUA 4I5SA 1ALQA 5LBRA 3EGXC 2XF3A 5FAOA 1Q2QA 3IHBA 2K7SA 3Q7VA 4HIAA 2PT7A 1KE4A 4U0XA 3CI6A 2A49A 1RCJA 4PKYA 5CGWA 5A91A 5HZHA 1K55C 2JKRM 3QP2A 4K0WA 4GHIB 2EFXA 1YKDA 2WUQA 3HUMA 3JPUA 1RP5A 4U0TA 2W3EA 4EQ1A 2XQZA 1E25A 1TS6A 3T4LA 1TS8A 5FATA 1ACFA 1T18A 3ZGAB 4MN5A 3GSGA 4HBTA 3RTYA 4HNBA 1OTEA 3FPVA 3LFVA 1JWPA 2HPBA 3O3VA 1YMXA 1XXMA 1BUEA 2K2NA 3GMWA 2JKFA 1FCNA 3V3RA 1H0MA 2W1TA 5J7EA 1YSQA 3N8LA 2XGNA 1XKZA 3H7WA 2W3GA 1O7EA 3MQ0A 5HL6A 5HX9A 4A5RA 2P7JA 3K2NA 4YFMA 5M18A 4UQIS 4IVIA 3GV9A 3ICYA 1IELA 4ZAMA 3IHAA 4R3JA 5HSQA 2VGKA 2Z6CA 3C2WA 3UNWA 2WADA 5CTNA 3NBLA 1DP9A 1J3WA 1G68A 4K08A 3O87A 4LV2A 3SOIA 2ZM0A 3ZDJA 4DE0A 1OPXA 1UWPX 5TBMB 3R7WB 4CLCC 3SH8A 1T1BA 4GCZA 1Y54A 1IKGA 1OTIA 2XFTA 4BBTA 4LV3A 2JKRI 1G28A 3NOPC 2O0YA 2G2WA 1K25A 1HVBA 4IBXA 4JXWA 5FQ9A 3NJAA 3NHQA 2RL3A 4QWOA 4UEYA 5HDDA 3TSGA 2HDSA 2BTFP 4C75A 5L09A 3GRJA 5IT5A 1NXYA 3GR2A 3T4TA 4WELA 4E6XA 4WZ5A 5GLCA 2L0WA 4MBKA 2WAFA 2I72A 4G3VA 3DTKA 2C6WB 3NOUC 4LFUA 5EV0A 3N6IA 1W8QA 5M1AA 4NXEA 1YMSA 2Y4AA 3CJMA 4MBHA 4BMWA 4ETZA 5E2GA 3W4OA 1MWSA 4EETB 4EWFA 4NXBA 3C30A 4E6WA 3C7VA 3PBNA 1NYYA 1MKIA 1YLWA 5DJUA 2QYBA 4KZ4A 5F6AA 4GJ4A 3V3SA 3DTMA 4E3JA 2XD5A 1S0WA 5GLDA 3PHYA 3KYZA 4EEUA 3MR0A 4UAAA 3F1NB 2XK1A 4Q0JA 1XGJA 1VETB 3LGOA 3L7HA 4ID4A 3UDFA 3Q82A 4KQOA 3UPPA 2ZC3B 2R9WA 5TGFA 2V1BA 1S67L 5EECA 1C3BA 3W4PA 4P6ZS 3DWKA 3GTCA 3RXWA 5GL9A 1EWZA 3MFDA 1HLUP 2W3DA 3ZYTA 1NZUA 4OQGA 2FH5A 1LSWA 5CTMA 5AVFA 4E3NA 1PWDA 3WS4A 2M1CA 2KLIA 3HLDA 1DP6A 1XA7A 3EGDC 4WUJA 4Y2FA 3ITBA 1XP4A 4B93A 1ZHHB 5E43A 4RX3A 4NK3A 1Q2PA 4BJPA 1CK3A 5FDSA 1GA9A 3T50A 1FCMA 4X55A 3AGDA 4PM8A 1L0DA 2W3FA 3IF6B 3WS2A 1EW0A 4BQMA 4R4SA 4BD1A 4OQHA 1SCWA 3EQVA 4PAUA 2RCXA 5J8XA 4F3LA 1D1JA 2VV6A 3KSIA 1W7FA 2XDMA 2VKSA 3W4QA 3T4SA 3TOIA 3UB7A 1ZTUA 4Y13A 4IVKA 5FQIA 2R9XA 4Y0TA 3LCEA 4DJ2A 5AJGA 4GDBA 1IFQA 1NRJA 1YSPA 4DN0A 4KZAA 1HD8A 2ZLYA 3HL9A 2VX8A 2O9CA 1IOUA 4ESPA 3LI8A 3ZNTA 2PHYA 4F3LB 5DTTA 2Y2HA 4N1HA 4LENA 2JBFA 3SS5A 4GZBA 5J4EA 1CEFA 2WZZA 2ZOHA 1WYBA 2A24A 3S7QA 5CECA 4IBRA 5EM1A 5EE8A 3PR6A 1SZVA 2O9AA 2LB9A 3LIDA 4ARZB 1NRFA 3E2LA 3EQUA 3U4LP 1KVLA 1K56D 2XEPA 3G31A 1H5XA 4KQQA 4GN2A 3NOTC 3EEHA 3LEQA 2M7UA 3A3JA 1XPBA 4MN6A 3FZCA 3R7WA 1Y28A 3S7NA 2DCFA 1K0KA 3MFXA 5GLAA 4YINA 4X1MA 3E4PA 4JGQA 1HTZA 2QKPA 1P9WA 3IXDA 4Q0IA 3BLMA 3G2YA 4II7A 3EEAA 4R4RA 3H82A 4PM9A 5F5YA 4F94A 3Q7ZA 1I2SA 3UB5P 1JTDA 3MQOA 2HP6A 2Y2IA 4Y0OA 3HJKA 1NJ4A 2J9OA 5CRFA 1KGFA 2O99A 4DF6A 3VP4A 2XR0A 3ZCZA 5FQMA 4ME4A 3PBRA 4LV1A 1WYCA 2GJ3A 4ZDXA 2W27A 2OAP1 4HESA 3IF6C 3DBAA 1LLBA 4R1GA 4EW7A 5EPHA 5HDSA 4I3AA 1H8ZA 2Y79A 4PMAA 1A0KA 3G35A 3QP5A 3T4QA 4WZ5C 1T19A 1XFQA 5DJTA 3S22A 1W63M 4S2IA 3R4KA 4OOMA 2M7VA 1FQGA 3QNCA 1YLYA 1GSWA 1PZOA 2X02A 1PI5A 2Y2KA 2P9VA 1T1CA 3G2ZA 1CF0A 3G30A 4QU3A 1YPRA 3NDEA 4BL3A 1L0GA 1LI9A 4FTXA 4EUZA 3G34A 1F98A 3F1OA 5HDCA 2VJWA 1TS0A 2V1AA 4XUZA 1LL9A 5AQBA 1MKMA 2I9VA 3IF6A 2E8JA 3OPLA 5AQAA 2INWA 3OZHA 3KX0X 2B95A 1BYWA 3BFFA 4Y0UA 3W8KA 3CPTB 2DMWA 1ESIA 4ZJ3A 2EX8A 2WKPA 4QB8A 2W0NA 4O7DA 4GKUA 3ZG8B 3OCNA 3W2ZA 3N4IA 1E3UA 5M19A 5HD3A 4D2OA 3T1XA 3VMAA 4DE2A 5KSHA 3A3EA 3SH9A 2X71A 3LY3A 2WGIA 4MN7A 3Q81A 3RXXA 3NCKA 2BLSA 1LSVA 5HWTA 4OKPA 4RYEA 3LIEA 5EVID 2P08A 3N7WA 3Q1FA 4XXRA 3VV4A 3ISGA 5F82A 1SKOA 1IEMA 1FR1A 1SDEA 3FC7A 2WYXA 3T1QB 1VHMA 3KSHA 4CLCA 5FA7A 4EERA 4OLGA 3BWLA 1FR6A 2WKRA 3JYIA 3ZHHA 3BY9A 3A0SA 1G5UA 3P7NA 1WA9A 3IQAA 4CLCD 4KUOA 2Y91A 2EWWA 4KUKA 2KX6A 5DF9A 4GHIA 3VP1A 1KDWA 5FQJA 5CHUA 4GNUA 3P98A 4IUKA 1OT6A 3ZG0A 4DE1A 3PBOA 4S2OA 1H8MA 1KE3A 3CUEC 3GECA 4YNRA 3T4JA 5F69A 1BLCA 2E8IA 4S2LA 4X25A 1V9YA 5DTSA 4KQRA 1IYPA 3SZTA 2X01A 4Y15A 2EX9A 2ZM8A 2A3UA 4U3TA 2VZWA 1E3UD 2IWDA 1PZPA 4X68A 2PU2A 5L07A 2JN7A 3BEBA 4BENA 3CMZA 3D9YA 3F1OB 3ZVWA 4JXSA 3IWIA 1JNUA 4R70A 3K3DA 3LR3A 2ZQAA 2J9PA 1BTLA 1IYSA 1SDNA 2GNXA 2XA7S 5KZHA 3BLSA 5HAIA 2Q9MA 3IX4A 4WM9A 1MXOA 3S7PA 3VE3A 4HHDA 1H3QA 4CQHA 1KGGA 3A0VA 1D06A 5EUAA 4QHCA 3HREA 3BQAA 4E3IA 1TEMA 5FL3A 3BRMA 2PYPA 4L9GA 3HLFA 4MBFA 3KO6A 4Y17A 1BLHA 4KZ6A 3UMEA 4CLCE 2JCHA 1O07A 2Q9NA 3VP0A 1LI0A 4NXFA 5EVIC 3BM6A 4R6LA 4FCFA 3MZDA 1ZKJA 4KG2A 4HOIA 1PW8A 2ZC7A 2YKHA 4BBUA 1DRMA 3NIAA 3B33A 4OOYA 5IS1A 5FASA 5IU1A 3OOVA 3TE8A 5JYPA 2HP9A 3H9WA 4AFIA 2J3TC 4KQDA 5HAPA 5DF7A 1PFLA 2WKIA 1I2WA 2VK3A 1FIKA 1OTBA 2VA0A 3VOZA 5KIZA 2Y8HA 3HLCA 5CEDA 4QY5A 4JGOA 3PXPA 5FI2A 1PW1A 5CHJA 3N8SA 4R0QA 1U60A 5EM0A 3UPNA 4KZBA 2Y2QA 5AQ9A 4OQ0A 2XH9A 4FSFA 2PR5A 2R78A 4FD8A 2ZM2A 5E2HA 3TJZC 2DNSA 2OWJA 5FQQA 3CHWP 2VGLS 2ZOIA 4HJ6A 5CHMA 4MCWA 4BL2A 3LO7A
chains in the Genus database with same CATH topology
2M7UA 4WLAA 4MN6A 1W63Q 3R7WA 1Y28A 4WF0A 2HV1A 1LSXA 3A0RA 3LYXA 3S7NA 3SW1A 2EWVA 1X0OA 2W1TB 3ULFA 3MFXA 3E4PA 3LI9A 4JGQA 3MXQA 3MMHA 3VOLA 2QKPA 1P9WA 4HP9A 2XSSA 1LT0A 3OBFA 1KOUA 4Q0IA 2A24B 3F1PA 3UE6A 3EOIA 4II7A 3EEAA 4NXGA 4HP4A 1N9OA 3H82A 2EA9A 5F5YA 1N9LA 3LICA 2J80A 3MJQA 5A8BA 4O01A 3CWFA 3MQOA 2QWSA 5TJJA 3FPWA 3B47A 2OAQ1 3D3OA 5AVEA 1N9NA 2V0WA 1NLYA 3HJKA 2D01A 4CLCB 4B9OA 2O99A 5L8MA 3MF0A 1XFNA 3JVUA 4PKYG 3C38A 2P04A 4ME4A 1YAXA 3CAXA 3BY8A 3PBRA 4HJ4A 4DJ3A 3LR4A 2GJ3A 2W27A 4IHQA 4G3KA 2OAP1 4DMZA 1P0ZA 4EEPA 3HJIA 2LB5A 3TRCA 3DBAA 4I5SA 3S7OA 4EW7A 5LBRA 2O9BA 4IUHA 3EGXC 5HDSA 4I3AA 2Y79A 2K7SA 4HIAA 2PT7A 3CI6A 3UB8A 3V67A 3KYQA 1MZUA 4PKYA 5HZHA 2JKRM 4QPRA 3T4QA 1T19A 4MDZA 2NUPC 1XFQA 4GHIB 4HQAA 4OOLA 1UGUA 5DJTA 3KSGA 2Z6DA 1W63M 2GZAA 1YKDA 3R4KA 4I39A 3G6OA 4OOMA 3CITA 5C5KA 2M7VA 1V9ZA 2W3EA 1TS7A 4EQ1A 4WEJA 4EU0A 1TS6A 4JGRA 1GSWA 2HF6A 3T4LA 1TS8A 2ZBBA 5HPIA 5G4YA 1T18A 3H7WB 1T1CA 4MN5A 1DP8A 3RTYA 4GLQA 4EUVA 4HNBA 4Q0HA 1OTEA 3UE3A 1NLZA 3E0YA 4R3AA 3FPVA 3LFVA 4R38A 5HWWA 4I38A 1F98A 4L9FA 1TF1A 3F1OA 5HDCA 2VJWA 1F9IA 2D02A 1TS0A 2V1AA 2K2NA 4G3WA 3LR0A 1ODVA 5K5BA 2W1TA 5J7EA 2YKFA 1YSQA 1MKMA 2I9VA 3LIBA 4GW9A 4I3JA 2INWA 3H7WA 3MQ0A 2W3GA 3KX0X 5HL6A 1XJ2A 3FG8A 1BYWA 2P7JA 3K2NA 4UQIS 2DMWA 2WKPA 3ICYA 3KSFA 2W0NA 5HSQA 4LLOB 1STZA 3OCNA 4L9EA 1MC0A 4Z1WA 2Z6CA 3PBSA 2VV8A 1P9RA 3W2ZA 2FZ0A 2VV7A 3C2WA 4ARZA 2G7UA 2NUTC 3IBJA 4GS9A 5HD3A 1DP9A 2K31A 2L4RA 3VE4A 4O8GA 4E04A 2XRNA 4ZRRA 5KSHA 5EFWA 5DFYA 4K08A 4MN7A 3H82B 1D7EA 3E4QA 1OTAA 1OPXA 1UWPX 5TBMB 1LSVA 3R7WB 5HWTA 5J3WA 4CLCC 3LIEA 1T1BA 3C8CA 4GCZA 5DKKA 2JHEA 2P08A 1OTIA 4BBTA 2B18A 4YWZA 2JKRI 1G28A 3NOPC 4HJ3A 3VV4A 2O0YA 1G6OA 2KDKA 5HPFA 1GSXA 4ETXA 3NJAA 2HGVA 1XJ3A 3FC7A 2QJ7A 2BASA 3NHQA 4UEYA 5HDDA 2ZMFA 3PBTA 2CMNA 3BJNA 5IT5A 1VHMA 4H6JB 3KSHA 3T4TA 3T4OA 4WELA 2PYRA 4CLCA 4EERA 3BWLA 3GDIA 2HJEA 2WKRA 2IA2A 2L0WA 4L0LA 5HWVA 4G3VA 3BY9A 3NOUC 3A0SA 3K3CA 1WA9A 3P7NA 4CLCD 4KUOA 4JGPA 4BBVA 4NXEA 4BMWA 2EWWA 4KUKA 2L1MA 2KX6A 2V0UA 3D72A 5DF9A 4ETZA 4GHIA 2VEAA 4RQ9A 4IUKA 2J3WA 1OT6A 5TBMA 4EETB 4NXBA 3C30A 3PBNA 3UMDA 2V9AA 2B02A 3PBOA 1H8MA 3BW6A 5DJUA 2QYBA 5F6AA 3CUEC 3GECA 4YNRA 4GJ4A 3B42A 3T4JA 4BWIA 2XROA 5F69A 4HH3A 1V9YA 4NKPA 3RFBA 3PHYA 2JKTI 3HCYA 1VB6A 1UWNX 1OTDA 3KYZA 2J3TD 4UQIM 4EEUA 3MR0A 4HH2A 2OOLA 2W1RA 5DFXA 3F1NB 1S66L 4Q0JA 2VZWA 4I3IA 4KQOA 4LRXC 3EWKA 4NEED 1XJ4A 2V1BA 3CUEA 1S67L 2JN7A 4LRYC 4P6ZS 2PD8A 4P6ZM 4LRZE 3F1OB 3F1PB 4Y3IA 4EXOA 2JKTM 4MMNA 3E98A 4IJGA 1JNUA 2W3DA 3ZYTA 2A2LA 4R70A 3K3DA 3LR3A 2OWHA 3OLOA 2FH5A 1LSWA 2VGLM 5AVFA 2GNXA 2XA7S 1GSVA 2M1CA 2KLIA 4GS9B 1DP6A 3VE3A 3S7PA 4HHDA 1H3QA 1NWZA 3T4KA 4CQHA 3U2AA 2QJ5A 3A0VA 1D06A 3EGDC 4EESA 4WUJA 3PYPA 2VLGA 4Y2FA 5HD5A 3BQAA 4B93A 1ZHHB 3CLOA 4WL9A 5FL3A 2ZMVA 2PYPA 2H28A 4L9GA 3IS2B 4BJPA 3KO6A 3T50A 2HJ9C 3UMEA 2W3FA 4CLCE 4WN5A 3TW8A 1S1ZA 1EW0A 3O5YA 4NXFA 2QHKA 5DKLA 1OJGA 2PD7A 2XA7M 3EQVA 4R6LA 3LUQA 4PAUA 4HOIA 4F3LA 3OC2A 2PDRA 3IBRA 2YKHA 1S4SA 4PHTA 1DRMA 1P97A 4BBUA 2VV6A 4H6JA 5CX7A 3KSIA 4XT2A 3B33A 1LL8A 5IS1A 2VKSA 3P01A 5IU1A 3T4SA 1TD5A 3UB7A 1ZTUA 3OOVA 3TE8A 4Y5FA 1XJ6A 2WKQA 3UB6A 3MQQA 4DJ2A 5AJGA 4YOFA 2KOIA 3H9WA 4AFIA 2J3TC 4KQDA 3E4OA 1IFQA 1NRJA 1YSPA 4DN0A 5F68A 1OTBA 4O0PA 5G4ZA 4M4XA 2MJ6A 2VA0A 2VX8A 3UB9A 2O9CA 1IOUA 3LI8A 2PHYA 4XT2B 3IS2A 4F3LB 5KIZA 2Y8HA 1OJ5A 1S1YA 2GX5A 4JGOA 3ZQ5A 3BQ8A 3PXPA 3LIAA 1T1AA 5J4EA 2ZOHA 4HY8A 3LIFA 2A24A 3S7QA 3LR5A 3PBQA 1F5MA 3PR6A 4WEKA 2O9AA 2LB9A 3LIDA 4FSFA 2PR5A 2R78A 4ARZB 3RH8B 3EQUA 3TJZC 4LPZA 2OWJA 4HI4A 1S4RA 5I5LA 2W3HA 1OT9A 5MC7A 2VGLS 2ZOIA 2PR6A 3JVVA 4HJ6A 4FOFA 3OCLA 3NOTC 3F1NA 3EEHA 4MCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYP A;  1TS6 A;  2H28 A;  1GSW A;  4H6J B;  4JGR A;  4WLA A;  1TS8 A;  2ZBB A;  4L9G A;  3IS2 B;  2PYR A;  4MN6 A;  5G4Y A;  4EER A;  1Y28 A;  4WF0 A;  2HV1 A;  1T18 A;  1LSX A;  3A0R A;  3H7W B;  1T1C A;  3BWL A;  3LYX A;  3GDI A;  3T50 A;  3SW1 A;  2WKR A;  1X0O A;  2L0W A;  5HWV A;  4MN5 A;  3UME A;  1DP8 A;  3RTY A;  3ULF A;  3BY9 A;  4HNB A;  3NOU C;  3MFX A;  1OTE A;  3A0S A;  4WN5 A;  1S1Z A;  1EW0 A;  1WA9 A;  3K3C A;  3E4P A;  3P7N A;  4R3A A;  3LI9 A;  4JGQ A;  4NXF A;  4KUO A;  2QHK A;  5DKL A;  1OJG A;  2PD7 A;  3MXQ A;  4JGP A;  4NXE A;  4BBV A;  4R38 A;  5HWW A;  4R6L A;  3VOL A;  2QKP A;  3LUQ A;  4I38 A;  4HOI A;  1F98 A;  4KUK A;  4L9F A;  4F3L A;  2L1M A;  4HP9 A;  2KX6 A;  1LT0 A;  2V0U A;  1KOU A;  3D72 A;  2A24 B;  2PDR A;  3F1O A;  3F1P A;  3IBR A;  4GHI A;  2YKH A;  1S4S A;  2VEA A;  1DRM A;  1P97 A;  5HDC A;  2VV6 A;  4H6J A;  4NXG A;  1F9I A;  4BBU A;  2D02 A;  1TS0 A;  4HP4 A;  4RQ9 A;  1N9O A;  2V1A A;  4XT2 A;  3B33 A;  3H82 A;  1LL8 A;  2EA9 A;  1N9L A;  5F5Y A;  1OT6 A;  5TBM A;  4EET B;  5IS1 A;  4NXB A;  3LIC A;  2J80 A;  3MJQ A;  1ODV A;  5IU1 A;  3UMD A;  2V9A A;  2B02 A;  2YKF A;  5J7E A;  5A8B A;  3UB7 A;  2I9V A;  5DJU A;  3LIB A;  1XJ6 A;  2WKQ A;  4GW9 A;  3CWF A;  3UB6 A;  3MQO A;  3MQQ A;  4I3J A;  5F6A A;  2INW A;  3H7W A;  4DJ2 A;  3KX0 X;  2QWS A;  3GEC A;  1XJ2 A;  3FG8 A;  1BYW A;  2P7J A;  5F69 A;  3H9W A;  4HH3 A;  1V9Y A;  4KQD A;  5AVE A;  3PHY A;  3E4O A;  1VB6 A;  1N9N A;  2V0W A;  1UWN X;  2WKP A;  3HJK A;  1OTD A;  5F68 A;  2D01 A;  3ICY A;  1OTB A;  5G4Z A;  4M4X A;  3UB9 A;  4B9O A;  2W0N A;  4EEU A;  5HSQ A;  3LI8 A;  3MR0 A;  4LLO B;  2PHY A;  4XT2 B;  3F1N A;  4HH2 A;  4L9E A;  2OOL A;  3F1N B;  1XFN A;  2Z6C A;  1S66 L;  2VV8 A;  3IS2 A;  4F3L B;  4PKY G;  4I3I A;  5KIZ A;  2VV7 A;  3C2W A;  4DJ3 A;  3CAX A;  3BY8 A;  4HJ4 A;  4GS9 A;  1OJ5 A;  1S1Y A;  2GJ3 A;  4LRX C;  4JGO A;  5HD3 A;  1DP9 A;  3EWK A;  2L4R A;  2W27 A;  3VE4 A;  1XJ4 A;  2V1B A;  3ZQ5 A;  4E04 A;  3LIA A;  4EEP A;  1T1A A;  5J4E A;  1P0Z A;  2ZOH A;  1S67 L;  5EFW A;  2JN7 A;  3HJI A;  4LRY C;  4K08 A;  4HY8 A;  4I5S A;  2PD8 A;  3LIF A;  4LRZ E;  2A24 A;  3F1O B;  4EW7 A;  3F1P B;  4EXO A;  3H82 B;  1D7E A;  3E4Q A;  5HDS A;  1OTA A;  1JNU A;  4I3A A;  1UWP X;  3K3D A;  4R70 A;  2K7S A;  4HIA A;  5TBM B;  2OWH A;  1LSV A;  3OLO A;  3UB8 A;  3LID A;  5HWT A;  1LSW A;  1MZU A;  4PKY A;  5AVF A;  5J3W A;  3LIE A;  2PR5 A;  2R78 A;  1T1B A;  1GSV A;  3C8C A;  4GCZ A;  5DKK A;  2M1C A;  2JHE A;  3RH8 B;  1OTI A;  4BBT A;  5HZH A;  4GS9 B;  4YWZ A;  1T19 A;  1DP6 A;  1G28 A;  3NOP C;  4HJ3 A;  4LPZ A;  2OWJ A;  3VE3 A;  4HHD A;  1NWZ A;  2KDK A;  4HI4 A;  1GSX A;  1S4R A;  5I5L A;  1XFQ A;  1OT9 A;  4GHI B;  4HQA A;  5DJT A;  1UGU A;  2QJ5 A;  1D06 A;  2Z6D A;  3A0V A;  4EES A;  4WUJ A;  2ZOI A;  3PYP A;  2VLG A;  3NJA A;  5HD5 A;  2PR6 A;  1XJ3 A;  3FC7 A;  2QJ7 A;  2BAS A;  3G6O A;  3NHQ A;  4HJ6 A;  4I39 A;  5HDD A;  3CLO A;  4WL9 A;  3NOT C;  1V9Z A;  3UE6 A;  1TS7 A;  2CMN A;  4EQ1 A;  3EEH A; 
#chains in the Genus database with same CATH topology
 2OSU A;  3GVB A;  1W63 Q;  3FWL A;  3SW1 A;  2EWV A;  3ZVT A;  3BFG A;  3MMH A;  1PYY A;  5FAP A;  2ZC4 B;  2XSS A;  2A24 B;  3F1P A;  3MKE A;  5E2E A;  3LIC A;  2J80 A;  2XD1 A;  4JKT A;  5A8B A;  2ZQ9 A;  3FKW A;  3CWF A;  5HW3 A;  3VP3 A;  5TJJ A;  4CPK A;  3LEZ A;  5CER A;  2OAQ 1;  5AVE A;  5DVA A;  4FH4 A;  1N9N A;  4RA7 A;  3VFH A;  3QP4 A;  2Q0O A;  4B9O A;  1EI5 A;  4P85 A;  4PKY G;  4DJ3 A;  1GHP A;  3BY8 A;  3N8R A;  2EXA A;  4ZBE A;  3NEC A;  4G3K A;  2J8Y A;  4EBN A;  3S7O A;  2H10 A;  3VOY A;  2O9B A;  4IUH A;  4N9K A;  4LGW A;  3UB8 A;  2V8C A;  3Q07 A;  2NUP C;  4OOL A;  1TDL A;  3VSK A;  2EXB A;  4QD4 A;  1V9Z A;  3MKF A;  1TS7 A;  3UDX A;  1MPL A;  3WRT A;  2ZMA A;  4UA7 A;  2Y2J A;  4WEJ A;  4EU0 A;  4JGR A;  2Y2O A;  1VEU A;  5HPI A;  3H7W B;  4NET A;  1PWG A;  4GDN A;  2FFF B;  1DP8 A;  2CC1 A;  4Q0H A;  3UE3 A;  1QMF A;  3WS5 A;  5I94 A;  4R3A A;  4BLM A;  5HWW A;  2XFS A;  2PAV P;  1TF1 A;  3BFE A;  4OQI A;  3MBZ A;  2D02 A;  3HLE A;  3M6B A;  4G3W A;  1ONG A;  3UPO A;  1ODV A;  5K5B A;  3AGE A;  2YKF A;  2ACG A;  3KYE A;  1MBL A;  4DRT A;  1DJA A;  4EBP A;  2JKG A;  4I3J A;  3SS3 A;  1L0E A;  1XJ2 A;  3FG8 A;  4Q8I A;  2OLV A;  4C6Y A;  4S2J A;  3IH8 A;  1MY8 A;  2ZQ8 A;  2DRW A;  2P9V B;  4L9E A;  4Z1W A;  2Y2G A;  3PBS A;  1VM1 A;  4WMC A;  2VV7 A;  4ARZ A;  2NUT C;  4KZ5 A;  2AVX A;  4GS9 A;  2Z2L B;  1K57 A;  1GHM A;  2K31 A;  2L4R A;  3VE4 A;  4O8G A;  5GHX A;  3E2K A;  5EFW A;  4UA9 A;  4S2N C;  1S6R A;  3BFC A;  1BLP A;  3WS1 A;  1ES3 A;  5J3W A;  3C8C A;  5DKK A;  2JHE A;  2ZL1 B;  1JVJ A;  5HFO A;  2WGV A;  1G6O A;  2KDK A;  4OH0 A;  1XJ3 A;  4Z9Q A;  3PBT A;  1ERM A;  5FAQ A;  1ES4 A;  3BJN A;  3L9K A;  4GOG A;  5HAQ A;  1JWZ A;  3GDI A;  2IA2 A;  1FSY A;  4L0L A;  5HWV A;  1CEG A;  1CJF A;  4HEF A;  1RGZ A;  4KZ7 A;  4OPZ A;  4GD8 A;  4HBU A;  4OPY A;  5IHV A;  2V0U A;  3D72 A;  1NZO A;  3FKV A;  2VEA A;  5FEF A;  1IYO A;  4RQ9 A;  2J3W A;  1VET A;  3UMD A;  2V9A A;  1GCE A;  3G32 A;  1ZG4 A;  5HAR A;  3B42 A;  5A92 A;  1G6A A;  3QNB A;  1L0F A;  4JF6 A;  4HH3 A;  3WWX A;  1XX2 A;  1K57 C;  2JKT I;  3HCY A;  5TR7 A;  1UWN X;  2WK0 A;  1OTD A;  1VEU B;  3O86 A;  4JF5 A;  4PM7 A;  5L10 A;  1TVF A;  1M40 A;  4QY6 A;  3IWQ A;  4LV0 A;  3HBR A;  4R23 A;  4JBF A;  1NYM A;  1Z09 A;  3EWK A;  3CUE A;  2HZ5 A;  4LRY C;  2PD8 A;  4P6Z M;  4LRZ E;  5CEB A;  2JKT M;  4MMN A;  4K0X A;  2Y55 A;  5AQ7 A;  4RVA A;  1GSV A;  2WGW B;  1MWR A;  1NWZ A;  3T4K A;  1N4O A;  3PAG A;  2QJ5 A;  4EES A;  3UDI A;  5JYO A;  2V8F A;  3PYP A;  4DXC A;  5EVI A;  2ZMV A;  1K6R A;  1JWV A;  4WMC D;  1ESU A;  1GHI A;  3V50 A;  3IS2 B;  2WZX A;  1RGY A;  5FDH A;  3HLB A;  3S4X A;  2HJ9 C;  4GD6 A;  2P74 A;  1FCO A;  4Y7P A;  3C4O A;  4WN5 A;  3TW8 A;  1S1Z A;  5CGS A;  3O5Y A;  1OJG A;  2PD7 A;  4E3L A;  2XA7 M;  4NG2 A;  4OON A;  1BZA A;  2JC7 A;  3OC2 A;  1L2S A;  4CJN A;  4PHT A;  4H6J A;  4XT2 A;  5GHZ A;  3T1R A;  3ZG9 B;  3CG5 A;  3P01 A;  5GLB A;  1YLJ A;  1TD5 A;  4Y5F A;  1W5D A;  2WKQ A;  3QP6 A;  3MQQ A;  1YQS A;  4X56 A;  2HDQ A;  2KOI A;  5F1G A;  1K38 A;  3CZD A;  1XA1 A;  5F68 A;  3IWO A;  4O0P A;  1FOF A;  4M4X A;  3UB9 A;  1CI8 A;  3DW0 A;  3UN7 A;  4XT2 B;  1DJC A;  3OPR A;  1KGE A;  1E4D A;  3ZQ5 A;  3BQ8 A;  3LIA A;  3IH9 A;  3RJU A;  3SH7 A;  4R3B A;  3LIF A;  2UV0 E;  5FEG A;  3LR5 A;  3PBQ A;  2B5R A;  3VSL A;  1F5M A;  3TG9 A;  4WEK A;  3MXR A;  2ZC6 B;  3ZNY A;  3RH8 B;  5EVE A;  5D3O A;  5L2F A;  4FUW A;  4HI4 A;  4DKI A;  1S4R A;  3MZE A;  2W3H A;  5MC7 A;  2PR6 A;  4FOF A;  3B3X A;  3F1N A;  1ZC2 A;  4WLA A;  1OME A;  1LSX A;  3A0R A;  3LYX A;  4B4X A;  1X0O A;  2W1T B;  4X53 A;  3ULF A;  5DF8 A;  4OP8 A;  2UWX A;  5DTK A;  4LCL A;  3OBF A;  3T12 B;  2Y2L A;  3EOI A;  3SS4 A;  1VQQ A;  4NXG A;  2EA9 A;  1N9L A;  3V5M A;  1SKO B;  3MJQ A;  4X69 A;  1TDG A;  2QPN A;  2Y2P A;  4O01 A;  2GDN A;  4OPQ A;  2V2F F;  2EX6 A;  3FPW A;  2WAE A;  4S2K A;  1BLS A;  4CLC B;  2QZ6 A;  1I5Q A;  5L8M A;  1K4F A;  3MF0 A;  4JXV A;  1XFN A;  5FI6 A;  2G2U A;  3JVU A;  3C38 A;  3CAX A;  4HJ4 A;  1PI4 A;  3MXS A;  1FIL A;  3LR4 A;  2ZL1 A;  1K55 A;  4KG6 A;  1P0Z A;  3TRC A;  5A90 A;  4ZJ2 A;  2EFU A;  1W79 A;  2PBD P;  3NY4 A;  1PIO A;  1JTG A;  3V67 A;  3KYQ A;  1H8Y A;  1MZU A;  2HDR A;  3A3F A;  5F83 A;  4QPR A;  4S2P A;  4MDZ A;  1K56 A;  4HQA A;  1UGU A;  2VGJ A;  3KSG A;  2Z6D A;  5FSR A;  4DXB A;  2GZA A;  4I39 A;  1F2K A;  3G6O A;  4JLF A;  3CIT A;  5C5K A;  1J9M A;  3T1S A;  1WE4 A;  4X6T A;  2HF6 A;  3HUO A;  2ZBB A;  4GB7 A;  5G4Y A;  3BFD A;  4GLQ A;  4EUV A;  1ERO A;  3ZFZ A;  1NLZ A;  3E0Y A;  4UA6 A;  3C4P A;  4OPR A;  4R38 A;  4I38 A;  3DWZ A;  4L9F A;  2OV5 A;  1F9I A;  2H5S A;  3MZF A;  3FV7 A;  4ZTK A;  4DDY A;  3LR0 A;  3BEC A;  3UO9 A;  2XLN A;  3LIB A;  4GW9 A;  2V1Z A;  3M2J A;  5BOH A;  2OLU A;  5E2F A;  5F1F A;  3KSF A;  3NI9 A;  4LLO B;  1STZ A;  1MC0 A;  4PPR A;  2VV8 A;  1P9R A;  3C7U A;  5U47 A;  2FZ0 A;  2G7U A;  3IBJ A;  4P0M A;  2WGW A;  3ITA A;  3PAE A;  1K54 C;  4E04 A;  2XRN A;  4ZRR A;  3HLW A;  5DFY A;  2ZQD A;  2PBY A;  3H82 B;  1D7E A;  1NY0 A;  3E4Q A;  1YLP A;  1OTA A;  3S1Y A;  4KZ8 A;  3A3I A;  4ZJ1 A;  4DDS A;  3C5A A;  4WZ4 A;  2B18 A;  4YWZ A;  1Z6F A;  4HJ3 A;  4JF4 A;  4IED A;  4JPM A;  5HPF A;  1GSX A;  4ETX A;  3GQZ A;  2HGV A;  2QJ7 A;  2BAS A;  2ZMF A;  2IWB A;  4D60 A;  2CMN A;  4M3K A;  2HP5 A;  3IXB A;  2IWC A;  4H6J B;  3T4O A;  2PYR A;  1AXB A;  1ONH A;  5KSC A;  1K6S A;  3IT9 A;  2HJE A;  3D4F A;  3OPH A;  3K3C A;  2ZD8 A;  5EOE A;  4JGP A;  4BBV A;  3AGF A;  3HLG A;  2L1M A;  2WKH A;  4KEN B;  1M6K A;  5EVL A;  3NUL A;  1PWC A;  5TBM A;  5KMW A;  2J7V A;  3P09 A;  1YM1 A;  2B02 A;  3BW6 A;  4MEZ A;  1PRQ A;  3NC8 A;  4B4Z A;  1IYQ A;  2XRO A;  4BWI A;  3QHY A;  1XGI A;  3RFB A;  2WKE A;  4NKP A;  1VB6 A;  5HL1 A;  3BYD A;  3IXG A;  2J3T D;  2Z2M B;  3QP8 A;  4OVD A;  4UQI M;  3I7J A;  3WS0 A;  3NDG A;  4HH2 A;  2OOL A;  2W1R A;  5DFX A;  5EOO A;  1S66 L;  4I3I A;  4LRX C;  4NEE D;  4KZ9 A;  1XJ4 A;  4N1X A;  1KDS A;  1KE0 A;  1IKI A;  3MS6 A;  3F1P B;  3HUN A;  4Y3I A;  4EXO A;  2EX2 A;  3E98 A;  4IJG A;  2A2L A;  2OWH A;  3OLO A;  4QJG A;  2VGL M;  4X1L A;  2ZQ7 A;  4GS9 B;  4OP5 A;  3CPT A;  3U2A A;  2VLG A;  4P6B A;  5HD5 A;  3CLO A;  4WL9 A;  3O88 A;  2H28 A;  1SHV A;  1ES2 A;  1KVM A;  1Y4O A;  4KZ3 A;  4BD0 A;  2C5W B;  3MSH A;  3HVF A;  4MLL A;  4E3K A;  2QHK A;  5DKL A;  3ZG5 A;  2Y59 A;  3LUQ A;  3M6H A;  2ZQC A;  1FSW A;  2PDR A;  3IBR A;  1S4S A;  1P97 A;  3DAV A;  3WRZ A;  5CX7 A;  1PNE A;  2PRF A;  2Y2N A;  1LL8 A;  3Q7V B;  4N92 A;  3UE0 A;  1ZG6 A;  3IXH A;  1XJ6 A;  3UB6 A;  1YLT A;  4N9L A;  5A93 A;  1CQA A;  4YOF A;  2JE5 A;  4XUX A;  4JXG A;  4C3Q A;  1K4E A;  3E4O A;  2Y2M A;  5EVI B;  1YT4 A;  1QME A;  5G4Z A;  4S2M A;  2MJ6 A;  3FYZ A;  1ERQ A;  1BSG A;  3PTE A;  3IS2 A;  1BUL A;  1OJ5 A;  1S1Y A;  2GX5 A;  3QP1 A;  3LY4 A;  1T1A A;  5CXW A;  4HY8 A;  4EQI A;  4K91 A;  4KG5 A;  2FFY A;  3DTE A;  3G4P A;  3A3D A;  4H8R A;  4FH2 A;  5FQK A;  2H0T A;  3OPP A;  4E3O A;  1YLZ A;  3IF5 A;  5G18 A;  4LPZ A;  3UE1 A;  4B88 A;  3VFF A;  5I5L A;  1OT9 A;  3JVV A;  4E3M A;  3OCL A;  1N9B A;  1GA0 A;  4RX2 A;  1LL5 A;  2HDU A;  4WF0 A;  2HV1 A;  3IX8 A;  3DTI A;  2V20 A;  1CI9 A;  1AWI A;  4P87 A;  1MWT A;  3V39 A;  1DJB A;  1DY6 A;  3LI9 A;  3MXQ A;  3VOL A;  4MNR A;  2H0Y A;  4HP9 A;  4LCM A;  1LT0 A;  1KOU A;  1LHY A;  4EBL A;  3UE6 A;  1HZO A;  4HP4 A;  2PU4 A;  1N9O A;  4WYY A;  1SKF A;  4DE3 A;  1W8Y A;  5TFQ A;  3VP2 A;  2ZC5 B;  2QWS A;  2BG1 A;  1ES5 A;  3B47 A;  2QMI A;  4PM6 A;  3D3O A;  2ZJ9 A;  1K54 A;  4EV4 A;  1BT5 A;  2V0W A;  1NLY A;  2D01 A;  3ZG7 B;  5FI7 A;  3M2K A;  4UHU A;  5GHY A;  5CGX A;  4S2N A;  2P04 A;  1YAX A;  1L3L A;  4OLD A;  4IHQ A;  4EEP A;  4DMZ A;  3UY6 A;  3HJI A;  2LB5 A;  4WBG A;  4PM5 A;  3IX3 A;  1MWU A;  4I5S A;  1ALQ A;  5LBR A;  3EGX C;  2XF3 A;  5FAO A;  1Q2Q A;  3IHB A;  2K7S A;  3Q7V A;  4HIA A;  2PT7 A;  1KE4 A;  4U0X A;  3CI6 A;  2A49 A;  1RCJ A;  4PKY A;  5CGW A;  5A91 A;  5HZH A;  1K55 C;  2JKR M;  3QP2 A;  4K0W A;  4GHI B;  2EFX A;  1YKD A;  2WUQ A;  3HUM A;  3JPU A;  1RP5 A;  4U0T A;  2W3E A;  4EQ1 A;  2XQZ A;  1E25 A;  1TS6 A;  3T4L A;  1TS8 A;  5FAT A;  1ACF A;  1T18 A;  3ZGA B;  4MN5 A;  3GSG A;  4HBT A;  3RTY A;  4HNB A;  1OTE A;  3FPV A;  3LFV A;  1JWP A;  2HPB A;  3O3V A;  1YMX A;  1XXM A;  1BUE A;  2K2N A;  3GMW A;  2JKF A;  1FCN A;  3V3R A;  1H0M A;  2W1T A;  5J7E A;  1YSQ A;  3N8L A;  2XGN A;  1XKZ A;  3H7W A;  2W3G A;  1O7E A;  3MQ0 A;  5HL6 A;  5HX9 A;  4A5R A;  2P7J A;  3K2N A;  4YFM A;  5M18 A;  4UQI S;  4IVI A;  3GV9 A;  3ICY A;  1IEL A;  4ZAM A;  3IHA A;  4R3J A;  5HSQ A;  2VGK A;  2Z6C A;  3C2W A;  3UNW A;  2WAD A;  5CTN A;  3NBL A;  1DP9 A;  1J3W A;  1G68 A;  4K08 A;  3O87 A;  4LV2 A;  3SOI A;  2ZM0 A;  3ZDJ A;  4DE0 A;  1OPX A;  1UWP X;  5TBM B;  3R7W B;  4CLC C;  3SH8 A;  1T1B A;  4GCZ A;  1Y54 A;  1IKG A;  1OTI A;  2XFT A;  4BBT A;  4LV3 A;  2JKR I;  1G28 A;  3NOP C;  2O0Y A;  2G2W A;  1K25 A;  1HVB A;  4IBX A;  4JXW A;  5FQ9 A;  3NJA A;  3NHQ A;  2RL3 A;  4QWO A;  4UEY A;  5HDD A;  3TSG A;  2HDS A;  2BTF P;  4C75 A;  5L09 A;  3GRJ A;  5IT5 A;  1NXY A;  3GR2 A;  3T4T A;  4WEL A;  4E6X A;  4WZ5 A;  5GLC A;  2L0W A;  4MBK A;  2WAF A;  2I72 A;  4G3V A;  3DTK A;  2C6W B;  3NOU C;  4LFU A;  5EV0 A;  3N6I A;  1W8Q A;  5M1A A;  4NXE A;  1YMS A;  2Y4A A;  3CJM A;  4MBH A;  4BMW A;  4ETZ A;  5E2G A;  3W4O A;  1MWS A;  4EET B;  4EWF A;  4NXB A;  3C30 A;  4E6W A;  3C7V A;  3PBN A;  1NYY A;  1MKI A;  1YLW A;  5DJU A;  2QYB A;  4KZ4 A;  5F6A A;  4GJ4 A;  3V3S A;  3DTM A;  4E3J A;  2XD5 A;  1S0W A;  5GLD A;  3PHY A;  3KYZ A;  4EEU A;  3MR0 A;  4UAA A;  3F1N B;  2XK1 A;  4Q0J A;  1XGJ A;  1VET B;  3LGO A;  3L7H A;  4ID4 A;  3UDF A;  3Q82 A;  4KQO A;  3UPP A;  2ZC3 B;  2R9W A;  5TGF A;  2V1B A;  1S67 L;  5EEC A;  1C3B A;  3W4P A;  4P6Z S;  3DWK A;  3GTC A;  3RXW A;  5GL9 A;  1EWZ A;  3MFD A;  1HLU P;  2W3D A;  3ZYT A;  1NZU A;  4OQG A;  2FH5 A;  1LSW A;  5CTM A;  5AVF A;  4E3N A;  1PWD A;  3WS4 A;  2M1C A;  2KLI A;  3HLD A;  1DP6 A;  1XA7 A;  3EGD C;  4WUJ A;  4Y2F A;  3ITB A;  1XP4 A;  4B93 A;  1ZHH B;  5E43 A;  4RX3 A;  4NK3 A;  1Q2P A;  4BJP A;  1CK3 A;  5FDS A;  1GA9 A;  3T50 A;  1FCM A;  4X55 A;  3AGD A;  4PM8 A;  1L0D A;  2W3F A;  3IF6 B;  3WS2 A;  1EW0 A;  4BQM A;  4R4S A;  4BD1 A;  4OQH A;  1SCW A;  3EQV A;  4PAU A;  2RCX A;  5J8X A;  4F3L A;  1D1J A;  2VV6 A;  3KSI A;  1W7F A;  2XDM A;  2VKS A;  3W4Q A;  3T4S A;  3TOI A;  3UB7 A;  1ZTU A;  4Y13 A;  4IVK A;  5FQI A;  2R9X A;  4Y0T A;  3LCE A;  4DJ2 A;  5AJG A;  4GDB A;  1IFQ A;  1NRJ A;  1YSP A;  4DN0 A;  4KZA A;  1HD8 A;  2ZLY A;  3HL9 A;  2VX8 A;  2O9C A;  1IOU A;  4ESP A;  3LI8 A;  3ZNT A;  2PHY A;  4F3L B;  5DTT A;  2Y2H A;  4N1H A;  4LEN A;  2JBF A;  3SS5 A;  4GZB A;  5J4E A;  1CEF A;  2WZZ A;  2ZOH A;  1WYB A;  2A24 A;  3S7Q A;  5CEC A;  4IBR A;  5EM1 A;  5EE8 A;  3PR6 A;  1SZV A;  2O9A A;  2LB9 A;  3LID A;  4ARZ B;  1NRF A;  3E2L A;  3EQU A;  3U4L P;  1KVL A;  1K56 D;  2XEP A;  3G31 A;  1H5X A;  4KQQ A;  4GN2 A;  3NOT C;  3EEH A;  3LEQ A;  2M7U A;  3A3J A;  1XPB A;  4MN6 A;  3FZC A;  3R7W A;  1Y28 A;  3S7N A;  2DCF A;  1K0K A;  3MFX A;  5GLA A;  4YIN A;  4X1M A;  3E4P A;  4JGQ A;  1HTZ A;  2QKP A;  1P9W A;  3IXD A;  4Q0I A;  3BLM A;  3G2Y A;  4II7 A;  3EEA A;  4R4R A;  3H82 A;  4PM9 A;  5F5Y A;  4F94 A;  3Q7Z A;  1I2S A;  3UB5 P;  1JTD A;  3MQO A;  2HP6 A;  2Y2I A;  4Y0O A;  3HJK A;  1NJ4 A;  2J9O A;  5CRF A;  1KGF A;  2O99 A;  4DF6 A;  3VP4 A;  2XR0 A;  3ZCZ A;  5FQM A;  4ME4 A;  3PBR A;  4LV1 A;  1WYC A;  2GJ3 A;  4ZDX A;  2W27 A;  2OAP 1;  4HES A;  3IF6 C;  3DBA A;  1LLB A;  4R1G A;  4EW7 A;  5EPH A;  5HDS A;  4I3A A;  1H8Z A;  2Y79 A;  4PMA A;  1A0K A;  3G35 A;  3QP5 A;  3T4Q A;  4WZ5 C;  1T19 A;  1XFQ A;  5DJT A;  3S22 A;  1W63 M;  4S2I A;  3R4K A;  4OOM A;  2M7V A;  1FQG A;  3QNC A;  1YLY A;  1GSW A;  1PZO A;  2X02 A;  1PI5 A;  2Y2K A;  2P9V A;  1T1C A;  3G2Z A;  1CF0 A;  3G30 A;  4QU3 A;  1YPR A;  3NDE A;  4BL3 A;  1L0G A;  1LI9 A;  4FTX A;  4EUZ A;  3G34 A;  1F98 A;  3F1O A;  5HDC A;  2VJW A;  1TS0 A;  2V1A A;  4XUZ A;  1LL9 A;  5AQB A;  1MKM A;  2I9V A;  3IF6 A;  2E8J A;  3OPL A;  5AQA A;  2INW A;  3OZH A;  3KX0 X;  2B95 A;  1BYW A;  3BFF A;  4Y0U A;  3W8K A;  3CPT B;  2DMW A;  1ESI A;  4ZJ3 A;  2EX8 A;  2WKP A;  4QB8 A;  2W0N A;  4O7D A;  4GKU A;  3ZG8 B;  3OCN A;  3W2Z A;  3N4I A;  1E3U A;  5M19 A;  5HD3 A;  4D2O A;  3T1X A;  3VMA A;  4DE2 A;  5KSH A;  3A3E A;  3SH9 A;  2X71 A;  3LY3 A;  2WGI A;  4MN7 A;  3Q81 A;  3RXX A;  3NCK A;  2BLS A;  1LSV A;  5HWT A;  4OKP A;  4RYE A;  3LIE A;  5EVI D;  2P08 A;  3N7W A;  3Q1F A;  4XXR A;  3VV4 A;  3ISG A;  5F82 A;  1SKO A;  1IEM A;  1FR1 A;  1SDE A;  3FC7 A;  2WYX A;  3T1Q B;  1VHM A;  3KSH A;  4CLC A;  5FA7 A;  4EER A;  4OLG A;  3BWL A;  1FR6 A;  2WKR A;  3JYI A;  3ZHH A;  3BY9 A;  3A0S A;  1G5U A;  3P7N A;  1WA9 A;  3IQA A;  4CLC D;  4KUO A;  2Y91 A;  2EWW A;  4KUK A;  2KX6 A;  5DF9 A;  4GHI A;  3VP1 A;  1KDW A;  5FQJ A;  5CHU A;  4GNU A;  3P98 A;  4IUK A;  1OT6 A;  3ZG0 A;  4DE1 A;  3PBO A;  4S2O A;  1H8M A;  1KE3 A;  3CUE C;  3GEC A;  4YNR A;  3T4J A;  5F69 A;  1BLC A;  2E8I A;  4S2L A;  4X25 A;  1V9Y A;  5DTS A;  4KQR A;  1IYP A;  3SZT A;  2X01 A;  4Y15 A;  2EX9 A;  2ZM8 A;  2A3U A;  4U3T A;  2VZW A;  1E3U D;  2IWD A;  1PZP A;  4X68 A;  2PU2 A;  5L07 A;  2JN7 A;  3BEB A;  4BEN A;  3CMZ A;  3D9Y A;  3F1O B;  3ZVW A;  4JXS A;  3IWI A;  1JNU A;  4R70 A;  3K3D A;  3LR3 A;  2ZQA A;  2J9P A;  1BTL A;  1IYS A;  1SDN A;  2GNX A;  2XA7 S;  5KZH A;  3BLS A;  5HAI A;  2Q9M A;  3IX4 A;  4WM9 A;  1MXO A;  3S7P A;  3VE3 A;  4HHD A;  1H3Q A;  4CQH A;  1KGG A;  3A0V A;  1D06 A;  5EUA A;  4QHC A;  3HRE A;  3BQA A;  4E3I A;  1TEM A;  5FL3 A;  3BRM A;  2PYP A;  4L9G A;  3HLF A;  4MBF A;  3KO6 A;  4Y17 A;  1BLH A;  4KZ6 A;  3UME A;  4CLC E;  2JCH A;  1O07 A;  2Q9N A;  3VP0 A;  1LI0 A;  4NXF A;  5EVI C;  3BM6 A;  4R6L A;  4FCF A;  3MZD A;  1ZKJ A;  4KG2 A;  4HOI A;  1PW8 A;  2ZC7 A;  2YKH A;  4BBU A;  1DRM A;  3NIA A;  3B33 A;  4OOY A;  5IS1 A;  5FAS A;  5IU1 A;  3OOV A;  3TE8 A;  5JYP A;  2HP9 A;  3H9W A;  4AFI A;  2J3T C;  4KQD A;  5HAP A;  5DF7 A;  1PFL A;  2WKI A;  1I2W A;  2VK3 A;  1FIK A;  1OTB A;  2VA0 A;  3VOZ A;  5KIZ A;  2Y8H A;  3HLC A;  5CED A;  4QY5 A;  4JGO A;  3PXP A;  5FI2 A;  1PW1 A;  5CHJ A;  3N8S A;  4R0Q A;  1U60 A;  5EM0 A;  3UPN A;  4KZB A;  2Y2Q A;  5AQ9 A;  4OQ0 A;  2XH9 A;  4FSF A;  2PR5 A;  2R78 A;  4FD8 A;  2ZM2 A;  5E2H A;  3TJZ C;  2DNS A;  2OWJ A;  5FQQ A;  3CHW P;  2VGL S;  2ZOI A;  4HJ6 A;  5CHM A;  4MCW A;  4BL2 A;  3LO7 A; 
#chains in the Genus database with same CATH homology
 2M7U A;  4WLA A;  4MN6 A;  1W63 Q;  3R7W A;  1Y28 A;  4WF0 A;  2HV1 A;  1LSX A;  3A0R A;  3LYX A;  3S7N A;  3SW1 A;  2EWV A;  1X0O A;  2W1T B;  3ULF A;  3MFX A;  3E4P A;  3LI9 A;  4JGQ A;  3MXQ A;  3MMH A;  3VOL A;  2QKP A;  1P9W A;  4HP9 A;  2XSS A;  1LT0 A;  3OBF A;  1KOU A;  4Q0I A;  2A24 B;  3F1P A;  3UE6 A;  3EOI A;  4II7 A;  3EEA A;  4NXG A;  4HP4 A;  1N9O A;  3H82 A;  2EA9 A;  5F5Y A;  1N9L A;  3LIC A;  2J80 A;  3MJQ A;  5A8B A;  4O01 A;  3CWF A;  3MQO A;  2QWS A;  5TJJ A;  3FPW A;  3B47 A;  2OAQ 1;  3D3O A;  5AVE A;  1N9N A;  2V0W A;  1NLY A;  3HJK A;  2D01 A;  4CLC B;  4B9O A;  2O99 A;  5L8M A;  3MF0 A;  1XFN A;  3JVU A;  4PKY G;  3C38 A;  2P04 A;  4ME4 A;  1YAX A;  3CAX A;  3BY8 A;  3PBR A;  4HJ4 A;  4DJ3 A;  3LR4 A;  2GJ3 A;  2W27 A;  4IHQ A;  4G3K A;  2OAP 1;  4DMZ A;  1P0Z A;  4EEP A;  3HJI A;  2LB5 A;  3TRC A;  3DBA A;  4I5S A;  3S7O A;  4EW7 A;  5LBR A;  2O9B A;  4IUH A;  3EGX C;  5HDS A;  4I3A A;  2Y79 A;  2K7S A;  4HIA A;  2PT7 A;  3CI6 A;  3UB8 A;  3V67 A;  3KYQ A;  1MZU A;  4PKY A;  5HZH A;  2JKR M;  4QPR A;  3T4Q A;  1T19 A;  4MDZ A;  2NUP C;  1XFQ A;  4GHI B;  4HQA A;  4OOL A;  1UGU A;  5DJT A;  3KSG A;  2Z6D A;  1W63 M;  2GZA A;  1YKD A;  3R4K A;  4I39 A;  3G6O A;  4OOM A;  3CIT A;  5C5K A;  2M7V A;  1V9Z A;  2W3E A;  1TS7 A;  4EQ1 A;  4WEJ A;  4EU0 A;  1TS6 A;  4JGR A;  1GSW A;  2HF6 A;  3T4L A;  1TS8 A;  2ZBB A;  5HPI A;  5G4Y A;  1T18 A;  3H7W B;  1T1C A;  4MN5 A;  1DP8 A;  3RTY A;  4GLQ A;  4EUV A;  4HNB A;  4Q0H A;  1OTE A;  3UE3 A;  1NLZ A;  3E0Y A;  4R3A A;  3FPV A;  3LFV A;  4R38 A;  5HWW A;  4I38 A;  1F98 A;  4L9F A;  1TF1 A;  3F1O A;  5HDC A;  2VJW A;  1F9I A;  2D02 A;  1TS0 A;  2V1A A;  2K2N A;  4G3W A;  3LR0 A;  1ODV A;  5K5B A;  2W1T A;  5J7E A;  2YKF A;  1YSQ A;  1MKM A;  2I9V A;  3LIB A;  4GW9 A;  4I3J A;  2INW A;  3H7W A;  3MQ0 A;  2W3G A;  3KX0 X;  5HL6 A;  1XJ2 A;  3FG8 A;  1BYW A;  2P7J A;  3K2N A;  4UQI S;  2DMW A;  2WKP A;  3ICY A;  3KSF A;  2W0N A;  5HSQ A;  4LLO B;  1STZ A;  3OCN A;  4L9E A;  1MC0 A;  4Z1W A;  2Z6C A;  3PBS A;  2VV8 A;  1P9R A;  3W2Z A;  2FZ0 A;  2VV7 A;  3C2W A;  4ARZ A;  2G7U A;  2NUT C;  3IBJ A;  4GS9 A;  5HD3 A;  1DP9 A;  2K31 A;  2L4R A;  3VE4 A;  4O8G A;  4E04 A;  2XRN A;  4ZRR A;  5KSH A;  5EFW A;  5DFY A;  4K08 A;  4MN7 A;  3H82 B;  1D7E A;  3E4Q A;  1OTA A;  1OPX A;  1UWP X;  5TBM B;  1LSV A;  3R7W B;  5HWT A;  5J3W A;  4CLC C;  3LIE A;  1T1B A;  3C8C A;  4GCZ A;  5DKK A;  2JHE A;  2P08 A;  1OTI A;  4BBT A;  2B18 A;  4YWZ A;  2JKR I;  1G28 A;  3NOP C;  4HJ3 A;  3VV4 A;  2O0Y A;  1G6O A;  2KDK A;  5HPF A;  1GSX A;  4ETX A;  3NJA A;  2HGV A;  1XJ3 A;  3FC7 A;  2QJ7 A;  2BAS A;  3NHQ A;  4UEY A;  5HDD A;  2ZMF A;  3PBT A;  2CMN A;  3BJN A;  5IT5 A;  1VHM A;  4H6J B;  3KSH A;  3T4T A;  3T4O A;  4WEL A;  2PYR A;  4CLC A;  4EER A;  3BWL A;  3GDI A;  2HJE A;  2WKR A;  2IA2 A;  2L0W A;  4L0L A;  5HWV A;  4G3V A;  3BY9 A;  3NOU C;  3A0S A;  3K3C A;  1WA9 A;  3P7N A;  4CLC D;  4KUO A;  4JGP A;  4BBV A;  4NXE A;  4BMW A;  2EWW A;  4KUK A;  2L1M A;  2KX6 A;  2V0U A;  3D72 A;  5DF9 A;  4ETZ A;  4GHI A;  2VEA A;  4RQ9 A;  4IUK A;  2J3W A;  1OT6 A;  5TBM A;  4EET B;  4NXB A;  3C30 A;  3PBN A;  3UMD A;  2V9A A;  2B02 A;  3PBO A;  1H8M A;  3BW6 A;  5DJU A;  2QYB A;  5F6A A;  3CUE C;  3GEC A;  4YNR A;  4GJ4 A;  3B42 A;  3T4J A;  4BWI A;  2XRO A;  5F69 A;  4HH3 A;  1V9Y A;  4NKP A;  3RFB A;  3PHY A;  2JKT I;  3HCY A;  1VB6 A;  1UWN X;  1OTD A;  3KYZ A;  2J3T D;  4UQI M;  4EEU A;  3MR0 A;  4HH2 A;  2OOL A;  2W1R A;  5DFX A;  3F1N B;  1S66 L;  4Q0J A;  2VZW A;  4I3I A;  4KQO A;  4LRX C;  3EWK A;  4NEE D;  1XJ4 A;  2V1B A;  3CUE A;  1S67 L;  2JN7 A;  4LRY C;  4P6Z S;  2PD8 A;  4P6Z M;  4LRZ E;  3F1O B;  3F1P B;  4Y3I A;  4EXO A;  2JKT M;  4MMN A;  3E98 A;  4IJG A;  1JNU A;  2W3D A;  3ZYT A;  2A2L A;  4R70 A;  3K3D A;  3LR3 A;  2OWH A;  3OLO A;  2FH5 A;  1LSW A;  2VGL M;  5AVF A;  2GNX A;  2XA7 S;  1GSV A;  2M1C A;  2KLI A;  4GS9 B;  1DP6 A;  3VE3 A;  3S7P A;  4HHD A;  1H3Q A;  1NWZ A;  3T4K A;  4CQH A;  3U2A A;  2QJ5 A;  3A0V A;  1D06 A;  3EGD C;  4EES A;  4WUJ A;  3PYP A;  2VLG A;  4Y2F A;  5HD5 A;  3BQA A;  4B93 A;  1ZHH B;  3CLO A;  4WL9 A;  5FL3 A;  2ZMV A;  2PYP A;  2H28 A;  4L9G A;  3IS2 B;  4BJP A;  3KO6 A;  3T50 A;  2HJ9 C;  3UME A;  2W3F A;  4CLC E;  4WN5 A;  3TW8 A;  1S1Z A;  1EW0 A;  3O5Y A;  4NXF A;  2QHK A;  5DKL A;  1OJG A;  2PD7 A;  2XA7 M;  3EQV A;  4R6L A;  3LUQ A;  4PAU A;  4HOI A;  4F3L A;  3OC2 A;  2PDR A;  3IBR A;  2YKH A;  1S4S A;  4PHT A;  1DRM A;  1P97 A;  4BBU A;  2VV6 A;  4H6J A;  5CX7 A;  3KSI A;  4XT2 A;  3B33 A;  1LL8 A;  5IS1 A;  2VKS A;  3P01 A;  5IU1 A;  3T4S A;  1TD5 A;  3UB7 A;  1ZTU A;  3OOV A;  3TE8 A;  4Y5F A;  1XJ6 A;  2WKQ A;  3UB6 A;  3MQQ A;  4DJ2 A;  5AJG A;  4YOF A;  2KOI A;  3H9W A;  4AFI A;  2J3T C;  4KQD A;  3E4O A;  1IFQ A;  1NRJ A;  1YSP A;  4DN0 A;  5F68 A;  1OTB A;  4O0P A;  5G4Z A;  4M4X A;  2MJ6 A;  2VA0 A;  2VX8 A;  3UB9 A;  2O9C A;  1IOU A;  3LI8 A;  2PHY A;  4XT2 B;  3IS2 A;  4F3L B;  5KIZ A;  2Y8H A;  1OJ5 A;  1S1Y A;  2GX5 A;  4JGO A;  3ZQ5 A;  3BQ8 A;  3PXP A;  3LIA A;  1T1A A;  5J4E A;  2ZOH A;  4HY8 A;  3LIF A;  2A24 A;  3S7Q A;  3LR5 A;  3PBQ A;  1F5M A;  3PR6 A;  4WEK A;  2O9A A;  2LB9 A;  3LID A;  4FSF A;  2PR5 A;  2R78 A;  4ARZ B;  3RH8 B;  3EQU A;  3TJZ C;  4LPZ A;  2OWJ A;  4HI4 A;  1S4R A;  5I5L A;  2W3H A;  1OT9 A;  5MC7 A;  2VGL S;  2ZOI A;  2PR6 A;  3JVV A;  4HJ6 A;  4FOF A;  3OCL A;  3NOT C;  3F1N A;  3EEH A;  4MCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...