1D0KA

The escherichia coli lytic transglycosylase slt35 in complex with two murodipeptides (glcnac-murnac-l-ala-d-glu)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
314
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
total genus 108
structure length 314
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0kA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0kA02
1IOSA 2DQAA 4WLDA 1LJGA 3RNXA 3D3DA 1LHMA 5FEKA 1LZYA 3ZEKA 3ZVQB 4HTQA 5HNCA 4ETCA 4NGWA 4H8YA 4HV2A 1HFZA 3CT5A 3F6ZA 1V7TA 1LPIA 1FLQA 1GF4A 4B4JA 1G7JC 3WW5A 2FBDA 2Q0MX 1DXJA 2LYOA 3CSRA 1IP6A 3HFMY 1WVVA 3WH1A 3E3DA 1B5WA 3G3AB 2BQDA 2XBSA 1QTKA 3D9AC 1HEQA 1GF5A 4WM2A 1I1ZA 1IWYA 2YVBA 1TCYA 4OWCA 1VDQA 5D5CA 4CFPA 9LYZA 1IP1A 1LZAA 4MR1A 3CSQA 1HEWA 1ALCA 1OUJA 2DBTA 3A96A 1IEEA 3A95A 3VWOA 5C6JA 3RZ4A 1AZFA 5B05A 1NMMA 3B0OA 1GFAA 3TXBA 1IR8A 4WM4A 4DD1A 1LZ5A 1LSYA 3ZVQA 1DQJC 1TDYA 2D91A 4WM3A 1I56A 1AT5A 1F6RA 1KXXA 4GLVA 1IWTA 1BWIA 2G4QA 1LAAA 1KXYA 2W1XA 2YSSC 4H92A 4HTKA 4WL6A 5LYZA 3TXKA 135LA 4DDCA 1PZYA 1GWDA 1LJHA 4GN4A 4AXTA 1G7IC 1JJ0A 4NGZA 3LYTA 1JTPL 1B5VA 1B2KA 1LZ1A 1T6VL 1LHHA 1MELL 2BPUA 1HEMA 1YKXX 3B0IA 4WLYA 2YBLA 4LYZA 4ZIXA 1B5ZA 1IWZA 1UIFA 1LJNA 3W6EA 1FN5A 4WMGA 1D0MA 1IP7A 1GB2A 1NHEA 1VATA 4NHSA 3TMXA 4NHTA 2B5ZA 3J4GA 4NHPA 1IC7Y 3BKHA 4LT2A 1INUA 3M3UA 1GD6A 2ZIJA 4KPMA 5M1YA 3P66A 1C45A 3TXDA 1KXWA 1GDXA 1RCMA 1JKDA 1VDSA 1WQQA 4UWUA 4N9RA 4HPIA 4W96A 1HMKA 2I6ZA 3A91A 1FLYA 1LZGA 1UIBA 3WL2A 1YKYX 5KKJA 1C08C 2HTXA 2CJLA 2FBBA 1LZ9A 4GCCA 1B7NA 1JHLA 3A94A 3A67Y 4R0FA 5LAGA 2YDGA 1GB3A 1N4FA 1JSFA 4NY5A 4GN5C 4W94A 4XADA 4ZFPA 2Z38A 3LYZA 4OWBA 1HEOA 4X3BA 4B1AA 5L9JA 1GXV2 4HJZA 5L3IA 5DLAA 4HPEA 1O23A 1LYYA 5FHWA 1D9UA 4NWHA 4Z98A 1F6SA 1JIYA 5F16A 3WPLA 1DPWA 5KJ9A 3CSZA 3TXJA 1D6QA 2H9KA 4BADA 4NGKA 1F10A 2DKVA 3A3RX 1RFPA 1WQOA 1CJ7A 1REYA 4NFVA 4R6CA 2IHLA 5KXKA 4ZEEA 5F9UA 2BQJA 1TBYA 3IJUA 1UACY 3K3TA 1GFRA 5KXXA 4WO6A 1QSWA 4HTNA 3AZ6A 3N9AA 1GXXA 1LSPA 1OUFA 1GB7A 1LSBA 2BQBA 2H5ZA 1B7QA 3SP3A 4H94A 5F14A 1KIQC 1YQVY 4H9IA 5KXYA 1GAZA 3ATNA 5JENB 2ZYCA 1NDGC 4QGZA 3AGHA 1WTMA 4II8A 2C8OA 4P2EA 1XGQC 1LCNA 3A90A 4LFXA 1QUTA 2HU3A 4TSCA 1FDLY 1LZSA 2BLYA 2ZIKA 5DL9A 4FJRA 3WVYA 1YL0X 1UICA 3AGGG 5HMJA 5I5QA 5DN5A 1UIGA 4J1BA 5APEA 4DC4A 4CGEA 4DD3A 4NGOA 1LZ6A 2CGIA 4WLXA 4O34A 1BWHA 1CKCA 1LHJA 4B49A 4U3XB 1GBSA 1D0KA 1GF6A 1XEJA 5J7CA 2RSCA 1JSEA 1IY4A 5L3HA 3AJNA 1DZBX 2BQHA 4WM1A 1B7MA 1AM7A 1B7RA 1GE2A 1LJKA 5LYMA 1J1OY 1LMAA 1LZBA 1FBIX 4N1EI 2HEEA 1D0LA 1IC5Y 1VDPA 2YBJA 4CHXA 133LA 5I4XA 5KXTA 2DQDY 2D4KA 5FDJA 2DQHY 3G3BB 1GFTA 1NBYC 2BQGA 1HERA 1BB7A 4GCBA 2I25L 1IP2A 1LSGA 1T3PA 2YBNA 2ZQ3A 1NWGA 1EQEA 4D9ZA 3GXKA 4CJ2A 2Z37A 5LYTA 3FI7A 2LYMA 1GFKA 4G49A 4TSBA 1IC4Y 1V7SA 2CDSA 4HJYA 2BQLA 4NEBA 1WQRA 1OP9B 4OWAA 1C10A 4NIJA 4WM5A 1CNSA 2D6BA 2C8PA 2LZTA 5B1FA 3T6UA 4ETAA 4NWEA 5LVHA 3WW6A 4GLAA 5FSTA 1KIPC 2HUBA 4XJDA 4NSGA 1PS5A 208LA 1B7OA 1CKHA 1LHKA 2MEIA 1BVKC 2MECA 3P64A 4XENA 4XJGA 4QY9A 4J0LA 1DPXA 4WO9A 4HP0A 1LSFA 2CWIA 4PJ2C 3W6BA 1A2YC 1NQIA 3T36A 3W6AA 5KXWA 2EKSC 2H9JA 3CT0A 3FE0A 4XN6A 3WYHA 1D6PA 2D4IA 1LJFA 5KXSA 4NG1A 1GB0A 1HHLA 4G4BA 2G4PA 1YROA 4G4HA 1SQ2L 1HFXA 4QEQA 1SLYA 4DD0A 1JKBA 2X0AA 3P68A 5LIOA 5ILFA 4WLTA 3WUAA 1LMQA 1P2CC 2GV0A 2DQEY 4I8SA 1GBXA 1GF3A 4LT0A 1EL1A 3WXTA 1J1XY 1OUEA 4H1PA 4C3WA 2DQCY 3WMKA 2LHMA 2BQOA 5KXNA 4A7DA 1XFPL 4G4CA 1TAYA 4LGKA 3W6CA 2VB1A 1DKKA 4RW2A 1W6ZA 3A92A 4NHIA 4ET9A 1LKSA 1C7PA 4ML7A 1LJ3A 4H91A 4RLNA 1UIHA 3ATOA 1FLWA 2YBMA 5DM9A 1DI4A 4PRQA 4UWVA 1ZVHL 1GFJA 5E4PA 4DWXA 1CJ6A 1YIKA 3QY4A 4FDYA 1IOQA 4C5FA 3EMSA 4Z3MA 3LN2A 4G9SA 4XJFA 1XGRC 1LSMA 3WPKA 4IATA 4H90A 1BGIA 1BQLY 3TXHA 1JWRA 2XBRA 4GN3A 2EIZC 4NHQA 5F81A 1GE0A 1NDMC 3WU9A 1BB6A 4J7VA 5FCPA 1QUSA 4TX7A 2MEBA 4GCEA 1G7LC 4H9CA 1LYOA 1H6MA 4WOAA 6LYTA 3A3QA 1IP3A 1JUGA 1CKDA 1NBZC 1LSAA 1UIEA 2BQCA 4NGLA 1JPOA 1GFEA 5C6LA 5B06A 4WG1A 2DQGY 1XGTC 3A34A 1IWXA 4OW1A 4NGIA 4L41A 5LVKA 2LZ2A 2EPEA 2F2NA 5I53A 4H9EA 4CFOA 3A8ZA 4XJIA 4B0DA 2BQNA 1IWVA 1GF7A 1QQYA 2I26L 2ZNXY 3WUMA 1IOTA 2W1YA 1QDTA 2DQIY 3WU7A 3GXRA 1VAUA 1B0DA 3WUNA 1IR7A 4OWEA 1OUIA 3LYMA 1LSEA 1UC0A 4I0CA 3WULA 2MEAA 3IWRA 4HJVA 5D5FA 1LJEA 4RDSA 1REXA 2A7FA 193LA 2NWDX 5KKIA 1FKVA 1BVXA 1CJ9A 3LYOA 5HQ1A 5IHGA 1LJ4A 3HBEX 4TUNA 3CQLA 5C6IA 1B7SA 2HECA 2HEFA 1B5XA 2FYDA 3W6FA 1QDRA 1XGPC 2ZWBA 5I4YA 3RT5X 4MSTA 4YEOA 4DD9A 4DDAA 1YAQA 1GDWA 2FYCA 5LVGA 2DQJY 3P4ZA 1HC0A 5APCA 1KIRC 1BWJA 1WVUA 1VDTA 1BHZA 4NG8A 7LYZA 2N5ZA 2Z12A 1EQ5A 3A6CY 3EXDA 3TMUA 1HMLA 1DI5A 1LKRA 4ETEA 2MEEA 4OOTA 4HV1A 1GB9A 3MGWA 1JTOL 3EO5A 3OJPA 4M6DA 1B7LA 2IFFY 2LYZA 4N1CC 4NGYA 4GCFA 1GFUA 4UWNA 1G7HC 3RW8A 4BAFA 4E3UA 1ZV5L 2BQKA 1WQPA 5APFA 5FELA 1HFYA 5HNLA 4OWHA 194LA 4DDBA 1LMNA 3AYQA 5A3EA 1JISA 4WG7A 1GE3A 1JJ1A 5HMVA 5KXOA 1IX0A 1LOZA 1WQNA 1GBYA 1ZMYL 2MEFA 1GE1A 2WARA 2HEAA 1YANA 5KXZA 5KXRA 1AT6A 5T3FA 4EMNA 1OUAA 2BQAA 5IDDA 1JITA 1YL1X 4B4IA 1GBWA 5B59A 1W08A 5B1GA 2MEHA 1HNLA 3HBHA 4KL7A 4RW1A 1HF4A 1LSCA 3A6BY 4DD7A 2XJWA 3A93A 5EBHA 4ANRA 1GF0A 4AGAA 1J1PY 132LA 2W1MA 1UCOA 5ILCA 1OUCA 4WM6A 1LSNA 5LVIA 1XEKA 1YAOA 1LZ8A 2XTHA 1HEPA 1CKFA 1HENA 1B5UA 1UBZA 1JJ3A 3N9CA 4IJ4A 6LYZA 3ULRA 1OUBA 1XEIA 1ZVYB 1JTTL 1LZRA 1LJIA 2Y8PA 5IELA 2YBIA 2F4AA 3B6LA 4HSFA 4N0JA 1LMTA 1LZTA 8LYZA 1OUDA 3QE8A 1GEVA 3WPJA 1BB5A 1UA6Y 1IP5A 4LZTA 2HEDA 3KAMA 5KXPA 4BAPA 3LZTA 1DKJA 1I20A 1LTMA 2HU1A 4Z46A 4NSHA 4WL7A 1LZCA 4NGVA 4KT3A 1GFHA 4NSJA 2D4JA 1IP4A 1B7PA 1WQMA 1JKCA 1REZA 1IWWA 1LMPA 5AMYA 2MEGA 1VEDA 4ETBA 1REMA 2F30A 4XJHA 1GF8A 2Z2EA 1GHLA 1DI3A 1LZDA 2ZILA 153LA 5APDA 1F0WA 4LT3A 3TXIA 2Z19A 3TXFA 4NSIA 2EQLA 4PHIA 4RLMA 134LA 1GEZA 3AW6A 4M4OA 1IIZA 1OUGA 2G4NA 1IORA 1A4VA 3B72A 3N9EA 4H93A 1CKGA 4DD2A 4ET8A 1E8LA 1QSAA 5K7OA 4J1AA 4LYTA 4N8ZA 1VFBC 5I4WA 1BB3A 1YAMA 5HLLA 2BQIA 3AB6A 2Z18A 3TXGA 3LZ2A 1XSFA 5F9XA 1NF5A 2BQMA 2Z39A 3B0KA 5LINA 2DQFC 3WU8A 3P65A 5LVJA 1HELA 1CJ8A 2A7DA 1GFVA 3J6KA 1IWUA 4H9AA 4IASA 4YEMA 2W1LA 207LA 3AW7A 5B07A 1IR9A 1MLCE 3RU5A 1IO5A 3TXEA 3WXUA 4ETDA 1LYSA 4N5RA 4H9BA 1HSXA 4H9HA 4DT3A 1UIDA 4YM8A 3TMWA 1LZEA 2F4GA 4TWSA 1LMOA 5I54A 4LT1A 1GB6A 3AGIA 1JKAA 2BQEA 4PGJB 154LA 4NGJA 1AKIA 1OQMA 3M18B 1GBZA 4Z41A 1OUHA 1IVMA 1LSZA 4QDNA 4LFPA 1GB8A 4KXIA 1NKHA 1LHIA 1BB4A 1LHLA 1RI8B 1G7MC 3IJVA 3W3EA 1GBOA 4YF2A 1WTNA 3QNGA 1TEWA 4H9FA 1YKZX 1B9OA 1JEFA 2ZNWY 1YILA 4GCDA 1LYZA 4XYYA 1GF9A 1GFGA 2ZYPA 1GB5A 1HSWA 5II3A 5KXMA 1LSDA 2ZQ4A 1C43A 1IOCA 3W6DA 2BQFA 4TTDA 1C46A 1EQ4A 2BLXA 5DN4A 5LA8A 1GE4A 3AZ5A 1QTEA 1GAYA 4LYMA 1IY3A 1LMCA 2BAAA 1YAPA 3AZ4A 4DYGA 4LYOA 1QIOA 3WVXA 1LJJA 1GPQC 4H8XA 4PPOA 1UIAA 4B4EA 1FLUA 3CB7A 5LA5A 2PC2A 3EBAB 4MCKA 4PRUA 1H87A 3BKVA 1RE2A 5LXWA 5KY1A 2MEDA 5A3ZA 4XJBA 1FKQA 3HBDA 5LAFA 1LZ4A 3AZ7A 5E9RA 4OOOA 1RJCB 1Z55A 4YENA 1UUZC 3TMVA 4EOFA 4LYBA 2YBHA 2AUBA 3OK0A 5KXLA 2HEBA 1LZNA 1B5YA 4LYCA 4YOPA 1XGUC 4BS7A 4H8ZA 2Z2FA 3CT1A 3LHMA
chains in the Genus database with same CATH superfamily
1ZMVA 3FTEA 3D3DA 3V76A 1LZYA 3ZVQB 3L2XA 2G3QA 1T97A 4HV2A 3HU8A 4LGYA 1L76A 3GLIA 4QHTA 3WW5A 1PJSA 1DXJA 2LYOA 4OVZB 1DO2A 3G3AB 4F1IA 4JI5M 4WM2A 4OWCA 2YVBA 1TCYA 1D9WA 4G4NA 1IP1A 4MH0E 1LYHA 1TR8A 2XEPA 2DBTA 1IEEA 1LYDA 3A95A 3VWOA 1SWZA 3SAVA 5B05A 3FUXA 1NMMA 2GQFA 176LA 1XC8A 126LA 3TXBA 150LA 1C6DA 1QT7A 3U6SA 4WM4A 4DD1A 4PT5A 4I7JA 1TDYA 4WM3A 2WSCF 2DI0A 4EPFA 5EXTA 4GLVA 3DMVA 2DZLA 2B74A 4WL6A 4ZEEA 2UUBM 5ITYA 1N78A 2G8LA 4GN4A 1G7IC 4LJ9A 3LYTA 4M0WA 3U6CA 4D80A 1T6VL 3FYDA 1MELL 1OAOC 3HUAA 5EP3A 1YKXX 4WLYA 3HY5A 4W51A 3KOYE 2QP9X 1LJNA 3A42A 1L98A 1NHEA 1IM2A 3HZJA 3LMMA 1D3FA 2ZIJA 3A45A 1C65A 2X8AA 3VK8A 1KXWA 1JKDA 213LA 1J5EM 3SB6A 5I14A 4KODA 1DGBA 4DUYM 4R0FA 1C6NA 4GCCA 5DFLA 5ITXA 1N4FA 3GQ4A 1DYEA 2V1CA 1JSFA 4ZFPA 4BBAA 3CTWB 1L0JA 1QZEA 4OWBA 1KSFX 5L9JA 1GXV2 4B08A 209LA 1NHBA 1D9UA 4L6V6 1L61A 2LTUA 1AIPC 4LRTA 3NWLA 3CSZA 251LA 1NY6A 3DN0A 3ODUA 2H9KA 1F10A 1QTHA 4IBFA 2GNOA 147LA 1YE9A 3E9SA 5F9UA 3SB9A 2BQJA 1TBYA 2ZAMA 206LA 1OUFA 4LF5M 1GB7A 2OOAA 3SP3A 3QAKA 1G07A 3KW6A 2EUCA 3VKGA 4H9IA 2L09A 1N32M 2EJSA 3RZEA 3ATNA 5JENB 231LA 1C6HA 4P2EA 1HT1E 4LFXA 3A90A 1L1TA 1L83A 1TH4A 3DMZA 1QSBA 2ZIKA 4FJRA 1T8GA 1YL0X 1XWIA 5DYIA 4NGOA 2IGCA 2B6ZA 1DGHA 1CKCA 1P6YA 2ANXA 5KO3A 4X64M 218LA 1B7MA 5KPRA 1B7RA 4G4RA 5LYMA 1LZBA 1FBIX 3NY8A 5I4XA 4LF6M 3KFUG 4JI2M 2DQDY 1XJUA 3G3BB 1T3TA 1C6IA 152LA 2F5PA 4GCBA 1XB2B 1OJLA 2UXBM 1IP2A 4LJ4A 1NWGA 4XGIA 4D9ZA 4ARQA 4I7KA 1NO1A 2Z37A 5LYTA 3FI7A 3OE6A 2LYMA 3U60A 1VQ1A 4I7NA 4HJYA 2BQLA 2MJ5B 1FNNA 5EP4A 2C8PA 2LZTA 4AW4A 5LVHA 3WW6A 3HU1A 240LA 208LA 1B7OA 2MECA 4XJGA 4QY9A 1XNQM 191LA 1L87A 1DPXA 4WO9A 1QT5A 4HP0A 1PRBA 142LA 3W6BA 3C8SA 3T36A 3FE0A 1OFHA 1T6HA 4QHSA 1LJFA 1Z6TA 2D7GA 3DN8A 1HHLA 1L60A 3Q8GA 4G4HA 4DD0A 2Y20A 2X0AA 4I7PA 3P68A 1IQPA 2HHHM 1PJQA 3HKPA 1P2CC 185LA 4A3VB 2B72A 4F2LA 4LT0A 1OUEA 1OYUA 1QTCA 3WMKA 235LA 2DXIA 2DWMA 4G4CA 4LGKA 1G4AE 1DKKA 1W6ZA 2XLJA 3A92A 4NHIA 1LKSA 5KQ8A 177LA 1LJ3A 4EKQA 1DI4A 1R6BX 2M5ZA 4FDYA 4DR3M 3LN2A 1CU0A 1P36A 3SAUA 2R0IA 1L24A 3THGA 4IATA 1C62A 3L64A 3M6AA 162LA 1ZMWA 3J7BA 3ZCBB 3HUQA 1D3MA 4J7VA 3SYKA 2KNZA 2JNHA 3OE0A 1NBZC 2O01F 2ZAOA 3HHWA 2B6YA 3QAUA 2BQCA 4NGLA 2QSFX 3U6LA 4AQNA 1OIZA 4LF9M 4WG1A 5ITRA 3A34A 4OW1A 2JUJA 111LA 2EPEA 3A8ZA 4TUWA 2OPFA 4IJFA 4B0DA 2BQNA 1GF7A 189LA 3WUMA 1IOTA 3WU7A 4OVZA 1VAUA 1IR7A 4OWEA 1KYIA 5ITUA 4KHPM 2D7EA 3FD9A 4QOSA 1LSEA 3LYMA 4I0CA 3WULA 4LG2A 3IWRA 4WP2A 212LA 2O5RA 1LJEA 1C64A 1REXA 3GULA 193LA 2V6ZM 1FKVA 1L89A 4TUNA 1L66A 3HBEX 3CQLA 5EXSA 1IN4A 2XSZD 1NSFA 1XGPC 3L2AA 245LA 3J2PB 4YEOA 4DD9A 1GDWA 5LVGA 4R3DA 221LA 2LZMA 1HC0A 1KIRC 1L99A 1VDTA 1BHZA 4E97A 1EQ5A 1NY5A 1L12A 3MGWA 1TF0B 3B74A 5KQDA 3C8RA 4GCFA 2BWBA 1OVHA 1ZMUA 5F3WA 5FELA 1GJTA 3AYQA 2DVWB 3TL4X 1JJ1A 4I8OA 5HMVA 1WQNA 3FUVA 4KO8A 2HEAA 1YANA 5KXRA 3B7QA 1WR1B 2BJVA 1PQMA 1PGYA 2RBNA 3ZQJA 1W08A 2JZ0A 4AG6A 5B1GA 4ARJA 181LA 1ZV1A 4EKPA 1L36A 173LA 3C80A 4NRVA 4AGAA 3RFWA 132LA 2W1MA 1OUCA 4WM6A 1YAOA 3HH3A 160LA 1CKFA 4PD2A 1L84A 4IJ4A 3ULRA 1OUBA 1L15A 1JTTL 4LDLA 3JR4A 1LJIA 1QAQA 1XXHE 112LA 3B6LA 3SB7A 1CV5A 3QE8A 2CEAA 3WPJA 257LA 1WIVA 1DKJA 256LA 4Z46A 4NSHA 2RBPA 3K92A 1LZCA 1HQYE 2JWSA 4GKJM 4LF4M 4KT3A 2D4JA 1LWKA 1JKCA 1YSYA 1PJTA 2JA2A 1VDLA 2MEGA 4CGYB 1VEDA 4ETBA 2F30A 1GF8A 1DI3A 4Y28F 2Y0QA 134LA 4RLMA 1L50A 1OUGA 1A4VA 3DKEX 3N9EA 3SC3A 3CGWA 3HT6A 2HWJA 1QSAA 4W52A 3GLFA 5I4WA 1BB3A 1YAMA 5HLLA 3AB6A 4G4QA 1EPYA 3TXGA 2Y0TA 3SFZA 3GUMA 3HTFA 2Z39A 3PNVA 5C18A 1L86A 155LA 156LA 2CHGA 1IR9A 3QYBA 3TXEA 3WXUA 1LYSA 4H9BA 1L29A 3GPPA 175LA 5I54A 1GB6A 3V2YA 1OQMA 1E94E 2RBOA 3KSJA 1LSZA 3JR6A 4LFPA 1QTBA 4KXIA 1NKHA 1LHIA 2CV0A 1G7MC 1RI8B 3K1JA 4YF2A 4DR1M 1L8QA 1ZWNA 255LA 2YNMD 1JEFA 1YILA 4GCDA 1LYZA 2ZYPA 1LSDA 3SBJA 1L93A 1C43A 1IOCA 4MGHA 3KOZE 1CU3A 1C46A 1L32A 1CV1A 7CATA 1GAYA 1QTEA 1DO0A 3AZ4A 1LI2A 3WVXA 2EKKA 3GUKA 3DN1A 1JQJC 3CB7A 5LA5A 1L71A 1LI3A 2PC2A 3EBAB 2KW0A 1H87A 3BKVA 1RE2A 1FKQA 1XJTA 2M60A 4ZPXA 5LAFA 2RGHA 3AOGA 1IBLM 1Z55A 197LA 1QT3A 4EOFA 3MK6A 3OK0A 3E46A 3HHYA 1LZNA 4LYCA 4BS7A 1DGGA 4LZJA 3TQSA 4KT0F 1ORYB 2K6BA 1IOSA 3RNXA 109LA 1N75A 3GLIB 5FEKA 3ZC7B 1QUGA 5HNCA 1C66A 4ETCA 4IBGA 1L82A 3VDUA 3R9XB 4IBKA 1LPIA 1LGWA 1K3WA 3CF6E 210LA 1PQDA 4L78A 2B3TA 5JI3E 3E3DA 1IBKM 2BQDA 1QTKA 2XBSA 5D5CA 1E32A 1IWYA 1VDQA 1L95A 4RF1A 5LZMA 1HEWA 1L90A 1ALCA 4LFCM 1HR0M 4CJ6A 4PDGA 5C6JA 1G0KA 1AZFA 261LA 2RBRA 130LA 1LZ5A 1LSYA 1DQJC 1LYJA 2D91A 1AT5A 1F6RA 3AOEA 3C7ZA 2DWNA 1IWTA 4W55A 1G59A 1BWIA 2YSSC 1LAAA 3IECA 3QYEA 5C1BA 4DDCA 3C9PA 3RGSA 4NGZA 1KW5A 1L33A 1LZ1A 1QS9A 1LHHA 3UJNA 3B0IA 3LQRA 2YBLA 3K9OA 3HHXA 4LYZA 2LHGA 3HH6A 1QAOA 4P17A 3MJ5A 2W82A 1F4IA 1IP7A 4MGIE 1L75A 3TMXA 2B5ZA 3J4GA 4NHPA 4LCBA 2R18A 1INUA 1I6SA 4KPMA 1XXHA 140LA 4DAJA 1L55A 1IXZA 3AKZA 2EO2A 1RCMA 3J81S 4LF7M 4DR7M 4N9RA 4HPIA 2C98A 4W96A 3A91A 5IZ7D 1HNZM 1C60A 2RH1A 1LZGA 1UIBA 1YKYX 1C08C 2R62A 1SXJC 151LA 1NNJA 2CJLA 1LI6A 2YDGA 1GB3A 3C8QA 4XADA 2Z38A 1HEOA 5DLAA 3W67A 5FHWA 2JXNA 4LJAA 1L02A 4PJZA 1L05A 4Z98A 3GLGE 5F16A 1YLAA 1DPWA 4ITQA 3TXJA 1K28A 1D6QA 1WJ7A 2CV2A 4BADA 3PFIA 1LPYA 3A3RX 2UU9M 1JTNA 4R6CA 4RF0A 4HEOA 3I51A 3GLFE 3IHPA 1ZAEA 3K3TA 1GFRA 3N9AA 1GXXA 3QWLA 234LA 1LSBA 1CV3A 3GLGA 2BQBA 1L49A 2H5ZA 1OFIA 4MB7A 5EXPA 4GITA 222LA 4H94A 5F14A 4OO9A 1YQVY 5ITTA 5KXYA 1LYIA 1R7RA 1NDGC 3AGHA 1LCNA 1G1WA 4MM3B 4OX9M 205LA 1FDLY 5I5QA 3AGGG 3HTGA 1UIGA 3HU9A 3GLHE 4CGEA 4DD3A 2EA0A 1LZ6A 3C82A 1CUKA 4JI6M 3F9LA 1JSEA 2A5YB 3AJNA 3H4JA 1J7KA 1HNWM 1DZBX 2BQHA 4WM1A 4IBDA 1AM7A 1LJKA 3VKHA 1T8AA 2YBJA 133LA 5KXTA 1EIJA 196LA 2DQHY 3FTCA 1GFTA 2CWBA 1NBYC 1HERA 1CV4A 3VW7A 2I25L 2YBNA 3U61A 1L41A 239LA 1C67A 4DR4M 2DAMA 1GFKA 1IC4Y 1V7SA 3PBLA 4OWAA 1L51A 1CNSA 1L56A 2VF8A 3T6UA 4XJDA 3HWLA 1CKHA 1LHKA 4QNMA 3DN2A 4IJEA 2CHQA 4J0LA 258LA 119LA 1L30A 1QVRA 1L40A 1A2YC 3GUNA 2H9JA 1P5CA 4B3SM 2RB2X 1TGUA 3RGPA 4XN6A 1V33A 1D6PA 2D4IA 5KXSA 3J7AS 1GB0A 8CATA 4YXCA 3HJ8A 3TWKA 1YROA 4QEQA 2F32A 5LIOA 5ILFA 1C6KA 1D2YA 3WUAA 4PCZA 1L59A 2GV0A 2DQEY 1GF3A 3B7ZA 4AKHA 1N77A 2O7AA 1DYGA 4EJ4A 4M9SA 2UUAM 1C6JA 2DQCY 2LHMA 2BQOA 3T38A 4A7DA 1SXJB 2VB1A 3HU2A 2LC9A 1C7PA 1C63A 3DFZA 3C58A 3ATOA 3SN6R 5DM9A 4LFAM 1NHGC 1C1KA 4UWVA 1N36M 259LA 1L77A 4DWXA 3QY4A 3AV0A 217LA 3GQ3A 1L2BA 1L07A 1L72A 4G9SA 1XGRC 1LSMA 4H90A 1BGIA 3CDQA 5F81A 1L97A 1GE0A 1CX6A 3WU9A 1EE8A 2R65A 3SHGB 5FTMA 1D3JA 4GCEA 4H9CA 3HJQA 1T8FA 1LYOA 5EXXA 4ARPA 4WOAA 1L28A 3HHZA 4I81A 170LA 1JPOA 4I5SA 1SXJD 3EIHA 5C6LA 5B06A 2DQGY 1XGTC 2ANVA 3C7YA 4L41A 1J09A 2QBYA 1EFUB 113LA 1CX7A 254LA 4CFOA 1NV8A 1QQYA 2I26L 2XZFA 4EIWA 5FLXS 3WUNA 1K3XA 5D5FA 2KZUA 2C9CA 3FADA 2K47A 4RDSA 2KEBA 3LYOA 5HQ1A 1IN6A 1LJ4A 1Q39A 5C6IA 2HECA 2FYDA 2QCUA 2LVQD 2LH0A 158LA 2DHYA 2ZWBA 3RT5X 4MSTA 2MH8A 143LA 2FYCA 1V92A 3P4ZA 4L4UA 4DBGB 1WVUA 4NG8A 4I7TA 2N5ZA 3A6CY 2KRKA 3GUJA 3GRYA 1L10A 3DOAA 1LKRA 4IBCA 4OOTA 4P16A 2DAKA 1UFZA 3OJPA 2JY5A 3TWLA 2V1UA 2LYZA 4N1CC 3RW8A 4UWNA 1X37A 1OIPA 4E3UA 1L22A 1ZV5L 249LA 125LA 2QARC 3L26A 2QENA 1LOZA 4S0WA 1ZMYL 2MEFA 5KXZA 1GE1A 2O4WA 4EMNA 4DV3M 1OUAA 2BQAA 3SB5A 4B4IA 5B59A 1GBWA 3HTBA 3HTDA 1L62A 4KL7A 1LSCA 2XZUA 4NL4H 2F4VM 1GF0A 1G06A 1J1PY 3GUOA 1UCOA 1C6QA 5LVIA 2LXEA 3GPXA 2Y21A 1P37A 1HEPA 1HENA 1UBZA 3OTOM 3G3VA 1ZVYB 2DAGA 1L64A 5IELA 129LA 2CFOA 2MR9A 4NC6A 1OUDA 1L58A 1IP5A 2HEDA 1VEGA 5KXPA 4QOZC 2HU1A 1PJJA 3Q8XA 1Z5AA 1JTMA 1DGHB 3FKEA 3T1YM 3DN3A 1REZA 3RE8A 233LA 4NXNM 2A4TA 2LCBA 5AMYA 3UGJA 219LA 1P7SA 153LA 5APDA 2XQOA 3A98B 1NJGA 1SSWA 2EQLA 4JI4M 3AW6A 1IORA 1CKGA 1IY2A 5DNYA 3B7NA 4J1AA 2Z6BA 5BPVA 4JN6A 4LJ8A 1XSFA 1G0QA 3B0KA 4DV1M 5LVJA 1GL7A 3WU8A 1CJ8A 2A7DA 2FFJA 1GFVA 3J6KA 4IASA 3LW5F 207LA 4YY3M 1MLCE 1L70A 224LA 4YM8A 4H9HA 2XFSA 1UIDA 3TMWA 1LZEA 2F4GA 4TWSA 4LT1A 2J5YA 3AGIA 1JKAA 2BQEA 4GBRB 154LA 4FCWA 3U6OA 180LA 1OUHA 1L91A 4EKSA 1C68A 2FOIC 3QNGA 1TEWA 2HL7A 253LA 2FS1A 1GFGA 4JI3M 4IBBA 5KXMA 4LJ5A 3W6DA 236LA 2CUUA 2RAYX 2BLXA 5DN4A 1GE4A 1DYAA 1L42A 3AZ5A 3HUKA 102LA 2BAAA 1QIOA 4W5WA 1L31A 4H8XA 4PPOA 1UIAA 4D82A 4B4EA 1FLUA 1TH2A 3KOWE 1WGLA 4PRUA 5KY1A 4WURA 3HBDA 4CIZA 169LA 1PQKA 4OOOA 1QT6A 2AUBA 1L43A 5KXLA 2YR0A 260LA 1B5YA 4YOPA 2FH0A 7LZMA 2J7OA 4KLNA 3FUWA 4R7GA 3U6PA 4W59A 1KS3A 2XSZA 1LYEA 2DQAA 3DNAA 2Q9DA 3EIEA 3HDFA 5GKNA 2OU8A 4NGWA 4H8YA 1HFZA 1N33M 1L44A 1V7TA 3F6ZA 2XF3A 1FLQA 1GF4A 128LA 1CU6A 2FBDA 2Q0MX 3HFMY 1HT2E 115LA 1IP6A 214LA 2X49A 3VLFB 1WVVA 127LA 1G8PA 1CV0A 1HEQA 4B7GA 3ZEKA 1I1ZA 1ZURA 9LYZA 2CHVA 2DZNB 3C7WA 4MR1A 3C81A 1SG9A 223LA 1WHCA 1OUJA 1Y8GA 3V2WA 4IIWA 4BLCA 4NSOB 1KNIA 3SBAA 4II7A 4W57A 3K9PA 2B6WA 3ZVQA 238LA 242LA 2G4QA 1KXYA 4H92A 5LYZA 2LBCA 135LA 1PZYA 1GWDA 4AXTA 3E21A 1JJ0A 201LA 1QUHA 3GPYA 4GHAA 1B2KA 1HEMA 2OEAX 166LA 2CV1A 1B5ZA 1IWZA 1QTZA 1L39A 3W6EA 4DV4M 1FN5A 2RGOA 199LA 1G0MA 4WMGA 2ZTDA 1L13A 3BKHA 4LT2A 3M3UA 1GD6A 3P66A 3UK6A 1C45A 3TXDA 198LA 1G3IA 1VDSA 3DZDA 3GRRA 3A46A 1G1VA 1WQQA 4JXJA 1L45A 4JYAM 5KKJA 2HTXA 2FBBA 1RU3A 1B7NA 1JHLA 3A94A 3A67Y 4S12A 5LAGA 4NY5A 4GN5C 2R46A 2OE9X 1L48A 4I7LA 3U6QA 4HJZA 5L3IA 2J7NA 2NQ8C 2VIIA 4NWHA 4LJ6A 1IN7A 262LA 1TH3A 183LA 1F6SA 3SAWA 3FUUA 5FTJA 187LA 2H1RA 4NGKA 3R8FA 3PNYA 3SMSA 2DKVA 5KPTA 3EMLA 1WQOA 1CJ7A 226LA 4GC5A 2DHRA 2HKJA 2L7IA 4DV5M 1UACY 4WO6A 1LSPA 2DENA 1B7QA 2EKFA 3C3DA 1KIQC 1P46A 2F5QA 3GLFB 4GHLA 163LA 3SB8A 4QGZA 5H37D 1WTMA 2C8OA 1XGQC 1QUDA 1DGFA 2JY7A 1QUTA 2HU3A 1L26A 3IG5A 3W68A 4GRVA 4FWGA 5DL9A 4YXAC 5HMJA 4M0DA 5DN5A 3KXEC 4J1BA 4LDOA 4LZZA 3OE8A 4DC4A 3E4RA 1L67A 4O34A 1BWHA 4B49A 3D8LA 2RB1X 4U3XB 1GF6A 1XEJA 2RSCA 3J80S 1DYCA 3SATA 1IY4A 1GJSA 1L47A 5L3HA 4DV7M 1E9SA 3CDRA 4LFBM 1GE2A 1G0PA 2HEEA 1IC5Y 1R2ZA 4CHXA 4DQJA 4OW0A 4G6ZA 2D4KA 5FDJA 2DNAA 1KFVA 2RKOA 2BQGA 246LA 2HCBA 1LYGA 1D3NA 3G3WA 4JI8M 4AZFA 3ILKA 2MGWA 3KP1E 2ZQ3A 1EQEA 2RB0X 1GL6A 3DA1A 148LE 3GLHA 4W54A 1CUPA 2CDSA 2QPAA 5EP2A 1P2LA 1WQRA 4WM5A 3BBZA 5B1FA 1E9RA 120LA 3HU3A 4ZPUA 1KIPC 3U6DA 2Z4RA 1PS5A 2MEIA 5IWAM 1BVKC 4XENA 215LA 1LGXA 1C6LA 4DR2M 2Q2EB 1L19A 2CWIA 4PJ2C 2KNAA 5E6JA 2CE7A 4M9ZA 3MHVC 1TLAA 3CT0A 4RNAA 4NG1A 1L88A 3HT9A 2L4EA 1JKBA 1T6OA 4WLTA 1LV7A 122LA 4QNRA 2Z4SA 4DQ7A 2ZM6M 1L52A 1SXJA 1GBXA 2UXCM 3HT7A 1OV5A 2VQEM 1J1XY 2VQFM 227LA 4H1PA 4C3WA 5EJCA 1XFPL 2WSEF 1TAYA 3W6CA 4FWDA 4FVMA 1G0GA 4GKKM 4ML7A 3SASA 4H91A 137LA 4RLNA 4LDEA 2YBMA 4PRQA 3T1HM 1YIKA 1L1ZA 1IOQA 168LA 4G3OA 1FJGM 3EMSA 4Z3MA 3FA0A 1CVKA 188LA 1L68A 4XJFA 1L21A 3WPKA 3U61B 2BNKA 1JWRA 1I94M 2XFTA 2QZ4A 1CV6A 1L27A 1NNUC 1QUSA 4TX7A 4K5YA 1G7LC 2KDLA 1H6MA 2WZJA 6LYTA 4L15A 248LA 3A3QA 1JUGA 250LA 1CKDA 1NHWC 3SMPA 1LSAA 1GLNA 2DZOB 1UM8A 6LZMA 3KS8A 1IWXA 3CDTA 4NGIA 5LVKA 1LW9A 2Q9EA 1R2YA 2F2NA 3PXGA 186LA 5I53A 4H9EA 1L38A 1IWVA 3H4MA 3JR5A 2ZNXY 1C6MA 1QDTA 1ZYTA 3HT8A 1B0DA 174LA 1OUIA 4L16A 1UC0A 4EKRA 2RAZX 2A7FA 5KKIA 3U6MA 1CJ9A 4D81A 1B7SA 1G71A 4GMQA 1B5XA 1QDRA 3RUNA 5I4YA 2L6OA 1QUOA 2CUZA 2OE7X 7LYZA 3UMMA 1OAIA 3TMUA 1XMQM 1DI5A 4ETEA 2LVPC 3EO5A 2O79A 161LA 2IFFY 4NGYA 2FNAA 5IT9S 2APLA 1WQPA 3PDSA 5APFA 3I04M 4DDBA 1JISA 4AG5A 1GE3A 3MMPA 4WG7A 4JI0M 4YX7C 1AT6A 5IDDA 1JITA 1YL1X 4DJHA 2KXEA 2MEHA 1HNLA 4R71A 2CRUA 1HF4A 3A6BY 1GVNA 2KZSA 1MU5A 5E26A 2H5XA 5EBHA 4UN2B 1IXSA 1C61A 1SWYA 5ILCA 2JY6B 1CU2A 1C6GA 1QSQA 1XEKA 2XTHA 3KDSE 1C6FA 3M7GA 1XEIA 1VEJA 2HUMA 2F4AA 4HSFA 4XK8F 8LYZA 1UA6Y 1L06A 3HX3A 184LA 1PQJA 4I7MA 2K9DA 4BAPA 3LZTA 1I20A 2E5LM 3F8VA 1SX2A 2LVOC 4NSJA 1T43A 1IP4A 1L14A 4LF8M 1L34A 1IWWA 1MN3A 1LMPA 1KY0A 1REMA 2Z2EA 3CDOA 1F0WA 3TXIA 2Z19A 1Z5CA 1C6TA 123LA 4PHIA 1GEZA 1L23A 1IIZA 4DD2A 3I4VA 5K7OA 4W58A 4N8ZA 4LYTA 1L20A 1VFBC 3L29A 5F9XA 5LINA 2RBSA 5LMUM 4DV2M 3HGIA 1IWUA 1PQOA 4H9AA 2W1LA 4I4LA 4M9XA 3RU5A 3I01M 1IO5A 4ETDA 4N5RA 2QB0B 1HSXA 3W0LB 4XBOA 1L65A 3AL0C 4AKGA 2OU0X 4PGJB 1AKIA 1IVMA 1GABA 1PQIA 4QDNA 2LHCA 3W3EA 4B7FA 3IJVA 3PVSA 1GBOA 1OWZA 1WTNA 3VK7A 1YKZX 2VF7A 2Z7JA 1B9OA 2ZNWY 5BR8M 3SYLA 1K82A 1L01A 1XNRM 3T6PA 1HSWA 5II3A 2BQFA 1CU5A 3CDVA 3LCUA 4LYMA 4REZA 1YAPA 4W53A 3U5ZB 1B6IA 1LJJA 2F47A 3GLIE 2Z3XA 107LA 2XH9A 4MCKA 5LXWA 2MEDA 5A3ZA 4XJBA 1QQWA 252LA 1XHBA 1LZ4A 3AZ7A 5E9RA 247LA 3TWMA 4YENA 1UUZC 2WSFF 1D2WA 1L09A 2N35A 4H8ZA 3HWSA 2Z2FA 1C7YA 3LHMA 4WLDA 1LJGA 4LJ7A 1LHMA 3BXWA 3GLGB 4HTQA 2UXDM 1WTHA 4NSRA 4BB9A 4Z6YA 3CT5A 4ARLA 3KVWA 4Z8XA 4B4JA 1G7JC 3CSRA 3WH1A 3DN4A 3VFDA 1B5WA 3D9AC 1GF5A 4CFPA 3FTDA 5FTLA 2HAKA 1L92A 1LZAA 1P64A 3CSQA 5ITXE 190LA 229LA 3A96A 3HH5A 2G5GX 2B6TA 3RZ4A 114LA 3B0OA 2JY8A 1GFAA 1IR8A 225LA 4NXMM 1G0LA 1PJIA 1OV7A 1I56A 1KXXA 1KW7A 149LA 2B70A 2W1XA 4GIPA 1P3NA 3TXKA 4HTKA 1LJHA 4FWHA 1JTPL 1B5VA 4AQYM 2BPUA 4DV0M 3U6EA 3F92A 1IBMM 1G0JA 1WXQA 4ZIXA 1CTWA 1VDDA 4RKUF 1UIFA 1IY0A 1D0MA 1GB2A 1VATA 4NHSA 2KNVA 4NHTA 3L25A 1IC7Y 2ZBKB 5M1YA 2R45A 1YUBA 1L54A 5DYGA 1GDXA 1NJFA 1QT8A 4UWUA 1QAMA 1HMKA 2I6ZA 1FLYA 1L37A 3C3EA 1L2CA 104LA 3WL2A 3GUPA 2CP8A 4M6DA 1LZ9A 2B6XA 3UZUA 5JI2E 2Z8YM 4W94A 1L00A 1GKIA 3LYZA 4GEWA 4X3BA 4B1AA 4GRIA 4HPEA 1O23A 1LYYA 4FW9A 4LZMA 5IREB 4G4OA 1JIYA 3AJIB 3LCVB 5FTKA 2OE4X 3WPLA 2LWXA 5KJ9A 3G3XA 4I7RA 2KRUA 2R6FA 1P2RA 1RFPA 1REYA 4NFVA 1L03A 1XMOM 2IHLA 5KXKA 3CF2A 243LA 4MGZE 3FTFA 1L16A 4NOOB 2L78A 2RRUA 4AKIA 1OVKA 1C6PA 3IJUA 1MX0A 1QYRA 5KXXA 1QSWA 4HTNA 3AZ6A 4GH9A 4LY6A 1W5TA 3J27B 3FYCA 1L81A 3LQQA 1GAZA 1V34A 1SSYA 2DWZB 2ZYCA 4B3MM 4II8A 4LGMA 3K2RA 3FI5A 1A5TA 118LA 4TSCA 2BJWA 1LZSA 1C6CA 3SHFA 2BLYA 3LVVA 3WVYA 145LA 1UICA 5APEA 1OTRA 5LMNM 2R4EA 2CGIA 4WLXA 110LA 4B3RM 1LHJA 1GBSA 1D0KA 2B73A 1HJPA 2UUCM 5J7CA 1KY1A 1CUQA 4PK0A 1J1OY 1LMAA 4N1EI 4FCTA 1D0LA 141LA 3ZH9B 1VDPA 1Z5BA 2F5SA 1L08A 1N34M 3GLHB 3FUTA 167LA 1BB7A 1LSGA 1T3PA 1P56A 3GXKA 4CJ2A 216LA 4G49A 1JR3D 1QANA 4TSBA 3OE9A 4NEBA 1OP9B 1C10A 2F5OA 4NIJA 2D6BA 2OO9A 3TPZA 4ETAA 4NWEA 4GLAA 5FSTA 1L25A 2HUBA 4NSGA 2OOBA 4CISA 2F2QA 3P64A 2C96A 2QNJA 1OWYA 1LSFA 1SX7A 1NQIA 3W6AA 5KXWA 2EKSC 3UONA 4Q7JA 3GRVA 5A2QS 3WYHA 2QHOB 103LA 3KSXA 2L7HA 3HDEA 4G4BA 2G4PA 192LA 2LNHC 1L11A 5L8RF 1SQ2L 1HFXA 2R4JA 3L27A 1SLYA 2DKLA 182LA 2VDBB 1NVMA 2OTZX 1W5SA 1LYFA 4AI6A 3L28A 1L04A 2B7XA 1OQYA 1LMQA 4I7OA 4I8SA 1C6AA 3LZMA 2X4AA 1EL1A 3WXTA 3GUIA 2OQ4A 1QTDA 5KXNA 4JV5M 2P5TA 2R44A 1IN8A 1DYDA 4RW2A 3JAMS 4ET9A 4GC9A 2ZANA 4HLQA 1UIHA 1JB0F 1FLWA 4ARQB 1L69A 2LVAA 1ZVHL 1GFJA 1XEPA 5E4PA 1CJ6A 220LA 4IBEA 1IFYA 4X62M 3B89A 2KHHA 2QBYB 4C5FA 4PDIA 5ITQA 4B7HA 3KP0E 1BQLY 3TXHA 2XBRA 3BOSA 165LA 1C6EA 2EIZC 4GN3A 4NHQA 1NDMC 1BB6A 228LA 1SXJE 4JI7M 2C9OA 2KA6B 2MROB 5FCPA 2I7NA 2MEBA 4NRWA 3VDPA 2DWLA 1ZQ9A 1Q3BA 157LA 1VG5A 146LA 1IP3A 2JP7A 5FTNA 1IY1A 3GQ5A 4FCVA 4YHHM 1UIEA 1XXHB 2OTYX 1L46A 4DQ5A 1GFEA 1DYFA 1QZMA 3AFHA 3M0EA 237LA 3D4SA 1OKSA 2LZ2A 1PM5A 1LWGA 1C69A 5EQTA 139LA 1R4GA 4XJIA 1IXSB 4L8RC 2W1YA 200LA 2DQIY 3GXRA 4IBJA 3DN6A 3K8ZA 2MEAA 4HJVA 3I4YA 1L94A 2NWDX 1BVXA 5IHGA 4EXMA 3FE3A 1L53A 2HEFA 3W6FA 4B3TM 2RBQA 1TTEA 4DUZM 2LVNC 4DDAA 1YAQA 3B9PA 2DQJY 2F5NA 5APCA 1BWJA 2Z12A 3EXDA 1HMLA 1DV0A 164LA 2L2DA 2MEEA 1JQUA 1GB9A 4HV1A 1JTOL 3KS4A 241LA 2HULA 1OVJA 1B7LA 4OU7A 1L18A 1GFUA 4BAFA 159LA 1G7HC 1G41A 244LA 2BQKA 1HFYA 5HNLA 2FE8A 4OWHA 194LA 1LMNA 2L4FA 2C99A 5A3EA 4WW0A 2O25A 1L96A 5KXOA 1IX0A 144LA 1GBYA 2WARA 4IBIA 5T3FA 3NBXX 2NTHA 1L80A 1TDHA 1L73A 2B75A 3HBHA 4RW1A 1JR3E 131LA 4DD7A 1QTVA 4W56A 2XJWA 3NBIA 3A93A 4ANRA 3U60B 1GO5A 3NYAA 2DAIA 4JI1M 3GP1A 1LSNA 3NY9A 1LZ8A 2ZTCA 1B5UA 3N9CA 1JJ3A 171LA 3AOEC 6LYZA 2I7PA 172LA 230LA 1L2DA 2Y8PA 1LZRA 4X66M 2YBIA 3GRUA 5EP1A 4N0JA 1Q3CA 1LMTA 1LZTA 1GEVA 1BB5A 4LZTA 3KAMA 2YQZA 1LTMA 3WHKA 4LRSA 4WL7A 1I4WA 4NGVA 1P3QQ 1GFHA 1B7PA 1WQMA 1IN5A 3HJSA 1H6UA 3HH4A 4MGYE 3T15A 3W0FA 2AHMA 4XJHA 1GHLA 2ZILA 1LZDA 3SBBC 3TXFA 4LT3A 2YFQA 3FRHA 108LA 4NSIA 4IAPA 4M4OA 4DR5M 3B72A 2G4NA 4ET8A 4H93A 1E8LA 3K2LA 1DYBA 2BQIA 3CF0A 2D7HA 2Z18A 3LZ2A 1L0KA 3KOXE 1NF5A 2BQMA 4I7QA 2DQFC 3DMXA 3P65A 1HELA 1LGUA 4YEMA 4DV6M 3AW7A 5B07A 1L35A 2HUKA 3WHLA 195LA 4DT3A 1BVSA 232LA 1LMOA 4I7SA 1HQCA 4NGJA 4Z41A 3M18B 1GBZA 1TDZA 1LLHA 1QT4A 4ARMB 1GB8A 3TE6A 1BB4A 1LHLA 1L79A 3SARA 4DKLA 2ERCA 3GO8A 4H9FA 1QS5A 3IG8A 1VEKA 1AUAA 4XYYA 1GF9A 2K0BX 1GB5A 2ZQ4A 3D8BA 178LA 4MGKE 3U5ZA 5FSWA 4TTDA 1D2NA 5LA8A 1EQ4A 1C6BA 1MJGM 1L17A 3C83A 1IY3A 1LMCA 1IXRC 1WGNA 1L74A 1Q02A 4DYGA 4LYOA 1HNXM 1R5LA 4FD2A 1GPQC 3GPUA 1JR3A 1Z59A 4EPIA 2JZ1A 2QQ8A 1NV9A 5KPZA 2DAEA 2XGNA 4ARMA 4X65M 211LA 1S3SA 1RJCB 2BWEA 3TMVA 2NTGA 4K0KM 2C5RA 4LYBA 2OU9A 3FRIA 2YBHA 1L57A 4CHTB 2HEBA 4HL4A 3LVWA 1L63A 1XGUC 3CT1A 4DR6M 1L85A 138LA
chains in the Genus database with same CATH topology
3D3DA 1LZYA 3ZVQB 3L2XA 1T97A 4HV2A 3HU8A 1L76A 3WW5A 1DXJA 2LYOA 3G3AB 4WM2A 4OWCA 2YVBA 1TCYA 1D9WA 1IP1A 1LYHA 2DBTA 1IEEA 1LYDA 3A95A 3VWOA 1SWZA 5B05A 1NMMA 176LA 126LA 3TXBA 150LA 1C6DA 1QT7A 4WM4A 4DD1A 4I7JA 1TDYA 4WM3A 4EPFA 4GLVA 3DMVA 2B74A 4ZEEA 4WL6A 4GN4A 1G7IC 3LYTA 1T6VL 1MELL 3HUAA 1YKXX 4WLYA 4W51A 1LJNA 1L98A 1NHEA 1D3FA 2ZIJA 1C65A 1KXWA 1JKDA 213LA 3SB6A 5I14A 4R0FA 1C6NA 4GCCA 1N4FA 1DYEA 1JSFA 4ZFPA 1L0JA 4OWBA 5L9JA 1GXV2 209LA 1NHBA 1D9UA 1L61A 3CSZA 251LA 3DN0A 3ODUA 2H9KA 1F10A 1QTHA 147LA 5F9UA 3SB9A 2BQJA 1TBYA 206LA 1OUFA 1GB7A 3SP3A 3QAKA 1G07A 4H9IA 3RZEA 3ATNA 5JENB 231LA 1C6HA 4P2EA 4LFXA 3A90A 1L83A 3DMZA 1QSBA 2ZIKA 4FJRA 1T8GA 1YL0X 4NGOA 2IGCA 2B6ZA 1CKCA 1P6YA 2ANXA 218LA 1B7MA 1B7RA 5LYMA 1LZBA 1FBIX 3NY8A 5I4XA 2DQDY 1XJUA 3G3BB 1C6IA 152LA 4GCBA 1IP2A 1NWGA 4D9ZA 4ARQA 4I7KA 2Z37A 5LYTA 3FI7A 3OE6A 2LYMA 4I7NA 4HJYA 2BQLA 2C8PA 2LZTA 5LVHA 3WW6A 240LA 208LA 1B7OA 2MECA 4XJGA 4QY9A 191LA 1L87A 1DPXA 4WO9A 1QT5A 4HP0A 142LA 3W6BA 3C8SA 3T36A 3FE0A 1T6HA 1LJFA 3DN8A 1HHLA 1L60A 4G4HA 4DD0A 2X0AA 4I7PA 3P68A 1P2CC 185LA 2B72A 4LT0A 1OUEA 1OYUA 1QTCA 3WMKA 235LA 4G4CA 4LGKA 1DKKA 1W6ZA 3A92A 4NHIA 1LKSA 177LA 1LJ3A 4EKQA 1DI4A 4FDYA 3LN2A 1CU0A 1P36A 1L24A 4IATA 1C62A 3L64A 162LA 3HUQA 1D3MA 4J7VA 3OE0A 1NBZC 2B6YA 2BQCA 4NGLA 4AQNA 4WG1A 3A34A 4OW1A 111LA 2EPEA 3A8ZA 4B0DA 2BQNA 1GF7A 189LA 3WUMA 1IOTA 3WU7A 1VAUA 1IR7A 4OWEA 3LYMA 1LSEA 3WULA 4I0CA 3IWRA 212LA 1LJEA 1C64A 1REXA 3GULA 193LA 1FKVA 1L89A 4TUNA 1L66A 3HBEX 3CQLA 1XGPC 245LA 4YEOA 4DD9A 1GDWA 5LVGA 221LA 2LZMA 1HC0A 1KIRC 1L99A 1VDTA 1BHZA 4E97A 1EQ5A 1L12A 3MGWA 3C8RA 4GCFA 1OVHA 5FELA 3AYQA 1JJ1A 5HMVA 1WQNA 5KXRA 2HEAA 1YANA 1PQMA 2RBNA 1W08A 5B1GA 4ARJA 181LA 4EKPA 1L36A 173LA 3C80A 4AGAA 132LA 2W1MA 1OUCA 4WM6A 1YAOA 3HH3A 160LA 1CKFA 4IJ4A 1L84A 3ULRA 1OUBA 1L15A 1JTTL 4LDLA 1LJIA 112LA 3B6LA 3SB7A 1CV5A 3QE8A 3WPJA 257LA 1DKJA 256LA 4Z46A 4NSHA 2RBPA 1LZCA 4KT3A 2D4JA 1LWKA 1JKCA 2MEGA 1VEDA 4ETBA 2F30A 1GF8A 1DI3A 4RLMA 134LA 1L50A 1OUGA 1A4VA 3DKEX 3N9EA 3HT6A 4W52A 1QSAA 5I4WA 1BB3A 1YAMA 5HLLA 3AB6A 1EPYA 3TXGA 3HTFA 3GUMA 2Z39A 1L86A 155LA 156LA 1IR9A 3TXEA 3WXUA 1LYSA 4H9BA 1L29A 175LA 5I54A 1GB6A 3V2YA 1OQMA 2RBOA 3JR6A 1LSZA 4LFPA 4KXIA 1QTBA 1NKHA 1LHIA 1RI8B 1G7MC 4YF2A 1ZWNA 255LA 1JEFA 1YILA 4GCDA 1LYZA 2ZYPA 1LSDA 1L93A 1C43A 1IOCA 1CU3A 1C46A 1L32A 1CV1A 1QTEA 1GAYA 3AZ4A 1LI2A 3WVXA 3GUKA 3DN1A 3CB7A 5LA5A 1L71A 1LI3A 2PC2A 3EBAB 1H87A 3BKVA 1RE2A 1FKQA 1XJTA 5LAFA 1Z55A 197LA 1QT3A 4EOFA 3OK0A 1LZNA 4LYCA 4BS7A 1IOSA 3RNXA 109LA 5FEKA 1QUGA 5HNCA 1C66A 4ETCA 1L82A 1LPIA 1LGWA 210LA 1PQDA 3E3DA 2BQDA 2XBSA 1QTKA 5D5CA 1IWYA 1VDQA 1L95A 5LZMA 1HEWA 1L90A 1ALCA 5C6JA 1G0KA 1AZFA 261LA 2RBRA 130LA 1LZ5A 1LSYA 1DQJC 1LYJA 2D91A 1AT5A 1F6RA 3C7ZA 1IWTA 4W55A 1BWIA 2YSSC 1LAAA 4DDCA 4NGZA 1KW5A 1L33A 1LZ1A 1QS9A 1LHHA 3B0IA 2YBLA 4LYZA 3HH6A 1IP7A 1L75A 3TMXA 2B5ZA 3J4GA 4NHPA 1INUA 1I6SA 4KPMA 140LA 4DAJA 1L55A 1RCMA 4N9RA 4HPIA 4W96A 3A91A 1C60A 2RH1A 1LZGA 1UIBA 1YKYX 1C08C 151LA 2CJLA 1LI6A 2YDGA 1GB3A 3C8QA 4XADA 2Z38A 1HEOA 5DLAA 5FHWA 1L02A 4PJZA 1L05A 4Z98A 5F16A 1DPWA 3TXJA 1K28A 1D6QA 4BADA 1LPYA 3A3RX 1JTNA 4R6CA 3K3TA 1GFRA 3N9AA 1GXXA 234LA 1LSBA 1CV3A 2BQBA 2H5ZA 1L49A 222LA 4H94A 5F14A 4OO9A 1YQVY 5KXYA 1LYIA 1NDGC 3AGHA 1LCNA 1G1WA 205LA 1FDLY 5I5QA 3AGGG 3HTGA 1UIGA 3HU9A 4CGEA 4DD3A 1LZ6A 3C82A 3F9LA 1JSEA 3AJNA 1DZBX 2BQHA 4WM1A 1LJKA 1AM7A 1T8AA 2YBJA 133LA 5KXTA 196LA 2DQHY 1GFTA 1NBYC 1HERA 1CV4A 3VW7A 2I25L 2YBNA 1L41A 239LA 1C67A 1GFKA 1IC4Y 1V7SA 3PBLA 4OWAA 1L51A 1CNSA 1L56A 3T6UA 4XJDA 3HWLA 1CKHA 1LHKA 3DN2A 4J0LA 258LA 119LA 1L30A 1L40A 1A2YC 3GUNA 2H9JA 1P5CA 2RB2X 4XN6A 1D6PA 2D4IA 5KXSA 1GB0A 4YXCA 1YROA 4QEQA 2F32A 5LIOA 5ILFA 1C6KA 1D2YA 3WUAA 1L59A 2GV0A 2DQEY 1GF3A 2O7AA 1DYGA 4EJ4A 1C6JA 2DQCY 2LHMA 2BQOA 4A7DA 2VB1A 2LC9A 1C7PA 1C63A 3ATOA 3SN6R 5DM9A 4UWVA 259LA 1L77A 4DWXA 3QY4A 217LA 1L07A 1L72A 4G9SA 1XGRC 1LSMA 4H90A 1BGIA 3CDQA 5F81A 1L97A 1GE0A 1CX6A 3WU9A 1D3JA 4GCEA 4H9CA 1T8FA 1LYOA 4ARPA 4WOAA 1L28A 170LA 1JPOA 5C6LA 5B06A 2DQGY 1XGTC 2ANVA 3C7YA 4L41A 113LA 1CX7A 254LA 4CFOA 1QQYA 2I26L 3WUNA 5D5FA 3FADA 4RDSA 3LYOA 5HQ1A 1LJ4A 5C6IA 2HECA 2FYDA 158LA 2ZWBA 3RT5X 4MSTA 143LA 2FYCA 3P4ZA 1WVUA 4NG8A 4I7TA 2N5ZA 3A6CY 3GUJA 1L10A 1LKRA 4OOTA 3OJPA 4N1CC 2LYZA 3RW8A 4UWNA 4E3UA 1L22A 1ZV5L 249LA 125LA 2QARC 1LOZA 4S0WA 1ZMYL 2MEFA 5KXZA 1GE1A 2O4WA 4EMNA 1OUAA 2BQAA 3SB5A 4B4IA 5B59A 1GBWA 3HTBA 3HTDA 1L62A 4KL7A 1LSCA 1GF0A 1G06A 1J1PY 3GUOA 1UCOA 1C6QA 5LVIA 1P37A 1HEPA 1HENA 1UBZA 3G3VA 1ZVYB 1L64A 5IELA 129LA 1OUDA 1L58A 1IP5A 2HEDA 5KXPA 2HU1A 1JTMA 3DN3A 1REZA 2A4TA 233LA 2LCBA 5AMYA 219LA 1P7SA 153LA 5APDA 2XQOA 1SSWA 2EQLA 3AW6A 1IORA 1CKGA 4J1AA 2Z6BA 1XSFA 5LVJA 1G0QA 3B0KA 3WU8A 1CJ8A 2A7DA 1GFVA 3J6KA 4IASA 207LA 1MLCE 1L70A 224LA 4YM8A 4H9HA 1UIDA 3TMWA 1LZEA 2F4GA 4TWSA 4LT1A 3AGIA 1JKAA 2BQEA 4GBRB 154LA 180LA 1OUHA 1L91A 4EKSA 1C68A 3QNGA 1TEWA 253LA 1GFGA 5KXMA 3W6DA 236LA 2CUUA 2RAYX 2BLXA 5DN4A 1GE4A 1DYAA 1L42A 3AZ5A 3HUKA 102LA 2BAAA 1QIOA 1L31A 4H8XA 4PPOA 1UIAA 4B4EA 1FLUA 4PRUA 5KY1A 3HBDA 169LA 1PQKA 4OOOA 1QT6A 2AUBA 1L43A 5KXLA 4YOPA 260LA 1B5YA 7LZMA 4W59A 1KS3A 1LYEA 2DQAA 3DNAA 2Q9DA 3HDFA 2OU8A 4NGWA 4H8YA 1HFZA 1L44A 3F6ZA 1V7TA 1FLQA 1GF4A 128LA 1CU6A 2FBDA 2Q0MX 3HFMY 115LA 1IP6A 214LA 1WVVA 127LA 1CV0A 1HEQA 3ZEKA 1I1ZA 1ZURA 9LYZA 3C7WA 4MR1A 3C81A 223LA 1OUJA 3V2WA 1KNIA 3SBAA 4W57A 2B6WA 3ZVQA 238LA 242LA 2G4QA 1KXYA 4H92A 5LYZA 135LA 1PZYA 1GWDA 4AXTA 1JJ0A 201LA 1QUHA 1B2KA 1HEMA 2OEAX 166LA 1QTZA 1B5ZA 1IWZA 1L39A 3W6EA 1FN5A 4WMGA 199LA 1G0MA 1L13A 3BKHA 4LT2A 3M3UA 1GD6A 3P66A 1C45A 3TXDA 198LA 1VDSA 1WQQA 1G1VA 1L45A 5KKJA 2HTXA 2FBBA 1B7NA 1JHLA 3A94A 3A67Y 5LAGA 4NY5A 4GN5C 2OE9X 1L48A 4I7LA 4HJZA 5L3IA 4NWHA 262LA 183LA 1F6SA 187LA 4NGKA 2DKVA 3EMLA 1WQOA 1CJ7A 226LA 1UACY 4WO6A 1LSPA 1B7QA 1KIQC 1P46A 163LA 3SB8A 4QGZA 1WTMA 2C8OA 1XGQC 1QUDA 1QUTA 2HU3A 1L26A 4GRVA 5DL9A 4YXAC 5HMJA 5DN5A 4J1BA 4LDOA 3OE8A 4DC4A 1L67A 4O34A 1BWHA 4B49A 2RB1X 4U3XB 1GF6A 1XEJA 2RSCA 1DYCA 1IY4A 1L47A 5L3HA 3CDRA 1GE2A 1G0PA 2HEEA 1IC5Y 4CHXA 4DQJA 2D4KA 5FDJA 2BQGA 246LA 1LYGA 1D3NA 3G3WA 2ZQ3A 1EQEA 2RB0X 148LE 4W54A 1CUPA 2CDSA 1WQRA 1P2LA 4WM5A 5B1FA 120LA 4ZPUA 1KIPC 1PS5A 2MEIA 1BVKC 4XENA 215LA 1LGXA 1C6LA 1L19A 2CWIA 4PJ2C 1TLAA 3CT0A 4NG1A 1L88A 3HT9A 1JKBA 4WLTA 122LA 4DQ7A 1L52A 1GBXA 3HT7A 1OV5A 1J1XY 227LA 4H1PA 4C3WA 1XFPL 1TAYA 3W6CA 1G0GA 4ML7A 4H91A 137LA 4RLNA 4LDEA 2YBMA 4PRQA 1YIKA 1IOQA 168LA 3EMSA 4Z3MA 3FA0A 1CVKA 188LA 1L68A 4XJFA 1L21A 3WPKA 1JWRA 1CV6A 1L27A 1QUSA 4TX7A 4K5YA 1G7LC 1H6MA 6LYTA 248LA 3A3QA 1JUGA 250LA 1CKDA 1LSAA 6LZMA 1IWXA 3CDTA 4NGIA 5LVKA 1LW9A 2Q9EA 2F2NA 186LA 5I53A 4H9EA 1L38A 1IWVA 2ZNXY 1C6MA 1QDTA 1ZYTA 3HT8A 1B0DA 174LA 1OUIA 1UC0A 4EKRA 2RAZX 2A7FA 5KKIA 1CJ9A 1B7SA 1B5XA 1QDRA 3RUNA 5I4YA 1QUOA 2OE7X 7LYZA 3TMUA 1DI5A 4ETEA 3EO5A 2O79A 161LA 2IFFY 4NGYA 1WQPA 3PDSA 5APFA 4DDBA 1JISA 4WG7A 1GE3A 4YX7C 1AT6A 5IDDA 1JITA 1YL1X 4DJHA 2MEHA 1HNLA 1HF4A 3A6BY 5EBHA 1C61A 1SWYA 5ILCA 1CU2A 1C6GA 1QSQA 1XEKA 2XTHA 1C6FA 1XEIA 2HUMA 2F4AA 4HSFA 8LYZA 1UA6Y 1L06A 1PQJA 184LA 4I7MA 4BAPA 3LZTA 1I20A 3F8VA 1SX2A 4NSJA 1IP4A 1L14A 1L34A 1IWWA 1LMPA 1KY0A 1REMA 2Z2EA 3CDOA 1F0WA 3TXIA 2Z19A 1C6TA 123LA 4PHIA 1GEZA 1L23A 1IIZA 4DD2A 5K7OA 4W58A 4N8ZA 4LYTA 1L20A 1VFBC 5F9XA 5LINA 2RBSA 1IWUA 1PQOA 4H9AA 2W1LA 3RU5A 1IO5A 4ETDA 4N5RA 2QB0B 1HSXA 1L65A 2OU0X 4PGJB 1AKIA 1IVMA 1PQIA 4QDNA 3W3EA 3IJVA 1GBOA 1OWZA 1WTNA 1YKZX 1B9OA 2ZNWY 1L01A 1HSWA 5II3A 2BQFA 1CU5A 3CDVA 4LYMA 1YAPA 4W53A 1B6IA 1LJJA 2F47A 107LA 4MCKA 5LXWA 2MEDA 5A3ZA 4XJBA 252LA 1LZ4A 3AZ7A 5E9RA 247LA 4YENA 1UUZC 1D2WA 1L09A 4H8ZA 2Z2FA 3LHMA 4WLDA 1LJGA 1LHMA 4HTQA 1WTHA 3CT5A 4ARLA 4B4JA 1G7JC 3CSRA 3WH1A 3DN4A 1B5WA 3D9AC 1GF5A 4CFPA 1L92A 1LZAA 1P64A 3CSQA 190LA 229LA 3A96A 3HH5A 2B6TA 3RZ4A 114LA 3B0OA 1GFAA 1IR8A 225LA 1G0LA 1OV7A 1I56A 1KXXA 1KW7A 149LA 2B70A 2W1XA 1P3NA 3TXKA 4HTKA 1LJHA 1JTPL 1B5VA 2BPUA 1G0JA 4ZIXA 1CTWA 1UIFA 1D0MA 1GB2A 1VATA 4NHSA 4NHTA 1IC7Y 5M1YA 1L54A 1GDXA 1QT8A 4UWUA 1HMKA 2I6ZA 1FLYA 1L37A 3WL2A 104LA 3GUPA 4M6DA 1LZ9A 2B6XA 4W94A 1L00A 3LYZA 4X3BA 4B1AA 4HPEA 1O23A 1LYYA 4LZMA 1JIYA 3WPLA 5KJ9A 2OE4X 3G3XA 4I7RA 1P2RA 1RFPA 1REYA 4NFVA 1L03A 2IHLA 5KXKA 243LA 1L16A 2L78A 3IJUA 1OVKA 1C6PA 5KXXA 1QSWA 4HTNA 3AZ6A 1L81A 1GAZA 1SSYA 2ZYCA 4II8A 3K2RA 3FI5A 118LA 4TSCA 1LZSA 1C6CA 2BLYA 3WVYA 145LA 1UICA 5APEA 2CGIA 4WLXA 110LA 1LHJA 1GBSA 1D0KA 2B73A 5J7CA 1KY1A 1CUQA 4PK0A 1J1OY 1LMAA 4N1EI 1D0LA 141LA 1VDPA 1L08A 167LA 1BB7A 1LSGA 1T3PA 1P56A 3GXKA 4CJ2A 216LA 4G49A 4TSBA 3OE9A 4NEBA 1OP9B 1C10A 4NIJA 2D6BA 4ETAA 4NWEA 4GLAA 5FSTA 1L25A 2HUBA 4NSGA 2F2QA 3P64A 1OWYA 1LSFA 1SX7A 1NQIA 3W6AA 5KXWA 2EKSC 3UONA 3WYHA 103LA 3HDEA 4G4BA 2G4PA 192LA 1L11A 1SQ2L 1HFXA 1SLYA 182LA 2OTZX 1LYFA 1L04A 2B7XA 1LMQA 4I7OA 4I8SA 1C6AA 3LZMA 1EL1A 3WXTA 3GUIA 1QTDA 5KXNA 1DYDA 4RW2A 4ET9A 1UIHA 1FLWA 4ARQB 1L69A 1ZVHL 1GFJA 1XEPA 5E4PA 1CJ6A 220LA 4C5FA 1BQLY 3TXHA 2XBRA 4GN3A 165LA 1C6EA 2EIZC 4NHQA 1NDMC 1BB6A 228LA 5FCPA 2MEBA 157LA 146LA 1IP3A 1UIEA 2OTYX 1L46A 4DQ5A 1GFEA 1DYFA 237LA 3D4SA 2LZ2A 1LWGA 1C69A 139LA 4XJIA 2W1YA 200LA 2DQIY 3GXRA 3DN6A 2MEAA 4HJVA 1L94A 2NWDX 1BVXA 5IHGA 4EXMA 1L53A 2HEFA 3W6FA 2RBQA 4DDAA 1YAQA 2DQJY 5APCA 1BWJA 2Z12A 3EXDA 1HMLA 164LA 2MEEA 1JQUA 1GB9A 4HV1A 1JTOL 241LA 2HULA 1OVJA 1B7LA 1L18A 1GFUA 4BAFA 159LA 1G7HC 244LA 2BQKA 1HFYA 5HNLA 4OWHA 194LA 1LMNA 5A3EA 1L96A 5KXOA 1IX0A 144LA 1GBYA 2WARA 5T3FA 2NTHA 1L80A 1L73A 2B75A 4RW1A 3HBHA 131LA 4DD7A 1QTVA 4W56A 2XJWA 3A93A 4ANRA 3NYAA 1LSNA 3NY9A 1LZ8A 1B5UA 3N9CA 1JJ3A 171LA 6LYZA 172LA 230LA 1LZRA 2Y8PA 2YBIA 4N0JA 1LMTA 1LZTA 1GEVA 1BB5A 4LZTA 3KAMA 1LTMA 4WL7A 4NGVA 1GFHA 1B7PA 1WQMA 3HH4A 4XJHA 1GHLA 2ZILA 1LZDA 3SBBC 3TXFA 4LT3A 108LA 4NSIA 4IAPA 4M4OA 3B72A 2G4NA 4ET8A 4H93A 1E8LA 1DYBA 2BQIA 2Z18A 3LZ2A 1L0KA 1NF5A 2BQMA 4I7QA 2DQFC 3DMXA 3P65A 1HELA 1LGUA 4YEMA 3AW7A 5B07A 1L35A 2HUKA 195LA 4DT3A 232LA 1LMOA 4I7SA 4NGJA 4Z41A 3M18B 1GBZA 1LLHA 1QT4A 4ARMB 1GB8A 1BB4A 1LHLA 1L79A 4DKLA 4H9FA 1QS5A 4XYYA 1GF9A 1GB5A 2ZQ4A 178LA 4TTDA 5LA8A 1EQ4A 1C6BA 1L17A 3C83A 1IY3A 1LMCA 1L74A 4DYGA 4LYOA 1GPQC 4EPIA 4ARMA 211LA 1RJCB 3TMVA 2NTGA 4LYBA 2OU9A 2YBHA 1L57A 2HEBA 1L63A 1XGUC 3CT1A 1L85A 138LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOS A;  2DQA A;  4WLD A;  1LJG A;  3RNX A;  3D3D A;  1LHM A;  5FEK A;  1LZY A;  3ZEK A;  3ZVQ B;  4HTQ A;  5HNC A;  4ETC A;  4NGW A;  4H8Y A;  4HV2 A;  1HFZ A;  3CT5 A;  3F6Z A;  1V7T A;  1LPI A;  1FLQ A;  1GF4 A;  4B4J A;  1G7J C;  3WW5 A;  2FBD A;  2Q0M X;  1DXJ A;  2LYO A;  3CSR A;  1IP6 A;  3HFM Y;  1WVV A;  3WH1 A;  3E3D A;  1B5W A;  3G3A B;  2BQD A;  2XBS A;  1QTK A;  3D9A C;  1HEQ A;  1GF5 A;  4WM2 A;  1I1Z A;  1IWY A;  2YVB A;  1TCY A;  4OWC A;  1VDQ A;  5D5C A;  4CFP A;  9LYZ A;  1IP1 A;  1LZA A;  4MR1 A;  3CSQ A;  1HEW A;  1ALC A;  1OUJ A;  2DBT A;  3A96 A;  1IEE A;  3A95 A;  3VWO A;  5C6J A;  3RZ4 A;  1AZF A;  5B05 A;  1NMM A;  3B0O A;  1GFA A;  3TXB A;  1IR8 A;  4WM4 A;  4DD1 A;  1LZ5 A;  1LSY A;  3ZVQ A;  1DQJ C;  1TDY A;  2D91 A;  4WM3 A;  1I56 A;  1AT5 A;  1F6R A;  1KXX A;  4GLV A;  1IWT A;  1BWI A;  2G4Q A;  1LAA A;  1KXY A;  2W1X A;  2YSS C;  4H92 A;  4HTK A;  4WL6 A;  5LYZ A;  3TXK A;  135L A;  4DDC A;  1PZY A;  1GWD A;  1LJH A;  4GN4 A;  4AXT A;  1G7I C;  1JJ0 A;  4NGZ A;  3LYT A;  1JTP L;  1B5V A;  1B2K A;  1LZ1 A;  1T6V L;  1LHH A;  1MEL L;  2BPU A;  1HEM A;  1YKX X;  3B0I A;  4WLY A;  2YBL A;  4LYZ A;  4ZIX A;  1B5Z A;  1IWZ A;  1UIF A;  1LJN A;  3W6E A;  1FN5 A;  4WMG A;  1D0M A;  1IP7 A;  1GB2 A;  1NHE A;  1VAT A;  4NHS A;  3TMX A;  4NHT A;  2B5Z A;  3J4G A;  4NHP A;  1IC7 Y;  3BKH A;  4LT2 A;  1INU A;  3M3U A;  1GD6 A;  2ZIJ A;  4KPM A;  5M1Y A;  3P66 A;  1C45 A;  3TXD A;  1KXW A;  1GDX A;  1RCM A;  1JKD A;  1VDS A;  1WQQ A;  4UWU A;  4N9R A;  4HPI A;  4W96 A;  1HMK A;  2I6Z A;  3A91 A;  1FLY A;  1LZG A;  1UIB A;  3WL2 A;  1YKY X;  5KKJ A;  1C08 C;  2HTX A;  2CJL A;  2FBB A;  1LZ9 A;  4GCC A;  1B7N A;  1JHL A;  3A94 A;  3A67 Y;  4R0F A;  5LAG A;  2YDG A;  1GB3 A;  1N4F A;  1JSF A;  4NY5 A;  4GN5 C;  4W94 A;  4XAD A;  4ZFP A;  2Z38 A;  3LYZ A;  4OWB A;  1HEO A;  4X3B A;  4B1A A;  5L9J A;  1GXV 2;  4HJZ A;  5L3I A;  5DLA A;  4HPE A;  1O23 A;  1LYY A;  5FHW A;  1D9U A;  4NWH A;  4Z98 A;  1F6S A;  1JIY A;  5F16 A;  3WPL A;  1DPW A;  5KJ9 A;  3CSZ A;  3TXJ A;  1D6Q A;  2H9K A;  4BAD A;  4NGK A;  1F10 A;  2DKV A;  3A3R X;  1RFP A;  1WQO A;  1CJ7 A;  1REY A;  4NFV A;  4R6C A;  2IHL A;  5KXK A;  4ZEE A;  5F9U A;  2BQJ A;  1TBY A;  3IJU A;  1UAC Y;  3K3T A;  1GFR A;  5KXX A;  4WO6 A;  1QSW A;  4HTN A;  3AZ6 A;  3N9A A;  1GXX A;  1LSP A;  1OUF A;  1GB7 A;  1LSB A;  2BQB A;  2H5Z A;  1B7Q A;  3SP3 A;  4H94 A;  5F14 A;  1KIQ C;  1YQV Y;  4H9I A;  5KXY A;  1GAZ A;  3ATN A;  5JEN B;  2ZYC A;  1NDG C;  4QGZ A;  3AGH A;  1WTM A;  4II8 A;  2C8O A;  4P2E A;  1XGQ C;  1LCN A;  3A90 A;  4LFX A;  1QUT A;  2HU3 A;  4TSC A;  1FDL Y;  1LZS A;  2BLY A;  2ZIK A;  5DL9 A;  4FJR A;  3WVY A;  1YL0 X;  1UIC A;  3AGG G;  5HMJ A;  5I5Q A;  5DN5 A;  1UIG A;  4J1B A;  5APE A;  4DC4 A;  4CGE A;  4DD3 A;  4NGO A;  1LZ6 A;  2CGI A;  4WLX A;  4O34 A;  1BWH A;  1CKC A;  1LHJ A;  4B49 A;  4U3X B;  1GBS A;  1D0K A;  1GF6 A;  1XEJ A;  5J7C A;  2RSC A;  1JSE A;  1IY4 A;  5L3H A;  3AJN A;  1DZB X;  2BQH A;  4WM1 A;  1B7M A;  1AM7 A;  1B7R A;  1GE2 A;  1LJK A;  5LYM A;  1J1O Y;  1LMA A;  1LZB A;  1FBI X;  4N1E I;  2HEE A;  1D0L A;  1IC5 Y;  1VDP A;  2YBJ A;  4CHX A;  133L A;  5I4X A;  5KXT A;  2DQD Y;  2D4K A;  5FDJ A;  2DQH Y;  3G3B B;  1GFT A;  1NBY C;  2BQG A;  1HER A;  1BB7 A;  4GCB A;  2I25 L;  1IP2 A;  1LSG A;  1T3P A;  2YBN A;  2ZQ3 A;  1NWG A;  1EQE A;  4D9Z A;  3GXK A;  4CJ2 A;  2Z37 A;  5LYT A;  3FI7 A;  2LYM A;  1GFK A;  4G49 A;  4TSB A;  1IC4 Y;  1V7S A;  2CDS A;  4HJY A;  2BQL A;  4NEB A;  1WQR A;  1OP9 B;  4OWA A;  1C10 A;  4NIJ A;  4WM5 A;  1CNS A;  2D6B A;  2C8P A;  2LZT A;  5B1F A;  3T6U A;  4ETA A;  4NWE A;  5LVH A;  3WW6 A;  4GLA A;  5FST A;  1KIP C;  2HUB A;  4XJD A;  4NSG A;  1PS5 A;  208L A;  1B7O A;  1CKH A;  1LHK A;  2MEI A;  1BVK C;  2MEC A;  3P64 A;  4XEN A;  4XJG A;  4QY9 A;  4J0L A;  1DPX A;  4WO9 A;  4HP0 A;  1LSF A;  2CWI A;  4PJ2 C;  3W6B A;  1A2Y C;  1NQI A;  3T36 A;  3W6A A;  5KXW A;  2EKS C;  2H9J A;  3CT0 A;  3FE0 A;  4XN6 A;  3WYH A;  1D6P A;  2D4I A;  1LJF A;  5KXS A;  4NG1 A;  1GB0 A;  1HHL A;  4G4B A;  2G4P A;  1YRO A;  4G4H A;  1SQ2 L;  1HFX A;  4QEQ A;  1SLY A;  4DD0 A;  1JKB A;  2X0A A;  3P68 A;  5LIO A;  5ILF A;  4WLT A;  3WUA A;  1LMQ A;  1P2C C;  2GV0 A;  2DQE Y;  4I8S A;  1GBX A;  1GF3 A;  4LT0 A;  1EL1 A;  3WXT A;  1J1X Y;  1OUE A;  4H1P A;  4C3W A;  2DQC Y;  3WMK A;  2LHM A;  2BQO A;  5KXN A;  4A7D A;  1XFP L;  4G4C A;  1TAY A;  4LGK A;  3W6C A;  2VB1 A;  1DKK A;  4RW2 A;  1W6Z A;  3A92 A;  4NHI A;  4ET9 A;  1LKS A;  1C7P A;  4ML7 A;  1LJ3 A;  4H91 A;  4RLN A;  1UIH A;  3ATO A;  1FLW A;  2YBM A;  5DM9 A;  1DI4 A;  4PRQ A;  4UWV A;  1ZVH L;  1GFJ A;  5E4P A;  4DWX A;  1CJ6 A;  1YIK A;  3QY4 A;  4FDY A;  1IOQ A;  4C5F A;  3EMS A;  4Z3M A;  3LN2 A;  4G9S A;  4XJF A;  1XGR C;  1LSM A;  3WPK A;  4IAT A;  4H90 A;  1BGI A;  1BQL Y;  3TXH A;  1JWR A;  2XBR A;  4GN3 A;  2EIZ C;  4NHQ A;  5F81 A;  1GE0 A;  1NDM C;  3WU9 A;  1BB6 A;  4J7V A;  5FCP A;  1QUS A;  4TX7 A;  2MEB A;  4GCE A;  1G7L C;  4H9C A;  1LYO A;  1H6M A;  4WOA A;  6LYT A;  3A3Q A;  1IP3 A;  1JUG A;  1CKD A;  1NBZ C;  1LSA A;  1UIE A;  2BQC A;  4NGL A;  1JPO A;  1GFE A;  5C6L A;  5B06 A;  4WG1 A;  2DQG Y;  1XGT C;  3A34 A;  1IWX A;  4OW1 A;  4NGI A;  4L41 A;  5LVK A;  2LZ2 A;  2EPE A;  2F2N A;  5I53 A;  4H9E A;  4CFO A;  3A8Z A;  4XJI A;  4B0D A;  2BQN A;  1IWV A;  1GF7 A;  1QQY A;  2I26 L;  2ZNX Y;  3WUM A;  1IOT A;  2W1Y A;  1QDT A;  2DQI Y;  3WU7 A;  3GXR A;  1VAU A;  1B0D A;  3WUN A;  1IR7 A;  4OWE A;  1OUI A;  3LYM A;  1LSE A;  1UC0 A;  4I0C A;  3WUL A;  2MEA A;  3IWR A;  4HJV A;  5D5F A;  1LJE A;  4RDS A;  1REX A;  2A7F A;  193L A;  2NWD X;  5KKI A;  1FKV A;  1BVX A;  1CJ9 A;  3LYO A;  5HQ1 A;  5IHG A;  1LJ4 A;  3HBE X;  4TUN A;  3CQL A;  5C6I A;  1B7S A;  2HEC A;  2HEF A;  1B5X A;  2FYD A;  3W6F A;  1QDR A;  1XGP C;  2ZWB A;  5I4Y A;  3RT5 X;  4MST A;  4YEO A;  4DD9 A;  4DDA A;  1YAQ A;  1GDW A;  2FYC A;  5LVG A;  2DQJ Y;  3P4Z A;  1HC0 A;  5APC A;  1KIR C;  1BWJ A;  1WVU A;  1VDT A;  1BHZ A;  4NG8 A;  7LYZ A;  2N5Z A;  2Z12 A;  1EQ5 A;  3A6C Y;  3EXD A;  3TMU A;  1HML A;  1DI5 A;  1LKR A;  4ETE A;  2MEE A;  4OOT A;  4HV1 A;  1GB9 A;  3MGW A;  1JTO L;  3EO5 A;  3OJP A;  4M6D A;  1B7L A;  2IFF Y;  2LYZ A;  4N1C C;  4NGY A;  4GCF A;  1GFU A;  4UWN A;  1G7H C;  3RW8 A;  4BAF A;  4E3U A;  1ZV5 L;  2BQK A;  1WQP A;  5APF A;  5FEL A;  1HFY A;  5HNL A;  4OWH A;  194L A;  4DDB A;  1LMN A;  3AYQ A;  5A3E A;  1JIS A;  4WG7 A;  1GE3 A;  1JJ1 A;  5HMV A;  5KXO A;  1IX0 A;  1LOZ A;  1WQN A;  1GBY A;  1ZMY L;  2MEF A;  1GE1 A;  2WAR A;  2HEA A;  1YAN A;  5KXZ A;  5KXR A;  1AT6 A;  5T3F A;  4EMN A;  1OUA A;  2BQA A;  5IDD A;  1JIT A;  1YL1 X;  4B4I A;  1GBW A;  5B59 A;  1W08 A;  5B1G A;  2MEH A;  1HNL A;  3HBH A;  4KL7 A;  4RW1 A;  1HF4 A;  1LSC A;  3A6B Y;  4DD7 A;  2XJW A;  3A93 A;  5EBH A;  4ANR A;  1GF0 A;  4AGA A;  1J1P Y;  132L A;  2W1M A;  1UCO A;  5ILC A;  1OUC A;  4WM6 A;  1LSN A;  5LVI A;  1XEK A;  1YAO A;  1LZ8 A;  2XTH A;  1HEP A;  1CKF A;  1HEN A;  1B5U A;  1UBZ A;  1JJ3 A;  3N9C A;  4IJ4 A;  6LYZ A;  3ULR A;  1OUB A;  1XEI A;  1ZVY B;  1JTT L;  1LZR A;  1LJI A;  2Y8P A;  5IEL A;  2YBI A;  2F4A A;  3B6L A;  4HSF A;  4N0J A;  1LMT A;  1LZT A;  8LYZ A;  1OUD A;  3QE8 A;  1GEV A;  3WPJ A;  1BB5 A;  1UA6 Y;  1IP5 A;  4LZT A;  2HED A;  3KAM A;  5KXP A;  4BAP A;  3LZT A;  1DKJ A;  1I20 A;  1LTM A;  2HU1 A;  4Z46 A;  4NSH A;  4WL7 A;  1LZC A;  4NGV A;  4KT3 A;  1GFH A;  4NSJ A;  2D4J A;  1IP4 A;  1B7P A;  1WQM A;  1JKC A;  1REZ A;  1IWW A;  1LMP A;  5AMY A;  2MEG A;  1VED A;  4ETB A;  1REM A;  2F30 A;  4XJH A;  1GF8 A;  2Z2E A;  1GHL A;  1DI3 A;  1LZD A;  2ZIL A;  153L A;  5APD A;  1F0W A;  4LT3 A;  3TXI A;  2Z19 A;  3TXF A;  4NSI A;  2EQL A;  4PHI A;  4RLM A;  134L A;  1GEZ A;  3AW6 A;  4M4O A;  1IIZ A;  1OUG A;  2G4N A;  1IOR A;  1A4V A;  3B72 A;  3N9E A;  4H93 A;  1CKG A;  4DD2 A;  4ET8 A;  1E8L A;  1QSA A;  5K7O A;  4J1A A;  4LYT A;  4N8Z A;  1VFB C;  5I4W A;  1BB3 A;  1YAM A;  5HLL A;  2BQI A;  3AB6 A;  2Z18 A;  3TXG A;  3LZ2 A;  1XSF A;  5F9X A;  1NF5 A;  2BQM A;  2Z39 A;  3B0K A;  5LIN A;  2DQF C;  3WU8 A;  3P65 A;  5LVJ A;  1HEL A;  1CJ8 A;  2A7D A;  1GFV A;  3J6K A;  1IWU A;  4H9A A;  4IAS A;  4YEM A;  2W1L A;  207L A;  3AW7 A;  5B07 A;  1IR9 A;  1MLC E;  3RU5 A;  1IO5 A;  3TXE A;  3WXU A;  4ETD A;  1LYS A;  4N5R A;  4H9B A;  1HSX A;  4H9H A;  4DT3 A;  1UID A;  4YM8 A;  3TMW A;  1LZE A;  2F4G A;  4TWS A;  1LMO A;  5I54 A;  4LT1 A;  1GB6 A;  3AGI A;  1JKA A;  2BQE A;  4PGJ B;  154L A;  4NGJ A;  1AKI A;  1OQM A;  3M18 B;  1GBZ A;  4Z41 A;  1OUH A;  1IVM A;  1LSZ A;  4QDN A;  4LFP A;  1GB8 A;  4KXI A;  1NKH A;  1LHI A;  1BB4 A;  1LHL A;  1RI8 B;  1G7M C;  3IJV A;  3W3E A;  1GBO A;  4YF2 A;  1WTN A;  3QNG A;  1TEW A;  4H9F A;  1YKZ X;  1B9O A;  1JEF A;  2ZNW Y;  1YIL A;  4GCD A;  1LYZ A;  4XYY A;  1GF9 A;  1GFG A;  2ZYP A;  1GB5 A;  1HSW A;  5II3 A;  5KXM A;  1LSD A;  2ZQ4 A;  1C43 A;  1IOC A;  3W6D A;  2BQF A;  4TTD A;  1C46 A;  1EQ4 A;  2BLX A;  5DN4 A;  5LA8 A;  1GE4 A;  3AZ5 A;  1QTE A;  1GAY A;  4LYM A;  1IY3 A;  1LMC A;  2BAA A;  1YAP A;  3AZ4 A;  4DYG A;  4LYO A;  1QIO A;  3WVX A;  1LJJ A;  1GPQ C;  4H8X A;  4PPO A;  1UIA A;  4B4E A;  1FLU A;  3CB7 A;  5LA5 A;  2PC2 A;  3EBA B;  4MCK A;  4PRU A;  1H87 A;  3BKV A;  1RE2 A;  5LXW A;  5KY1 A;  2MED A;  5A3Z A;  4XJB A;  1FKQ A;  3HBD A;  5LAF A;  1LZ4 A;  3AZ7 A;  5E9R A;  4OOO A;  1RJC B;  1Z55 A;  4YEN A;  1UUZ C;  3TMV A;  4EOF A;  4LYB A;  2YBH A;  2AUB A;  3OK0 A;  5KXL A;  2HEB A;  1LZN A;  1B5Y A;  4LYC A;  4YOP A;  1XGU C;  4BS7 A;  4H8Z A;  2Z2F A;  3CT1 A;  3LHM A; 
#chains in the Genus database with same CATH topology
 1ZMV A;  3FTE A;  3D3D A;  3V76 A;  1LZY A;  3ZVQ B;  3L2X A;  2G3Q A;  1T97 A;  4HV2 A;  3HU8 A;  4LGY A;  1L76 A;  3GLI A;  4QHT A;  3WW5 A;  1PJS A;  1DXJ A;  2LYO A;  4OVZ B;  1DO2 A;  3G3A B;  4F1I A;  4JI5 M;  4WM2 A;  4OWC A;  2YVB A;  1TCY A;  1D9W A;  4G4N A;  1IP1 A;  4MH0 E;  1LYH A;  1TR8 A;  2XEP A;  2DBT A;  1IEE A;  1LYD A;  3A95 A;  3VWO A;  1SWZ A;  3SAV A;  5B05 A;  3FUX A;  1NMM A;  2GQF A;  176L A;  1XC8 A;  126L A;  3TXB A;  150L A;  1C6D A;  1QT7 A;  3U6S A;  4WM4 A;  4DD1 A;  4PT5 A;  4I7J A;  1TDY A;  4WM3 A;  2WSC F;  2DI0 A;  4EPF A;  5EXT A;  4GLV A;  3DMV A;  2DZL A;  2B74 A;  4WL6 A;  4ZEE A;  2UUB M;  5ITY A;  1N78 A;  2G8L A;  4GN4 A;  1G7I C;  4LJ9 A;  3LYT A;  4M0W A;  3U6C A;  4D80 A;  1T6V L;  3FYD A;  1MEL L;  1OAO C;  3HUA A;  5EP3 A;  1YKX X;  4WLY A;  3HY5 A;  4W51 A;  3KOY E;  2QP9 X;  1LJN A;  3A42 A;  1L98 A;  1NHE A;  1IM2 A;  3HZJ A;  3LMM A;  1D3F A;  2ZIJ A;  3A45 A;  1C65 A;  2X8A A;  3VK8 A;  1KXW A;  1JKD A;  213L A;  1J5E M;  3SB6 A;  5I14 A;  4KOD A;  1DGB A;  4DUY M;  4R0F A;  1C6N A;  4GCC A;  5DFL A;  5ITX A;  1N4F A;  3GQ4 A;  1DYE A;  2V1C A;  1JSF A;  4ZFP A;  4BBA A;  3CTW B;  1L0J A;  1QZE A;  4OWB A;  1KSF X;  5L9J A;  1GXV 2;  4B08 A;  209L A;  1NHB A;  1D9U A;  4L6V 6;  1L61 A;  2LTU A;  1AIP C;  4LRT A;  3NWL A;  3CSZ A;  251L A;  1NY6 A;  3DN0 A;  3ODU A;  2H9K A;  1F10 A;  1QTH A;  4IBF A;  2GNO A;  147L A;  1YE9 A;  3E9S A;  5F9U A;  3SB9 A;  2BQJ A;  1TBY A;  2ZAM A;  206L A;  1OUF A;  4LF5 M;  1GB7 A;  2OOA A;  3SP3 A;  3QAK A;  1G07 A;  3KW6 A;  2EUC A;  3VKG A;  4H9I A;  2L09 A;  1N32 M;  2EJS A;  3RZE A;  3ATN A;  5JEN B;  231L A;  1C6H A;  4P2E A;  1HT1 E;  4LFX A;  3A90 A;  1L1T A;  1L83 A;  1TH4 A;  3DMZ A;  1QSB A;  2ZIK A;  4FJR A;  1T8G A;  1YL0 X;  1XWI A;  5DYI A;  4NGO A;  2IGC A;  2B6Z A;  1DGH A;  1CKC A;  1P6Y A;  2ANX A;  5KO3 A;  4X64 M;  218L A;  1B7M A;  5KPR A;  1B7R A;  4G4R A;  5LYM A;  1LZB A;  1FBI X;  3NY8 A;  5I4X A;  4LF6 M;  3KFU G;  4JI2 M;  2DQD Y;  1XJU A;  3G3B B;  1T3T A;  1C6I A;  152L A;  2F5P A;  4GCB A;  1XB2 B;  1OJL A;  2UXB M;  1IP2 A;  4LJ4 A;  1NWG A;  4XGI A;  4D9Z A;  4ARQ A;  4I7K A;  1NO1 A;  2Z37 A;  5LYT A;  3FI7 A;  3OE6 A;  2LYM A;  3U60 A;  1VQ1 A;  4I7N A;  4HJY A;  2BQL A;  2MJ5 B;  1FNN A;  5EP4 A;  2C8P A;  2LZT A;  4AW4 A;  5LVH A;  3WW6 A;  3HU1 A;  240L A;  208L A;  1B7O A;  2MEC A;  4XJG A;  4QY9 A;  1XNQ M;  191L A;  1L87 A;  1DPX A;  4WO9 A;  1QT5 A;  4HP0 A;  1PRB A;  142L A;  3W6B A;  3C8S A;  3T36 A;  3FE0 A;  1OFH A;  1T6H A;  4QHS A;  1LJF A;  1Z6T A;  2D7G A;  3DN8 A;  1HHL A;  1L60 A;  3Q8G A;  4G4H A;  4DD0 A;  2Y20 A;  2X0A A;  4I7P A;  3P68 A;  1IQP A;  2HHH M;  1PJQ A;  3HKP A;  1P2C C;  185L A;  4A3V B;  2B72 A;  4F2L A;  4LT0 A;  1OUE A;  1OYU A;  1QTC A;  3WMK A;  235L A;  2DXI A;  2DWM A;  4G4C A;  4LGK A;  1G4A E;  1DKK A;  1W6Z A;  2XLJ A;  3A92 A;  4NHI A;  1LKS A;  5KQ8 A;  177L A;  1LJ3 A;  4EKQ A;  1DI4 A;  1R6B X;  2M5Z A;  4FDY A;  4DR3 M;  3LN2 A;  1CU0 A;  1P36 A;  3SAU A;  2R0I A;  1L24 A;  3THG A;  4IAT A;  1C62 A;  3L64 A;  3M6A A;  162L A;  1ZMW A;  3J7B A;  3ZCB B;  3HUQ A;  1D3M A;  4J7V A;  3SYK A;  2KNZ A;  2JNH A;  3OE0 A;  1NBZ C;  2O01 F;  2ZAO A;  3HHW A;  2B6Y A;  3QAU A;  2BQC A;  4NGL A;  2QSF X;  3U6L A;  4AQN A;  1OIZ A;  4LF9 M;  4WG1 A;  5ITR A;  3A34 A;  4OW1 A;  2JUJ A;  111L A;  2EPE A;  3A8Z A;  4TUW A;  2OPF A;  4IJF A;  4B0D A;  2BQN A;  1GF7 A;  189L A;  3WUM A;  1IOT A;  3WU7 A;  4OVZ A;  1VAU A;  1IR7 A;  4OWE A;  1KYI A;  5ITU A;  4KHP M;  2D7E A;  3FD9 A;  4QOS A;  1LSE A;  3LYM A;  4I0C A;  3WUL A;  4LG2 A;  3IWR A;  4WP2 A;  212L A;  2O5R A;  1LJE A;  1C64 A;  1REX A;  3GUL A;  193L A;  2V6Z M;  1FKV A;  1L89 A;  4TUN A;  1L66 A;  3HBE X;  3CQL A;  5EXS A;  1IN4 A;  2XSZ D;  1NSF A;  1XGP C;  3L2A A;  245L A;  3J2P B;  4YEO A;  4DD9 A;  1GDW A;  5LVG A;  4R3D A;  221L A;  2LZM A;  1HC0 A;  1KIR C;  1L99 A;  1VDT A;  1BHZ A;  4E97 A;  1EQ5 A;  1NY5 A;  1L12 A;  3MGW A;  1TF0 B;  3B74 A;  5KQD A;  3C8R A;  4GCF A;  2BWB A;  1OVH A;  1ZMU A;  5F3W A;  5FEL A;  1GJT A;  3AYQ A;  2DVW B;  3TL4 X;  1JJ1 A;  4I8O A;  5HMV A;  1WQN A;  3FUV A;  4KO8 A;  2HEA A;  1YAN A;  5KXR A;  3B7Q A;  1WR1 B;  2BJV A;  1PQM A;  1PGY A;  2RBN A;  3ZQJ A;  1W08 A;  2JZ0 A;  4AG6 A;  5B1G A;  4ARJ A;  181L A;  1ZV1 A;  4EKP A;  1L36 A;  173L A;  3C80 A;  4NRV A;  4AGA A;  3RFW A;  132L A;  2W1M A;  1OUC A;  4WM6 A;  1YAO A;  3HH3 A;  160L A;  1CKF A;  4PD2 A;  1L84 A;  4IJ4 A;  3ULR A;  1OUB A;  1L15 A;  1JTT L;  4LDL A;  3JR4 A;  1LJI A;  1QAQ A;  1XXH E;  112L A;  3B6L A;  3SB7 A;  1CV5 A;  3QE8 A;  2CEA A;  3WPJ A;  257L A;  1WIV A;  1DKJ A;  256L A;  4Z46 A;  4NSH A;  2RBP A;  3K92 A;  1LZC A;  1HQY E;  2JWS A;  4GKJ M;  4LF4 M;  4KT3 A;  2D4J A;  1LWK A;  1JKC A;  1YSY A;  1PJT A;  2JA2 A;  1VDL A;  2MEG A;  4CGY B;  1VED A;  4ETB A;  2F30 A;  1GF8 A;  1DI3 A;  4Y28 F;  2Y0Q A;  134L A;  4RLM A;  1L50 A;  1OUG A;  1A4V A;  3DKE X;  3N9E A;  3SC3 A;  3CGW A;  3HT6 A;  2HWJ A;  1QSA A;  4W52 A;  3GLF A;  5I4W A;  1BB3 A;  1YAM A;  5HLL A;  3AB6 A;  4G4Q A;  1EPY A;  3TXG A;  2Y0T A;  3SFZ A;  3GUM A;  3HTF A;  2Z39 A;  3PNV A;  5C18 A;  1L86 A;  155L A;  156L A;  2CHG A;  1IR9 A;  3QYB A;  3TXE A;  3WXU A;  1LYS A;  4H9B A;  1L29 A;  3GPP A;  175L A;  5I54 A;  1GB6 A;  3V2Y A;  1OQM A;  1E94 E;  2RBO A;  3KSJ A;  1LSZ A;  3JR6 A;  4LFP A;  1QTB A;  4KXI A;  1NKH A;  1LHI A;  2CV0 A;  1G7M C;  1RI8 B;  3K1J A;  4YF2 A;  4DR1 M;  1L8Q A;  1ZWN A;  255L A;  2YNM D;  1JEF A;  1YIL A;  4GCD A;  1LYZ A;  2ZYP A;  1LSD A;  3SBJ A;  1L93 A;  1C43 A;  1IOC A;  4MGH A;  3KOZ E;  1CU3 A;  1C46 A;  1L32 A;  1CV1 A;  7CAT A;  1GAY A;  1QTE A;  1DO0 A;  3AZ4 A;  1LI2 A;  3WVX A;  2EKK A;  3GUK A;  3DN1 A;  1JQJ C;  3CB7 A;  5LA5 A;  1L71 A;  1LI3 A;  2PC2 A;  3EBA B;  2KW0 A;  1H87 A;  3BKV A;  1RE2 A;  1FKQ A;  1XJT A;  2M60 A;  4ZPX A;  5LAF A;  2RGH A;  3AOG A;  1IBL M;  1Z55 A;  197L A;  1QT3 A;  4EOF A;  3MK6 A;  3OK0 A;  3E46 A;  3HHY A;  1LZN A;  4LYC A;  4BS7 A;  1DGG A;  4LZJ A;  3TQS A;  4KT0 F;  1ORY B;  2K6B A;  1IOS A;  3RNX A;  109L A;  1N75 A;  3GLI B;  5FEK A;  3ZC7 B;  1QUG A;  5HNC A;  1C66 A;  4ETC A;  4IBG A;  1L82 A;  3VDU A;  3R9X B;  4IBK A;  1LPI A;  1LGW A;  1K3W A;  3CF6 E;  210L A;  1PQD A;  4L78 A;  2B3T A;  5JI3 E;  3E3D A;  1IBK M;  2BQD A;  1QTK A;  2XBS A;  5D5C A;  1E32 A;  1IWY A;  1VDQ A;  1L95 A;  4RF1 A;  5LZM A;  1HEW A;  1L90 A;  1ALC A;  4LFC M;  1HR0 M;  4CJ6 A;  4PDG A;  5C6J A;  1G0K A;  1AZF A;  261L A;  2RBR A;  130L A;  1LZ5 A;  1LSY A;  1DQJ C;  1LYJ A;  2D91 A;  1AT5 A;  1F6R A;  3AOE A;  3C7Z A;  2DWN A;  1IWT A;  4W55 A;  1G59 A;  1BWI A;  2YSS C;  1LAA A;  3IEC A;  3QYE A;  5C1B A;  4DDC A;  3C9P A;  3RGS A;  4NGZ A;  1KW5 A;  1L33 A;  1LZ1 A;  1QS9 A;  1LHH A;  3UJN A;  3B0I A;  3LQR A;  2YBL A;  3K9O A;  3HHX A;  4LYZ A;  2LHG A;  3HH6 A;  1QAO A;  4P17 A;  3MJ5 A;  2W82 A;  1F4I A;  1IP7 A;  4MGI E;  1L75 A;  3TMX A;  2B5Z A;  3J4G A;  4NHP A;  4LCB A;  2R18 A;  1INU A;  1I6S A;  4KPM A;  1XXH A;  140L A;  4DAJ A;  1L55 A;  1IXZ A;  3AKZ A;  2EO2 A;  1RCM A;  3J81 S;  4LF7 M;  4DR7 M;  4N9R A;  4HPI A;  2C98 A;  4W96 A;  3A91 A;  5IZ7 D;  1HNZ M;  1C60 A;  2RH1 A;  1LZG A;  1UIB A;  1YKY X;  1C08 C;  2R62 A;  1SXJ C;  151L A;  1NNJ A;  2CJL A;  1LI6 A;  2YDG A;  1GB3 A;  3C8Q A;  4XAD A;  2Z38 A;  1HEO A;  5DLA A;  3W67 A;  5FHW A;  2JXN A;  4LJA A;  1L02 A;  4PJZ A;  1L05 A;  4Z98 A;  3GLG E;  5F16 A;  1YLA A;  1DPW A;  4ITQ A;  3TXJ A;  1K28 A;  1D6Q A;  1WJ7 A;  2CV2 A;  4BAD A;  3PFI A;  1LPY A;  3A3R X;  2UU9 M;  1JTN A;  4R6C A;  4RF0 A;  4HEO A;  3I51 A;  3GLF E;  3IHP A;  1ZAE A;  3K3T A;  1GFR A;  3N9A A;  1GXX A;  3QWL A;  234L A;  1LSB A;  1CV3 A;  3GLG A;  2BQB A;  1L49 A;  2H5Z A;  1OFI A;  4MB7 A;  5EXP A;  4GIT A;  222L A;  4H94 A;  5F14 A;  4OO9 A;  1YQV Y;  5ITT A;  5KXY A;  1LYI A;  1R7R A;  1NDG C;  3AGH A;  1LCN A;  1G1W A;  4MM3 B;  4OX9 M;  205L A;  1FDL Y;  5I5Q A;  3AGG G;  3HTG A;  1UIG A;  3HU9 A;  3GLH E;  4CGE A;  4DD3 A;  2EA0 A;  1LZ6 A;  3C82 A;  1CUK A;  4JI6 M;  3F9L A;  1JSE A;  2A5Y B;  3AJN A;  3H4J A;  1J7K A;  1HNW M;  1DZB X;  2BQH A;  4WM1 A;  4IBD A;  1AM7 A;  1LJK A;  3VKH A;  1T8A A;  2YBJ A;  133L A;  5KXT A;  1EIJ A;  196L A;  2DQH Y;  3FTC A;  1GFT A;  2CWB A;  1NBY C;  1HER A;  1CV4 A;  3VW7 A;  2I25 L;  2YBN A;  3U61 A;  1L41 A;  239L A;  1C67 A;  4DR4 M;  2DAM A;  1GFK A;  1IC4 Y;  1V7S A;  3PBL A;  4OWA A;  1L51 A;  1CNS A;  1L56 A;  2VF8 A;  3T6U A;  4XJD A;  3HWL A;  1CKH A;  1LHK A;  4QNM A;  3DN2 A;  4IJE A;  2CHQ A;  4J0L A;  258L A;  119L A;  1L30 A;  1QVR A;  1L40 A;  1A2Y C;  3GUN A;  2H9J A;  1P5C A;  4B3S M;  2RB2 X;  1TGU A;  3RGP A;  4XN6 A;  1V33 A;  1D6P A;  2D4I A;  5KXS A;  3J7A S;  1GB0 A;  8CAT A;  4YXC A;  3HJ8 A;  3TWK A;  1YRO A;  4QEQ A;  2F32 A;  5LIO A;  5ILF A;  1C6K A;  1D2Y A;  3WUA A;  4PCZ A;  1L59 A;  2GV0 A;  2DQE Y;  1GF3 A;  3B7Z A;  4AKH A;  1N77 A;  2O7A A;  1DYG A;  4EJ4 A;  4M9S A;  2UUA M;  1C6J A;  2DQC Y;  2LHM A;  2BQO A;  3T38 A;  4A7D A;  1SXJ B;  2VB1 A;  3HU2 A;  2LC9 A;  1C7P A;  1C63 A;  3DFZ A;  3C58 A;  3ATO A;  3SN6 R;  5DM9 A;  4LFA M;  1NHG C;  1C1K A;  4UWV A;  1N36 M;  259L A;  1L77 A;  4DWX A;  3QY4 A;  3AV0 A;  217L A;  3GQ3 A;  1L2B A;  1L07 A;  1L72 A;  4G9S A;  1XGR C;  1LSM A;  4H90 A;  1BGI A;  3CDQ A;  5F81 A;  1L97 A;  1GE0 A;  1CX6 A;  3WU9 A;  1EE8 A;  2R65 A;  3SHG B;  5FTM A;  1D3J A;  4GCE A;  4H9C A;  3HJQ A;  1T8F A;  1LYO A;  5EXX A;  4ARP A;  4WOA A;  1L28 A;  3HHZ A;  4I81 A;  170L A;  1JPO A;  4I5S A;  1SXJ D;  3EIH A;  5C6L A;  5B06 A;  2DQG Y;  1XGT C;  2ANV A;  3C7Y A;  4L41 A;  1J09 A;  2QBY A;  1EFU B;  113L A;  1CX7 A;  254L A;  4CFO A;  1NV8 A;  1QQY A;  2I26 L;  2XZF A;  4EIW A;  5FLX S;  3WUN A;  1K3X A;  5D5F A;  2KZU A;  2C9C A;  3FAD A;  2K47 A;  4RDS A;  2KEB A;  3LYO A;  5HQ1 A;  1IN6 A;  1LJ4 A;  1Q39 A;  5C6I A;  2HEC A;  2FYD A;  2QCU A;  2LVQ D;  2LH0 A;  158L A;  2DHY A;  2ZWB A;  3RT5 X;  4MST A;  2MH8 A;  143L A;  2FYC A;  1V92 A;  3P4Z A;  4L4U A;  4DBG B;  1WVU A;  4NG8 A;  4I7T A;  2N5Z A;  3A6C Y;  2KRK A;  3GUJ A;  3GRY A;  1L10 A;  3DOA A;  1LKR A;  4IBC A;  4OOT A;  4P16 A;  2DAK A;  1UFZ A;  3OJP A;  2JY5 A;  3TWL A;  2V1U A;  2LYZ A;  4N1C C;  3RW8 A;  4UWN A;  1X37 A;  1OIP A;  4E3U A;  1L22 A;  1ZV5 L;  249L A;  125L A;  2QAR C;  3L26 A;  2QEN A;  1LOZ A;  4S0W A;  1ZMY L;  2MEF A;  5KXZ A;  1GE1 A;  2O4W A;  4EMN A;  4DV3 M;  1OUA A;  2BQA A;  3SB5 A;  4B4I A;  5B59 A;  1GBW A;  3HTB A;  3HTD A;  1L62 A;  4KL7 A;  1LSC A;  2XZU A;  4NL4 H;  2F4V M;  1GF0 A;  1G06 A;  1J1P Y;  3GUO A;  1UCO A;  1C6Q A;  5LVI A;  2LXE A;  3GPX A;  2Y21 A;  1P37 A;  1HEP A;  1HEN A;  1UBZ A;  3OTO M;  3G3V A;  1ZVY B;  2DAG A;  1L64 A;  5IEL A;  129L A;  2CFO A;  2MR9 A;  4NC6 A;  1OUD A;  1L58 A;  1IP5 A;  2HED A;  1VEG A;  5KXP A;  4QOZ C;  2HU1 A;  1PJJ A;  3Q8X A;  1Z5A A;  1JTM A;  1DGH B;  3FKE A;  3T1Y M;  3DN3 A;  1REZ A;  3RE8 A;  233L A;  4NXN M;  2A4T A;  2LCB A;  5AMY A;  3UGJ A;  219L A;  1P7S A;  153L A;  5APD A;  2XQO A;  3A98 B;  1NJG A;  1SSW A;  2EQL A;  4JI4 M;  3AW6 A;  1IOR A;  1CKG A;  1IY2 A;  5DNY A;  3B7N A;  4J1A A;  2Z6B A;  5BPV A;  4JN6 A;  4LJ8 A;  1XSF A;  1G0Q A;  3B0K A;  4DV1 M;  5LVJ A;  1GL7 A;  3WU8 A;  1CJ8 A;  2A7D A;  2FFJ A;  1GFV A;  3J6K A;  4IAS A;  3LW5 F;  207L A;  4YY3 M;  1MLC E;  1L70 A;  224L A;  4YM8 A;  4H9H A;  2XFS A;  1UID A;  3TMW A;  1LZE A;  2F4G A;  4TWS A;  4LT1 A;  2J5Y A;  3AGI A;  1JKA A;  2BQE A;  4GBR B;  154L A;  4FCW A;  3U6O A;  180L A;  1OUH A;  1L91 A;  4EKS A;  1C68 A;  2FOI C;  3QNG A;  1TEW A;  2HL7 A;  253L A;  2FS1 A;  1GFG A;  4JI3 M;  4IBB A;  5KXM A;  4LJ5 A;  3W6D A;  236L A;  2CUU A;  2RAY X;  2BLX A;  5DN4 A;  1GE4 A;  1DYA A;  1L42 A;  3AZ5 A;  3HUK A;  102L A;  2BAA A;  1QIO A;  4W5W A;  1L31 A;  4H8X A;  4PPO A;  1UIA A;  4D82 A;  4B4E A;  1FLU A;  1TH2 A;  3KOW E;  1WGL A;  4PRU A;  5KY1 A;  4WUR A;  3HBD A;  4CIZ A;  169L A;  1PQK A;  4OOO A;  1QT6 A;  2AUB A;  1L43 A;  5KXL A;  2YR0 A;  260L A;  1B5Y A;  4YOP A;  2FH0 A;  7LZM A;  2J7O A;  4KLN A;  3FUW A;  4R7G A;  3U6P A;  4W59 A;  1KS3 A;  2XSZ A;  1LYE A;  2DQA A;  3DNA A;  2Q9D A;  3EIE A;  3HDF A;  5GKN A;  2OU8 A;  4NGW A;  4H8Y A;  1HFZ A;  1N33 M;  1L44 A;  1V7T A;  3F6Z A;  2XF3 A;  1FLQ A;  1GF4 A;  128L A;  1CU6 A;  2FBD A;  2Q0M X;  3HFM Y;  1HT2 E;  115L A;  1IP6 A;  214L A;  2X49 A;  3VLF B;  1WVV A;  127L A;  1G8P A;  1CV0 A;  1HEQ A;  4B7G A;  3ZEK A;  1I1Z A;  1ZUR A;  9LYZ A;  2CHV A;  2DZN B;  3C7W A;  4MR1 A;  3C81 A;  1SG9 A;  223L A;  1WHC A;  1OUJ A;  1Y8G A;  3V2W A;  4IIW A;  4BLC A;  4NSO B;  1KNI A;  3SBA A;  4II7 A;  4W57 A;  3K9P A;  2B6W A;  3ZVQ A;  238L A;  242L A;  2G4Q A;  1KXY A;  4H92 A;  5LYZ A;  2LBC A;  135L A;  1PZY A;  1GWD A;  4AXT A;  3E21 A;  1JJ0 A;  201L A;  1QUH A;  3GPY A;  4GHA A;  1B2K A;  1HEM A;  2OEA X;  166L A;  2CV1 A;  1B5Z A;  1IWZ A;  1QTZ A;  1L39 A;  3W6E A;  4DV4 M;  1FN5 A;  2RGO A;  199L A;  1G0M A;  4WMG A;  2ZTD A;  1L13 A;  3BKH A;  4LT2 A;  3M3U A;  1GD6 A;  3P66 A;  3UK6 A;  1C45 A;  3TXD A;  198L A;  1G3I A;  1VDS A;  3DZD A;  3GRR A;  3A46 A;  1G1V A;  1WQQ A;  4JXJ A;  1L45 A;  4JYA M;  5KKJ A;  2HTX A;  2FBB A;  1RU3 A;  1B7N A;  1JHL A;  3A94 A;  3A67 Y;  4S12 A;  5LAG A;  4NY5 A;  4GN5 C;  2R46 A;  2OE9 X;  1L48 A;  4I7L A;  3U6Q A;  4HJZ A;  5L3I A;  2J7N A;  2NQ8 C;  2VII A;  4NWH A;  4LJ6 A;  1IN7 A;  262L A;  1TH3 A;  183L A;  1F6S A;  3SAW A;  3FUU A;  5FTJ A;  187L A;  2H1R A;  4NGK A;  3R8F A;  3PNY A;  3SMS A;  2DKV A;  5KPT A;  3EML A;  1WQO A;  1CJ7 A;  226L A;  4GC5 A;  2DHR A;  2HKJ A;  2L7I A;  4DV5 M;  1UAC Y;  4WO6 A;  1LSP A;  2DEN A;  1B7Q A;  2EKF A;  3C3D A;  1KIQ C;  1P46 A;  2F5Q A;  3GLF B;  4GHL A;  163L A;  3SB8 A;  4QGZ A;  5H37 D;  1WTM A;  2C8O A;  1XGQ C;  1QUD A;  1DGF A;  2JY7 A;  1QUT A;  2HU3 A;  1L26 A;  3IG5 A;  3W68 A;  4GRV A;  4FWG A;  5DL9 A;  4YXA C;  5HMJ A;  4M0D A;  5DN5 A;  3KXE C;  4J1B A;  4LDO A;  4LZZ A;  3OE8 A;  4DC4 A;  3E4R A;  1L67 A;  4O34 A;  1BWH A;  4B49 A;  3D8L A;  2RB1 X;  4U3X B;  1GF6 A;  1XEJ A;  2RSC A;  3J80 S;  1DYC A;  3SAT A;  1IY4 A;  1GJS A;  1L47 A;  5L3H A;  4DV7 M;  1E9S A;  3CDR A;  4LFB M;  1GE2 A;  1G0P A;  2HEE A;  1IC5 Y;  1R2Z A;  4CHX A;  4DQJ A;  4OW0 A;  4G6Z A;  2D4K A;  5FDJ A;  2DNA A;  1KFV A;  2RKO A;  2BQG A;  246L A;  2HCB A;  1LYG A;  1D3N A;  3G3W A;  4JI8 M;  4AZF A;  3ILK A;  2MGW A;  3KP1 E;  2ZQ3 A;  1EQE A;  2RB0 X;  1GL6 A;  3DA1 A;  148L E;  3GLH A;  4W54 A;  1CUP A;  2CDS A;  2QPA A;  5EP2 A;  1P2L A;  1WQR A;  4WM5 A;  3BBZ A;  5B1F A;  1E9R A;  120L A;  3HU3 A;  4ZPU A;  1KIP C;  3U6D A;  2Z4R A;  1PS5 A;  2MEI A;  5IWA M;  1BVK C;  4XEN A;  215L A;  1LGX A;  1C6L A;  4DR2 M;  2Q2E B;  1L19 A;  2CWI A;  4PJ2 C;  2KNA A;  5E6J A;  2CE7 A;  4M9Z A;  3MHV C;  1TLA A;  3CT0 A;  4RNA A;  4NG1 A;  1L88 A;  3HT9 A;  2L4E A;  1JKB A;  1T6O A;  4WLT A;  1LV7 A;  122L A;  4QNR A;  2Z4S A;  4DQ7 A;  2ZM6 M;  1L52 A;  1SXJ A;  1GBX A;  2UXC M;  3HT7 A;  1OV5 A;  2VQE M;  1J1X Y;  2VQF M;  227L A;  4H1P A;  4C3W A;  5EJC A;  1XFP L;  2WSE F;  1TAY A;  3W6C A;  4FWD A;  4FVM A;  1G0G A;  4GKK M;  4ML7 A;  3SAS A;  4H91 A;  137L A;  4RLN A;  4LDE A;  2YBM A;  4PRQ A;  3T1H M;  1YIK A;  1L1Z A;  1IOQ A;  168L A;  4G3O A;  1FJG M;  3EMS A;  4Z3M A;  3FA0 A;  1CVK A;  188L A;  1L68 A;  4XJF A;  1L21 A;  3WPK A;  3U61 B;  2BNK A;  1JWR A;  1I94 M;  2XFT A;  2QZ4 A;  1CV6 A;  1L27 A;  1NNU C;  1QUS A;  4TX7 A;  4K5Y A;  1G7L C;  2KDL A;  1H6M A;  2WZJ A;  6LYT A;  4L15 A;  248L A;  3A3Q A;  1JUG A;  250L A;  1CKD A;  1NHW C;  3SMP A;  1LSA A;  1GLN A;  2DZO B;  1UM8 A;  6LZM A;  3KS8 A;  1IWX A;  3CDT A;  4NGI A;  5LVK A;  1LW9 A;  2Q9E A;  1R2Y A;  2F2N A;  3PXG A;  186L A;  5I53 A;  4H9E A;  1L38 A;  1IWV A;  3H4M A;  3JR5 A;  2ZNX Y;  1C6M A;  1QDT A;  1ZYT A;  3HT8 A;  1B0D A;  174L A;  1OUI A;  4L16 A;  1UC0 A;  4EKR A;  2RAZ X;  2A7F A;  5KKI A;  3U6M A;  1CJ9 A;  4D81 A;  1B7S A;  1G71 A;  4GMQ A;  1B5X A;  1QDR A;  3RUN A;  5I4Y A;  2L6O A;  1QUO A;  2CUZ A;  2OE7 X;  7LYZ A;  3UMM A;  1OAI A;  3TMU A;  1XMQ M;  1DI5 A;  4ETE A;  2LVP C;  3EO5 A;  2O79 A;  161L A;  2IFF Y;  4NGY A;  2FNA A;  5IT9 S;  2APL A;  1WQP A;  3PDS A;  5APF A;  3I04 M;  4DDB A;  1JIS A;  4AG5 A;  1GE3 A;  3MMP A;  4WG7 A;  4JI0 M;  4YX7 C;  1AT6 A;  5IDD A;  1JIT A;  1YL1 X;  4DJH A;  2KXE A;  2MEH A;  1HNL A;  4R71 A;  2CRU A;  1HF4 A;  3A6B Y;  1GVN A;  2KZS A;  1MU5 A;  5E26 A;  2H5X A;  5EBH A;  4UN2 B;  1IXS A;  1C61 A;  1SWY A;  5ILC A;  2JY6 B;  1CU2 A;  1C6G A;  1QSQ A;  1XEK A;  2XTH A;  3KDS E;  1C6F A;  3M7G A;  1XEI A;  1VEJ A;  2HUM A;  2F4A A;  4HSF A;  4XK8 F;  8LYZ A;  1UA6 Y;  1L06 A;  3HX3 A;  184L A;  1PQJ A;  4I7M A;  2K9D A;  4BAP A;  3LZT A;  1I20 A;  2E5L M;  3F8V A;  1SX2 A;  2LVO C;  4NSJ A;  1T43 A;  1IP4 A;  1L14 A;  4LF8 M;  1L34 A;  1IWW A;  1MN3 A;  1LMP A;  1KY0 A;  1REM A;  2Z2E A;  3CDO A;  1F0W A;  3TXI A;  2Z19 A;  1Z5C A;  1C6T A;  123L A;  4PHI A;  1GEZ A;  1L23 A;  1IIZ A;  4DD2 A;  3I4V A;  5K7O A;  4W58 A;  4N8Z A;  4LYT A;  1L20 A;  1VFB C;  3L29 A;  5F9X A;  5LIN A;  2RBS A;  5LMU M;  4DV2 M;  3HGI A;  1IWU A;  1PQO A;  4H9A A;  2W1L A;  4I4L A;  4M9X A;  3RU5 A;  3I01 M;  1IO5 A;  4ETD A;  4N5R A;  2QB0 B;  1HSX A;  3W0L B;  4XBO A;  1L65 A;  3AL0 C;  4AKG A;  2OU0 X;  4PGJ B;  1AKI A;  1IVM A;  1GAB A;  1PQI A;  4QDN A;  2LHC A;  3W3E A;  4B7F A;  3IJV A;  3PVS A;  1GBO A;  1OWZ A;  1WTN A;  3VK7 A;  1YKZ X;  2VF7 A;  2Z7J A;  1B9O A;  2ZNW Y;  5BR8 M;  3SYL A;  1K82 A;  1L01 A;  1XNR M;  3T6P A;  1HSW A;  5II3 A;  2BQF A;  1CU5 A;  3CDV A;  3LCU A;  4LYM A;  4REZ A;  1YAP A;  4W53 A;  3U5Z B;  1B6I A;  1LJJ A;  2F47 A;  3GLI E;  2Z3X A;  107L A;  2XH9 A;  4MCK A;  5LXW A;  2MED A;  5A3Z A;  4XJB A;  1QQW A;  252L A;  1XHB A;  1LZ4 A;  3AZ7 A;  5E9R A;  247L A;  3TWM A;  4YEN A;  1UUZ C;  2WSF F;  1D2W A;  1L09 A;  2N35 A;  4H8Z A;  3HWS A;  2Z2F A;  1C7Y A;  3LHM A;  4WLD A;  1LJG A;  4LJ7 A;  1LHM A;  3BXW A;  3GLG B;  4HTQ A;  2UXD M;  1WTH A;  4NSR A;  4BB9 A;  4Z6Y A;  3CT5 A;  4ARL A;  3KVW A;  4Z8X A;  4B4J A;  1G7J C;  3CSR A;  3WH1 A;  3DN4 A;  3VFD A;  1B5W A;  3D9A C;  1GF5 A;  4CFP A;  3FTD A;  5FTL A;  2HAK A;  1L92 A;  1LZA A;  1P64 A;  3CSQ A;  5ITX E;  190L A;  229L A;  3A96 A;  3HH5 A;  2G5G X;  2B6T A;  3RZ4 A;  114L A;  3B0O A;  2JY8 A;  1GFA A;  1IR8 A;  225L A;  4NXM M;  1G0L A;  1PJI A;  1OV7 A;  1I56 A;  1KXX A;  1KW7 A;  149L A;  2B70 A;  2W1X A;  4GIP A;  1P3N A;  3TXK A;  4HTK A;  1LJH A;  4FWH A;  1JTP L;  1B5V A;  4AQY M;  2BPU A;  4DV0 M;  3U6E A;  3F92 A;  1IBM M;  1G0J A;  1WXQ A;  4ZIX A;  1CTW A;  1VDD A;  4RKU F;  1UIF A;  1IY0 A;  1D0M A;  1GB2 A;  1VAT A;  4NHS A;  2KNV A;  4NHT A;  3L25 A;  1IC7 Y;  2ZBK B;  5M1Y A;  2R45 A;  1YUB A;  1L54 A;  5DYG A;  1GDX A;  1NJF A;  1QT8 A;  4UWU A;  1QAM A;  1HMK A;  2I6Z A;  1FLY A;  1L37 A;  3C3E A;  1L2C A;  104L A;  3WL2 A;  3GUP A;  2CP8 A;  4M6D A;  1LZ9 A;  2B6X A;  3UZU A;  5JI2 E;  2Z8Y M;  4W94 A;  1L00 A;  1GKI A;  3LYZ A;  4GEW A;  4X3B A;  4B1A A;  4GRI A;  4HPE A;  1O23 A;  1LYY A;  4FW9 A;  4LZM A;  5IRE B;  4G4O A;  1JIY A;  3AJI B;  3LCV B;  5FTK A;  2OE4 X;  3WPL A;  2LWX A;  5KJ9 A;  3G3X A;  4I7R A;  2KRU A;  2R6F A;  1P2R A;  1RFP A;  1REY A;  4NFV A;  1L03 A;  1XMO M;  2IHL A;  5KXK A;  3CF2 A;  243L A;  4MGZ E;  3FTF A;  1L16 A;  4NOO B;  2L78 A;  2RRU A;  4AKI A;  1OVK A;  1C6P A;  3IJU A;  1MX0 A;  1QYR A;  5KXX A;  1QSW A;  4HTN A;  3AZ6 A;  4GH9 A;  4LY6 A;  1W5T A;  3J27 B;  3FYC A;  1L81 A;  3LQQ A;  1GAZ A;  1V34 A;  1SSY A;  2DWZ B;  2ZYC A;  4B3M M;  4II8 A;  4LGM A;  3K2R A;  3FI5 A;  1A5T A;  118L A;  4TSC A;  2BJW A;  1LZS A;  1C6C A;  3SHF A;  2BLY A;  3LVV A;  3WVY A;  145L A;  1UIC A;  5APE A;  1OTR A;  5LMN M;  2R4E A;  2CGI A;  4WLX A;  110L A;  4B3R M;  1LHJ A;  1GBS A;  1D0K A;  2B73 A;  1HJP A;  2UUC M;  5J7C A;  1KY1 A;  1CUQ A;  4PK0 A;  1J1O Y;  1LMA A;  4N1E I;  4FCT A;  1D0L A;  141L A;  3ZH9 B;  1VDP A;  1Z5B A;  2F5S A;  1L08 A;  1N34 M;  3GLH B;  3FUT A;  167L A;  1BB7 A;  1LSG A;  1T3P A;  1P56 A;  3GXK A;  4CJ2 A;  216L A;  4G49 A;  1JR3 D;  1QAN A;  4TSB A;  3OE9 A;  4NEB A;  1OP9 B;  1C10 A;  2F5O A;  4NIJ A;  2D6B A;  2OO9 A;  3TPZ A;  4ETA A;  4NWE A;  4GLA A;  5FST A;  1L25 A;  2HUB A;  4NSG A;  2OOB A;  4CIS A;  2F2Q A;  3P64 A;  2C96 A;  2QNJ A;  1OWY A;  1LSF A;  1SX7 A;  1NQI A;  3W6A A;  5KXW A;  2EKS C;  3UON A;  4Q7J A;  3GRV A;  5A2Q S;  3WYH A;  2QHO B;  103L A;  3KSX A;  2L7H A;  3HDE A;  4G4B A;  2G4P A;  192L A;  2LNH C;  1L11 A;  5L8R F;  1SQ2 L;  1HFX A;  2R4J A;  3L27 A;  1SLY A;  2DKL A;  182L A;  2VDB B;  1NVM A;  2OTZ X;  1W5S A;  1LYF A;  4AI6 A;  3L28 A;  1L04 A;  2B7X A;  1OQY A;  1LMQ A;  4I7O A;  4I8S A;  1C6A A;  3LZM A;  2X4A A;  1EL1 A;  3WXT A;  3GUI A;  2OQ4 A;  1QTD A;  5KXN A;  4JV5 M;  2P5T A;  2R44 A;  1IN8 A;  1DYD A;  4RW2 A;  3JAM S;  4ET9 A;  4GC9 A;  2ZAN A;  4HLQ A;  1UIH A;  1JB0 F;  1FLW A;  4ARQ B;  1L69 A;  2LVA A;  1ZVH L;  1GFJ A;  1XEP A;  5E4P A;  1CJ6 A;  220L A;  4IBE A;  1IFY A;  4X62 M;  3B89 A;  2KHH A;  2QBY B;  4C5F A;  4PDI A;  5ITQ A;  4B7H A;  3KP0 E;  1BQL Y;  3TXH A;  2XBR A;  3BOS A;  165L A;  1C6E A;  2EIZ C;  4GN3 A;  4NHQ A;  1NDM C;  1BB6 A;  228L A;  1SXJ E;  4JI7 M;  2C9O A;  2KA6 B;  2MRO B;  5FCP A;  2I7N A;  2MEB A;  4NRW A;  3VDP A;  2DWL A;  1ZQ9 A;  1Q3B A;  157L A;  1VG5 A;  146L A;  1IP3 A;  2JP7 A;  5FTN A;  1IY1 A;  3GQ5 A;  4FCV A;  4YHH M;  1UIE A;  1XXH B;  2OTY X;  1L46 A;  4DQ5 A;  1GFE A;  1DYF A;  1QZM A;  3AFH A;  3M0E A;  237L A;  3D4S A;  1OKS A;  2LZ2 A;  1PM5 A;  1LWG A;  1C69 A;  5EQT A;  139L A;  1R4G A;  4XJI A;  1IXS B;  4L8R C;  2W1Y A;  200L A;  2DQI Y;  3GXR A;  4IBJ A;  3DN6 A;  3K8Z A;  2MEA A;  4HJV A;  3I4Y A;  1L94 A;  2NWD X;  1BVX A;  5IHG A;  4EXM A;  3FE3 A;  1L53 A;  2HEF A;  3W6F A;  4B3T M;  2RBQ A;  1TTE A;  4DUZ M;  2LVN C;  4DDA A;  1YAQ A;  3B9P A;  2DQJ Y;  2F5N A;  5APC A;  1BWJ A;  2Z12 A;  3EXD A;  1HML A;  1DV0 A;  164L A;  2L2D A;  2MEE A;  1JQU A;  1GB9 A;  4HV1 A;  1JTO L;  3KS4 A;  241L A;  2HUL A;  1OVJ A;  1B7L A;  4OU7 A;  1L18 A;  1GFU A;  4BAF A;  159L A;  1G7H C;  1G41 A;  244L A;  2BQK A;  1HFY A;  5HNL A;  2FE8 A;  4OWH A;  194L A;  1LMN A;  2L4F A;  2C99 A;  5A3E A;  4WW0 A;  2O25 A;  1L96 A;  5KXO A;  1IX0 A;  144L A;  1GBY A;  2WAR A;  4IBI A;  5T3F A;  3NBX X;  2NTH A;  1L80 A;  1TDH A;  1L73 A;  2B75 A;  3HBH A;  4RW1 A;  1JR3 E;  131L A;  4DD7 A;  1QTV A;  4W56 A;  2XJW A;  3NBI A;  3A93 A;  4ANR A;  3U60 B;  1GO5 A;  3NYA A;  2DAI A;  4JI1 M;  3GP1 A;  1LSN A;  3NY9 A;  1LZ8 A;  2ZTC A;  1B5U A;  3N9C A;  1JJ3 A;  171L A;  3AOE C;  6LYZ A;  2I7P A;  172L A;  230L A;  1L2D A;  2Y8P A;  1LZR A;  4X66 M;  2YBI A;  3GRU A;  5EP1 A;  4N0J A;  1Q3C A;  1LMT A;  1LZT A;  1GEV A;  1BB5 A;  4LZT A;  3KAM A;  2YQZ A;  1LTM A;  3WHK A;  4LRS A;  4WL7 A;  1I4W A;  4NGV A;  1P3Q Q;  1GFH A;  1B7P A;  1WQM A;  1IN5 A;  3HJS A;  1H6U A;  3HH4 A;  4MGY E;  3T15 A;  3W0F A;  2AHM A;  4XJH A;  1GHL A;  2ZIL A;  1LZD A;  3SBB C;  3TXF A;  4LT3 A;  2YFQ A;  3FRH A;  108L A;  4NSI A;  4IAP A;  4M4O A;  4DR5 M;  3B72 A;  2G4N A;  4ET8 A;  4H93 A;  1E8L A;  3K2L A;  1DYB A;  2BQI A;  3CF0 A;  2D7H A;  2Z18 A;  3LZ2 A;  1L0K A;  3KOX E;  1NF5 A;  2BQM A;  4I7Q A;  2DQF C;  3DMX A;  3P65 A;  1HEL A;  1LGU A;  4YEM A;  4DV6 M;  3AW7 A;  5B07 A;  1L35 A;  2HUK A;  3WHL A;  195L A;  4DT3 A;  1BVS A;  232L A;  1LMO A;  4I7S A;  1HQC A;  4NGJ A;  4Z41 A;  3M18 B;  1GBZ A;  1TDZ A;  1LLH A;  1QT4 A;  4ARM B;  1GB8 A;  3TE6 A;  1BB4 A;  1LHL A;  1L79 A;  3SAR A;  4DKL A;  2ERC A;  3GO8 A;  4H9F A;  1QS5 A;  3IG8 A;  1VEK A;  1AUA A;  4XYY A;  1GF9 A;  2K0B X;  1GB5 A;  2ZQ4 A;  3D8B A;  178L A;  4MGK E;  3U5Z A;  5FSW A;  4TTD A;  1D2N A;  5LA8 A;  1EQ4 A;  1C6B A;  1MJG M;  1L17 A;  3C83 A;  1IY3 A;  1LMC A;  1IXR C;  1WGN A;  1L74 A;  1Q02 A;  4DYG A;  4LYO A;  1HNX M;  1R5L A;  4FD2 A;  1GPQ C;  3GPU A;  1JR3 A;  1Z59 A;  4EPI A;  2JZ1 A;  2QQ8 A;  1NV9 A;  5KPZ A;  2DAE A;  2XGN A;  4ARM A;  4X65 M;  211L A;  1S3S A;  1RJC B;  2BWE A;  3TMV A;  2NTG A;  4K0K M;  2C5R A;  4LYB A;  2OU9 A;  3FRI A;  2YBH A;  1L57 A;  4CHT B;  2HEB A;  4HL4 A;  3LVW A;  1L63 A;  1XGU C;  3CT1 A;  4DR6 M;  1L85 A;  138L A; 
#chains in the Genus database with same CATH homology
 3D3D A;  1LZY A;  3ZVQ B;  3L2X A;  1T97 A;  4HV2 A;  3HU8 A;  1L76 A;  3WW5 A;  1DXJ A;  2LYO A;  3G3A B;  4WM2 A;  4OWC A;  2YVB A;  1TCY A;  1D9W A;  1IP1 A;  1LYH A;  2DBT A;  1IEE A;  1LYD A;  3A95 A;  3VWO A;  1SWZ A;  5B05 A;  1NMM A;  176L A;  126L A;  3TXB A;  150L A;  1C6D A;  1QT7 A;  4WM4 A;  4DD1 A;  4I7J A;  1TDY A;  4WM3 A;  4EPF A;  4GLV A;  3DMV A;  2B74 A;  4ZEE A;  4WL6 A;  4GN4 A;  1G7I C;  3LYT A;  1T6V L;  1MEL L;  3HUA A;  1YKX X;  4WLY A;  4W51 A;  1LJN A;  1L98 A;  1NHE A;  1D3F A;  2ZIJ A;  1C65 A;  1KXW A;  1JKD A;  213L A;  3SB6 A;  5I14 A;  4R0F A;  1C6N A;  4GCC A;  1N4F A;  1DYE A;  1JSF A;  4ZFP A;  1L0J A;  4OWB A;  5L9J A;  1GXV 2;  209L A;  1NHB A;  1D9U A;  1L61 A;  3CSZ A;  251L A;  3DN0 A;  3ODU A;  2H9K A;  1F10 A;  1QTH A;  147L A;  5F9U A;  3SB9 A;  2BQJ A;  1TBY A;  206L A;  1OUF A;  1GB7 A;  3SP3 A;  3QAK A;  1G07 A;  4H9I A;  3RZE A;  3ATN A;  5JEN B;  231L A;  1C6H A;  4P2E A;  4LFX A;  3A90 A;  1L83 A;  3DMZ A;  1QSB A;  2ZIK A;  4FJR A;  1T8G A;  1YL0 X;  4NGO A;  2IGC A;  2B6Z A;  1CKC A;  1P6Y A;  2ANX A;  218L A;  1B7M A;  1B7R A;  5LYM A;  1LZB A;  1FBI X;  3NY8 A;  5I4X A;  2DQD Y;  1XJU A;  3G3B B;  1C6I A;  152L A;  4GCB A;  1IP2 A;  1NWG A;  4D9Z A;  4ARQ A;  4I7K A;  2Z37 A;  5LYT A;  3FI7 A;  3OE6 A;  2LYM A;  4I7N A;  4HJY A;  2BQL A;  2C8P A;  2LZT A;  5LVH A;  3WW6 A;  240L A;  208L A;  1B7O A;  2MEC A;  4XJG A;  4QY9 A;  191L A;  1L87 A;  1DPX A;  4WO9 A;  1QT5 A;  4HP0 A;  142L A;  3W6B A;  3C8S A;  3T36 A;  3FE0 A;  1T6H A;  1LJF A;  3DN8 A;  1HHL A;  1L60 A;  4G4H A;  4DD0 A;  2X0A A;  4I7P A;  3P68 A;  1P2C C;  185L A;  2B72 A;  4LT0 A;  1OUE A;  1OYU A;  1QTC A;  3WMK A;  235L A;  4G4C A;  4LGK A;  1DKK A;  1W6Z A;  3A92 A;  4NHI A;  1LKS A;  177L A;  1LJ3 A;  4EKQ A;  1DI4 A;  4FDY A;  3LN2 A;  1CU0 A;  1P36 A;  1L24 A;  4IAT A;  1C62 A;  3L64 A;  162L A;  3HUQ A;  1D3M A;  4J7V A;  3OE0 A;  1NBZ C;  2B6Y A;  2BQC A;  4NGL A;  4AQN A;  4WG1 A;  3A34 A;  4OW1 A;  111L A;  2EPE A;  3A8Z A;  4B0D A;  2BQN A;  1GF7 A;  189L A;  3WUM A;  1IOT A;  3WU7 A;  1VAU A;  1IR7 A;  4OWE A;  3LYM A;  1LSE A;  3WUL A;  4I0C A;  3IWR A;  212L A;  1LJE A;  1C64 A;  1REX A;  3GUL A;  193L A;  1FKV A;  1L89 A;  4TUN A;  1L66 A;  3HBE X;  3CQL A;  1XGP C;  245L A;  4YEO A;  4DD9 A;  1GDW A;  5LVG A;  221L A;  2LZM A;  1HC0 A;  1KIR C;  1L99 A;  1VDT A;  1BHZ A;  4E97 A;  1EQ5 A;  1L12 A;  3MGW A;  3C8R A;  4GCF A;  1OVH A;  5FEL A;  3AYQ A;  1JJ1 A;  5HMV A;  1WQN A;  5KXR A;  2HEA A;  1YAN A;  1PQM A;  2RBN A;  1W08 A;  5B1G A;  4ARJ A;  181L A;  4EKP A;  1L36 A;  173L A;  3C80 A;  4AGA A;  132L A;  2W1M A;  1OUC A;  4WM6 A;  1YAO A;  3HH3 A;  160L A;  1CKF A;  4IJ4 A;  1L84 A;  3ULR A;  1OUB A;  1L15 A;  1JTT L;  4LDL A;  1LJI A;  112L A;  3B6L A;  3SB7 A;  1CV5 A;  3QE8 A;  3WPJ A;  257L A;  1DKJ A;  256L A;  4Z46 A;  4NSH A;  2RBP A;  1LZC A;  4KT3 A;  2D4J A;  1LWK A;  1JKC A;  2MEG A;  1VED A;  4ETB A;  2F30 A;  1GF8 A;  1DI3 A;  4RLM A;  134L A;  1L50 A;  1OUG A;  1A4V A;  3DKE X;  3N9E A;  3HT6 A;  4W52 A;  1QSA A;  5I4W A;  1BB3 A;  1YAM A;  5HLL A;  3AB6 A;  1EPY A;  3TXG A;  3HTF A;  3GUM A;  2Z39 A;  1L86 A;  155L A;  156L A;  1IR9 A;  3TXE A;  3WXU A;  1LYS A;  4H9B A;  1L29 A;  175L A;  5I54 A;  1GB6 A;  3V2Y A;  1OQM A;  2RBO A;  3JR6 A;  1LSZ A;  4LFP A;  4KXI A;  1QTB A;  1NKH A;  1LHI A;  1RI8 B;  1G7M C;  4YF2 A;  1ZWN A;  255L A;  1JEF A;  1YIL A;  4GCD A;  1LYZ A;  2ZYP A;  1LSD A;  1L93 A;  1C43 A;  1IOC A;  1CU3 A;  1C46 A;  1L32 A;  1CV1 A;  1QTE A;  1GAY A;  3AZ4 A;  1LI2 A;  3WVX A;  3GUK A;  3DN1 A;  3CB7 A;  5LA5 A;  1L71 A;  1LI3 A;  2PC2 A;  3EBA B;  1H87 A;  3BKV A;  1RE2 A;  1FKQ A;  1XJT A;  5LAF A;  1Z55 A;  197L A;  1QT3 A;  4EOF A;  3OK0 A;  1LZN A;  4LYC A;  4BS7 A;  1IOS A;  3RNX A;  109L A;  5FEK A;  1QUG A;  5HNC A;  1C66 A;  4ETC A;  1L82 A;  1LPI A;  1LGW A;  210L A;  1PQD A;  3E3D A;  2BQD A;  2XBS A;  1QTK A;  5D5C A;  1IWY A;  1VDQ A;  1L95 A;  5LZM A;  1HEW A;  1L90 A;  1ALC A;  5C6J A;  1G0K A;  1AZF A;  261L A;  2RBR A;  130L A;  1LZ5 A;  1LSY A;  1DQJ C;  1LYJ A;  2D91 A;  1AT5 A;  1F6R A;  3C7Z A;  1IWT A;  4W55 A;  1BWI A;  2YSS C;  1LAA A;  4DDC A;  4NGZ A;  1KW5 A;  1L33 A;  1LZ1 A;  1QS9 A;  1LHH A;  3B0I A;  2YBL A;  4LYZ A;  3HH6 A;  1IP7 A;  1L75 A;  3TMX A;  2B5Z A;  3J4G A;  4NHP A;  1INU A;  1I6S A;  4KPM A;  140L A;  4DAJ A;  1L55 A;  1RCM A;  4N9R A;  4HPI A;  4W96 A;  3A91 A;  1C60 A;  2RH1 A;  1LZG A;  1UIB A;  1YKY X;  1C08 C;  151L A;  2CJL A;  1LI6 A;  2YDG A;  1GB3 A;  3C8Q A;  4XAD A;  2Z38 A;  1HEO A;  5DLA A;  5FHW A;  1L02 A;  4PJZ A;  1L05 A;  4Z98 A;  5F16 A;  1DPW A;  3TXJ A;  1K28 A;  1D6Q A;  4BAD A;  1LPY A;  3A3R X;  1JTN A;  4R6C A;  3K3T A;  1GFR A;  3N9A A;  1GXX A;  234L A;  1LSB A;  1CV3 A;  2BQB A;  2H5Z A;  1L49 A;  222L A;  4H94 A;  5F14 A;  4OO9 A;  1YQV Y;  5KXY A;  1LYI A;  1NDG C;  3AGH A;  1LCN A;  1G1W A;  205L A;  1FDL Y;  5I5Q A;  3AGG G;  3HTG A;  1UIG A;  3HU9 A;  4CGE A;  4DD3 A;  1LZ6 A;  3C82 A;  3F9L A;  1JSE A;  3AJN A;  1DZB X;  2BQH A;  4WM1 A;  1LJK A;  1AM7 A;  1T8A A;  2YBJ A;  133L A;  5KXT A;  196L A;  2DQH Y;  1GFT A;  1NBY C;  1HER A;  1CV4 A;  3VW7 A;  2I25 L;  2YBN A;  1L41 A;  239L A;  1C67 A;  1GFK A;  1IC4 Y;  1V7S A;  3PBL A;  4OWA A;  1L51 A;  1CNS A;  1L56 A;  3T6U A;  4XJD A;  3HWL A;  1CKH A;  1LHK A;  3DN2 A;  4J0L A;  258L A;  119L A;  1L30 A;  1L40 A;  1A2Y C;  3GUN A;  2H9J A;  1P5C A;  2RB2 X;  4XN6 A;  1D6P A;  2D4I A;  5KXS A;  1GB0 A;  4YXC A;  1YRO A;  4QEQ A;  2F32 A;  5LIO A;  5ILF A;  1C6K A;  1D2Y A;  3WUA A;  1L59 A;  2GV0 A;  2DQE Y;  1GF3 A;  2O7A A;  1DYG A;  4EJ4 A;  1C6J A;  2DQC Y;  2LHM A;  2BQO A;  4A7D A;  2VB1 A;  2LC9 A;  1C7P A;  1C63 A;  3ATO A;  3SN6 R;  5DM9 A;  4UWV A;  259L A;  1L77 A;  4DWX A;  3QY4 A;  217L A;  1L07 A;  1L72 A;  4G9S A;  1XGR C;  1LSM A;  4H90 A;  1BGI A;  3CDQ A;  5F81 A;  1L97 A;  1GE0 A;  1CX6 A;  3WU9 A;  1D3J A;  4GCE A;  4H9C A;  1T8F A;  1LYO A;  4ARP A;  4WOA A;  1L28 A;  170L A;  1JPO A;  5C6L A;  5B06 A;  2DQG Y;  1XGT C;  2ANV A;  3C7Y A;  4L41 A;  113L A;  1CX7 A;  254L A;  4CFO A;  1QQY A;  2I26 L;  3WUN A;  5D5F A;  3FAD A;  4RDS A;  3LYO A;  5HQ1 A;  1LJ4 A;  5C6I A;  2HEC A;  2FYD A;  158L A;  2ZWB A;  3RT5 X;  4MST A;  143L A;  2FYC A;  3P4Z A;  1WVU A;  4NG8 A;  4I7T A;  2N5Z A;  3A6C Y;  3GUJ A;  1L10 A;  1LKR A;  4OOT A;  3OJP A;  4N1C C;  2LYZ A;  3RW8 A;  4UWN A;  4E3U A;  1L22 A;  1ZV5 L;  249L A;  125L A;  2QAR C;  1LOZ A;  4S0W A;  1ZMY L;  2MEF A;  5KXZ A;  1GE1 A;  2O4W A;  4EMN A;  1OUA A;  2BQA A;  3SB5 A;  4B4I A;  5B59 A;  1GBW A;  3HTB A;  3HTD A;  1L62 A;  4KL7 A;  1LSC A;  1GF0 A;  1G06 A;  1J1P Y;  3GUO A;  1UCO A;  1C6Q A;  5LVI A;  1P37 A;  1HEP A;  1HEN A;  1UBZ A;  3G3V A;  1ZVY B;  1L64 A;  5IEL A;  129L A;  1OUD A;  1L58 A;  1IP5 A;  2HED A;  5KXP A;  2HU1 A;  1JTM A;  3DN3 A;  1REZ A;  2A4T A;  233L A;  2LCB A;  5AMY A;  219L A;  1P7S A;  153L A;  5APD A;  2XQO A;  1SSW A;  2EQL A;  3AW6 A;  1IOR A;  1CKG A;  4J1A A;  2Z6B A;  1XSF A;  5LVJ A;  1G0Q A;  3B0K A;  3WU8 A;  1CJ8 A;  2A7D A;  1GFV A;  3J6K A;  4IAS A;  207L A;  1MLC E;  1L70 A;  224L A;  4YM8 A;  4H9H A;  1UID A;  3TMW A;  1LZE A;  2F4G A;  4TWS A;  4LT1 A;  3AGI A;  1JKA A;  2BQE A;  4GBR B;  154L A;  180L A;  1OUH A;  1L91 A;  4EKS A;  1C68 A;  3QNG A;  1TEW A;  253L A;  1GFG A;  5KXM A;  3W6D A;  236L A;  2CUU A;  2RAY X;  2BLX A;  5DN4 A;  1GE4 A;  1DYA A;  1L42 A;  3AZ5 A;  3HUK A;  102L A;  2BAA A;  1QIO A;  1L31 A;  4H8X A;  4PPO A;  1UIA A;  4B4E A;  1FLU A;  4PRU A;  5KY1 A;  3HBD A;  169L A;  1PQK A;  4OOO A;  1QT6 A;  2AUB A;  1L43 A;  5KXL A;  4YOP A;  260L A;  1B5Y A;  7LZM A;  4W59 A;  1KS3 A;  1LYE A;  2DQA A;  3DNA A;  2Q9D A;  3HDF A;  2OU8 A;  4NGW A;  4H8Y A;  1HFZ A;  1L44 A;  3F6Z A;  1V7T A;  1FLQ A;  1GF4 A;  128L A;  1CU6 A;  2FBD A;  2Q0M X;  3HFM Y;  115L A;  1IP6 A;  214L A;  1WVV A;  127L A;  1CV0 A;  1HEQ A;  3ZEK A;  1I1Z A;  1ZUR A;  9LYZ A;  3C7W A;  4MR1 A;  3C81 A;  223L A;  1OUJ A;  3V2W A;  1KNI A;  3SBA A;  4W57 A;  2B6W A;  3ZVQ A;  238L A;  242L A;  2G4Q A;  1KXY A;  4H92 A;  5LYZ A;  135L A;  1PZY A;  1GWD A;  4AXT A;  1JJ0 A;  201L A;  1QUH A;  1B2K A;  1HEM A;  2OEA X;  166L A;  1QTZ A;  1B5Z A;  1IWZ A;  1L39 A;  3W6E A;  1FN5 A;  4WMG A;  199L A;  1G0M A;  1L13 A;  3BKH A;  4LT2 A;  3M3U A;  1GD6 A;  3P66 A;  1C45 A;  3TXD A;  198L A;  1VDS A;  1WQQ A;  1G1V A;  1L45 A;  5KKJ A;  2HTX A;  2FBB A;  1B7N A;  1JHL A;  3A94 A;  3A67 Y;  5LAG A;  4NY5 A;  4GN5 C;  2OE9 X;  1L48 A;  4I7L A;  4HJZ A;  5L3I A;  4NWH A;  262L A;  183L A;  1F6S A;  187L A;  4NGK A;  2DKV A;  3EML A;  1WQO A;  1CJ7 A;  226L A;  1UAC Y;  4WO6 A;  1LSP A;  1B7Q A;  1KIQ C;  1P46 A;  163L A;  3SB8 A;  4QGZ A;  1WTM A;  2C8O A;  1XGQ C;  1QUD A;  1QUT A;  2HU3 A;  1L26 A;  4GRV A;  5DL9 A;  4YXA C;  5HMJ A;  5DN5 A;  4J1B A;  4LDO A;  3OE8 A;  4DC4 A;  1L67 A;  4O34 A;  1BWH A;  4B49 A;  2RB1 X;  4U3X B;  1GF6 A;  1XEJ A;  2RSC A;  1DYC A;  1IY4 A;  1L47 A;  5L3H A;  3CDR A;  1GE2 A;  1G0P A;  2HEE A;  1IC5 Y;  4CHX A;  4DQJ A;  2D4K A;  5FDJ A;  2BQG A;  246L A;  1LYG A;  1D3N A;  3G3W A;  2ZQ3 A;  1EQE A;  2RB0 X;  148L E;  4W54 A;  1CUP A;  2CDS A;  1WQR A;  1P2L A;  4WM5 A;  5B1F A;  120L A;  4ZPU A;  1KIP C;  1PS5 A;  2MEI A;  1BVK C;  4XEN A;  215L A;  1LGX A;  1C6L A;  1L19 A;  2CWI A;  4PJ2 C;  1TLA A;  3CT0 A;  4NG1 A;  1L88 A;  3HT9 A;  1JKB A;  4WLT A;  122L A;  4DQ7 A;  1L52 A;  1GBX A;  3HT7 A;  1OV5 A;  1J1X Y;  227L A;  4H1P A;  4C3W A;  1XFP L;  1TAY A;  3W6C A;  1G0G A;  4ML7 A;  4H91 A;  137L A;  4RLN A;  4LDE A;  2YBM A;  4PRQ A;  1YIK A;  1IOQ A;  168L A;  3EMS A;  4Z3M A;  3FA0 A;  1CVK A;  188L A;  1L68 A;  4XJF A;  1L21 A;  3WPK A;  1JWR A;  1CV6 A;  1L27 A;  1QUS A;  4TX7 A;  4K5Y A;  1G7L C;  1H6M A;  6LYT A;  248L A;  3A3Q A;  1JUG A;  250L A;  1CKD A;  1LSA A;  6LZM A;  1IWX A;  3CDT A;  4NGI A;  5LVK A;  1LW9 A;  2Q9E A;  2F2N A;  186L A;  5I53 A;  4H9E A;  1L38 A;  1IWV A;  2ZNX Y;  1C6M A;  1QDT A;  1ZYT A;  3HT8 A;  1B0D A;  174L A;  1OUI A;  1UC0 A;  4EKR A;  2RAZ X;  2A7F A;  5KKI A;  1CJ9 A;  1B7S A;  1B5X A;  1QDR A;  3RUN A;  5I4Y A;  1QUO A;  2OE7 X;  7LYZ A;  3TMU A;  1DI5 A;  4ETE A;  3EO5 A;  2O79 A;  161L A;  2IFF Y;  4NGY A;  1WQP A;  3PDS A;  5APF A;  4DDB A;  1JIS A;  4WG7 A;  1GE3 A;  4YX7 C;  1AT6 A;  5IDD A;  1JIT A;  1YL1 X;  4DJH A;  2MEH A;  1HNL A;  1HF4 A;  3A6B Y;  5EBH A;  1C61 A;  1SWY A;  5ILC A;  1CU2 A;  1C6G A;  1QSQ A;  1XEK A;  2XTH A;  1C6F A;  1XEI A;  2HUM A;  2F4A A;  4HSF A;  8LYZ A;  1UA6 Y;  1L06 A;  1PQJ A;  184L A;  4I7M A;  4BAP A;  3LZT A;  1I20 A;  3F8V A;  1SX2 A;  4NSJ A;  1IP4 A;  1L14 A;  1L34 A;  1IWW A;  1LMP A;  1KY0 A;  1REM A;  2Z2E A;  3CDO A;  1F0W A;  3TXI A;  2Z19 A;  1C6T A;  123L A;  4PHI A;  1GEZ A;  1L23 A;  1IIZ A;  4DD2 A;  5K7O A;  4W58 A;  4N8Z A;  4LYT A;  1L20 A;  1VFB C;  5F9X A;  5LIN A;  2RBS A;  1IWU A;  1PQO A;  4H9A A;  2W1L A;  3RU5 A;  1IO5 A;  4ETD A;  4N5R A;  2QB0 B;  1HSX A;  1L65 A;  2OU0 X;  4PGJ B;  1AKI A;  1IVM A;  1PQI A;  4QDN A;  3W3E A;  3IJV A;  1GBO A;  1OWZ A;  1WTN A;  1YKZ X;  1B9O A;  2ZNW Y;  1L01 A;  1HSW A;  5II3 A;  2BQF A;  1CU5 A;  3CDV A;  4LYM A;  1YAP A;  4W53 A;  1B6I A;  1LJJ A;  2F47 A;  107L A;  4MCK A;  5LXW A;  2MED A;  5A3Z A;  4XJB A;  252L A;  1LZ4 A;  3AZ7 A;  5E9R A;  247L A;  4YEN A;  1UUZ C;  1D2W A;  1L09 A;  4H8Z A;  2Z2F A;  3LHM A;  4WLD A;  1LJG A;  1LHM A;  4HTQ A;  1WTH A;  3CT5 A;  4ARL A;  4B4J A;  1G7J C;  3CSR A;  3WH1 A;  3DN4 A;  1B5W A;  3D9A C;  1GF5 A;  4CFP A;  1L92 A;  1LZA A;  1P64 A;  3CSQ A;  190L A;  229L A;  3A96 A;  3HH5 A;  2B6T A;  3RZ4 A;  114L A;  3B0O A;  1GFA A;  1IR8 A;  225L A;  1G0L A;  1OV7 A;  1I56 A;  1KXX A;  1KW7 A;  149L A;  2B70 A;  2W1X A;  1P3N A;  3TXK A;  4HTK A;  1LJH A;  1JTP L;  1B5V A;  2BPU A;  1G0J A;  4ZIX A;  1CTW A;  1UIF A;  1D0M A;  1GB2 A;  1VAT A;  4NHS A;  4NHT A;  1IC7 Y;  5M1Y A;  1L54 A;  1GDX A;  1QT8 A;  4UWU A;  1HMK A;  2I6Z A;  1FLY A;  1L37 A;  3WL2 A;  104L A;  3GUP A;  4M6D A;  1LZ9 A;  2B6X A;  4W94 A;  1L00 A;  3LYZ A;  4X3B A;  4B1A A;  4HPE A;  1O23 A;  1LYY A;  4LZM A;  1JIY A;  3WPL A;  5KJ9 A;  2OE4 X;  3G3X A;  4I7R A;  1P2R A;  1RFP A;  1REY A;  4NFV A;  1L03 A;  2IHL A;  5KXK A;  243L A;  1L16 A;  2L78 A;  3IJU A;  1OVK A;  1C6P A;  5KXX A;  1QSW A;  4HTN A;  3AZ6 A;  1L81 A;  1GAZ A;  1SSY A;  2ZYC A;  4II8 A;  3K2R A;  3FI5 A;  118L A;  4TSC A;  1LZS A;  1C6C A;  2BLY A;  3WVY A;  145L A;  1UIC A;  5APE A;  2CGI A;  4WLX A;  110L A;  1LHJ A;  1GBS A;  1D0K A;  2B73 A;  5J7C A;  1KY1 A;  1CUQ A;  4PK0 A;  1J1O Y;  1LMA A;  4N1E I;  1D0L A;  141L A;  1VDP A;  1L08 A;  167L A;  1BB7 A;  1LSG A;  1T3P A;  1P56 A;  3GXK A;  4CJ2 A;  216L A;  4G49 A;  4TSB A;  3OE9 A;  4NEB A;  1OP9 B;  1C10 A;  4NIJ A;  2D6B A;  4ETA A;  4NWE A;  4GLA A;  5FST A;  1L25 A;  2HUB A;  4NSG A;  2F2Q A;  3P64 A;  1OWY A;  1LSF A;  1SX7 A;  1NQI A;  3W6A A;  5KXW A;  2EKS C;  3UON A;  3WYH A;  103L A;  3HDE A;  4G4B A;  2G4P A;  192L A;  1L11 A;  1SQ2 L;  1HFX A;  1SLY A;  182L A;  2OTZ X;  1LYF A;  1L04 A;  2B7X A;  1LMQ A;  4I7O A;  4I8S A;  1C6A A;  3LZM A;  1EL1 A;  3WXT A;  3GUI A;  1QTD A;  5KXN A;  1DYD A;  4RW2 A;  4ET9 A;  1UIH A;  1FLW A;  4ARQ B;  1L69 A;  1ZVH L;  1GFJ A;  1XEP A;  5E4P A;  1CJ6 A;  220L A;  4C5F A;  1BQL Y;  3TXH A;  2XBR A;  4GN3 A;  165L A;  1C6E A;  2EIZ C;  4NHQ A;  1NDM C;  1BB6 A;  228L A;  5FCP A;  2MEB A;  157L A;  146L A;  1IP3 A;  1UIE A;  2OTY X;  1L46 A;  4DQ5 A;  1GFE A;  1DYF A;  237L A;  3D4S A;  2LZ2 A;  1LWG A;  1C69 A;  139L A;  4XJI A;  2W1Y A;  200L A;  2DQI Y;  3GXR A;  3DN6 A;  2MEA A;  4HJV A;  1L94 A;  2NWD X;  1BVX A;  5IHG A;  4EXM A;  1L53 A;  2HEF A;  3W6F A;  2RBQ A;  4DDA A;  1YAQ A;  2DQJ Y;  5APC A;  1BWJ A;  2Z12 A;  3EXD A;  1HML A;  164L A;  2MEE A;  1JQU A;  1GB9 A;  4HV1 A;  1JTO L;  241L A;  2HUL A;  1OVJ A;  1B7L A;  1L18 A;  1GFU A;  4BAF A;  159L A;  1G7H C;  244L A;  2BQK A;  1HFY A;  5HNL A;  4OWH A;  194L A;  1LMN A;  5A3E A;  1L96 A;  5KXO A;  1IX0 A;  144L A;  1GBY A;  2WAR A;  5T3F A;  2NTH A;  1L80 A;  1L73 A;  2B75 A;  4RW1 A;  3HBH A;  131L A;  4DD7 A;  1QTV A;  4W56 A;  2XJW A;  3A93 A;  4ANR A;  3NYA A;  1LSN A;  3NY9 A;  1LZ8 A;  1B5U A;  3N9C A;  1JJ3 A;  171L A;  6LYZ A;  172L A;  230L A;  1LZR A;  2Y8P A;  2YBI A;  4N0J A;  1LMT A;  1LZT A;  1GEV A;  1BB5 A;  4LZT A;  3KAM A;  1LTM A;  4WL7 A;  4NGV A;  1GFH A;  1B7P A;  1WQM A;  3HH4 A;  4XJH A;  1GHL A;  2ZIL A;  1LZD A;  3SBB C;  3TXF A;  4LT3 A;  108L A;  4NSI A;  4IAP A;  4M4O A;  3B72 A;  2G4N A;  4ET8 A;  4H93 A;  1E8L A;  1DYB A;  2BQI A;  2Z18 A;  3LZ2 A;  1L0K A;  1NF5 A;  2BQM A;  4I7Q A;  2DQF C;  3DMX A;  3P65 A;  1HEL A;  1LGU A;  4YEM A;  3AW7 A;  5B07 A;  1L35 A;  2HUK A;  195L A;  4DT3 A;  232L A;  1LMO A;  4I7S A;  4NGJ A;  4Z41 A;  3M18 B;  1GBZ A;  1LLH A;  1QT4 A;  4ARM B;  1GB8 A;  1BB4 A;  1LHL A;  1L79 A;  4DKL A;  4H9F A;  1QS5 A;  4XYY A;  1GF9 A;  1GB5 A;  2ZQ4 A;  178L A;  4TTD A;  5LA8 A;  1EQ4 A;  1C6B A;  1L17 A;  3C83 A;  1IY3 A;  1LMC A;  1L74 A;  4DYG A;  4LYO A;  1GPQ C;  4EPI A;  4ARM A;  211L A;  1RJC B;  3TMV A;  2NTG A;  4LYB A;  2OU9 A;  2YBH A;  1L57 A;  2HEB A;  1L63 A;  1XGU C;  3CT1 A;  1L85 A;  138L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...