1D0KA

The escherichia coli lytic transglycosylase slt35 in complex with two murodipeptides (glcnac-murnac-l-ala-d-glu)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
314
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 108
structure length 314
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0kA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0kA02
5HMVA 3LN2A 3CQLA 4XJDA 5LYTA 1JJ1A 4BS7A 1LOZA 1LZDA 1RCMA 2FYDA 3A95A 4GCEA 1A2YC 2XTHA 1DI5A 3EMSA 4PPOA 5APCA 4LYMA 3AJNA 135LA 4PGJB 1REXA 2EQLA 1AT5A 4DD7A 1OUIA 1OUJA 4H8YA 1OUFA 3OJPA 1I1ZA 3AYQA 3SP3A 1I20A 1YIKA 4NHTA 1DPXA 2FYCA 1IY3A 5JENB 2MEDA 4GN4A 1ZVYB 1GF5A 2DQHY 1CKHA 3IWRA 2YBJA 1INUA 1IX0A 1J1PY 1WVUA 1LHLA 2Z19A 1IWWA 5FELA 2BQIA 1W08A 5F16A 3KAMA 4EMNA 4NGWA 1LSZA 1IWYA 3CSRA 1IORA 1QIOA 1RE2A 4LFXA 5D5CA 2C8PA 4PRQA 5A3EA 2BQGA 1LYYA 3WUNA 4XJGA 1NMMA 1Z55A 1IP2A 2XJWA 1CJ7A 5I54A 4DDBA 1JTTL 5APDA 3TXGA 4NGVA 1YILA 1IWZA 1LZBA 1YL1X 3TXFA 207LA 3T6UA 5C6IA 1UIHA 1LSBA 5LINA 1LJFA 3A3RX 3J6KA 4NSGA 2DQDY 2YBLA 5IHGA 1EQ4A 1G7IC 1GBYA 4QY9A 3FE0A 5DLAA 4DD0A 1OUGA 3TXHA 2VB1A 3AW6A 1NQIA 3LYOA 1GXV2 1IO5A 1UA6Y 3K3TA 3RZ4A 2DKVA 1LSGA 1G7MC 5F14A 2W1MA 1CKGA 1RI8B 3FI7A 1DKKA 5KXLA 1IWUA 1QTEA 1LMPA 3CB7A 3CSQA 3HBDA 3W3EA 3W6CA 1NWGA 4H94A 5LVGA 4H9HA 1F6SA 4E3UA 208LA 4WMGA 1UCOA 4ML7A 2DQAA 1KXWA 2BQLA 4KXIA 5I53A 1REMA 5LAFA 1IOTA 2CJLA 4H92A 4NEBA 4FDYA 4G4BA 2F4GA 1GAYA 1JSFA 4L41A 1IC7Y 1DXJA 2DQFC 3ATOA 5I4YA 1HERA 4LGKA 1FN5A 1W6ZA 4WO9A 3WULA 2HEBA 3WVYA 5LVJA 4Z41A 1GXXA 4LYOA 3P64A 4ET8A 3W6DA 1JJ3A 1HFZA 4KL7A 5LVIA 1B5VA 3TXDA 4NHPA 5I4WA 3TMVA 7LYZA 1QTKA 4ZFPA 3ZVQA 1JKAA 4TSBA 4GLAA 1JSEA 4WOAA 4WM6A 2BQFA 4R0FA 2HECA 4NHQA 4B49A 1LYSA 4H93A 1TDYA 4LYZA 5APFA 2YBHA 4C5FA 4Z3MA 1JEFA 8LYZA 5DM9A 5LYZA 1LZ8A 2YBNA 1LSAA 1GD6A 4YM8A 1IEEA 4B4IA 4Z46A 4ANRA 1D6PA 2IHLA 4W94A 1GHLA 2XBRA 3B72A 2CGIA 1FKVA 4J1BA 5E9RA 4NFVA 5KXPA 1OUHA 2W1YA 2G4NA 4H8ZA 5E4PA 4WL7A 1J1OY 3WVXA 1LZ1A 2RSCA 4NG8A 3OK0A 5KKIA 4DD9A 1UACY 1IWXA 5KXKA 4WLYA 1GB3A 1IOCA 3WU8A 2DQIY 4DWXA 4UWNA 2LYMA 1ZV5L 1OUEA 2D4JA 1FBIX 6LYTA 1LSCA 2BQDA 133LA 1HEMA 4RLMA 1KIPC 1GFHA 5LAGA 3P65A 4IATA 4B4EA 1GF4A 3A94A 2DQGY 3WPLA 1XEKA 2HEEA 1JITA 3T36A 1I56A 2NWDX 1GPQC 3P68A 1JHLA 1F6RA 1GBXA 1H6MA 3A90A 2BPUA 4H90A 4NG1A 1LTMA 3ULRA 4Z98A 4I8SA 4ETBA 1XSFA 1HF4A 1JKDA 1JPOA 3ZEKA 5HLLA 1UIFA 4LYTA 4ETAA 1WQNA 4B0DA 2H5ZA 1LHHA 3A92A 4NGYA 1GF0A 1A4VA 3B0KA 4B4JA 2ZYPA 2Q0MX 2BLYA 1NDMC 1C45A 4WM3A 1D0MA 1HENA 1LMQA 5IDDA 1DKJA 1B7PA 1AT6A 1BB5A 2D6BA 1WTMA 1XEIA 4KT3A 1QSAA 2D4IA 1HEWA 3QNGA 4DC4A 4WLXA 5ILFA 2ZIJA 4NSHA 4C3WA 2LHMA 1FLUA 1LZEA 2HUBA 2H9JA 3A67Y 4CHXA 1GFRA 1DPWA 1NDGC 5FSTA 1GFEA 3WUAA 1WTNA 1GE4A 4WLTA 4YOPA 5DN5A 3WU9A 3A93A 1GFKA 4HP0A 1BB4A 1ZMYL 4J7VA 4H9IA 4CFPA 4WG7A 5FHWA 3LZTA 4OOTA 5KXTA 2DBTA 1GFVA 1EQEA 2I26L 5HNCA 4N8ZA 4NY5A 1HELA 4RW1A 3TMWA 1B7SA 2BLXA 3AB6A 3W6AA 2ZNWY 1GFTA 2YVBA 4UWVA 2C8OA 3A6BY 1WQQA 1BHZA 1IP4A 4HJYA 1IR9A 4KPMA 1EL1A 4YF2A 1UIAA 1IOSA 3ATNA 3MGWA 3AZ7A 1ZVHL 5B1GA 1DZBX 1B7MA 1B5UA 4D9ZA 2YDGA 5J7CA 4U3XB 2B5ZA 1EQ5A 2YSSC 2BQHA 3QY4A 1LJEA 3GXKA 1JKBA 4HV2A 3TXKA 1YAPA 5KXRA 1LZTA 2EIZC 4TWSA 1FLYA 1LSFA 1IVMA 1B7NA 2A7FA 3WL2A 1LSYA 2ZIKA 2W1XA 1GB6A 2IFFY 1LZ4A 1LZYA 1V7SA 2HEDA 1C7PA 4HTQA 4WLDA 1LZGA 1LHMA 1N4FA 4ZEEA 1VFBC 3EO5A 1BGIA 3WPKA 1XGPC 2MEBA 3LYMA 2LYZA 2Y8PA 1BWJA 1LJNA 1LMNA 4LT0A 2BQOA 3EXDA 4I0CA 5I5QA 4DD3A 1LZAA 1YKYX 1LZSA 3N9EA 1JTOL 4OWHA 1PS5A 1IWTA 5HNLA 3WU7A 1QDRA 5L9JA 1T6VL 2HTXA 2LZTA 1IP1A 3QE8A 4N9RA 1NKHA 1DI3A 1LAAA 2PC2A 3GXRA 4N5RA 4NSIA 2MEAA 1LJIA 2GV0A 3IJUA 1YAQA 1UBZA 5B1FA 1KIQC 5LXWA 4PHIA 1UICA 4MSTA 1JWRA 4ETEA 2Z39A 1QSWA 2Z18A 4GLVA 6LYZA 1LSEA 1YKXX 4GCCA 1GBZA 2Z2EA 3WXTA 5II3A 3AZ4A 1DQJC 1VDTA 2W1LA 2ZNXY 1B5ZA 1HMKA 1HNLA 1BB6A 1OQMA 2H9KA 5EBHA 3D3DA 5B06A 4WM5A 1BVKC 1GAZA 1IR7A 1LYZA 3W6FA 1VATA 1H87A 3WMKA 5F9UA 4YEOA 1VAUA 4ZIXA 194LA 5FCPA 5KKJA 2ZQ3A 1LMCA 4CGEA 1GE1A 1YQVY 5DL9A 1GF7A 5IELA 4QGZA 1YAMA 4H9AA 1LHJA 4GN3A 1HFYA 1LJ4A 1YL0X 1CJ6A 2BQBA 4OW1A 1GDXA 1SQ2L 2D4KA 4G49A 4HTKA 1GFJA 5K7OA 2EKSC 1LHIA 3CSZA 3EBAB 2G4QA 4H1PA 4J0LA 4B1AA 1CJ9A 3B0IA 4G4CA 3AGHA 1GE2A 3HFMY 1JJ0A 4RLNA 1IP5A 2CWIA 1GF8A 1BB7A 4H9FA 5AMYA 3W6BA 4GCFA 1G7LC 1HEPA 2F30A 2Z12A 4TSCA 1LCNA 1XGTC 2LYOA 1QUSA 1JIYA 5KXWA 1GE0A 5KXNA 2HU1A 1BWIA 1SLYA 1WQPA 1B5XA 1TEWA 4H9CA 4P2EA 4NGKA 3BKVA 4HJZA 4NGOA 4LT3A 4W96A 1YKZX 2D91A 3BKHA 1G7HC 1LSNA 4WM2A 1CKCA 1PZYA 2Z37A 3WXUA 1XGQC 3AZ5A 3RU5A 4DD2A 1B2KA 1B5YA 3A34A 1D0KA 3D9AC 1OUCA 1GWDA 5HMJA 1BVXA 1RFPA 4LYCA 1D9UA 2ZYCA 4NGIA 1REZA 3P4ZA 1LZ6A 4CFOA 1HHLA 1XGUC 3TXBA 3HBHA 1TBYA 4FJRA 1JISA 5LIOA 5ILCA 1KXYA 4BAPA 1LSDA 1GBWA 3A91A 3A3QA 3W6EA 4PJ2C 4GN5C 1BQLY 1B7OA 1AM7A 1GB7A 1IOQA 2Z2FA 1KIRC 2HEFA 2F4AA 5D5FA 4LT1A 4WL6A 4YEMA 3WH1A 4TUNA 4XN6A 5DN4A 4IASA 3CT5A 4NGJA 4OOOA 1VEDA 4WM4A 1FKQA 1LJ3A 1OUAA 4WM1A 1JKCA 4XJHA 1CNSA 2MEFA 4QDNA 1KXXA 1HEQA 3HBEX 3N9CA 3RW8A 4DYGA 193LA 1VDSA 1CJ8A 2MEEA 1MELL 3E3DA 2A7DA 4RDSA 4NGZA 4O34A 1IP6A 5APEA 1LJJA 5LVKA 3RT5X 1IC5Y 1LSPA 4XJBA 2DQCY 4NHSA 4QEQA 1VDQA 4ETDA 4DD1A 1UIDA 1QUTA 1UIGA 1QDTA 2HEAA 4XJIA 4NHIA 4OWBA 4ET9A 1REYA 4N0JA 4N1CC 134LA 5F81A 3AGGG 1QQYA 4DT3A 132LA 1D6QA 4II8A 5L3HA 5T3FA 4GCBA 1WQOA 1TCYA 5B59A 1GDWA 1HEOA 1AKIA 1JUGA 5LA5A 2MEGA 3WUMA 1IY4A 4HTNA 4EOFA 2EPEA 4OWAA 3TXIA 1CKDA 4DDCA 1IIZA 2BQJA 1IWVA 2F2NA 4HPIA 4DDAA 5LA8A 3TMUA 4OWEA 1FLQA 154LA 1IP3A 4TTDA 3TMXA 1LJKA 1GE3A 1HSXA 1LJGA 1LZ5A 2WARA 3M18B 2DQEY 4HSFA 9LYZA 5C6JA 1LZNA 2XBSA 1VDPA 3LYTA 1G7JC 1IP7A 1LMOA 3J4GA 5F9XA 1HFXA 5KXZA 1LKSA 2BQAA 3A96A 1V7TA 1FDLY 1B5WA 2MEHA 4R6CA 3LYZA 4J1AA 1GEVA 5B07A 1GB8A 1GB5A 1LHKA 4IJ4A 4MCKA 1J1XY 1B7QA 1WVVA 2YBIA 1GBOA 4NGLA 1YROA 1GB9A 2MECA 4M4OA 4G4HA 5LVHA 2BQNA 2BQMA 4WO6A 4GCDA 5M1YA 4H9EA 1GB0A 4HPEA 1LKRA 4G9SA 2ZQ4A 3IJVA 1LSMA 3LZ2A 4LT2A 4AXTA 1UUZC 3WYHA 1GF6A 153LA 3AZ6A 4XENA 4XJFA 4NWHA 1XFPL 2FBDA 4YENA 1IR8A 1P2CC 2HU3A 1BWHA 5B05A 2I25L 2AUBA 1B0DA 2N5ZA 1HC0A 4XADA 3ZVQB 1OUBA 5HQ1A 1C43A 5KXOA 3WW6A 3WPJA 1D0LA 1LMAA 3N9AA 4AGAA 1UC0A 4NSJA 4CJ2A 3AGIA 1GF9A 2BQCA 2BAAA 2G4PA 1LMTA 3CT1A 4M6DA 1LYOA 4H9BA 1F10A 1LZ9A 1GBSA 4XYYA 5I4XA 1YANA 1WQMA 1E8LA 4BAFA 5C6LA 1GF3A 5LYMA 1C46A 2BQKA 1HMLA 3TXEA 1B7LA 2ZILA 2CDSA 3M3UA 1ALCA 1O23A 3TXJA 4WG1A 3WW5A 1JTPL 1TAYA 2X0AA 4HV1A 3VWOA 1YAOA 4X3BA 5KXSA 1C10A 3LHMA 1OP9B 4N1EI 4LFPA 5A3ZA 4A7DA 1C08C 1GFGA 1NHEA 1F0WA 1NBZC 2LZ2A 2ZWBA 2FBBA 3G3BB 1DI4A 1UIEA 4H91A 4HJVA 4LYBA 5FEKA 1T3PA 4NWEA 1IC4Y 4UWUA 1AZFA 1BB3A 3P66A 3CT0A 5KY1A 5FDJA 2I6ZA 3B0OA 4OWCA 5KXXA 3F6ZA 1LZRA 4TX7A 1GEZA 1LZCA 1LJHA 5KJ9A 1NF5A 3A6CY 4ETCA 1XEJA 5KXMA 5L3IA 3B6LA 1GFUA 4BADA 4NIJA 1UIBA 1B7RA 2DQJY 1GB2A 2YBMA 3A8ZA 1B9OA 1RJCB 2Z38A 3AW7A 5KXYA 4LZTA 1HSWA 1CKFA 1MLCE 1GFAA 2BQEA 1NBYC 1OUDA 4PRUA 4RW2A 3RNXA 2MEIA 4H8XA 4MR1A 1FLWA 1LPIA 3G3AB 1WQRA 1XGRC
chains in the Genus database with same CATH superfamily
3CQLA 4DV2M 1JJ1A 1RCMA 4CISA 1A2YC 221LA 1DI5A 1GO5A 3UMMA 3GUPA 3NYAA 1AIPC 2Z4RA 3AJNA 3LQRA 2EQLA 1IXSA 1OUIA 2CE7A 4NHTA 1DPXA 4AQNA 1QAOA 112LA 2MEDA 4GN4A 1ZVYB 1GF5A 4NXNM 3IWRA 4DUZM 1INUA 3D8BA 1G0MA 151LA 1G0GA 5I14A 1L24A 1XC8A 1JR3D 5A3EA 2BQGA 4XJGA 1NMMA 1C6KA 188LA 2APLA 1NHWC 192LA 2XJWA 1K3XA 3TXGA 1L57A 207LA 1UIHA 1G71A 1ZMUA 3A3RX 1NV8A 2DQDY 4PDIA 1EQ4A 2O01F 5ITUA 3B74A 3GLHE 1OUGA 2B6WA 1UA6Y 1G7MC 2LTUA 1LWGA 4JXJA 1Q02A 2RKOA 1IWUA 1QTEA 3HJQA 1LMPA 3CB7A 3CSQA 3W6CA 3GLGE 5LVGA 4H9HA 1DO2A 2BQLA 1JR3E 2XGNA 1DO0A 3U61A 5LAFA 1IOTA 2CJLA 4NEBA 4A3VB 4D80A 4L41A 2DQFC 1FN5A 4WO9A 3P64A 4JN6A 2N35A 1HFZA 1L16A 261LA 4I7PA 223LA 2LC9A 4DV5M 1QTKA 1ZYTA 3GQ4A 1R2YA 4WOAA 3GLHA 1L17A 2DENA 1G41A 1LYSA 144LA 1TDYA 2RAYX 2YBHA 1C6CA 4Z3MA 5DM9A 4W55A 4ARQA 4YM8A 4JI4M 1IEEA 4ANRA 5BR8M 2F5SA 1D6PA 2XF3A 1NNUC 4W94A 2V1UA 3B72A 4K5YA 3PBLA 5E9RA 1UM8A 1OUHA 102LA 3K2RA 1HNZM 2XFSA 5E4PA 1IN4A 1P46A 1J1OY 3WVXA 3FRHA 1L62A 4I7KA 3GPUA 1QQWA 4FWHA 2DQIY 4DWXA 2LH0A 1L80A 3UJNA 3SAVA 2D4JA 1TH3A 2UXBM 3ZCBB 1HEMA 1KIPC 2EKKA 1XEKA 1JITA 3P68A 5E26A 1L54A 3A90A 5ITYA 2RBQA 4Z98A 1IFYA 2NTGA 5FTMA 2OE7X 1JKDA 1DGGA 2ANXA 1P3QQ 1IBMM 3SBAA 4R71A 1A4VA 2BLYA 1NDMC 1C45A 1L64A 1E94E 3SC3A 4JI7M 2RBOA 215LA 3L2XA 2D6BA 1WTMA 4KT3A 2CHQA 5ILFA 3QNGA 3LVVA 2O4WA 3U60A 4LDOA 3CDOA 2QENA 2ZIJA 4C3WA 2WSFF 5ITQA 4QNMA 1L07A 4LF7M 1FLUA 4LJAA 3DNAA 3A67Y 3J7BA 4QHTA 5ITXE 1NY5A 1NDGC 4DR5M 1V92A 5BPVA 4JYAM 1GFEA 3WUAA 3B7QA 3WU9A 5ITTA 2JY6B 1L74A 4CJ6A 3RGSA 5C1BA 4B08A 1QANA 5FHWA 5KXTA 3ZC7B 4EPIA 1EQEA 4N8ZA 4NY5A 3TMWA 2BLXA 2QZ4A 3W6AA 1N36M 1LYJA 1C60A 3DN3A 2QCUA 1EL1A 2H1RA 4QOZC 2K47A 1JQUA 1UIAA 1WHCA 3ATNA 2RGHA 3MGWA 3AZ7A 1ZVHL 1L28A 2RAZX 2OO9A 1SG9A 2FH0A 3IECA 3J7AS 1B7MA 5B1GA 4LF6M 1G1VA 4D9ZA 1L04A 2B5ZA 1L42A 5FTNA 3VKGA 4JI5M 3QY4A 3FTCA 1LZTA 2NQ8C 1FLYA 3U6OA 3WL2A 4I7JA 3KS4A 1EPYA 1LSYA 201LA 1GB6A 3U6PA 1LZYA 2IFFY 1C7PA 1L12A 1NHGC 1IM2A 2MEBA 2LYZA 3LW5F 5KQ8A 4LG2A 5I5QA 107LA 3K8ZA 1TH4A 4G4RA 5L9JA 5EP2A 2LZTA 3KOZE 3T1HM 4PDGA 2PC2A 4FWGA 1Z5AA 1CV4A 1VEKA 150LA 225LA 3IJUA 5B1FA 1KIQC 2G8LA 1OIPA 3BXWA 157LA 4ETEA 2Z39A 2R46A 213LA 1L19A 3C3DA 1L2BA 189LA 3VDPA 2ZNXY 5EBHA 1HMKA 3GLFE 1OQMA 2R6FA 3VFDA 5DNYA 3U6CA 1IR7A 1LYZA 3C81A 3SMSA 1VATA 1VAUA 3R9XB 3RE8A 4D82A 194LA 1L51A 4OVZB 2Q9EA 5JI3E 1LI3A 197LA 1PGYA 3PVSA 250LA 5IELA 1D2WA 4QGZA 1KY1A 4W53A 1KFVA 1G4AE 232LA 3MK6A 2DWZB 123LA 4HTKA 1GFJA 5K7OA 3HJSA 3DA1A 3FUVA 1CJ9A 1L26A 3VKHA 4RLNA 3W6BA 3HY5A 2R4JA 2F5PA 4GCFA 2F30A 2CWBA 4B7GA 4TSCA 3QWLA 4IBCA 163LA 1GE0A 1KW5A 1PRBA 4NGKA 1TDZA 5IREB 4NGOA 1E9SA 1HT2E 1YKZX 2B73A 4ARPA 2UUCM 3RZEA 2MH8A 2CHVA 2F5OA 4DD2A 3T1YM 4F2LA 171LA 4LYCA 4DKLA 1D9UA 2ZYCA 160LA 3P4ZA 4W58A 4DAJA 140LA 1HNXM 3FYCA 1L96A 1GBWA 1QTBA 3A91A 1BQLY 3OTOM 1B7OA 1X37A 2Z2FA 3GRVA 4RF0A 4AW4A 4LT1A 3GUMA 3WHLA 4WL6A 2RB1X 4TUNA 1LWKA 2O7AA 149LA 1D9WA 1FKQA 1OUAA 1L63A 4WM1A 4DR6M 3N9CA 4GEWA 3HBEX 1FJGM 3NY9A 1VDSA 1CJ8A 5APEA 1MELL 7LZMA 1G8PA 4O34A 1D2NA 3KXEC 2UXCM 4PK0A 1PJQA 1SSWA 1UIDA 3LCVB 1Q39A 4BB9A 2CEAA 1IN6A 177LA 4II8A 4DBGB 1XEPA 1OQYA 4GKJM 1L86A 1TCYA 1L32A 1HEOA 3F92A 2L4FA 4EOFA 4HTNA 2Y0QA 2FOIC 3D8LA 2A5YB 4OWAA 2HL7A 4MH0E 1LGXA 2BQJA 231LA 5LA8A 1FLQA 4TTDA 3TWKA 248LA 9LYZA 3NWLA 1DYDA 4PD2A 237LA 3HGIA 183LA 4FCVA 2R62A 1Y8GA 5KXZA 2QBYB 2BQAA 111LA 3LYZA 1GEVA 5B07A 2ZBKB 3J2PB 1GB5A 4IJ4A 1W5TA 4GKKM 1B7QA 1ZURA 1GL6A 4E97A 2JY7A 3AOEA 4NXMM 1YROA 3GUJA 2D7EA 2MECA 1Q3BA 155LA 2OTYX 206LA 2BQMA 1L94A 4GCDA 1DGHA 4H9EA 1ZQ9A 4HPEA 1LKRA 3U6SA 1LSMA 3LZ2A 4LT2A 113LA 2A4TA 1L15A 1L14A 1T8GA 2KNZA 2KW0A 4LF8M 4NWHA 4XJFA 2Z3XA 1F4IA 4YENA 2FS1A 2D7GA 1B0DA 3IHPA 2N5ZA 218LA 3THGA 3SB6A 1L21A 1KY0A 1UC0A 3CT1A 2YNMD 1LMTA 129LA 4M6DA 4H9BA 5I4XA 1LZ9A 4X64M 1GBSA 1WQMA 3GLIE 4IBBA 2XLJA 1C46A 1JTMA 1L44A 3TXEA 2D7HA 3TXJA 4HV1A 3PXGA 1RU3A 1R7RA 5EJCA 3MHVC 4AKGA 1C08C 1GFGA 1L2DA 3HH6A 4W56A 1NBZC 3G3BB 4H91A 1QVRA 3DMXA 3FTFA 4LYBA 3KSXA 3V2WA 3P66A 4AQYM 2DZOB 2I6ZA 5KXXA 1P5CA 3F6ZA 1IY2A 4TX7A 1NF5A 3JAMS 1LI2A 1XEJA 2QHOB 4BADA 1B7RA 4FVMA 2YBMA 1LYFA 1P64A 1RJCB 1QTVA 1NBYC 1QT5A 4B7FA 3SB9A 4H8XA 4ARJA 4MR1A 1P56A 1FLWA 3VW7A 4IBIA 3HZJA 1HT1E 1TGUA 2ZANA 2FYDA 3GLIA 4K0KM 4LYMA 3EMLA 4RNAA 3GPYA 2XZUA 137LA 1IN5A 2UUAM 2LHGA 3U5ZA 4DD7A 2OTZX 168LA 3C7WA 3AYQA 2Z6BA 4YHHM 5LMNM 3SP3A 1I20A 4M9SA 4FCWA 3MJ5A 148LE 2DHRA 5JENB 1OV7A 2DQHY 4WURA 5F16A 3KAMA 2JP7A 4D81A 2KNAA 1IWYA 3CSRA 1IORA 3GULA 3QYEA 1GKIA 4GC9A 4PRQA 1L68A 3WUNA 4ARMA 3TE6A 211LA 2J7NA 5APDA 1L00A 3KP0E 1L18A 3TXFA 1L79A 5LINA 255LA 4NL4H 1OV5A 1GBYA 3FE0A 5DLAA 4DD0A 1Z59A 2LXEA 2C9CA 3AW6A 3LYOA 4BLCA 3U6LA 3GO8A 1RI8B 1MN3A 2DWNA 2QQ8A 3SHGB 1NWGA 4DV4M 1F6SA 4E3UA 2LVAA 208LA 4PT5A 2DQAA 5I53A 4RKUF 2I7PA 1XNQM 4X62M 4H92A 1GAYA 1JSFA 1L36A 2VQFM 5I4YA 4S12A 2HEBA 5DYGA 5C18A 2CFOA 1QYRA 1L34A 2XEPA 3BOSA 5LVIA 1L20A 1XXHB 3TXDA 216LA 4ZFPA 2KHHA 4DJHA 4TSBA 3TPZA 251LA 2HECA 1OAOC 4R0FA 3ODUA 3LCUA 4NHQA 4ZPUA 4LZMA 1QUOA 4H93A 1QAQA 8LYZA 1H6UA 1LSAA 2X8AA 2K0BX 1CV1A 2ZAMA 2XZFA 2YQZA 5FTKA 4I7SA 1G0JA 1DYEA 4OX9M 5KXPA 4EPFA 2K9DA 2HUKA 4WL7A 1QSBA 1L11A 5KKIA 3CF0A 161LA 1IWXA 2MJ5B 1C66A 1WIVA 1IQPA 4JV5M 4UWNA 2VDBB 1T43A 1ZV5L 1OUEA 125LA 2RBSA 6LYTA 3VLFB 1LSCA 162LA 1N75A 1GFHA 1XHBA 2KNVA 2CV2A 4IATA 4B4EA 1GF4A 3A94A 3WPLA 2HEEA 1CV0A 2BNKA 1I56A 2NWDX 4FD2A 4NG1A 4W52A 1IBKM 1HF4A 2BWEA 1JPOA 3ZEKA 214LA 2KRUA 4OO9A 1WQNA 3KSJA 2CRUA 3SAWA 1KYIA 1LHHA 1OVJA 1GF0A 1L60A 1CU3A 239LA 2QSFX 1D0MA 4WM3A 4NSRA 3DZDA 1L31A 1AT6A 3L29A 1XEIA 4DC4A 4JI3M 1LYHA 1G07A 3NBIA 3HKPA 3SB5A 5EP1A 2MROB 4DV3M 1ZAEA 1LZEA 3TQSA 1GFRA 1C68A 3UONA 1P36A 5DYIA 2F32A 1C6IA 4YOPA 5DN5A 3V2YA 1BB4A 4EXMA 1ZMYL 4J7VA 4CFPA 2UXDM 195LA 2DBTA 1OIZA 2V1CA 4RW1A 1HELA 1SXJB 3HU9A 1L98A 1C6GA 2AHMA 1Z6TA 2LVQD 1IY0A 2DZLA 1IP4A 103LA 4EKPA 4GITA 3HUQA 4W51A 138LA 5KO3A 2QARC 2Z7JA 4DR4M 4U3XB 4HV2A 3L28A 122LA 4TWSA 3GPPA 3K92A 1IVMA 109LA 158LA 1R6BX 2A7FA 2ZAOA 2ZIKA 1LZ4A 2HEDA 4WLDA 1C62A 1N4FA 1LHMA 1CV6A 2JWSA 1L73A 2Y8PA 1LJNA 4LT0A 1L41A 3W0FA 3EXDA 4I0CA 3N9EA 4IBFA 1IWTA 4N9RA 1P37A 3QE8A 4WW0A 2MEAA 1YAQA 2RBNA 4PHIA 2DNAA 4B3RM 3R8FA 1LYGA 4LY6A 6LYZA 1LSEA 4GCCA 1GBZA 2X4AA 3WXTA 5II3A 1DQJC 3HHXA 3PNYA 2H9KA 4WM5A 3W6FA 1C6AA 1L70A 167LA 1H87A 5F9UA 4ZIXA 2XQOA 4CGEA 1YQVY 1GF7A 3G3XA 2LZMA 187LA 5EXSA 1LHJA 241LA 174LA 1HFYA 1LJ4A 2BQBA 1OTRA 4OW1A 1GDXA 209LA 3GLHB 4YXCA 4G49A 3LVWA 2EJSA 3I4VA 3CSZA 4J0LA 4B1AA 4DR2M 3NBXX 3B0IA 2M60A 1GE2A 1JJ0A 2CWIA 1GF8A 131LA 5AMYA 5IT9S 3KP1E 3GLGB 2LYOA 4PCZA 1JIYA 1I4WA 5KPZA 5KXWA 4P2EA 1B5XA 1TEWA 2HUMA 2RRUA 1G7HC 1K82A 1CKCA 2Z37A 1XGQC 3RGPA 1OFIA 1B2KA 1L81A 1B5YA 1D0KA 3D9AC 2B6TA 1GWDA 1BVXA 4NGIA 4YXAC 1C7YA 1HHLA 1L69A 3G3VA 1CU2A 1KNIA 1PJJA 3H4JA 2QPAA 217LA 1JISA 4L8RC 5ILCA 4BAPA 3BBZA 1LSDA 3W68A 3A3QA 3W6EA 4PJ2C 4I7NA 3SMPA 1IOQA 2GQFA 3VK8A 1GABA 1KIRC 2R18A 4GH9A 3UZUA 3C7ZA 3SFZA 1IN8A 110LA 1PQMA 3QYBA 5F3WA 3HDFA 3GUOA 3CT5A 1QZMA 4NGJA 2VQEM 4OOOA 4WM4A 1LJ3A 1CX7A 1JKCA 4XJHA 2MEFA 4QDNA 4Z6YA 3GUKA 4I7LA 1TH2A 193LA 1QAMA 4AI6A 3JR4A 1LJJA 3U60B 1LSPA 4XJBA 1L52A 1VDQA 4ETDA 2OE9X 4ET9A 4QOSA 3C8RA 249LA 5F81A 3AGGG 4DT3A 3WHKA 4IAPA 4AG6A 3KOWE 1L72A 1WQOA 5B59A 1W5SA 5LA5A 4GC5A 4DR1M 2MEGA 4L78A 2Q9DA 4DR3M 1T97A 1IXRC 1T6HA 1IWVA 2F2NA 1PQIA 1P2LA 4DDAA 4OWEA 154LA 2F4VM 1NV9A 3M18B 3FUTA 1L1TA 4HSFA 205LA 1LZNA 2XBSA 1G7JC 3J4GA 5F9XA 3E46A 3LQQA 1WGLA 1ZV1A 1LKSA 152LA 1FDLY 4R6CA 3V76A 1L40A 146LA 104LA 2YBIA 1GBOA 4M4OA 2WSEF 5EXXA 1T8AA 3HU3A 5M1YA 4P17A 2LVPC 1GB0A 2HCBA 4KO8A 2XH9A 3IJVA 2KDLA 4AXTA 3C8QA 4DUYM 4OVZA 2ZM6M 4XENA 3GUNA 1N34M 1C1KA 1IR8A 2B6XA 2Y0TA 3A46A 3Q8GA 230LA 1OFHA 4MGZE 1HC0A 4XADA 3ZVQB 4MGYE 2LHCA 3WW6A 1L1ZA 1LMAA 4CJ2A 3AGIA 2BQCA 4W57A 3K9PA 2I7NA 3AOEC 1YANA 3B9PA 4IJFA 1GF3A 2BQKA 1HMLA 4I81A 2CDSA 1IBLM 1ALCA 4WG1A 1QTCA 3VWOA 1NNJA 5A3ZA 2LZ2A 2FBBA 4HJVA 1T3PA 1L76A 4NWEA 1DYGA 3CDVA 5FDJA 5A2QS 3B0OA 1C61A 4OWCA 1GEZA 1C6TA 4LRTA 3A6CY 3B6LA 1GFUA 4NIJA 3G3WA 2DWMA 3C80A 3RUNA 3AW7A 5KXYA 4LZTA 1HSWA 1CKFA 1GFAA 3SB7A 2MEIA 1T3TA 4IBEA 1P2RA 1QTHA 4HLQA 1WQRA 3LN2A 4XJDA 184LA 3GLFB 1DYFA 1LOZA 4GCEA 3Q8XA 2KA6B 4HL4A 1L97A 2XTHA 3EMSA 5APCA 258LA 5FSWA 4PGJB 135LA 3B89A 1REXA 2JXNA 3HX3A 1AT5A 191LA 3OJPA 1Q3CA 5EP4A 1I1ZA 3HWLA 3OE9A 2EO2A 3DN0A 1QS9A 4I7RA 1C6BA 1WVUA 1DYBA 1IWWA 4LCBA 5FELA 1SWYA 1W08A 4EMNA 233LA 1LSZA 1G0KA 1QIOA 5D5CA 176LA 4CIZA 228LA 1B6IA 1Z55A 1XB2B 1CU0A 1LGUA 1L35A 4DDBA 1JTTL 5I54A 240LA 3NY8A 190LA 4NGVA 4L15A 1YILA 2VF8A 3U6EA 3PDSA 5C6IA 200LA 1A5TA 4NSGA 2YBLA 4I4LA 3KDSE 4ARLA 5LMUM 3B7ZA 4G3OA 4EKQA 3RZ4A 1XNRM 1LSGA 2DKVA 2W1MA 1QSQA 3FI7A 2QP9X 5KXLA 3W3EA 4H94A 172LA 4FCTA 1DGFA 4WMGA 2DAGA 4G4BA 4LDLA 1R4GA 238LA 4LGKA 1PJIA 5LVJA 1L03A 1GXXA 1L38A 1L43A 4LYOA 4Z41A 2Y20A 1JJ3A 4W54A 235LA 4MGIE 6LZMA 4NHPA 1L50A 199LA 1C6EA 4JI2M 7CATA 4GLAA 1JSEA 3HH4A 3CDTA 2B70A 2R45A 4B49A 1OJLA 2O25A 4DV1M 4JI1M 4LYZA 4C5FA 3CGWA 1T8FA 2F5QA 1JEFA 5LYZA 2XFTA 4GRVA 2CP8A 1BVSA 2JNHA 1GD6A 1SWZA 4CGYB 4Z46A 2L09A 2LVOC 4LJ8A 2R44A 2IHLA 3K2LA 2CGIA 1FKVA 2B7XA 4J1BA 4NFVA 4MM3B 2W1YA 4H8ZA 2DAMA 1L58A 1N78A 1C64A 4NG8A 1L25A 4XK8F 1G0QA 4DD9A 2LWXA 1L30A 1NJGA 5KXKA 4WLYA 219LA 1GB3A 1IOCA 3LMMA 3PNVA 2LYMA 2KEBA 2X49A 3B7NA 1FBIX 2BQDA 2B6ZA 133LA 4RLMA 5LAGA 3P65A 1I94M 1IN7A 2Z4SA 4HEOA 1L23A 1JHLA 1QT7A 1GBXA 2BPUA 4H90A 2MGWA 3ULRA 3T6PA 3FD9A 1K28A 4I8SA 1LGWA 3SBJA 1XSFA 2KZSA 4ETBA 1UIFA 4ETAA 4B0DA 2JA2A 1SX2A 2H5ZA 4NGYA 4B4JA 2ZYPA 4FW9A 1PQKA 4G6ZA 1HENA 1OWZA 5IDDA 2DHYA 1B7PA 1XWIA 2JZ1A 128LA 1QSAA 1HEWA 5GKNA 1XJUA 2LHMA 3E9SA 8CATA 165LA 1SSYA 3GLIB 4ZPXA 2HUBA 1C6LA 3SARA 2BJVA 1DPWA 4YX7C 5FSTA 1WTNA 1R2ZA 4WLTA 4IBDA 2C99A 4Q7JA 5DFLA 1L33A 4QNRA 4H9IA 3I4YA 3LZTA 4F1IA 1GFVA 3AL0C 1B7SA 3HUAA 1L89A 5FLXS 1IY1A 3IG8A 1GFTA 3L2AA 1WQQA 1D2YA 1BHZA 4I7QA 4KPMA 4YF2A 1IOSA 1WR1B 1L87A 4IJEA 1B5UA 4LJ9A 2YDGA 5J7CA 2YSSC 2BQHA 2OU8A 1LJEA 2UUBM 1CU5A 1E32A 119LA 1YAPA 5KXRA 4GHLA 2L6OA 1FNNA 4G4NA 1B7NA 1N32M 2W1XA 1V7SA 4HTQA 3OE8A 1LYEA 4LF5M 1VFBC 3W67A 1BGIA 2F5NA 3WPKA 169LA 1BWJA 3SN6R 3A45A 4DD3A 2B6YA 1YKYX 3U6DA 1JTOL 3MMPA 2C9OA 3FI5A 3WU7A 1VDDA 1QDRA 5EXTA 142LA 1C69A 1IP1A 3OE0A 1NKHA 4W59A 1DI3A 256LA 3GXRA 4N5RA 4NSIA 3SB8A 4MB7A 226LA 1GVNA 5LXWA 3OE6A 1WTHA 2IGCA 2Z18A 4GLVA 1L82A 1YKXX 4LF4M 2Z2EA 4LFBM 3AZ4A 1VDTA 2W1LA 2K6BA 1B5ZA 1HNLA 181LA 1BB6A 243LA 1L13A 5B06A 1L27A 4AKHA 4YEOA 1SXJD 1KSFX 1WJ7A 5FCPA 5KKJA 4GIPA 1LMCA 1GE1A 4L6V6 2L2DA 3HU1A 1YAMA 4H9AA 1SQ2L 4JI8M 3I04M 4LF9M 4S0WA 1N33M 1TDHA 1LHIA 3GRRA 3EBAB 4H1PA 2G4QA 1NJFA 3K1JA 3SBBC 4NC6A 1CV3A 3HFMY 1LV7A 4H9FA 3GQ5A 1L99A 3I51A 2Y21A 4Y28F 1HQCA 242LA 5KXNA 1BWIA 1SLYA 1WQPA 5LZMA 2L7IA 4HJZA 4LT3A 4W96A 2D91A 1L08A 1LSNA 3FADA 4WM2A 1WXQA 2O79A 1PZYA 3AZ5A 3RU5A 3SASA 170LA 1OUCA 5HMJA 1RFPA 3HT6A 4CFOA 1REZA 1LZ6A 3TXBA 3HBHA 2EKFA 1TBYA 4LRSA 4FJRA 2YR0A 1QS5A 4RF1A 4NRVA 4DV0M 4GN5C 3J81S 1AM7A 1GB7A 2B74A 1TLAA 1LI6A 2HEFA 5D5FA 5H37D 4MGHA 2CHGA 186LA 3WH1A 3KW6A 4XN6A 5DN4A 3T15A 2C5RA 1L66A 3KFUG 4LDEA 1IXSB 3ZQJA 145LA 196LA 1UFZA 3M6AA 1D3JA 1VEGA 1CNSA 4I7OA 222LA 3RW8A 229LA 2RB2X 4IBKA 4RDSA 1SXJA 1IP6A 5LVKA 1IC5Y 2DQCY 4NHSA 3DN4A 1PQDA 4DD1A 2HEAA 1NO1A 254LA 3L64A 2DXIA 134LA 3JR5A 1CUQA 1QQYA 132LA 5L3HA 5T3FA 4BBAA 1AKIA 4DQ5A 3WUMA 1IY4A 2CUZA 3TXIA 1CKDA 2WSCF 4YY3M 1IIZA 4DDCA 2BJWA 1L65A 4HPIA 4OU7A 118LA 2ZTDA 4REZA 2WZJA 3GPXA 1LZ5A 1GE3A 3W0LB 1LJGA 2WARA 4DQJA 4G4OA 1EE8A 5C6JA 3J80S 2OQ4A 178LA 1IP7A 1LMOA 1ORYB 4M9ZA 1YUBA 1LW9A 1V7TA 2MEHA 3DKEX 1LYDA 4J1AA 1L09A 1ZWNA 4DR7M 1OWYA 2EUCA 1J1XY 2ANVA 4JI6M 3J27B 247LA 2JY5A 1ZMVA 4NGLA 3U61B 139LA 5LVHA 2BQNA 3VK7A 4WO6A 1L01A 1R5LA 2R0IA 3KOXE 2ZQ4A 2OU0X 1MJGM 1UUZC 3E21A 3WYHA 1GF6A 4LJ7A 4ITQA 1VQ1A 2DAEA 3C58A 1XFPL 2FBDA 3DN1A 2I25L 2AUBA 5ITRA 1TTEA 4JI0M 1C43A 5KXOA 4KT0F 1TF0B 3N9AA 1GF9A 1L90A 2NTHA 1LYOA 4XYYA 1VEJA 4EKRA 1E8LA 4BAFA 3FTDA 4ARQB 2ZILA 3M3UA 1Z5CA 3HT7A 1O23A 1JTPL 2X0AA 3GLGA 1PQOA 2VF7A 3DMVA 4X3BA 1C10A 1OP9B 4N1EI 2ERCA 1JR3A 164LA 1F0WA 1NHEA 1YE9A 253LA 2RB0X 1UIEA 4UWUA 180LA 2KXEA 1AZFA 1BB3A 2F2QA 3GUIA 3DN2A 1LZRA 2DAIA 2M5ZA 227LA 1LJHA 5L3IA 4ETCA 1T6OA 3HTFA 5KXMA 1C6FA 3A8ZA 4CHTB 1HR0M 1B9OA 4RW2A 1MLCE 2BQEA 4PRUA 4KODA 4II7A 1OUDA 1K3WA 4IBGA 3DFZA 2XSZD 259LA 4B3SM 4BS7A 1LZDA 1G1WA 4PPOA 3A95A 4R7GA 4LGMA 3SYKA 166LA 1L93A 1QUGA 1JQJC 1G06A 3GP1A 1QT4A 1OUJA 4H8YA 2DWLA 1OUFA 3IG5A 2JUJA 3EIHA 1C63A 1YIKA 2FYCA 1IY3A 4NSOB 1CKHA 2HWJA 2YBJA 1IX0A 3GRYA 2CV0A 1J1PY 1G0LA 1LHLA 2Z19A 2RBRA 1NY6A 2BQIA 2G5GX 4NGWA 3F8VA 3VDUA 4LFXA 1RE2A 2C8PA 1NVMA 4I7MA 1LYYA 4X66M 252LA 4DQ7A 1IP2A 1CJ7A 1L02A 1L91A 4I5SA 2L4EA 5E6JA 126LA 1IWZA 1LZBA 1YL1X 3T6UA 2HULA 1LSBA 1LJFA 1CTWA 3J6KA 5IHGA 1HQYE 1V34A 1G59A 2KZUA 159LA 1G7IC 1LLHA 4QY9A 1L55A 3TXHA 4I8OA 2OEAX 1L0JA 2VB1A 3CF2A 2OOAA 1NQIA 1GXV2 1DGBA 1IO5A 3K3TA 4IIWA 5F14A 4M0WA 3SYLA 1CKGA 2G3QA 3HUKA 2B3TA 1DKKA 2QNJA 3HBDA 185LA 3SAUA 234LA 4XGIA 130LA 2JY8A 1UCOA 4ML7A 1KXWA 4KXIA 1REMA 3HH5A 5ITXA 1L88A 3U6MA 1KW7A 4FDYA 2F4GA 1IC7Y 4LJ4A 1DXJA 3ATOA 1CVKA 3QAKA 2XSZA 1HERA 2EA0A 1W6ZA 3DN6A 2CV1A 3WULA 3WVYA 1WGNA 1QTDA 3TWMA 4ET8A 1PQJA 3W6DA 173LA 4KL7A 1B5VA 4LZJA 1C6MA 3FYDA 3TMVA 5I4WA 7LYZA 4LFCM 3ZVQA 1JKAA 3CTWB 127LA 4WM6A 3L27A 2BQFA 1HNWM 1QUDA 2FNAA 1V33A 3FUUA 5APFA 1OKSA 4GHAA 1LZ8A 2YBNA 2E5LM 4B4IA 4XBOA 1DV0A 114LA 182LA 1GHLA 2XBRA 4KLNA 3L26A 4GRIA 2KRKA 2G4NA 4UN2B 1IXZA 2V6ZM 2YFQA 3FRIA 1LZ1A 2RSCA 3OK0A 1UACY 224LA 1CU6A 4PJZA 3HT9A 4W5WA 3M7GA 3TL4X 1C6PA 2DQGY 3T36A 1GPQC 1F6RA 1L84A 2OOBA 1H6MA 1L71A 4L16A 3GLFA 2OPFA 1LTMA 2VIIA 5L8RF 2BWBA 4NOOB 2DI0A 1L47A 3DMZA 5HLLA 4LYTA 4M0DA 3DOAA 3A92A 3B0KA 3C3EA 3HU8A 1VG5A 2Q0MX 4LJ5A 1OVKA 1LMQA 1DKJA 1BB5A 3HH3A 2D4IA 3KOYE 3FTEA 4WLXA 2LBCA 1ZMWA 4NSHA 3HJ8A 257LA 4OW0A 3FUWA 3GQ3A 1LPYA 2UU9M 2H9JA 1C6NA 4CHXA 2L7HA 4IBJA 3FA0A 1L49A 1XJTA 2R4EA 4WP2A 1GE4A 2GNOA 3A93A 1GFKA 4HP0A 1G3IA 4WG7A 4OOTA 2I26L 5HNCA 2RBPA 3AB6A 1JB0F 2ZNWY 2YVBA 4UWVA 245LA 1L92A 2C8OA 1L2CA 3A6BY 2DVWB 2Q2EB 1J09A 4AZFA 1IR9A 4HJYA 3LZMA 1C6DA 1L06A 1QT8A 3FUXA 3D4SA 1DZBX 5EP3A 3HTBA 4B7HA 2QBYA 156LA 4TUWA 1D3FA 1EQ5A 3TXKA 2HKJA 3GXKA 1C67A 1JKBA 2C98A 2EIZC 1G0PA 1L77A 1LSFA 1QT3A 115LA 2LCBA 2L78A 1L29A 1L85A 1LZGA 4ZEEA 4DV6M 3EO5A 1L61A 1XGPC 3LYMA 3WU8A 5LYMA 1L22A 1LMNA 2BQOA 1LZAA 3A42A 1LZSA 3HWSA 3QAUA 1PS5A 4OWHA 5HNLA 4B3MM 1T6VL 2HTXA 3F9LA 1LAAA 1LJIA 2GV0A 1CX6A 5JI2E 1L56A 1UBZA 1UICA 1J7KA 4MSTA 3AKZA 1JWRA 3HHYA 220LA 1QSWA 4LZZA 1HJPA 1L59A 4P16A 1DGHB 3D3DA 1BVKC 2RGOA 1GAZA 1L53A 3ZH9B 3WMKA 3GRUA 3A98B 2ZQ3A 1AUAA 1GLNA 5DL9A 3T38A 1C6JA 1L0KA 1L39A 4GN3A 198LA 1YL0X 1CJ6A 4EIWA 1L8QA 1PM5A 2D4KA 3CF6E 1GL7A 1PJSA 2EKSC 2ZTCA 1J5EM 4L4UA 143LA 262LA 5KPTA 4G4CA 2RH1A 3AGHA 5HMVA 5LYTA 1IP5A 1BB7A 1I6SA 1G7LC 1HEPA 1EFUB 3EIEA 2Z12A 1LCNA 1D3NA 1XGTC 1QUSA 3C82A 5IZ7D 2LNHC 2OU9A 2HU1A 108LA 4H9CA 2JZ0A 5KPRA 244LA 4MGKE 3HHZA 3BKVA 3L25A 1P7SA 1SX7A 3BKHA 3WXUA 4FWDA 3AV0A 3A34A 4I7TA 1OYUA 2F47A 1L95A 2J7OA 1XGUC 4X65M 5LIOA 1OAIA 1KXYA 1NHBA 3HHWA 3FKEA 1QUHA 3AJIB 3KVWA 4R3DA 1TR8A 1P6YA 3C7YA 1QZEA 2F4AA 4B3TM 1L05A 1L46A 3K9OA 120LA 3E4RA 2DAKA 3HTDA 4GBRB 4YEMA 1LYIA 4EKSA 1YLAA 1YSYA 4QHSA 4IASA 4KHPM 3U5ZB 1S3SA 1VEDA 3DN8A 1JTNA 2R65A 1VDLA 1N77A 2FFJA 1KXXA 1HEQA 5EXPA 4DYGA 1Z5BA 2MEEA 3E3DA 2A7DA 4NGZA 1P3NA 1XXHE 3RT5X 5EQTA 4QEQA 1L67A 1L37A 1QUTA 3KS8A 1QDTA 2HHHM 1UIGA 4XJIA 4NHIA 4OWBA 1REYA 3SHFA 4N0JA 4N1CC 3RFWA 1D6QA 4Z8XA 4GMQA 3M0EA 1E9RA 4GCBA 4NRWA 1GDWA 1JUGA 4ARMB 2FE8A 260LA 3I01M 2EPEA 141LA 1L75A 3HTGA 1CV5A 3TMUA 4G4QA 4LJ6A 1IP3A 3TMXA 3HT8A 1LJKA 1HSXA 1QTZA 2DQEY 1SXJC 1DYAA 3C9PA 4DV7M 3HDEA 1OVHA 1VDPA 3LYTA 2LVNC 4AG5A 1HFXA 1C65A 2B75A 3A96A 1B5WA 1DYCA 1KS3A 1GB8A 3AOGA 1LHKA 1XXHA 5IWAM 3CDQA 1GJSA 4MCKA 3UK6A 1WVVA 2J5YA 1CUPA 2C96A 1GJTA 5KQDA 2P5TA 1GB9A 147LA 4G4HA 1L48A 5FTJA 1L10A 1D3MA 3TWLA 2MR9A 2B72A 4G9SA 1NSFA 4LFAM 3C8SA 153LA 3FE3A 1MU5A 1C6HA 3AZ6A 1P2CC 3UGJA 2HU3A 3HU2A 1BWHA 5B05A 1MX0A 1OUBA 5HQ1A 3WPJA 1D0LA 4AGAA 4NSJA 1L83A 2BAAA 2G4PA 1F10A 2DZNB 3H4MA 5FTLA 3ILKA 5C6LA 4M9XA 1B7LA 1XMOM 2OE4X 1XMQM 3WW5A 1TAYA 2O5RA 2QB0B 1EIJA 1YAOA 5KXSA 3U6QA 3LHMA 1PJTA 212LA 4LFPA 2DKLA 4A7DA 2CUUA 236LA 2ZWBA 1DI4A 5FEKA 2W82A 1IC4Y 1SXJE 3CT0A 5KY1A 4LGYA 1C6QA 3PFIA 4EJ4A 1LZCA 210LA 2HAKA 1L45A 5KJ9A 1CUKA 246LA 3C83A 3JR6A 1UIBA 2Z8YM 2DQJY 1GB2A 3SATA 2Z38A 4AKIA 3AFHA 3RNXA 2H5XA 1QT6A 3CDRA 175LA 1LPIA 3G3AB 1XGRC
chains in the Genus database with same CATH topology
3CQLA 1JJ1A 1RCMA 1A2YC 221LA 1DI5A 3GUPA 3NYAA 3AJNA 2EQLA 1OUIA 4NHTA 1DPXA 4AQNA 112LA 2MEDA 4GN4A 1ZVYB 1GF5A 3IWRA 1INUA 1G0MA 151LA 1G0GA 5I14A 1L24A 5A3EA 2BQGA 4XJGA 1NMMA 1C6KA 188LA 192LA 2XJWA 3TXGA 1L57A 207LA 1UIHA 3A3RX 2DQDY 1EQ4A 1OUGA 2B6WA 1UA6Y 1G7MC 1LWGA 1IWUA 1QTEA 1LMPA 3CB7A 3CSQA 3W6CA 5LVGA 4H9HA 2BQLA 5LAFA 1IOTA 2CJLA 4NEBA 4L41A 2DQFC 1FN5A 4WO9A 3P64A 1HFZA 1L16A 261LA 4I7PA 223LA 2LC9A 1QTKA 1ZYTA 4WOAA 1L17A 1LYSA 144LA 1TDYA 2RAYX 2YBHA 1C6CA 4Z3MA 5DM9A 4W55A 4ARQA 4YM8A 1IEEA 4ANRA 1D6PA 4W94A 3B72A 4K5YA 3PBLA 5E9RA 1OUHA 102LA 3K2RA 5E4PA 1P46A 1J1OY 3WVXA 1L62A 4I7KA 2DQIY 4DWXA 2D4JA 1L80A 1HEMA 1KIPC 1XEKA 1JITA 3P68A 1L54A 3A90A 2RBQA 4Z98A 2NTGA 2OE7X 1JKDA 2ANXA 3SBAA 1A4VA 2BLYA 1NDMC 1C45A 1L64A 2RBOA 215LA 3L2XA 2D6BA 1WTMA 4KT3A 5ILFA 3QNGA 2O4WA 4LDOA 3CDOA 2ZIJA 4C3WA 1L07A 1FLUA 3DNAA 3A67Y 1NDGC 1GFEA 3WUAA 3WU9A 1L74A 5FHWA 5KXTA 4EPIA 1EQEA 4N8ZA 4NY5A 3TMWA 2BLXA 3W6AA 1LYJA 1C60A 3DN3A 1EL1A 1JQUA 1UIAA 3ATNA 3MGWA 3AZ7A 1ZVHL 1L28A 2RAZX 5B1GA 1B7MA 4D9ZA 1G1VA 1L04A 2B5ZA 1L42A 3QY4A 1LZTA 1FLYA 3WL2A 4I7JA 1EPYA 201LA 1LSYA 1GB6A 2IFFY 1LZYA 1C7PA 1L12A 2MEBA 2LYZA 5I5QA 107LA 5L9JA 2LZTA 2PC2A 3IJUA 1CV4A 225LA 150LA 5B1FA 1KIQC 157LA 4ETEA 2Z39A 213LA 1L19A 189LA 2ZNXY 5EBHA 1HMKA 1OQMA 3C81A 1IR7A 1LYZA 1VATA 1VAUA 194LA 1L51A 2Q9EA 1LI3A 197LA 5IELA 250LA 1D2WA 4QGZA 1KY1A 4W53A 232LA 123LA 4HTKA 1GFJA 5K7OA 1CJ9A 1L26A 4RLNA 3W6BA 4GCFA 2F30A 4TSCA 163LA 1GE0A 1KW5A 4NGKA 4NGOA 4ARPA 1YKZX 2B73A 3RZEA 4DD2A 171LA 4LYCA 4DKLA 1D9UA 2ZYCA 160LA 3P4ZA 4W58A 4DAJA 140LA 1L96A 1GBWA 1QTBA 3A91A 1BQLY 1B7OA 2Z2FA 4LT1A 3GUMA 4WL6A 2RB1X 4TUNA 1LWKA 2O7AA 149LA 1D9WA 1FKQA 1OUAA 1L63A 4WM1A 3N9CA 3HBEX 3NY9A 1VDSA 1CJ8A 5APEA 1MELL 7LZMA 4O34A 4PK0A 1SSWA 1UIDA 177LA 4II8A 1XEPA 1L86A 1TCYA 1L32A 1HEOA 4EOFA 4HTNA 4OWAA 1LGXA 2BQJA 231LA 5LA8A 1FLQA 4TTDA 248LA 9LYZA 1DYDA 237LA 183LA 5KXZA 2BQAA 111LA 3LYZA 1GEVA 5B07A 1GB5A 4IJ4A 1B7QA 1ZURA 4E97A 1YROA 3GUJA 2MECA 155LA 2OTYX 206LA 2BQMA 1L94A 4GCDA 4H9EA 4HPEA 1LKRA 1LSMA 3LZ2A 4LT2A 113LA 2A4TA 1L15A 1L14A 1T8GA 4XJFA 4NWHA 4YENA 1B0DA 2N5ZA 3SB6A 218LA 1L21A 1KY0A 1UC0A 3CT1A 4M6DA 1LMTA 129LA 5I4XA 4H9BA 1LZ9A 1GBSA 1WQMA 1JTMA 1C46A 1L44A 3TXEA 3TXJA 4HV1A 1C08C 1GFGA 3HH6A 4W56A 1NBZC 3G3BB 4H91A 3DMXA 4LYBA 3V2WA 3P66A 2I6ZA 5KXXA 1P5CA 3F6ZA 4TX7A 1NF5A 1LI2A 1XEJA 4BADA 1B7RA 2YBMA 1LYFA 1P64A 1RJCB 1QTVA 1NBYC 1QT5A 3SB9A 4H8XA 4ARJA 4MR1A 1P56A 1FLWA 3VW7A 2FYDA 4LYMA 3EMLA 137LA 4DD7A 2OTZX 168LA 3C7WA 3AYQA 2Z6BA 3SP3A 1I20A 148LE 5JENB 1OV7A 2DQHY 5F16A 3KAMA 1IWYA 3CSRA 1IORA 3GULA 4PRQA 1L68A 3WUNA 4ARMA 211LA 5APDA 1L00A 1L18A 3TXFA 1L79A 5LINA 255LA 1OV5A 1GBYA 3FE0A 5DLAA 4DD0A 3AW6A 3LYOA 1RI8B 1NWGA 1F6SA 4E3UA 208LA 2DQAA 5I53A 4H92A 1GAYA 1JSFA 1L36A 5I4YA 2HEBA 1L34A 5LVIA 1L20A 3TXDA 216LA 4ZFPA 4DJHA 4TSBA 251LA 2HECA 4R0FA 3ODUA 4NHQA 4ZPUA 4LZMA 1QUOA 4H93A 8LYZA 1LSAA 1CV1A 4I7SA 1G0JA 1DYEA 5KXPA 4EPFA 2HUKA 4WL7A 1QSBA 1L11A 5KKIA 161LA 1IWXA 1C66A 4UWNA 1ZV5L 1OUEA 125LA 2RBSA 6LYTA 1LSCA 162LA 1GFHA 4IATA 4B4EA 1GF4A 3A94A 3WPLA 2HEEA 1CV0A 1I56A 2NWDX 4NG1A 4W52A 1HF4A 1JPOA 3ZEKA 214LA 4OO9A 1WQNA 1LHHA 1OVJA 1GF0A 1L60A 1CU3A 239LA 4WM3A 1D0MA 1L31A 1AT6A 1XEIA 4DC4A 1LYHA 1G07A 3SB5A 1LZEA 1GFRA 1C68A 3UONA 1P36A 2F32A 1C6IA 4YOPA 5DN5A 3V2YA 1BB4A 4EXMA 1ZMYL 4J7VA 4CFPA 195LA 2DBTA 4RW1A 1HELA 3HU9A 1L98A 1C6GA 1IP4A 103LA 4EKPA 3HUQA 4W51A 138LA 2QARC 4U3XB 4HV2A 122LA 4TWSA 1IVMA 109LA 158LA 2A7FA 2ZIKA 1LZ4A 2HEDA 4WLDA 1C62A 1N4FA 1LHMA 1CV6A 1L73A 2Y8PA 1LJNA 4LT0A 1L41A 3EXDA 4I0CA 3N9EA 1IWTA 4N9RA 1P37A 3QE8A 2MEAA 1YAQA 2RBNA 4PHIA 1LYGA 6LYZA 1LSEA 4GCCA 1GBZA 3WXTA 5II3A 1DQJC 2H9KA 4WM5A 3W6FA 1C6AA 1L70A 167LA 1H87A 5F9UA 4ZIXA 2XQOA 4CGEA 1YQVY 1GF7A 3G3XA 2LZMA 187LA 1LHJA 241LA 174LA 1HFYA 1LJ4A 2BQBA 4OW1A 1GDXA 209LA 4YXCA 4G49A 3CSZA 4J0LA 4B1AA 3B0IA 1GE2A 1JJ0A 2CWIA 1GF8A 131LA 5AMYA 2LYOA 1JIYA 5KXWA 4P2EA 1B5XA 1TEWA 2HUMA 1G7HC 1CKCA 2Z37A 1XGQC 1B2KA 1L81A 1B5YA 1D0KA 3D9AC 2B6TA 1GWDA 1BVXA 4NGIA 4YXAC 1HHLA 1L69A 3G3VA 1CU2A 1KNIA 217LA 1JISA 5ILCA 4BAPA 1LSDA 3A3QA 3W6EA 4PJ2C 4I7NA 1IOQA 1KIRC 3C7ZA 110LA 1PQMA 3HDFA 3GUOA 3CT5A 4NGJA 4OOOA 4WM4A 1LJ3A 1CX7A 1JKCA 4XJHA 2MEFA 4QDNA 3GUKA 4I7LA 193LA 1LJJA 1LSPA 4XJBA 1L52A 1VDQA 4ETDA 2OE9X 4ET9A 3C8RA 249LA 5F81A 3AGGG 4DT3A 4IAPA 1L72A 1WQOA 5B59A 5LA5A 2MEGA 2Q9DA 1T97A 1T6HA 1IWVA 2F2NA 1PQIA 1P2LA 4DDAA 4OWEA 154LA 3M18B 4HSFA 205LA 1LZNA 2XBSA 1G7JC 3J4GA 5F9XA 1LKSA 152LA 1FDLY 4R6CA 1L40A 146LA 104LA 2YBIA 1GBOA 4M4OA 1T8AA 5M1YA 1GB0A 3IJVA 4AXTA 3C8QA 4XENA 3GUNA 1IR8A 2B6XA 230LA 1HC0A 4XADA 3ZVQB 3WW6A 1LMAA 4CJ2A 3AGIA 2BQCA 4W57A 1YANA 1GF3A 2BQKA 1HMLA 2CDSA 1ALCA 4WG1A 1QTCA 3VWOA 5A3ZA 2LZ2A 2FBBA 4HJVA 1T3PA 1L76A 4NWEA 1DYGA 3CDVA 5FDJA 3B0OA 1C61A 4OWCA 1GEZA 1C6TA 3A6CY 3B6LA 1GFUA 4NIJA 3G3WA 3C80A 3RUNA 3AW7A 5KXYA 4LZTA 1HSWA 1CKFA 1GFAA 3SB7A 2MEIA 1P2RA 1QTHA 1WQRA 3LN2A 4XJDA 184LA 1DYFA 1LOZA 4GCEA 1L97A 2XTHA 3EMSA 5APCA 258LA 4PGJB 135LA 1REXA 1AT5A 191LA 3OJPA 1I1ZA 3HWLA 3OE9A 3DN0A 1QS9A 4I7RA 1C6BA 1WVUA 1DYBA 1IWWA 5FELA 1SWYA 1W08A 4EMNA 233LA 1LSZA 1G0KA 1QIOA 5D5CA 176LA 228LA 1B6IA 1Z55A 1LGUA 1CU0A 1L35A 4DDBA 1JTTL 5I54A 240LA 3NY8A 190LA 4NGVA 1YILA 3PDSA 5C6IA 200LA 4NSGA 2YBLA 4ARLA 4EKQA 3RZ4A 2DKVA 1LSGA 2W1MA 1QSQA 3FI7A 5KXLA 3W3EA 4H94A 172LA 4WMGA 4G4BA 4LDLA 238LA 4LGKA 5LVJA 1L03A 1GXXA 1L38A 1L43A 4LYOA 4Z41A 1JJ3A 4W54A 235LA 6LZMA 4NHPA 1L50A 199LA 1C6EA 4GLAA 1JSEA 3HH4A 3CDTA 2B70A 4B49A 4LYZA 4C5FA 1T8FA 1JEFA 5LYZA 4GRVA 1GD6A 1SWZA 4Z46A 2IHLA 2CGIA 1FKVA 2B7XA 4J1BA 4NFVA 2W1YA 4H8ZA 1L58A 1C64A 4NG8A 1L25A 1G0QA 4DD9A 1L30A 5KXKA 4WLYA 219LA 1GB3A 1IOCA 2LYMA 1FBIX 2BQDA 2B6ZA 133LA 4RLMA 5LAGA 3P65A 1L23A 1JHLA 1QT7A 1GBXA 2BPUA 4H90A 3ULRA 1K28A 4I8SA 4ETBA 1LGWA 1XSFA 1UIFA 4ETAA 4B0DA 1SX2A 2H5ZA 4NGYA 4B4JA 2ZYPA 1PQKA 1HENA 1OWZA 5IDDA 1B7PA 128LA 1QSAA 1HEWA 1XJUA 2LHMA 165LA 1SSYA 2HUBA 1C6LA 1DPWA 4YX7C 5FSTA 1WTNA 4WLTA 1L33A 4H9IA 3LZTA 1GFVA 1B7SA 3HUAA 1L89A 1GFTA 1WQQA 1D2YA 1BHZA 4I7QA 4KPMA 4YF2A 1IOSA 1L87A 1B5UA 2YDGA 5J7CA 2YSSC 2BQHA 2OU8A 1LJEA 1CU5A 1YAPA 119LA 5KXRA 1B7NA 2W1XA 1V7SA 4HTQA 3OE8A 1LYEA 1VFBC 1BGIA 3WPKA 169LA 1BWJA 3SN6R 4DD3A 2B6YA 1YKYX 1JTOL 3FI5A 3WU7A 1QDRA 142LA 1C69A 1IP1A 3OE0A 1NKHA 4W59A 1DI3A 256LA 3GXRA 4N5RA 4NSIA 3SB8A 226LA 5LXWA 3OE6A 1WTHA 2IGCA 2Z18A 4GLVA 1L82A 1YKXX 2Z2EA 3AZ4A 1VDTA 2W1LA 1B5ZA 1HNLA 181LA 1BB6A 243LA 1L13A 5B06A 1L27A 4YEOA 5FCPA 5KKJA 1LMCA 1GE1A 1YAMA 4H9AA 1SQ2L 4S0WA 1LHIA 3EBAB 4H1PA 2G4QA 3SBBC 1CV3A 3HFMY 4H9FA 1L99A 242LA 5KXNA 1BWIA 1SLYA 1WQPA 5LZMA 4HJZA 4LT3A 4W96A 2D91A 1L08A 1LSNA 3FADA 4WM2A 2O79A 1PZYA 3AZ5A 3RU5A 170LA 1OUCA 5HMJA 1RFPA 3HT6A 4CFOA 1REZA 1LZ6A 3TXBA 3HBHA 1TBYA 4FJRA 1QS5A 4GN5C 1AM7A 1GB7A 2B74A 1TLAA 1LI6A 2HEFA 5D5FA 186LA 3WH1A 4XN6A 5DN4A 1L66A 4LDEA 145LA 196LA 1D3JA 1CNSA 4I7OA 222LA 3RW8A 229LA 2RB2X 4RDSA 1IP6A 5LVKA 1IC5Y 2DQCY 4NHSA 3DN4A 1PQDA 4DD1A 2HEAA 254LA 3L64A 1CUQA 134LA 1QQYA 132LA 5L3HA 5T3FA 4DQ5A 1AKIA 3WUMA 1IY4A 3TXIA 1CKDA 4DDCA 1IIZA 1L65A 4HPIA 118LA 1LZ5A 1GE3A 1LJGA 2WARA 4DQJA 5C6JA 178LA 1IP7A 1LMOA 3DKEX 1LW9A 1V7TA 2MEHA 1LYDA 4J1AA 1L09A 1ZWNA 1OWYA 1J1XY 2ANVA 247LA 4NGLA 139LA 5LVHA 2BQNA 4WO6A 1L01A 2ZQ4A 2OU0X 1UUZC 3WYHA 1GF6A 1XFPL 2FBDA 3DN1A 2I25L 2AUBA 1C43A 5KXOA 3N9AA 1GF9A 1L90A 2NTHA 1LYOA 4XYYA 4EKRA 1E8LA 4BAFA 4ARQB 2ZILA 3M3UA 3HT7A 1O23A 1JTPL 2X0AA 1PQOA 3DMVA 4X3BA 1C10A 1OP9B 4N1EI 164LA 1F0WA 1NHEA 253LA 2RB0X 1UIEA 4UWUA 180LA 1AZFA 1BB3A 2F2QA 3GUIA 3DN2A 1LZRA 227LA 1LJHA 5L3IA 4ETCA 3HTFA 5KXMA 1C6FA 3A8ZA 1B9OA 4RW2A 1MLCE 2BQEA 4PRUA 1OUDA 259LA 4BS7A 1LZDA 1G1WA 4PPOA 3A95A 166LA 1L93A 1QUGA 1G06A 1QT4A 1OUJA 4H8YA 1OUFA 1YIKA 1C63A 2FYCA 1IY3A 1CKHA 2YBJA 1IX0A 1J1PY 1G0LA 1LHLA 2Z19A 2RBRA 2BQIA 4NGWA 3F8VA 4LFXA 1RE2A 2C8PA 4I7MA 1LYYA 252LA 4DQ7A 1IP2A 1CJ7A 1L02A 1L91A 126LA 1IWZA 1LZBA 1YL1X 3T6UA 2HULA 1LSBA 1LJFA 1CTWA 3J6KA 5IHGA 1G7IC 159LA 1LLHA 4QY9A 1L55A 3TXHA 2OEAX 1L0JA 2VB1A 1NQIA 1GXV2 1IO5A 3K3TA 5F14A 1CKGA 3HUKA 1DKKA 3HBDA 185LA 234LA 130LA 1UCOA 4ML7A 1KXWA 4KXIA 1REMA 3HH5A 1L88A 1KW7A 4FDYA 2F4GA 1IC7Y 1DXJA 3ATOA 1CVKA 3QAKA 1HERA 1W6ZA 3DN6A 3WULA 3WVYA 1QTDA 4ET8A 1PQJA 3W6DA 173LA 4KL7A 1B5VA 1C6MA 5I4WA 3TMVA 7LYZA 3ZVQA 1JKAA 127LA 4WM6A 2BQFA 1QUDA 5APFA 1LZ8A 2YBNA 4B4IA 114LA 182LA 1GHLA 2XBRA 2G4NA 1LZ1A 2RSCA 3OK0A 1UACY 224LA 1CU6A 4PJZA 3HT9A 1C6PA 2DQGY 3T36A 1GPQC 1F6RA 1L84A 1H6MA 1L71A 1LTMA 1L47A 3DMZA 5HLLA 4LYTA 3A92A 3B0KA 3HU8A 2Q0MX 1OVKA 1LMQA 1DKJA 1BB5A 3HH3A 2D4IA 4WLXA 4NSHA 257LA 1LPYA 2H9JA 1C6NA 4CHXA 3FA0A 1L49A 1XJTA 1GE4A 3A93A 1GFKA 4HP0A 4WG7A 4OOTA 2I26L 5HNCA 2RBPA 3AB6A 2ZNWY 2YVBA 4UWVA 245LA 1L92A 2C8OA 3A6BY 4HJYA 1IR9A 3LZMA 1C6DA 1L06A 1QT8A 3D4SA 1DZBX 3HTBA 156LA 1D3FA 1EQ5A 3TXKA 3GXKA 1C67A 1JKBA 2EIZC 1G0PA 1L77A 1LSFA 1QT3A 115LA 2LCBA 2L78A 1L29A 1L85A 1LZGA 4ZEEA 3EO5A 1L61A 1XGPC 3LYMA 3WU8A 5LYMA 1L22A 1LMNA 2BQOA 1LZAA 1LZSA 4OWHA 1PS5A 5HNLA 1T6VL 2HTXA 3F9LA 1LAAA 1LJIA 2GV0A 1CX6A 1L56A 1UBZA 1UICA 4MSTA 1JWRA 220LA 1QSWA 1L59A 3D3DA 1BVKC 1GAZA 1L53A 3WMKA 2ZQ3A 5DL9A 1C6JA 4GN3A 1L0KA 1L39A 198LA 1YL0X 1CJ6A 2D4KA 2EKSC 143LA 262LA 4G4CA 2RH1A 3AGHA 5HMVA 5LYTA 1IP5A 1BB7A 1I6SA 1G7LC 1HEPA 2Z12A 1LCNA 1D3NA 1XGTC 1QUSA 3C82A 2OU9A 2HU1A 108LA 4H9CA 244LA 3BKVA 1P7SA 1SX7A 3BKHA 3WXUA 3A34A 4I7TA 1OYUA 2F47A 1L95A 1XGUC 5LIOA 1KXYA 1NHBA 1QUHA 1P6YA 3C7YA 2F4AA 1L05A 1L46A 120LA 3HTDA 4GBRB 4YEMA 1LYIA 4EKSA 4IASA 1VEDA 3DN8A 1JTNA 1KXXA 1HEQA 4DYGA 2MEEA 3E3DA 2A7DA 4NGZA 1P3NA 3RT5X 4QEQA 1L67A 1L37A 1QUTA 1UIGA 1QDTA 4XJIA 4NHIA 4OWBA 1REYA 4N0JA 4N1CC 1D6QA 4GCBA 1GDWA 1JUGA 4ARMB 260LA 2EPEA 141LA 1L75A 3HTGA 1CV5A 3TMUA 1IP3A 3TMXA 3HT8A 1LJKA 1HSXA 1QTZA 2DQEY 1DYAA 3HDEA 1OVHA 1VDPA 3LYTA 1HFXA 1C65A 2B75A 3A96A 1B5WA 1DYCA 1KS3A 1GB8A 1LHKA 3CDQA 4MCKA 1WVVA 1CUPA 1GB9A 147LA 4G4HA 1L48A 1L10A 1D3MA 2B72A 4G9SA 3C8SA 153LA 1C6HA 3AZ6A 1P2CC 2HU3A 1BWHA 5B05A 1OUBA 5HQ1A 3WPJA 1D0LA 4AGAA 4NSJA 1L83A 2BAAA 2G4PA 1F10A 5C6LA 1B7LA 2OE4X 3WW5A 1TAYA 2QB0B 1YAOA 5KXSA 3LHMA 212LA 4LFPA 4A7DA 2CUUA 236LA 2ZWBA 1DI4A 5FEKA 1IC4Y 3CT0A 5KY1A 1C6QA 4EJ4A 1LZCA 210LA 5KJ9A 1L45A 246LA 3C83A 3JR6A 1UIBA 2DQJY 1GB2A 2Z38A 3RNXA 1QT6A 3CDRA 175LA 1LPIA 3G3AB 1XGRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HMV A;  3LN2 A;  3CQL A;  4XJD A;  5LYT A;  1JJ1 A;  4BS7 A;  1LOZ A;  1LZD A;  1RCM A;  2FYD A;  3A95 A;  4GCE A;  1A2Y C;  2XTH A;  1DI5 A;  3EMS A;  4PPO A;  5APC A;  4LYM A;  3AJN A;  135L A;  4PGJ B;  1REX A;  2EQL A;  1AT5 A;  4DD7 A;  1OUI A;  1OUJ A;  4H8Y A;  1OUF A;  3OJP A;  1I1Z A;  3AYQ A;  3SP3 A;  1I20 A;  1YIK A;  4NHT A;  1DPX A;  2FYC A;  1IY3 A;  5JEN B;  2MED A;  4GN4 A;  1ZVY B;  1GF5 A;  2DQH Y;  1CKH A;  3IWR A;  2YBJ A;  1INU A;  1IX0 A;  1J1P Y;  1WVU A;  1LHL A;  2Z19 A;  1IWW A;  5FEL A;  2BQI A;  1W08 A;  5F16 A;  3KAM A;  4EMN A;  4NGW A;  1LSZ A;  1IWY A;  3CSR A;  1IOR A;  1QIO A;  1RE2 A;  4LFX A;  5D5C A;  2C8P A;  4PRQ A;  5A3E A;  2BQG A;  1LYY A;  3WUN A;  4XJG A;  1NMM A;  1Z55 A;  1IP2 A;  2XJW A;  1CJ7 A;  5I54 A;  4DDB A;  1JTT L;  5APD A;  3TXG A;  4NGV A;  1YIL A;  1IWZ A;  1LZB A;  1YL1 X;  3TXF A;  207L A;  3T6U A;  5C6I A;  1UIH A;  1LSB A;  5LIN A;  1LJF A;  3A3R X;  3J6K A;  4NSG A;  2DQD Y;  2YBL A;  5IHG A;  1EQ4 A;  1G7I C;  1GBY A;  4QY9 A;  3FE0 A;  5DLA A;  4DD0 A;  1OUG A;  3TXH A;  2VB1 A;  3AW6 A;  1NQI A;  3LYO A;  1GXV 2;  1IO5 A;  1UA6 Y;  3K3T A;  3RZ4 A;  2DKV A;  1LSG A;  1G7M C;  5F14 A;  2W1M A;  1CKG A;  1RI8 B;  3FI7 A;  1DKK A;  5KXL A;  1IWU A;  1QTE A;  1LMP A;  3CB7 A;  3CSQ A;  3HBD A;  3W3E A;  3W6C A;  1NWG A;  4H94 A;  5LVG A;  4H9H A;  1F6S A;  4E3U A;  208L A;  4WMG A;  1UCO A;  4ML7 A;  2DQA A;  1KXW A;  2BQL A;  4KXI A;  5I53 A;  1REM A;  5LAF A;  1IOT A;  2CJL A;  4H92 A;  4NEB A;  4FDY A;  4G4B A;  2F4G A;  1GAY A;  1JSF A;  4L41 A;  1IC7 Y;  1DXJ A;  2DQF C;  3ATO A;  5I4Y A;  1HER A;  4LGK A;  1FN5 A;  1W6Z A;  4WO9 A;  3WUL A;  2HEB A;  3WVY A;  5LVJ A;  4Z41 A;  1GXX A;  4LYO A;  3P64 A;  4ET8 A;  3W6D A;  1JJ3 A;  1HFZ A;  4KL7 A;  5LVI A;  1B5V A;  3TXD A;  4NHP A;  5I4W A;  3TMV A;  7LYZ A;  1QTK A;  4ZFP A;  3ZVQ A;  1JKA A;  4TSB A;  4GLA A;  1JSE A;  4WOA A;  4WM6 A;  2BQF A;  4R0F A;  2HEC A;  4NHQ A;  4B49 A;  1LYS A;  4H93 A;  1TDY A;  4LYZ A;  5APF A;  2YBH A;  4C5F A;  4Z3M A;  1JEF A;  8LYZ A;  5DM9 A;  5LYZ A;  1LZ8 A;  2YBN A;  1LSA A;  1GD6 A;  4YM8 A;  1IEE A;  4B4I A;  4Z46 A;  4ANR A;  1D6P A;  2IHL A;  4W94 A;  1GHL A;  2XBR A;  3B72 A;  2CGI A;  1FKV A;  4J1B A;  5E9R A;  4NFV A;  5KXP A;  1OUH A;  2W1Y A;  2G4N A;  4H8Z A;  5E4P A;  4WL7 A;  1J1O Y;  3WVX A;  1LZ1 A;  2RSC A;  4NG8 A;  3OK0 A;  5KKI A;  4DD9 A;  1UAC Y;  1IWX A;  5KXK A;  4WLY A;  1GB3 A;  1IOC A;  3WU8 A;  2DQI Y;  4DWX A;  4UWN A;  2LYM A;  1ZV5 L;  1OUE A;  2D4J A;  1FBI X;  6LYT A;  1LSC A;  2BQD A;  133L A;  1HEM A;  4RLM A;  1KIP C;  1GFH A;  5LAG A;  3P65 A;  4IAT A;  4B4E A;  1GF4 A;  3A94 A;  2DQG Y;  3WPL A;  1XEK A;  2HEE A;  1JIT A;  3T36 A;  1I56 A;  2NWD X;  1GPQ C;  3P68 A;  1JHL A;  1F6R A;  1GBX A;  1H6M A;  3A90 A;  2BPU A;  4H90 A;  4NG1 A;  1LTM A;  3ULR A;  4Z98 A;  4I8S A;  4ETB A;  1XSF A;  1HF4 A;  1JKD A;  1JPO A;  3ZEK A;  5HLL A;  1UIF A;  4LYT A;  4ETA A;  1WQN A;  4B0D A;  2H5Z A;  1LHH A;  3A92 A;  4NGY A;  1GF0 A;  1A4V A;  3B0K A;  4B4J A;  2ZYP A;  2Q0M X;  2BLY A;  1NDM C;  1C45 A;  4WM3 A;  1D0M A;  1HEN A;  1LMQ A;  5IDD A;  1DKJ A;  1B7P A;  1AT6 A;  1BB5 A;  2D6B A;  1WTM A;  1XEI A;  4KT3 A;  1QSA A;  2D4I A;  1HEW A;  3QNG A;  4DC4 A;  4WLX A;  5ILF A;  2ZIJ A;  4NSH A;  4C3W A;  2LHM A;  1FLU A;  1LZE A;  2HUB A;  2H9J A;  3A67 Y;  4CHX A;  1GFR A;  1DPW A;  1NDG C;  5FST A;  1GFE A;  3WUA A;  1WTN A;  1GE4 A;  4WLT A;  4YOP A;  5DN5 A;  3WU9 A;  3A93 A;  1GFK A;  4HP0 A;  1BB4 A;  1ZMY L;  4J7V A;  4H9I A;  4CFP A;  4WG7 A;  5FHW A;  3LZT A;  4OOT A;  5KXT A;  2DBT A;  1GFV A;  1EQE A;  2I26 L;  5HNC A;  4N8Z A;  4NY5 A;  1HEL A;  4RW1 A;  3TMW A;  1B7S A;  2BLX A;  3AB6 A;  3W6A A;  2ZNW Y;  1GFT A;  2YVB A;  4UWV A;  2C8O A;  3A6B Y;  1WQQ A;  1BHZ A;  1IP4 A;  4HJY A;  1IR9 A;  4KPM A;  1EL1 A;  4YF2 A;  1UIA A;  1IOS A;  3ATN A;  3MGW A;  3AZ7 A;  1ZVH L;  5B1G A;  1DZB X;  1B7M A;  1B5U A;  4D9Z A;  2YDG A;  5J7C A;  4U3X B;  2B5Z A;  1EQ5 A;  2YSS C;  2BQH A;  3QY4 A;  1LJE A;  3GXK A;  1JKB A;  4HV2 A;  3TXK A;  1YAP A;  5KXR A;  1LZT A;  2EIZ C;  4TWS A;  1FLY A;  1LSF A;  1IVM A;  1B7N A;  2A7F A;  3WL2 A;  1LSY A;  2ZIK A;  2W1X A;  1GB6 A;  2IFF Y;  1LZ4 A;  1LZY A;  1V7S A;  2HED A;  1C7P A;  4HTQ A;  4WLD A;  1LZG A;  1LHM A;  1N4F A;  4ZEE A;  1VFB C;  3EO5 A;  1BGI A;  3WPK A;  1XGP C;  2MEB A;  3LYM A;  2LYZ A;  2Y8P A;  1BWJ A;  1LJN A;  1LMN A;  4LT0 A;  2BQO A;  3EXD A;  4I0C A;  5I5Q A;  4DD3 A;  1LZA A;  1YKY X;  1LZS A;  3N9E A;  1JTO L;  4OWH A;  1PS5 A;  1IWT A;  5HNL A;  3WU7 A;  1QDR A;  5L9J A;  1T6V L;  2HTX A;  2LZT A;  1IP1 A;  3QE8 A;  4N9R A;  1NKH A;  1DI3 A;  1LAA A;  2PC2 A;  3GXR A;  4N5R A;  4NSI A;  2MEA A;  1LJI A;  2GV0 A;  3IJU A;  1YAQ A;  1UBZ A;  5B1F A;  1KIQ C;  5LXW A;  4PHI A;  1UIC A;  4MST A;  1JWR A;  4ETE A;  2Z39 A;  1QSW A;  2Z18 A;  4GLV A;  6LYZ A;  1LSE A;  1YKX X;  4GCC A;  1GBZ A;  2Z2E A;  3WXT A;  5II3 A;  3AZ4 A;  1DQJ C;  1VDT A;  2W1L A;  2ZNX Y;  1B5Z A;  1HMK A;  1HNL A;  1BB6 A;  1OQM A;  2H9K A;  5EBH A;  3D3D A;  5B06 A;  4WM5 A;  1BVK C;  1GAZ A;  1IR7 A;  1LYZ A;  3W6F A;  1VAT A;  1H87 A;  3WMK A;  5F9U A;  4YEO A;  1VAU A;  4ZIX A;  194L A;  5FCP A;  5KKJ A;  2ZQ3 A;  1LMC A;  4CGE A;  1GE1 A;  1YQV Y;  5DL9 A;  1GF7 A;  5IEL A;  4QGZ A;  1YAM A;  4H9A A;  1LHJ A;  4GN3 A;  1HFY A;  1LJ4 A;  1YL0 X;  1CJ6 A;  2BQB A;  4OW1 A;  1GDX A;  1SQ2 L;  2D4K A;  4G49 A;  4HTK A;  1GFJ A;  5K7O A;  2EKS C;  1LHI A;  3CSZ A;  3EBA B;  2G4Q A;  4H1P A;  4J0L A;  4B1A A;  1CJ9 A;  3B0I A;  4G4C A;  3AGH A;  1GE2 A;  3HFM Y;  1JJ0 A;  4RLN A;  1IP5 A;  2CWI A;  1GF8 A;  1BB7 A;  4H9F A;  5AMY A;  3W6B A;  4GCF A;  1G7L C;  1HEP A;  2F30 A;  2Z12 A;  4TSC A;  1LCN A;  1XGT C;  2LYO A;  1QUS A;  1JIY A;  5KXW A;  1GE0 A;  5KXN A;  2HU1 A;  1BWI A;  1SLY A;  1WQP A;  1B5X A;  1TEW A;  4H9C A;  4P2E A;  4NGK A;  3BKV A;  4HJZ A;  4NGO A;  4LT3 A;  4W96 A;  1YKZ X;  2D91 A;  3BKH A;  1G7H C;  1LSN A;  4WM2 A;  1CKC A;  1PZY A;  2Z37 A;  3WXU A;  1XGQ C;  3AZ5 A;  3RU5 A;  4DD2 A;  1B2K A;  1B5Y A;  3A34 A;  1D0K A;  3D9A C;  1OUC A;  1GWD A;  5HMJ A;  1BVX A;  1RFP A;  4LYC A;  1D9U A;  2ZYC A;  4NGI A;  1REZ A;  3P4Z A;  1LZ6 A;  4CFO A;  1HHL A;  1XGU C;  3TXB A;  3HBH A;  1TBY A;  4FJR A;  1JIS A;  5LIO A;  5ILC A;  1KXY A;  4BAP A;  1LSD A;  1GBW A;  3A91 A;  3A3Q A;  3W6E A;  4PJ2 C;  4GN5 C;  1BQL Y;  1B7O A;  1AM7 A;  1GB7 A;  1IOQ A;  2Z2F A;  1KIR C;  2HEF A;  2F4A A;  5D5F A;  4LT1 A;  4WL6 A;  4YEM A;  3WH1 A;  4TUN A;  4XN6 A;  5DN4 A;  4IAS A;  3CT5 A;  4NGJ A;  4OOO A;  1VED A;  4WM4 A;  1FKQ A;  1LJ3 A;  1OUA A;  4WM1 A;  1JKC A;  4XJH A;  1CNS A;  2MEF A;  4QDN A;  1KXX A;  1HEQ A;  3HBE X;  3N9C A;  3RW8 A;  4DYG A;  193L A;  1VDS A;  1CJ8 A;  2MEE A;  1MEL L;  3E3D A;  2A7D A;  4RDS A;  4NGZ A;  4O34 A;  1IP6 A;  5APE A;  1LJJ A;  5LVK A;  3RT5 X;  1IC5 Y;  1LSP A;  4XJB A;  2DQC Y;  4NHS A;  4QEQ A;  1VDQ A;  4ETD A;  4DD1 A;  1UID A;  1QUT A;  1UIG A;  1QDT A;  2HEA A;  4XJI A;  4NHI A;  4OWB A;  4ET9 A;  1REY A;  4N0J A;  4N1C C;  134L A;  5F81 A;  3AGG G;  1QQY A;  4DT3 A;  132L A;  1D6Q A;  4II8 A;  5L3H A;  5T3F A;  4GCB A;  1WQO A;  1TCY A;  5B59 A;  1GDW A;  1HEO A;  1AKI A;  1JUG A;  5LA5 A;  2MEG A;  3WUM A;  1IY4 A;  4HTN A;  4EOF A;  2EPE A;  4OWA A;  3TXI A;  1CKD A;  4DDC A;  1IIZ A;  2BQJ A;  1IWV A;  2F2N A;  4HPI A;  4DDA A;  5LA8 A;  3TMU A;  4OWE A;  1FLQ A;  154L A;  1IP3 A;  4TTD A;  3TMX A;  1LJK A;  1GE3 A;  1HSX A;  1LJG A;  1LZ5 A;  2WAR A;  3M18 B;  2DQE Y;  4HSF A;  9LYZ A;  5C6J A;  1LZN A;  2XBS A;  1VDP A;  3LYT A;  1G7J C;  1IP7 A;  1LMO A;  3J4G A;  5F9X A;  1HFX A;  5KXZ A;  1LKS A;  2BQA A;  3A96 A;  1V7T A;  1FDL Y;  1B5W A;  2MEH A;  4R6C A;  3LYZ A;  4J1A A;  1GEV A;  5B07 A;  1GB8 A;  1GB5 A;  1LHK A;  4IJ4 A;  4MCK A;  1J1X Y;  1B7Q A;  1WVV A;  2YBI A;  1GBO A;  4NGL A;  1YRO A;  1GB9 A;  2MEC A;  4M4O A;  4G4H A;  5LVH A;  2BQN A;  2BQM A;  4WO6 A;  4GCD A;  5M1Y A;  4H9E A;  1GB0 A;  4HPE A;  1LKR A;  4G9S A;  2ZQ4 A;  3IJV A;  1LSM A;  3LZ2 A;  4LT2 A;  4AXT A;  1UUZ C;  3WYH A;  1GF6 A;  153L A;  3AZ6 A;  4XEN A;  4XJF A;  4NWH A;  1XFP L;  2FBD A;  4YEN A;  1IR8 A;  1P2C C;  2HU3 A;  1BWH A;  5B05 A;  2I25 L;  2AUB A;  1B0D A;  2N5Z A;  1HC0 A;  4XAD A;  3ZVQ B;  1OUB A;  5HQ1 A;  1C43 A;  5KXO A;  3WW6 A;  3WPJ A;  1D0L A;  1LMA A;  3N9A A;  4AGA A;  1UC0 A;  4NSJ A;  4CJ2 A;  3AGI A;  1GF9 A;  2BQC A;  2BAA A;  2G4P A;  1LMT A;  3CT1 A;  4M6D A;  1LYO A;  4H9B A;  1F10 A;  1LZ9 A;  1GBS A;  4XYY A;  5I4X A;  1YAN A;  1WQM A;  1E8L A;  4BAF A;  5C6L A;  1GF3 A;  5LYM A;  1C46 A;  2BQK A;  1HML A;  3TXE A;  1B7L A;  2ZIL A;  2CDS A;  3M3U A;  1ALC A;  1O23 A;  3TXJ A;  4WG1 A;  3WW5 A;  1JTP L;  1TAY A;  2X0A A;  4HV1 A;  3VWO A;  1YAO A;  4X3B A;  5KXS A;  1C10 A;  3LHM A;  1OP9 B;  4N1E I;  4LFP A;  5A3Z A;  4A7D A;  1C08 C;  1GFG A;  1NHE A;  1F0W A;  1NBZ C;  2LZ2 A;  2ZWB A;  2FBB A;  3G3B B;  1DI4 A;  1UIE A;  4H91 A;  4HJV A;  4LYB A;  5FEK A;  1T3P A;  4NWE A;  1IC4 Y;  4UWU A;  1AZF A;  1BB3 A;  3P66 A;  3CT0 A;  5KY1 A;  5FDJ A;  2I6Z A;  3B0O A;  4OWC A;  5KXX A;  3F6Z A;  1LZR A;  4TX7 A;  1GEZ A;  1LZC A;  1LJH A;  5KJ9 A;  1NF5 A;  3A6C Y;  4ETC A;  1XEJ A;  5KXM A;  5L3I A;  3B6L A;  1GFU A;  4BAD A;  4NIJ A;  1UIB A;  1B7R A;  2DQJ Y;  1GB2 A;  2YBM A;  3A8Z A;  1B9O A;  1RJC B;  2Z38 A;  3AW7 A;  5KXY A;  4LZT A;  1HSW A;  1CKF A;  1MLC E;  1GFA A;  2BQE A;  1NBY C;  1OUD A;  4PRU A;  4RW2 A;  3RNX A;  2MEI A;  4H8X A;  4MR1 A;  1FLW A;  1LPI A;  3G3A B;  1WQR A;  1XGR C; 
#chains in the Genus database with same CATH topology
 3CQL A;  4DV2 M;  1JJ1 A;  1RCM A;  4CIS A;  1A2Y C;  221L A;  1DI5 A;  1GO5 A;  3UMM A;  3GUP A;  3NYA A;  1AIP C;  2Z4R A;  3AJN A;  3LQR A;  2EQL A;  1IXS A;  1OUI A;  2CE7 A;  4NHT A;  1DPX A;  4AQN A;  1QAO A;  112L A;  2MED A;  4GN4 A;  1ZVY B;  1GF5 A;  4NXN M;  3IWR A;  4DUZ M;  1INU A;  3D8B A;  1G0M A;  151L A;  1G0G A;  5I14 A;  1L24 A;  1XC8 A;  1JR3 D;  5A3E A;  2BQG A;  4XJG A;  1NMM A;  1C6K A;  188L A;  2APL A;  1NHW C;  192L A;  2XJW A;  1K3X A;  3TXG A;  1L57 A;  207L A;  1UIH A;  1G71 A;  1ZMU A;  3A3R X;  1NV8 A;  2DQD Y;  4PDI A;  1EQ4 A;  2O01 F;  5ITU A;  3B74 A;  3GLH E;  1OUG A;  2B6W A;  1UA6 Y;  1G7M C;  2LTU A;  1LWG A;  4JXJ A;  1Q02 A;  2RKO A;  1IWU A;  1QTE A;  3HJQ A;  1LMP A;  3CB7 A;  3CSQ A;  3W6C A;  3GLG E;  5LVG A;  4H9H A;  1DO2 A;  2BQL A;  1JR3 E;  2XGN A;  1DO0 A;  3U61 A;  5LAF A;  1IOT A;  2CJL A;  4NEB A;  4A3V B;  4D80 A;  4L41 A;  2DQF C;  1FN5 A;  4WO9 A;  3P64 A;  4JN6 A;  2N35 A;  1HFZ A;  1L16 A;  261L A;  4I7P A;  223L A;  2LC9 A;  4DV5 M;  1QTK A;  1ZYT A;  3GQ4 A;  1R2Y A;  4WOA A;  3GLH A;  1L17 A;  2DEN A;  1G41 A;  1LYS A;  144L A;  1TDY A;  2RAY X;  2YBH A;  1C6C A;  4Z3M A;  5DM9 A;  4W55 A;  4ARQ A;  4YM8 A;  4JI4 M;  1IEE A;  4ANR A;  5BR8 M;  2F5S A;  1D6P A;  2XF3 A;  1NNU C;  4W94 A;  2V1U A;  3B72 A;  4K5Y A;  3PBL A;  5E9R A;  1UM8 A;  1OUH A;  102L A;  3K2R A;  1HNZ M;  2XFS A;  5E4P A;  1IN4 A;  1P46 A;  1J1O Y;  3WVX A;  3FRH A;  1L62 A;  4I7K A;  3GPU A;  1QQW A;  4FWH A;  2DQI Y;  4DWX A;  2LH0 A;  1L80 A;  3UJN A;  3SAV A;  2D4J A;  1TH3 A;  2UXB M;  3ZCB B;  1HEM A;  1KIP C;  2EKK A;  1XEK A;  1JIT A;  3P68 A;  5E26 A;  1L54 A;  3A90 A;  5ITY A;  2RBQ A;  4Z98 A;  1IFY A;  2NTG A;  5FTM A;  2OE7 X;  1JKD A;  1DGG A;  2ANX A;  1P3Q Q;  1IBM M;  3SBA A;  4R71 A;  1A4V A;  2BLY A;  1NDM C;  1C45 A;  1L64 A;  1E94 E;  3SC3 A;  4JI7 M;  2RBO A;  215L A;  3L2X A;  2D6B A;  1WTM A;  4KT3 A;  2CHQ A;  5ILF A;  3QNG A;  3LVV A;  2O4W A;  3U60 A;  4LDO A;  3CDO A;  2QEN A;  2ZIJ A;  4C3W A;  2WSF F;  5ITQ A;  4QNM A;  1L07 A;  4LF7 M;  1FLU A;  4LJA A;  3DNA A;  3A67 Y;  3J7B A;  4QHT A;  5ITX E;  1NY5 A;  1NDG C;  4DR5 M;  1V92 A;  5BPV A;  4JYA M;  1GFE A;  3WUA A;  3B7Q A;  3WU9 A;  5ITT A;  2JY6 B;  1L74 A;  4CJ6 A;  3RGS A;  5C1B A;  4B08 A;  1QAN A;  5FHW A;  5KXT A;  3ZC7 B;  4EPI A;  1EQE A;  4N8Z A;  4NY5 A;  3TMW A;  2BLX A;  2QZ4 A;  3W6A A;  1N36 M;  1LYJ A;  1C60 A;  3DN3 A;  2QCU A;  1EL1 A;  2H1R A;  4QOZ C;  2K47 A;  1JQU A;  1UIA A;  1WHC A;  3ATN A;  2RGH A;  3MGW A;  3AZ7 A;  1ZVH L;  1L28 A;  2RAZ X;  2OO9 A;  1SG9 A;  2FH0 A;  3IEC A;  3J7A S;  1B7M A;  5B1G A;  4LF6 M;  1G1V A;  4D9Z A;  1L04 A;  2B5Z A;  1L42 A;  5FTN A;  3VKG A;  4JI5 M;  3QY4 A;  3FTC A;  1LZT A;  2NQ8 C;  1FLY A;  3U6O A;  3WL2 A;  4I7J A;  3KS4 A;  1EPY A;  1LSY A;  201L A;  1GB6 A;  3U6P A;  1LZY A;  2IFF Y;  1C7P A;  1L12 A;  1NHG C;  1IM2 A;  2MEB A;  2LYZ A;  3LW5 F;  5KQ8 A;  4LG2 A;  5I5Q A;  107L A;  3K8Z A;  1TH4 A;  4G4R A;  5L9J A;  5EP2 A;  2LZT A;  3KOZ E;  3T1H M;  4PDG A;  2PC2 A;  4FWG A;  1Z5A A;  1CV4 A;  1VEK A;  150L A;  225L A;  3IJU A;  5B1F A;  1KIQ C;  2G8L A;  1OIP A;  3BXW A;  157L A;  4ETE A;  2Z39 A;  2R46 A;  213L A;  1L19 A;  3C3D A;  1L2B A;  189L A;  3VDP A;  2ZNX Y;  5EBH A;  1HMK A;  3GLF E;  1OQM A;  2R6F A;  3VFD A;  5DNY A;  3U6C A;  1IR7 A;  1LYZ A;  3C81 A;  3SMS A;  1VAT A;  1VAU A;  3R9X B;  3RE8 A;  4D82 A;  194L A;  1L51 A;  4OVZ B;  2Q9E A;  5JI3 E;  1LI3 A;  197L A;  1PGY A;  3PVS A;  250L A;  5IEL A;  1D2W A;  4QGZ A;  1KY1 A;  4W53 A;  1KFV A;  1G4A E;  232L A;  3MK6 A;  2DWZ B;  123L A;  4HTK A;  1GFJ A;  5K7O A;  3HJS A;  3DA1 A;  3FUV A;  1CJ9 A;  1L26 A;  3VKH A;  4RLN A;  3W6B A;  3HY5 A;  2R4J A;  2F5P A;  4GCF A;  2F30 A;  2CWB A;  4B7G A;  4TSC A;  3QWL A;  4IBC A;  163L A;  1GE0 A;  1KW5 A;  1PRB A;  4NGK A;  1TDZ A;  5IRE B;  4NGO A;  1E9S A;  1HT2 E;  1YKZ X;  2B73 A;  4ARP A;  2UUC M;  3RZE A;  2MH8 A;  2CHV A;  2F5O A;  4DD2 A;  3T1Y M;  4F2L A;  171L A;  4LYC A;  4DKL A;  1D9U A;  2ZYC A;  160L A;  3P4Z A;  4W58 A;  4DAJ A;  140L A;  1HNX M;  3FYC A;  1L96 A;  1GBW A;  1QTB A;  3A91 A;  1BQL Y;  3OTO M;  1B7O A;  1X37 A;  2Z2F A;  3GRV A;  4RF0 A;  4AW4 A;  4LT1 A;  3GUM A;  3WHL A;  4WL6 A;  2RB1 X;  4TUN A;  1LWK A;  2O7A A;  149L A;  1D9W A;  1FKQ A;  1OUA A;  1L63 A;  4WM1 A;  4DR6 M;  3N9C A;  4GEW A;  3HBE X;  1FJG M;  3NY9 A;  1VDS A;  1CJ8 A;  5APE A;  1MEL L;  7LZM A;  1G8P A;  4O34 A;  1D2N A;  3KXE C;  2UXC M;  4PK0 A;  1PJQ A;  1SSW A;  1UID A;  3LCV B;  1Q39 A;  4BB9 A;  2CEA A;  1IN6 A;  177L A;  4II8 A;  4DBG B;  1XEP A;  1OQY A;  4GKJ M;  1L86 A;  1TCY A;  1L32 A;  1HEO A;  3F92 A;  2L4F A;  4EOF A;  4HTN A;  2Y0Q A;  2FOI C;  3D8L A;  2A5Y B;  4OWA A;  2HL7 A;  4MH0 E;  1LGX A;  2BQJ A;  231L A;  5LA8 A;  1FLQ A;  4TTD A;  3TWK A;  248L A;  9LYZ A;  3NWL A;  1DYD A;  4PD2 A;  237L A;  3HGI A;  183L A;  4FCV A;  2R62 A;  1Y8G A;  5KXZ A;  2QBY B;  2BQA A;  111L A;  3LYZ A;  1GEV A;  5B07 A;  2ZBK B;  3J2P B;  1GB5 A;  4IJ4 A;  1W5T A;  4GKK M;  1B7Q A;  1ZUR A;  1GL6 A;  4E97 A;  2JY7 A;  3AOE A;  4NXM M;  1YRO A;  3GUJ A;  2D7E A;  2MEC A;  1Q3B A;  155L A;  2OTY X;  206L A;  2BQM A;  1L94 A;  4GCD A;  1DGH A;  4H9E A;  1ZQ9 A;  4HPE A;  1LKR A;  3U6S A;  1LSM A;  3LZ2 A;  4LT2 A;  113L A;  2A4T A;  1L15 A;  1L14 A;  1T8G A;  2KNZ A;  2KW0 A;  4LF8 M;  4NWH A;  4XJF A;  2Z3X A;  1F4I A;  4YEN A;  2FS1 A;  2D7G A;  1B0D A;  3IHP A;  2N5Z A;  218L A;  3THG A;  3SB6 A;  1L21 A;  1KY0 A;  1UC0 A;  3CT1 A;  2YNM D;  1LMT A;  129L A;  4M6D A;  4H9B A;  5I4X A;  1LZ9 A;  4X64 M;  1GBS A;  1WQM A;  3GLI E;  4IBB A;  2XLJ A;  1C46 A;  1JTM A;  1L44 A;  3TXE A;  2D7H A;  3TXJ A;  4HV1 A;  3PXG A;  1RU3 A;  1R7R A;  5EJC A;  3MHV C;  4AKG A;  1C08 C;  1GFG A;  1L2D A;  3HH6 A;  4W56 A;  1NBZ C;  3G3B B;  4H91 A;  1QVR A;  3DMX A;  3FTF A;  4LYB A;  3KSX A;  3V2W A;  3P66 A;  4AQY M;  2DZO B;  2I6Z A;  5KXX A;  1P5C A;  3F6Z A;  1IY2 A;  4TX7 A;  1NF5 A;  3JAM S;  1LI2 A;  1XEJ A;  2QHO B;  4BAD A;  1B7R A;  4FVM A;  2YBM A;  1LYF A;  1P64 A;  1RJC B;  1QTV A;  1NBY C;  1QT5 A;  4B7F A;  3SB9 A;  4H8X A;  4ARJ A;  4MR1 A;  1P56 A;  1FLW A;  3VW7 A;  4IBI A;  3HZJ A;  1HT1 E;  1TGU A;  2ZAN A;  2FYD A;  3GLI A;  4K0K M;  4LYM A;  3EML A;  4RNA A;  3GPY A;  2XZU A;  137L A;  1IN5 A;  2UUA M;  2LHG A;  3U5Z A;  4DD7 A;  2OTZ X;  168L A;  3C7W A;  3AYQ A;  2Z6B A;  4YHH M;  5LMN M;  3SP3 A;  1I20 A;  4M9S A;  4FCW A;  3MJ5 A;  148L E;  2DHR A;  5JEN B;  1OV7 A;  2DQH Y;  4WUR A;  5F16 A;  3KAM A;  2JP7 A;  4D81 A;  2KNA A;  1IWY A;  3CSR A;  1IOR A;  3GUL A;  3QYE A;  1GKI A;  4GC9 A;  4PRQ A;  1L68 A;  3WUN A;  4ARM A;  3TE6 A;  211L A;  2J7N A;  5APD A;  1L00 A;  3KP0 E;  1L18 A;  3TXF A;  1L79 A;  5LIN A;  255L A;  4NL4 H;  1OV5 A;  1GBY A;  3FE0 A;  5DLA A;  4DD0 A;  1Z59 A;  2LXE A;  2C9C A;  3AW6 A;  3LYO A;  4BLC A;  3U6L A;  3GO8 A;  1RI8 B;  1MN3 A;  2DWN A;  2QQ8 A;  3SHG B;  1NWG A;  4DV4 M;  1F6S A;  4E3U A;  2LVA A;  208L A;  4PT5 A;  2DQA A;  5I53 A;  4RKU F;  2I7P A;  1XNQ M;  4X62 M;  4H92 A;  1GAY A;  1JSF A;  1L36 A;  2VQF M;  5I4Y A;  4S12 A;  2HEB A;  5DYG A;  5C18 A;  2CFO A;  1QYR A;  1L34 A;  2XEP A;  3BOS A;  5LVI A;  1L20 A;  1XXH B;  3TXD A;  216L A;  4ZFP A;  2KHH A;  4DJH A;  4TSB A;  3TPZ A;  251L A;  2HEC A;  1OAO C;  4R0F A;  3ODU A;  3LCU A;  4NHQ A;  4ZPU A;  4LZM A;  1QUO A;  4H93 A;  1QAQ A;  8LYZ A;  1H6U A;  1LSA A;  2X8A A;  2K0B X;  1CV1 A;  2ZAM A;  2XZF A;  2YQZ A;  5FTK A;  4I7S A;  1G0J A;  1DYE A;  4OX9 M;  5KXP A;  4EPF A;  2K9D A;  2HUK A;  4WL7 A;  1QSB A;  1L11 A;  5KKI A;  3CF0 A;  161L A;  1IWX A;  2MJ5 B;  1C66 A;  1WIV A;  1IQP A;  4JV5 M;  4UWN A;  2VDB B;  1T43 A;  1ZV5 L;  1OUE A;  125L A;  2RBS A;  6LYT A;  3VLF B;  1LSC A;  162L A;  1N75 A;  1GFH A;  1XHB A;  2KNV A;  2CV2 A;  4IAT A;  4B4E A;  1GF4 A;  3A94 A;  3WPL A;  2HEE A;  1CV0 A;  2BNK A;  1I56 A;  2NWD X;  4FD2 A;  4NG1 A;  4W52 A;  1IBK M;  1HF4 A;  2BWE A;  1JPO A;  3ZEK A;  214L A;  2KRU A;  4OO9 A;  1WQN A;  3KSJ A;  2CRU A;  3SAW A;  1KYI A;  1LHH A;  1OVJ A;  1GF0 A;  1L60 A;  1CU3 A;  239L A;  2QSF X;  1D0M A;  4WM3 A;  4NSR A;  3DZD A;  1L31 A;  1AT6 A;  3L29 A;  1XEI A;  4DC4 A;  4JI3 M;  1LYH A;  1G07 A;  3NBI A;  3HKP A;  3SB5 A;  5EP1 A;  2MRO B;  4DV3 M;  1ZAE A;  1LZE A;  3TQS A;  1GFR A;  1C68 A;  3UON A;  1P36 A;  5DYI A;  2F32 A;  1C6I A;  4YOP A;  5DN5 A;  3V2Y A;  1BB4 A;  4EXM A;  1ZMY L;  4J7V A;  4CFP A;  2UXD M;  195L A;  2DBT A;  1OIZ A;  2V1C A;  4RW1 A;  1HEL A;  1SXJ B;  3HU9 A;  1L98 A;  1C6G A;  2AHM A;  1Z6T A;  2LVQ D;  1IY0 A;  2DZL A;  1IP4 A;  103L A;  4EKP A;  4GIT A;  3HUQ A;  4W51 A;  138L A;  5KO3 A;  2QAR C;  2Z7J A;  4DR4 M;  4U3X B;  4HV2 A;  3L28 A;  122L A;  4TWS A;  3GPP A;  3K92 A;  1IVM A;  109L A;  158L A;  1R6B X;  2A7F A;  2ZAO A;  2ZIK A;  1LZ4 A;  2HED A;  4WLD A;  1C62 A;  1N4F A;  1LHM A;  1CV6 A;  2JWS A;  1L73 A;  2Y8P A;  1LJN A;  4LT0 A;  1L41 A;  3W0F A;  3EXD A;  4I0C A;  3N9E A;  4IBF A;  1IWT A;  4N9R A;  1P37 A;  3QE8 A;  4WW0 A;  2MEA A;  1YAQ A;  2RBN A;  4PHI A;  2DNA A;  4B3R M;  3R8F A;  1LYG A;  4LY6 A;  6LYZ A;  1LSE A;  4GCC A;  1GBZ A;  2X4A A;  3WXT A;  5II3 A;  1DQJ C;  3HHX A;  3PNY A;  2H9K A;  4WM5 A;  3W6F A;  1C6A A;  1L70 A;  167L A;  1H87 A;  5F9U A;  4ZIX A;  2XQO A;  4CGE A;  1YQV Y;  1GF7 A;  3G3X A;  2LZM A;  187L A;  5EXS A;  1LHJ A;  241L A;  174L A;  1HFY A;  1LJ4 A;  2BQB A;  1OTR A;  4OW1 A;  1GDX A;  209L A;  3GLH B;  4YXC A;  4G49 A;  3LVW A;  2EJS A;  3I4V A;  3CSZ A;  4J0L A;  4B1A A;  4DR2 M;  3NBX X;  3B0I A;  2M60 A;  1GE2 A;  1JJ0 A;  2CWI A;  1GF8 A;  131L A;  5AMY A;  5IT9 S;  3KP1 E;  3GLG B;  2LYO A;  4PCZ A;  1JIY A;  1I4W A;  5KPZ A;  5KXW A;  4P2E A;  1B5X A;  1TEW A;  2HUM A;  2RRU A;  1G7H C;  1K82 A;  1CKC A;  2Z37 A;  1XGQ C;  3RGP A;  1OFI A;  1B2K A;  1L81 A;  1B5Y A;  1D0K A;  3D9A C;  2B6T A;  1GWD A;  1BVX A;  4NGI A;  4YXA C;  1C7Y A;  1HHL A;  1L69 A;  3G3V A;  1CU2 A;  1KNI A;  1PJJ A;  3H4J A;  2QPA A;  217L A;  1JIS A;  4L8R C;  5ILC A;  4BAP A;  3BBZ A;  1LSD A;  3W68 A;  3A3Q A;  3W6E A;  4PJ2 C;  4I7N A;  3SMP A;  1IOQ A;  2GQF A;  3VK8 A;  1GAB A;  1KIR C;  2R18 A;  4GH9 A;  3UZU A;  3C7Z A;  3SFZ A;  1IN8 A;  110L A;  1PQM A;  3QYB A;  5F3W A;  3HDF A;  3GUO A;  3CT5 A;  1QZM A;  4NGJ A;  2VQE M;  4OOO A;  4WM4 A;  1LJ3 A;  1CX7 A;  1JKC A;  4XJH A;  2MEF A;  4QDN A;  4Z6Y A;  3GUK A;  4I7L A;  1TH2 A;  193L A;  1QAM A;  4AI6 A;  3JR4 A;  1LJJ A;  3U60 B;  1LSP A;  4XJB A;  1L52 A;  1VDQ A;  4ETD A;  2OE9 X;  4ET9 A;  4QOS A;  3C8R A;  249L A;  5F81 A;  3AGG G;  4DT3 A;  3WHK A;  4IAP A;  4AG6 A;  3KOW E;  1L72 A;  1WQO A;  5B59 A;  1W5S A;  5LA5 A;  4GC5 A;  4DR1 M;  2MEG A;  4L78 A;  2Q9D A;  4DR3 M;  1T97 A;  1IXR C;  1T6H A;  1IWV A;  2F2N A;  1PQI A;  1P2L A;  4DDA A;  4OWE A;  154L A;  2F4V M;  1NV9 A;  3M18 B;  3FUT A;  1L1T A;  4HSF A;  205L A;  1LZN A;  2XBS A;  1G7J C;  3J4G A;  5F9X A;  3E46 A;  3LQQ A;  1WGL A;  1ZV1 A;  1LKS A;  152L A;  1FDL Y;  4R6C A;  3V76 A;  1L40 A;  146L A;  104L A;  2YBI A;  1GBO A;  4M4O A;  2WSE F;  5EXX A;  1T8A A;  3HU3 A;  5M1Y A;  4P17 A;  2LVP C;  1GB0 A;  2HCB A;  4KO8 A;  2XH9 A;  3IJV A;  2KDL A;  4AXT A;  3C8Q A;  4DUY M;  4OVZ A;  2ZM6 M;  4XEN A;  3GUN A;  1N34 M;  1C1K A;  1IR8 A;  2B6X A;  2Y0T A;  3A46 A;  3Q8G A;  230L A;  1OFH A;  4MGZ E;  1HC0 A;  4XAD A;  3ZVQ B;  4MGY E;  2LHC A;  3WW6 A;  1L1Z A;  1LMA A;  4CJ2 A;  3AGI A;  2BQC A;  4W57 A;  3K9P A;  2I7N A;  3AOE C;  1YAN A;  3B9P A;  4IJF A;  1GF3 A;  2BQK A;  1HML A;  4I81 A;  2CDS A;  1IBL M;  1ALC A;  4WG1 A;  1QTC A;  3VWO A;  1NNJ A;  5A3Z A;  2LZ2 A;  2FBB A;  4HJV A;  1T3P A;  1L76 A;  4NWE A;  1DYG A;  3CDV A;  5FDJ A;  5A2Q S;  3B0O A;  1C61 A;  4OWC A;  1GEZ A;  1C6T A;  4LRT A;  3A6C Y;  3B6L A;  1GFU A;  4NIJ A;  3G3W A;  2DWM A;  3C80 A;  3RUN A;  3AW7 A;  5KXY A;  4LZT A;  1HSW A;  1CKF A;  1GFA A;  3SB7 A;  2MEI A;  1T3T A;  4IBE A;  1P2R A;  1QTH A;  4HLQ A;  1WQR A;  3LN2 A;  4XJD A;  184L A;  3GLF B;  1DYF A;  1LOZ A;  4GCE A;  3Q8X A;  2KA6 B;  4HL4 A;  1L97 A;  2XTH A;  3EMS A;  5APC A;  258L A;  5FSW A;  4PGJ B;  135L A;  3B89 A;  1REX A;  2JXN A;  3HX3 A;  1AT5 A;  191L A;  3OJP A;  1Q3C A;  5EP4 A;  1I1Z A;  3HWL A;  3OE9 A;  2EO2 A;  3DN0 A;  1QS9 A;  4I7R A;  1C6B A;  1WVU A;  1DYB A;  1IWW A;  4LCB A;  5FEL A;  1SWY A;  1W08 A;  4EMN A;  233L A;  1LSZ A;  1G0K A;  1QIO A;  5D5C A;  176L A;  4CIZ A;  228L A;  1B6I A;  1Z55 A;  1XB2 B;  1CU0 A;  1LGU A;  1L35 A;  4DDB A;  1JTT L;  5I54 A;  240L A;  3NY8 A;  190L A;  4NGV A;  4L15 A;  1YIL A;  2VF8 A;  3U6E A;  3PDS A;  5C6I A;  200L A;  1A5T A;  4NSG A;  2YBL A;  4I4L A;  3KDS E;  4ARL A;  5LMU M;  3B7Z A;  4G3O A;  4EKQ A;  3RZ4 A;  1XNR M;  1LSG A;  2DKV A;  2W1M A;  1QSQ A;  3FI7 A;  2QP9 X;  5KXL A;  3W3E A;  4H94 A;  172L A;  4FCT A;  1DGF A;  4WMG A;  2DAG A;  4G4B A;  4LDL A;  1R4G A;  238L A;  4LGK A;  1PJI A;  5LVJ A;  1L03 A;  1GXX A;  1L38 A;  1L43 A;  4LYO A;  4Z41 A;  2Y20 A;  1JJ3 A;  4W54 A;  235L A;  4MGI E;  6LZM A;  4NHP A;  1L50 A;  199L A;  1C6E A;  4JI2 M;  7CAT A;  4GLA A;  1JSE A;  3HH4 A;  3CDT A;  2B70 A;  2R45 A;  4B49 A;  1OJL A;  2O25 A;  4DV1 M;  4JI1 M;  4LYZ A;  4C5F A;  3CGW A;  1T8F A;  2F5Q A;  1JEF A;  5LYZ A;  2XFT A;  4GRV A;  2CP8 A;  1BVS A;  2JNH A;  1GD6 A;  1SWZ A;  4CGY B;  4Z46 A;  2L09 A;  2LVO C;  4LJ8 A;  2R44 A;  2IHL A;  3K2L A;  2CGI A;  1FKV A;  2B7X A;  4J1B A;  4NFV A;  4MM3 B;  2W1Y A;  4H8Z A;  2DAM A;  1L58 A;  1N78 A;  1C64 A;  4NG8 A;  1L25 A;  4XK8 F;  1G0Q A;  4DD9 A;  2LWX A;  1L30 A;  1NJG A;  5KXK A;  4WLY A;  219L A;  1GB3 A;  1IOC A;  3LMM A;  3PNV A;  2LYM A;  2KEB A;  2X49 A;  3B7N A;  1FBI X;  2BQD A;  2B6Z A;  133L A;  4RLM A;  5LAG A;  3P65 A;  1I94 M;  1IN7 A;  2Z4S A;  4HEO A;  1L23 A;  1JHL A;  1QT7 A;  1GBX A;  2BPU A;  4H90 A;  2MGW A;  3ULR A;  3T6P A;  3FD9 A;  1K28 A;  4I8S A;  1LGW A;  3SBJ A;  1XSF A;  2KZS A;  4ETB A;  1UIF A;  4ETA A;  4B0D A;  2JA2 A;  1SX2 A;  2H5Z A;  4NGY A;  4B4J A;  2ZYP A;  4FW9 A;  1PQK A;  4G6Z A;  1HEN A;  1OWZ A;  5IDD A;  2DHY A;  1B7P A;  1XWI A;  2JZ1 A;  128L A;  1QSA A;  1HEW A;  5GKN A;  1XJU A;  2LHM A;  3E9S A;  8CAT A;  165L A;  1SSY A;  3GLI B;  4ZPX A;  2HUB A;  1C6L A;  3SAR A;  2BJV A;  1DPW A;  4YX7 C;  5FST A;  1WTN A;  1R2Z A;  4WLT A;  4IBD A;  2C99 A;  4Q7J A;  5DFL A;  1L33 A;  4QNR A;  4H9I A;  3I4Y A;  3LZT A;  4F1I A;  1GFV A;  3AL0 C;  1B7S A;  3HUA A;  1L89 A;  5FLX S;  1IY1 A;  3IG8 A;  1GFT A;  3L2A A;  1WQQ A;  1D2Y A;  1BHZ A;  4I7Q A;  4KPM A;  4YF2 A;  1IOS A;  1WR1 B;  1L87 A;  4IJE A;  1B5U A;  4LJ9 A;  2YDG A;  5J7C A;  2YSS C;  2BQH A;  2OU8 A;  1LJE A;  2UUB M;  1CU5 A;  1E32 A;  119L A;  1YAP A;  5KXR A;  4GHL A;  2L6O A;  1FNN A;  4G4N A;  1B7N A;  1N32 M;  2W1X A;  1V7S A;  4HTQ A;  3OE8 A;  1LYE A;  4LF5 M;  1VFB C;  3W67 A;  1BGI A;  2F5N A;  3WPK A;  169L A;  1BWJ A;  3SN6 R;  3A45 A;  4DD3 A;  2B6Y A;  1YKY X;  3U6D A;  1JTO L;  3MMP A;  2C9O A;  3FI5 A;  3WU7 A;  1VDD A;  1QDR A;  5EXT A;  142L A;  1C69 A;  1IP1 A;  3OE0 A;  1NKH A;  4W59 A;  1DI3 A;  256L A;  3GXR A;  4N5R A;  4NSI A;  3SB8 A;  4MB7 A;  226L A;  1GVN A;  5LXW A;  3OE6 A;  1WTH A;  2IGC A;  2Z18 A;  4GLV A;  1L82 A;  1YKX X;  4LF4 M;  2Z2E A;  4LFB M;  3AZ4 A;  1VDT A;  2W1L A;  2K6B A;  1B5Z A;  1HNL A;  181L A;  1BB6 A;  243L A;  1L13 A;  5B06 A;  1L27 A;  4AKH A;  4YEO A;  1SXJ D;  1KSF X;  1WJ7 A;  5FCP A;  5KKJ A;  4GIP A;  1LMC A;  1GE1 A;  4L6V 6;  2L2D A;  3HU1 A;  1YAM A;  4H9A A;  1SQ2 L;  4JI8 M;  3I04 M;  4LF9 M;  4S0W A;  1N33 M;  1TDH A;  1LHI A;  3GRR A;  3EBA B;  4H1P A;  2G4Q A;  1NJF A;  3K1J A;  3SBB C;  4NC6 A;  1CV3 A;  3HFM Y;  1LV7 A;  4H9F A;  3GQ5 A;  1L99 A;  3I51 A;  2Y21 A;  4Y28 F;  1HQC A;  242L A;  5KXN A;  1BWI A;  1SLY A;  1WQP A;  5LZM A;  2L7I A;  4HJZ A;  4LT3 A;  4W96 A;  2D91 A;  1L08 A;  1LSN A;  3FAD A;  4WM2 A;  1WXQ A;  2O79 A;  1PZY A;  3AZ5 A;  3RU5 A;  3SAS A;  170L A;  1OUC A;  5HMJ A;  1RFP A;  3HT6 A;  4CFO A;  1REZ A;  1LZ6 A;  3TXB A;  3HBH A;  2EKF A;  1TBY A;  4LRS A;  4FJR A;  2YR0 A;  1QS5 A;  4RF1 A;  4NRV A;  4DV0 M;  4GN5 C;  3J81 S;  1AM7 A;  1GB7 A;  2B74 A;  1TLA A;  1LI6 A;  2HEF A;  5D5F A;  5H37 D;  4MGH A;  2CHG A;  186L A;  3WH1 A;  3KW6 A;  4XN6 A;  5DN4 A;  3T15 A;  2C5R A;  1L66 A;  3KFU G;  4LDE A;  1IXS B;  3ZQJ A;  145L A;  196L A;  1UFZ A;  3M6A A;  1D3J A;  1VEG A;  1CNS A;  4I7O A;  222L A;  3RW8 A;  229L A;  2RB2 X;  4IBK A;  4RDS A;  1SXJ A;  1IP6 A;  5LVK A;  1IC5 Y;  2DQC Y;  4NHS A;  3DN4 A;  1PQD A;  4DD1 A;  2HEA A;  1NO1 A;  254L A;  3L64 A;  2DXI A;  134L A;  3JR5 A;  1CUQ A;  1QQY A;  132L A;  5L3H A;  5T3F A;  4BBA A;  1AKI A;  4DQ5 A;  3WUM A;  1IY4 A;  2CUZ A;  3TXI A;  1CKD A;  2WSC F;  4YY3 M;  1IIZ A;  4DDC A;  2BJW A;  1L65 A;  4HPI A;  4OU7 A;  118L A;  2ZTD A;  4REZ A;  2WZJ A;  3GPX A;  1LZ5 A;  1GE3 A;  3W0L B;  1LJG A;  2WAR A;  4DQJ A;  4G4O A;  1EE8 A;  5C6J A;  3J80 S;  2OQ4 A;  178L A;  1IP7 A;  1LMO A;  1ORY B;  4M9Z A;  1YUB A;  1LW9 A;  1V7T A;  2MEH A;  3DKE X;  1LYD A;  4J1A A;  1L09 A;  1ZWN A;  4DR7 M;  1OWY A;  2EUC A;  1J1X Y;  2ANV A;  4JI6 M;  3J27 B;  247L A;  2JY5 A;  1ZMV A;  4NGL A;  3U61 B;  139L A;  5LVH A;  2BQN A;  3VK7 A;  4WO6 A;  1L01 A;  1R5L A;  2R0I A;  3KOX E;  2ZQ4 A;  2OU0 X;  1MJG M;  1UUZ C;  3E21 A;  3WYH A;  1GF6 A;  4LJ7 A;  4ITQ A;  1VQ1 A;  2DAE A;  3C58 A;  1XFP L;  2FBD A;  3DN1 A;  2I25 L;  2AUB A;  5ITR A;  1TTE A;  4JI0 M;  1C43 A;  5KXO A;  4KT0 F;  1TF0 B;  3N9A A;  1GF9 A;  1L90 A;  2NTH A;  1LYO A;  4XYY A;  1VEJ A;  4EKR A;  1E8L A;  4BAF A;  3FTD A;  4ARQ B;  2ZIL A;  3M3U A;  1Z5C A;  3HT7 A;  1O23 A;  1JTP L;  2X0A A;  3GLG A;  1PQO A;  2VF7 A;  3DMV A;  4X3B A;  1C10 A;  1OP9 B;  4N1E I;  2ERC A;  1JR3 A;  164L A;  1F0W A;  1NHE A;  1YE9 A;  253L A;  2RB0 X;  1UIE A;  4UWU A;  180L A;  2KXE A;  1AZF A;  1BB3 A;  2F2Q A;  3GUI A;  3DN2 A;  1LZR A;  2DAI A;  2M5Z A;  227L A;  1LJH A;  5L3I A;  4ETC A;  1T6O A;  3HTF A;  5KXM A;  1C6F A;  3A8Z A;  4CHT B;  1HR0 M;  1B9O A;  4RW2 A;  1MLC E;  2BQE A;  4PRU A;  4KOD A;  4II7 A;  1OUD A;  1K3W A;  4IBG A;  3DFZ A;  2XSZ D;  259L A;  4B3S M;  4BS7 A;  1LZD A;  1G1W A;  4PPO A;  3A95 A;  4R7G A;  4LGM A;  3SYK A;  166L A;  1L93 A;  1QUG A;  1JQJ C;  1G06 A;  3GP1 A;  1QT4 A;  1OUJ A;  4H8Y A;  2DWL A;  1OUF A;  3IG5 A;  2JUJ A;  3EIH A;  1C63 A;  1YIK A;  2FYC A;  1IY3 A;  4NSO B;  1CKH A;  2HWJ A;  2YBJ A;  1IX0 A;  3GRY A;  2CV0 A;  1J1P Y;  1G0L A;  1LHL A;  2Z19 A;  2RBR A;  1NY6 A;  2BQI A;  2G5G X;  4NGW A;  3F8V A;  3VDU A;  4LFX A;  1RE2 A;  2C8P A;  1NVM A;  4I7M A;  1LYY A;  4X66 M;  252L A;  4DQ7 A;  1IP2 A;  1CJ7 A;  1L02 A;  1L91 A;  4I5S A;  2L4E A;  5E6J A;  126L A;  1IWZ A;  1LZB A;  1YL1 X;  3T6U A;  2HUL A;  1LSB A;  1LJF A;  1CTW A;  3J6K A;  5IHG A;  1HQY E;  1V34 A;  1G59 A;  2KZU A;  159L A;  1G7I C;  1LLH A;  4QY9 A;  1L55 A;  3TXH A;  4I8O A;  2OEA X;  1L0J A;  2VB1 A;  3CF2 A;  2OOA A;  1NQI A;  1GXV 2;  1DGB A;  1IO5 A;  3K3T A;  4IIW A;  5F14 A;  4M0W A;  3SYL A;  1CKG A;  2G3Q A;  3HUK A;  2B3T A;  1DKK A;  2QNJ A;  3HBD A;  185L A;  3SAU A;  234L A;  4XGI A;  130L A;  2JY8 A;  1UCO A;  4ML7 A;  1KXW A;  4KXI A;  1REM A;  3HH5 A;  5ITX A;  1L88 A;  3U6M A;  1KW7 A;  4FDY A;  2F4G A;  1IC7 Y;  4LJ4 A;  1DXJ A;  3ATO A;  1CVK A;  3QAK A;  2XSZ A;  1HER A;  2EA0 A;  1W6Z A;  3DN6 A;  2CV1 A;  3WUL A;  3WVY A;  1WGN A;  1QTD A;  3TWM A;  4ET8 A;  1PQJ A;  3W6D A;  173L A;  4KL7 A;  1B5V A;  4LZJ A;  1C6M A;  3FYD A;  3TMV A;  5I4W A;  7LYZ A;  4LFC M;  3ZVQ A;  1JKA A;  3CTW B;  127L A;  4WM6 A;  3L27 A;  2BQF A;  1HNW M;  1QUD A;  2FNA A;  1V33 A;  3FUU A;  5APF A;  1OKS A;  4GHA A;  1LZ8 A;  2YBN A;  2E5L M;  4B4I A;  4XBO A;  1DV0 A;  114L A;  182L A;  1GHL A;  2XBR A;  4KLN A;  3L26 A;  4GRI A;  2KRK A;  2G4N A;  4UN2 B;  1IXZ A;  2V6Z M;  2YFQ A;  3FRI A;  1LZ1 A;  2RSC A;  3OK0 A;  1UAC Y;  224L A;  1CU6 A;  4PJZ A;  3HT9 A;  4W5W A;  3M7G A;  3TL4 X;  1C6P A;  2DQG Y;  3T36 A;  1GPQ C;  1F6R A;  1L84 A;  2OOB A;  1H6M A;  1L71 A;  4L16 A;  3GLF A;  2OPF A;  1LTM A;  2VII A;  5L8R F;  2BWB A;  4NOO B;  2DI0 A;  1L47 A;  3DMZ A;  5HLL A;  4LYT A;  4M0D A;  3DOA A;  3A92 A;  3B0K A;  3C3E A;  3HU8 A;  1VG5 A;  2Q0M X;  4LJ5 A;  1OVK A;  1LMQ A;  1DKJ A;  1BB5 A;  3HH3 A;  2D4I A;  3KOY E;  3FTE A;  4WLX A;  2LBC A;  1ZMW A;  4NSH A;  3HJ8 A;  257L A;  4OW0 A;  3FUW A;  3GQ3 A;  1LPY A;  2UU9 M;  2H9J A;  1C6N A;  4CHX A;  2L7H A;  4IBJ A;  3FA0 A;  1L49 A;  1XJT A;  2R4E A;  4WP2 A;  1GE4 A;  2GNO A;  3A93 A;  1GFK A;  4HP0 A;  1G3I A;  4WG7 A;  4OOT A;  2I26 L;  5HNC A;  2RBP A;  3AB6 A;  1JB0 F;  2ZNW Y;  2YVB A;  4UWV A;  245L A;  1L92 A;  2C8O A;  1L2C A;  3A6B Y;  2DVW B;  2Q2E B;  1J09 A;  4AZF A;  1IR9 A;  4HJY A;  3LZM A;  1C6D A;  1L06 A;  1QT8 A;  3FUX A;  3D4S A;  1DZB X;  5EP3 A;  3HTB A;  4B7H A;  2QBY A;  156L A;  4TUW A;  1D3F A;  1EQ5 A;  3TXK A;  2HKJ A;  3GXK A;  1C67 A;  1JKB A;  2C98 A;  2EIZ C;  1G0P A;  1L77 A;  1LSF A;  1QT3 A;  115L A;  2LCB A;  2L78 A;  1L29 A;  1L85 A;  1LZG A;  4ZEE A;  4DV6 M;  3EO5 A;  1L61 A;  1XGP C;  3LYM A;  3WU8 A;  5LYM A;  1L22 A;  1LMN A;  2BQO A;  1LZA A;  3A42 A;  1LZS A;  3HWS A;  3QAU A;  1PS5 A;  4OWH A;  5HNL A;  4B3M M;  1T6V L;  2HTX A;  3F9L A;  1LAA A;  1LJI A;  2GV0 A;  1CX6 A;  5JI2 E;  1L56 A;  1UBZ A;  1UIC A;  1J7K A;  4MST A;  3AKZ A;  1JWR A;  3HHY A;  220L A;  1QSW A;  4LZZ A;  1HJP A;  1L59 A;  4P16 A;  1DGH B;  3D3D A;  1BVK C;  2RGO A;  1GAZ A;  1L53 A;  3ZH9 B;  3WMK A;  3GRU A;  3A98 B;  2ZQ3 A;  1AUA A;  1GLN A;  5DL9 A;  3T38 A;  1C6J A;  1L0K A;  1L39 A;  4GN3 A;  198L A;  1YL0 X;  1CJ6 A;  4EIW A;  1L8Q A;  1PM5 A;  2D4K A;  3CF6 E;  1GL7 A;  1PJS A;  2EKS C;  2ZTC A;  1J5E M;  4L4U A;  143L A;  262L A;  5KPT A;  4G4C A;  2RH1 A;  3AGH A;  5HMV A;  5LYT A;  1IP5 A;  1BB7 A;  1I6S A;  1G7L C;  1HEP A;  1EFU B;  3EIE A;  2Z12 A;  1LCN A;  1D3N A;  1XGT C;  1QUS A;  3C82 A;  5IZ7 D;  2LNH C;  2OU9 A;  2HU1 A;  108L A;  4H9C A;  2JZ0 A;  5KPR A;  244L A;  4MGK E;  3HHZ A;  3BKV A;  3L25 A;  1P7S A;  1SX7 A;  3BKH A;  3WXU A;  4FWD A;  3AV0 A;  3A34 A;  4I7T A;  1OYU A;  2F47 A;  1L95 A;  2J7O A;  1XGU C;  4X65 M;  5LIO A;  1OAI A;  1KXY A;  1NHB A;  3HHW A;  3FKE A;  1QUH A;  3AJI B;  3KVW A;  4R3D A;  1TR8 A;  1P6Y A;  3C7Y A;  1QZE A;  2F4A A;  4B3T M;  1L05 A;  1L46 A;  3K9O A;  120L A;  3E4R A;  2DAK A;  3HTD A;  4GBR B;  4YEM A;  1LYI A;  4EKS A;  1YLA A;  1YSY A;  4QHS A;  4IAS A;  4KHP M;  3U5Z B;  1S3S A;  1VED A;  3DN8 A;  1JTN A;  2R65 A;  1VDL A;  1N77 A;  2FFJ A;  1KXX A;  1HEQ A;  5EXP A;  4DYG A;  1Z5B A;  2MEE A;  3E3D A;  2A7D A;  4NGZ A;  1P3N A;  1XXH E;  3RT5 X;  5EQT A;  4QEQ A;  1L67 A;  1L37 A;  1QUT A;  3KS8 A;  1QDT A;  2HHH M;  1UIG A;  4XJI A;  4NHI A;  4OWB A;  1REY A;  3SHF A;  4N0J A;  4N1C C;  3RFW A;  1D6Q A;  4Z8X A;  4GMQ A;  3M0E A;  1E9R A;  4GCB A;  4NRW A;  1GDW A;  1JUG A;  4ARM B;  2FE8 A;  260L A;  3I01 M;  2EPE A;  141L A;  1L75 A;  3HTG A;  1CV5 A;  3TMU A;  4G4Q A;  4LJ6 A;  1IP3 A;  3TMX A;  3HT8 A;  1LJK A;  1HSX A;  1QTZ A;  2DQE Y;  1SXJ C;  1DYA A;  3C9P A;  4DV7 M;  3HDE A;  1OVH A;  1VDP A;  3LYT A;  2LVN C;  4AG5 A;  1HFX A;  1C65 A;  2B75 A;  3A96 A;  1B5W A;  1DYC A;  1KS3 A;  1GB8 A;  3AOG A;  1LHK A;  1XXH A;  5IWA M;  3CDQ A;  1GJS A;  4MCK A;  3UK6 A;  1WVV A;  2J5Y A;  1CUP A;  2C96 A;  1GJT A;  5KQD A;  2P5T A;  1GB9 A;  147L A;  4G4H A;  1L48 A;  5FTJ A;  1L10 A;  1D3M A;  3TWL A;  2MR9 A;  2B72 A;  4G9S A;  1NSF A;  4LFA M;  3C8S A;  153L A;  3FE3 A;  1MU5 A;  1C6H A;  3AZ6 A;  1P2C C;  3UGJ A;  2HU3 A;  3HU2 A;  1BWH A;  5B05 A;  1MX0 A;  1OUB A;  5HQ1 A;  3WPJ A;  1D0L A;  4AGA A;  4NSJ A;  1L83 A;  2BAA A;  2G4P A;  1F10 A;  2DZN B;  3H4M A;  5FTL A;  3ILK A;  5C6L A;  4M9X A;  1B7L A;  1XMO M;  2OE4 X;  1XMQ M;  3WW5 A;  1TAY A;  2O5R A;  2QB0 B;  1EIJ A;  1YAO A;  5KXS A;  3U6Q A;  3LHM A;  1PJT A;  212L A;  4LFP A;  2DKL A;  4A7D A;  2CUU A;  236L A;  2ZWB A;  1DI4 A;  5FEK A;  2W82 A;  1IC4 Y;  1SXJ E;  3CT0 A;  5KY1 A;  4LGY A;  1C6Q A;  3PFI A;  4EJ4 A;  1LZC A;  210L A;  2HAK A;  1L45 A;  5KJ9 A;  1CUK A;  246L A;  3C83 A;  3JR6 A;  1UIB A;  2Z8Y M;  2DQJ Y;  1GB2 A;  3SAT A;  2Z38 A;  4AKI A;  3AFH A;  3RNX A;  2H5X A;  1QT6 A;  3CDR A;  175L A;  1LPI A;  3G3A B;  1XGR C; 
#chains in the Genus database with same CATH homology
 3CQL A;  1JJ1 A;  1RCM A;  1A2Y C;  221L A;  1DI5 A;  3GUP A;  3NYA A;  3AJN A;  2EQL A;  1OUI A;  4NHT A;  1DPX A;  4AQN A;  112L A;  2MED A;  4GN4 A;  1ZVY B;  1GF5 A;  3IWR A;  1INU A;  1G0M A;  151L A;  1G0G A;  5I14 A;  1L24 A;  5A3E A;  2BQG A;  4XJG A;  1NMM A;  1C6K A;  188L A;  192L A;  2XJW A;  3TXG A;  1L57 A;  207L A;  1UIH A;  3A3R X;  2DQD Y;  1EQ4 A;  1OUG A;  2B6W A;  1UA6 Y;  1G7M C;  1LWG A;  1IWU A;  1QTE A;  1LMP A;  3CB7 A;  3CSQ A;  3W6C A;  5LVG A;  4H9H A;  2BQL A;  5LAF A;  1IOT A;  2CJL A;  4NEB A;  4L41 A;  2DQF C;  1FN5 A;  4WO9 A;  3P64 A;  1HFZ A;  1L16 A;  261L A;  4I7P A;  223L A;  2LC9 A;  1QTK A;  1ZYT A;  4WOA A;  1L17 A;  1LYS A;  144L A;  1TDY A;  2RAY X;  2YBH A;  1C6C A;  4Z3M A;  5DM9 A;  4W55 A;  4ARQ A;  4YM8 A;  1IEE A;  4ANR A;  1D6P A;  4W94 A;  3B72 A;  4K5Y A;  3PBL A;  5E9R A;  1OUH A;  102L A;  3K2R A;  5E4P A;  1P46 A;  1J1O Y;  3WVX A;  1L62 A;  4I7K A;  2DQI Y;  4DWX A;  2D4J A;  1L80 A;  1HEM A;  1KIP C;  1XEK A;  1JIT A;  3P68 A;  1L54 A;  3A90 A;  2RBQ A;  4Z98 A;  2NTG A;  2OE7 X;  1JKD A;  2ANX A;  3SBA A;  1A4V A;  2BLY A;  1NDM C;  1C45 A;  1L64 A;  2RBO A;  215L A;  3L2X A;  2D6B A;  1WTM A;  4KT3 A;  5ILF A;  3QNG A;  2O4W A;  4LDO A;  3CDO A;  2ZIJ A;  4C3W A;  1L07 A;  1FLU A;  3DNA A;  3A67 Y;  1NDG C;  1GFE A;  3WUA A;  3WU9 A;  1L74 A;  5FHW A;  5KXT A;  4EPI A;  1EQE A;  4N8Z A;  4NY5 A;  3TMW A;  2BLX A;  3W6A A;  1LYJ A;  1C60 A;  3DN3 A;  1EL1 A;  1JQU A;  1UIA A;  3ATN A;  3MGW A;  3AZ7 A;  1ZVH L;  1L28 A;  2RAZ X;  5B1G A;  1B7M A;  4D9Z A;  1G1V A;  1L04 A;  2B5Z A;  1L42 A;  3QY4 A;  1LZT A;  1FLY A;  3WL2 A;  4I7J A;  1EPY A;  201L A;  1LSY A;  1GB6 A;  2IFF Y;  1LZY A;  1C7P A;  1L12 A;  2MEB A;  2LYZ A;  5I5Q A;  107L A;  5L9J A;  2LZT A;  2PC2 A;  3IJU A;  1CV4 A;  225L A;  150L A;  5B1F A;  1KIQ C;  157L A;  4ETE A;  2Z39 A;  213L A;  1L19 A;  189L A;  2ZNX Y;  5EBH A;  1HMK A;  1OQM A;  3C81 A;  1IR7 A;  1LYZ A;  1VAT A;  1VAU A;  194L A;  1L51 A;  2Q9E A;  1LI3 A;  197L A;  5IEL A;  250L A;  1D2W A;  4QGZ A;  1KY1 A;  4W53 A;  232L A;  123L A;  4HTK A;  1GFJ A;  5K7O A;  1CJ9 A;  1L26 A;  4RLN A;  3W6B A;  4GCF A;  2F30 A;  4TSC A;  163L A;  1GE0 A;  1KW5 A;  4NGK A;  4NGO A;  4ARP A;  1YKZ X;  2B73 A;  3RZE A;  4DD2 A;  171L A;  4LYC A;  4DKL A;  1D9U A;  2ZYC A;  160L A;  3P4Z A;  4W58 A;  4DAJ A;  140L A;  1L96 A;  1GBW A;  1QTB A;  3A91 A;  1BQL Y;  1B7O A;  2Z2F A;  4LT1 A;  3GUM A;  4WL6 A;  2RB1 X;  4TUN A;  1LWK A;  2O7A A;  149L A;  1D9W A;  1FKQ A;  1OUA A;  1L63 A;  4WM1 A;  3N9C A;  3HBE X;  3NY9 A;  1VDS A;  1CJ8 A;  5APE A;  1MEL L;  7LZM A;  4O34 A;  4PK0 A;  1SSW A;  1UID A;  177L A;  4II8 A;  1XEP A;  1L86 A;  1TCY A;  1L32 A;  1HEO A;  4EOF A;  4HTN A;  4OWA A;  1LGX A;  2BQJ A;  231L A;  5LA8 A;  1FLQ A;  4TTD A;  248L A;  9LYZ A;  1DYD A;  237L A;  183L A;  5KXZ A;  2BQA A;  111L A;  3LYZ A;  1GEV A;  5B07 A;  1GB5 A;  4IJ4 A;  1B7Q A;  1ZUR A;  4E97 A;  1YRO A;  3GUJ A;  2MEC A;  155L A;  2OTY X;  206L A;  2BQM A;  1L94 A;  4GCD A;  4H9E A;  4HPE A;  1LKR A;  1LSM A;  3LZ2 A;  4LT2 A;  113L A;  2A4T A;  1L15 A;  1L14 A;  1T8G A;  4XJF A;  4NWH A;  4YEN A;  1B0D A;  2N5Z A;  3SB6 A;  218L A;  1L21 A;  1KY0 A;  1UC0 A;  3CT1 A;  4M6D A;  1LMT A;  129L A;  5I4X A;  4H9B A;  1LZ9 A;  1GBS A;  1WQM A;  1JTM A;  1C46 A;  1L44 A;  3TXE A;  3TXJ A;  4HV1 A;  1C08 C;  1GFG A;  3HH6 A;  4W56 A;  1NBZ C;  3G3B B;  4H91 A;  3DMX A;  4LYB A;  3V2W A;  3P66 A;  2I6Z A;  5KXX A;  1P5C A;  3F6Z A;  4TX7 A;  1NF5 A;  1LI2 A;  1XEJ A;  4BAD A;  1B7R A;  2YBM A;  1LYF A;  1P64 A;  1RJC B;  1QTV A;  1NBY C;  1QT5 A;  3SB9 A;  4H8X A;  4ARJ A;  4MR1 A;  1P56 A;  1FLW A;  3VW7 A;  2FYD A;  4LYM A;  3EML A;  137L A;  4DD7 A;  2OTZ X;  168L A;  3C7W A;  3AYQ A;  2Z6B A;  3SP3 A;  1I20 A;  148L E;  5JEN B;  1OV7 A;  2DQH Y;  5F16 A;  3KAM A;  1IWY A;  3CSR A;  1IOR A;  3GUL A;  4PRQ A;  1L68 A;  3WUN A;  4ARM A;  211L A;  5APD A;  1L00 A;  1L18 A;  3TXF A;  1L79 A;  5LIN A;  255L A;  1OV5 A;  1GBY A;  3FE0 A;  5DLA A;  4DD0 A;  3AW6 A;  3LYO A;  1RI8 B;  1NWG A;  1F6S A;  4E3U A;  208L A;  2DQA A;  5I53 A;  4H92 A;  1GAY A;  1JSF A;  1L36 A;  5I4Y A;  2HEB A;  1L34 A;  5LVI A;  1L20 A;  3TXD A;  216L A;  4ZFP A;  4DJH A;  4TSB A;  251L A;  2HEC A;  4R0F A;  3ODU A;  4NHQ A;  4ZPU A;  4LZM A;  1QUO A;  4H93 A;  8LYZ A;  1LSA A;  1CV1 A;  4I7S A;  1G0J A;  1DYE A;  5KXP A;  4EPF A;  2HUK A;  4WL7 A;  1QSB A;  1L11 A;  5KKI A;  161L A;  1IWX A;  1C66 A;  4UWN A;  1ZV5 L;  1OUE A;  125L A;  2RBS A;  6LYT A;  1LSC A;  162L A;  1GFH A;  4IAT A;  4B4E A;  1GF4 A;  3A94 A;  3WPL A;  2HEE A;  1CV0 A;  1I56 A;  2NWD X;  4NG1 A;  4W52 A;  1HF4 A;  1JPO A;  3ZEK A;  214L A;  4OO9 A;  1WQN A;  1LHH A;  1OVJ A;  1GF0 A;  1L60 A;  1CU3 A;  239L A;  4WM3 A;  1D0M A;  1L31 A;  1AT6 A;  1XEI A;  4DC4 A;  1LYH A;  1G07 A;  3SB5 A;  1LZE A;  1GFR A;  1C68 A;  3UON A;  1P36 A;  2F32 A;  1C6I A;  4YOP A;  5DN5 A;  3V2Y A;  1BB4 A;  4EXM A;  1ZMY L;  4J7V A;  4CFP A;  195L A;  2DBT A;  4RW1 A;  1HEL A;  3HU9 A;  1L98 A;  1C6G A;  1IP4 A;  103L A;  4EKP A;  3HUQ A;  4W51 A;  138L A;  2QAR C;  4U3X B;  4HV2 A;  122L A;  4TWS A;  1IVM A;  109L A;  158L A;  2A7F A;  2ZIK A;  1LZ4 A;  2HED A;  4WLD A;  1C62 A;  1N4F A;  1LHM A;  1CV6 A;  1L73 A;  2Y8P A;  1LJN A;  4LT0 A;  1L41 A;  3EXD A;  4I0C A;  3N9E A;  1IWT A;  4N9R A;  1P37 A;  3QE8 A;  2MEA A;  1YAQ A;  2RBN A;  4PHI A;  1LYG A;  6LYZ A;  1LSE A;  4GCC A;  1GBZ A;  3WXT A;  5II3 A;  1DQJ C;  2H9K A;  4WM5 A;  3W6F A;  1C6A A;  1L70 A;  167L A;  1H87 A;  5F9U A;  4ZIX A;  2XQO A;  4CGE A;  1YQV Y;  1GF7 A;  3G3X A;  2LZM A;  187L A;  1LHJ A;  241L A;  174L A;  1HFY A;  1LJ4 A;  2BQB A;  4OW1 A;  1GDX A;  209L A;  4YXC A;  4G49 A;  3CSZ A;  4J0L A;  4B1A A;  3B0I A;  1GE2 A;  1JJ0 A;  2CWI A;  1GF8 A;  131L A;  5AMY A;  2LYO A;  1JIY A;  5KXW A;  4P2E A;  1B5X A;  1TEW A;  2HUM A;  1G7H C;  1CKC A;  2Z37 A;  1XGQ C;  1B2K A;  1L81 A;  1B5Y A;  1D0K A;  3D9A C;  2B6T A;  1GWD A;  1BVX A;  4NGI A;  4YXA C;  1HHL A;  1L69 A;  3G3V A;  1CU2 A;  1KNI A;  217L A;  1JIS A;  5ILC A;  4BAP A;  1LSD A;  3A3Q A;  3W6E A;  4PJ2 C;  4I7N A;  1IOQ A;  1KIR C;  3C7Z A;  110L A;  1PQM A;  3HDF A;  3GUO A;  3CT5 A;  4NGJ A;  4OOO A;  4WM4 A;  1LJ3 A;  1CX7 A;  1JKC A;  4XJH A;  2MEF A;  4QDN A;  3GUK A;  4I7L A;  193L A;  1LJJ A;  1LSP A;  4XJB A;  1L52 A;  1VDQ A;  4ETD A;  2OE9 X;  4ET9 A;  3C8R A;  249L A;  5F81 A;  3AGG G;  4DT3 A;  4IAP A;  1L72 A;  1WQO A;  5B59 A;  5LA5 A;  2MEG A;  2Q9D A;  1T97 A;  1T6H A;  1IWV A;  2F2N A;  1PQI A;  1P2L A;  4DDA A;  4OWE A;  154L A;  3M18 B;  4HSF A;  205L A;  1LZN A;  2XBS A;  1G7J C;  3J4G A;  5F9X A;  1LKS A;  152L A;  1FDL Y;  4R6C A;  1L40 A;  146L A;  104L A;  2YBI A;  1GBO A;  4M4O A;  1T8A A;  5M1Y A;  1GB0 A;  3IJV A;  4AXT A;  3C8Q A;  4XEN A;  3GUN A;  1IR8 A;  2B6X A;  230L A;  1HC0 A;  4XAD A;  3ZVQ B;  3WW6 A;  1LMA A;  4CJ2 A;  3AGI A;  2BQC A;  4W57 A;  1YAN A;  1GF3 A;  2BQK A;  1HML A;  2CDS A;  1ALC A;  4WG1 A;  1QTC A;  3VWO A;  5A3Z A;  2LZ2 A;  2FBB A;  4HJV A;  1T3P A;  1L76 A;  4NWE A;  1DYG A;  3CDV A;  5FDJ A;  3B0O A;  1C61 A;  4OWC A;  1GEZ A;  1C6T A;  3A6C Y;  3B6L A;  1GFU A;  4NIJ A;  3G3W A;  3C80 A;  3RUN A;  3AW7 A;  5KXY A;  4LZT A;  1HSW A;  1CKF A;  1GFA A;  3SB7 A;  2MEI A;  1P2R A;  1QTH A;  1WQR A;  3LN2 A;  4XJD A;  184L A;  1DYF A;  1LOZ A;  4GCE A;  1L97 A;  2XTH A;  3EMS A;  5APC A;  258L A;  4PGJ B;  135L A;  1REX A;  1AT5 A;  191L A;  3OJP A;  1I1Z A;  3HWL A;  3OE9 A;  3DN0 A;  1QS9 A;  4I7R A;  1C6B A;  1WVU A;  1DYB A;  1IWW A;  5FEL A;  1SWY A;  1W08 A;  4EMN A;  233L A;  1LSZ A;  1G0K A;  1QIO A;  5D5C A;  176L A;  228L A;  1B6I A;  1Z55 A;  1LGU A;  1CU0 A;  1L35 A;  4DDB A;  1JTT L;  5I54 A;  240L A;  3NY8 A;  190L A;  4NGV A;  1YIL A;  3PDS A;  5C6I A;  200L A;  4NSG A;  2YBL A;  4ARL A;  4EKQ A;  3RZ4 A;  2DKV A;  1LSG A;  2W1M A;  1QSQ A;  3FI7 A;  5KXL A;  3W3E A;  4H94 A;  172L A;  4WMG A;  4G4B A;  4LDL A;  238L A;  4LGK A;  5LVJ A;  1L03 A;  1GXX A;  1L38 A;  1L43 A;  4LYO A;  4Z41 A;  1JJ3 A;  4W54 A;  235L A;  6LZM A;  4NHP A;  1L50 A;  199L A;  1C6E A;  4GLA A;  1JSE A;  3HH4 A;  3CDT A;  2B70 A;  4B49 A;  4LYZ A;  4C5F A;  1T8F A;  1JEF A;  5LYZ A;  4GRV A;  1GD6 A;  1SWZ A;  4Z46 A;  2IHL A;  2CGI A;  1FKV A;  2B7X A;  4J1B A;  4NFV A;  2W1Y A;  4H8Z A;  1L58 A;  1C64 A;  4NG8 A;  1L25 A;  1G0Q A;  4DD9 A;  1L30 A;  5KXK A;  4WLY A;  219L A;  1GB3 A;  1IOC A;  2LYM A;  1FBI X;  2BQD A;  2B6Z A;  133L A;  4RLM A;  5LAG A;  3P65 A;  1L23 A;  1JHL A;  1QT7 A;  1GBX A;  2BPU A;  4H90 A;  3ULR A;  1K28 A;  4I8S A;  4ETB A;  1LGW A;  1XSF A;  1UIF A;  4ETA A;  4B0D A;  1SX2 A;  2H5Z A;  4NGY A;  4B4J A;  2ZYP A;  1PQK A;  1HEN A;  1OWZ A;  5IDD A;  1B7P A;  128L A;  1QSA A;  1HEW A;  1XJU A;  2LHM A;  165L A;  1SSY A;  2HUB A;  1C6L A;  1DPW A;  4YX7 C;  5FST A;  1WTN A;  4WLT A;  1L33 A;  4H9I A;  3LZT A;  1GFV A;  1B7S A;  3HUA A;  1L89 A;  1GFT A;  1WQQ A;  1D2Y A;  1BHZ A;  4I7Q A;  4KPM A;  4YF2 A;  1IOS A;  1L87 A;  1B5U A;  2YDG A;  5J7C A;  2YSS C;  2BQH A;  2OU8 A;  1LJE A;  1CU5 A;  1YAP A;  119L A;  5KXR A;  1B7N A;  2W1X A;  1V7S A;  4HTQ A;  3OE8 A;  1LYE A;  1VFB C;  1BGI A;  3WPK A;  169L A;  1BWJ A;  3SN6 R;  4DD3 A;  2B6Y A;  1YKY X;  1JTO L;  3FI5 A;  3WU7 A;  1QDR A;  142L A;  1C69 A;  1IP1 A;  3OE0 A;  1NKH A;  4W59 A;  1DI3 A;  256L A;  3GXR A;  4N5R A;  4NSI A;  3SB8 A;  226L A;  5LXW A;  3OE6 A;  1WTH A;  2IGC A;  2Z18 A;  4GLV A;  1L82 A;  1YKX X;  2Z2E A;  3AZ4 A;  1VDT A;  2W1L A;  1B5Z A;  1HNL A;  181L A;  1BB6 A;  243L A;  1L13 A;  5B06 A;  1L27 A;  4YEO A;  5FCP A;  5KKJ A;  1LMC A;  1GE1 A;  1YAM A;  4H9A A;  1SQ2 L;  4S0W A;  1LHI A;  3EBA B;  4H1P A;  2G4Q A;  3SBB C;  1CV3 A;  3HFM Y;  4H9F A;  1L99 A;  242L A;  5KXN A;  1BWI A;  1SLY A;  1WQP A;  5LZM A;  4HJZ A;  4LT3 A;  4W96 A;  2D91 A;  1L08 A;  1LSN A;  3FAD A;  4WM2 A;  2O79 A;  1PZY A;  3AZ5 A;  3RU5 A;  170L A;  1OUC A;  5HMJ A;  1RFP A;  3HT6 A;  4CFO A;  1REZ A;  1LZ6 A;  3TXB A;  3HBH A;  1TBY A;  4FJR A;  1QS5 A;  4GN5 C;  1AM7 A;  1GB7 A;  2B74 A;  1TLA A;  1LI6 A;  2HEF A;  5D5F A;  186L A;  3WH1 A;  4XN6 A;  5DN4 A;  1L66 A;  4LDE A;  145L A;  196L A;  1D3J A;  1CNS A;  4I7O A;  222L A;  3RW8 A;  229L A;  2RB2 X;  4RDS A;  1IP6 A;  5LVK A;  1IC5 Y;  2DQC Y;  4NHS A;  3DN4 A;  1PQD A;  4DD1 A;  2HEA A;  254L A;  3L64 A;  1CUQ A;  134L A;  1QQY A;  132L A;  5L3H A;  5T3F A;  4DQ5 A;  1AKI A;  3WUM A;  1IY4 A;  3TXI A;  1CKD A;  4DDC A;  1IIZ A;  1L65 A;  4HPI A;  118L A;  1LZ5 A;  1GE3 A;  1LJG A;  2WAR A;  4DQJ A;  5C6J A;  178L A;  1IP7 A;  1LMO A;  3DKE X;  1LW9 A;  1V7T A;  2MEH A;  1LYD A;  4J1A A;  1L09 A;  1ZWN A;  1OWY A;  1J1X Y;  2ANV A;  247L A;  4NGL A;  139L A;  5LVH A;  2BQN A;  4WO6 A;  1L01 A;  2ZQ4 A;  2OU0 X;  1UUZ C;  3WYH A;  1GF6 A;  1XFP L;  2FBD A;  3DN1 A;  2I25 L;  2AUB A;  1C43 A;  5KXO A;  3N9A A;  1GF9 A;  1L90 A;  2NTH A;  1LYO A;  4XYY A;  4EKR A;  1E8L A;  4BAF A;  4ARQ B;  2ZIL A;  3M3U A;  3HT7 A;  1O23 A;  1JTP L;  2X0A A;  1PQO A;  3DMV A;  4X3B A;  1C10 A;  1OP9 B;  4N1E I;  164L A;  1F0W A;  1NHE A;  253L A;  2RB0 X;  1UIE A;  4UWU A;  180L A;  1AZF A;  1BB3 A;  2F2Q A;  3GUI A;  3DN2 A;  1LZR A;  227L A;  1LJH A;  5L3I A;  4ETC A;  3HTF A;  5KXM A;  1C6F A;  3A8Z A;  1B9O A;  4RW2 A;  1MLC E;  2BQE A;  4PRU A;  1OUD A;  259L A;  4BS7 A;  1LZD A;  1G1W A;  4PPO A;  3A95 A;  166L A;  1L93 A;  1QUG A;  1G06 A;  1QT4 A;  1OUJ A;  4H8Y A;  1OUF A;  1YIK A;  1C63 A;  2FYC A;  1IY3 A;  1CKH A;  2YBJ A;  1IX0 A;  1J1P Y;  1G0L A;  1LHL A;  2Z19 A;  2RBR A;  2BQI A;  4NGW A;  3F8V A;  4LFX A;  1RE2 A;  2C8P A;  4I7M A;  1LYY A;  252L A;  4DQ7 A;  1IP2 A;  1CJ7 A;  1L02 A;  1L91 A;  126L A;  1IWZ A;  1LZB A;  1YL1 X;  3T6U A;  2HUL A;  1LSB A;  1LJF A;  1CTW A;  3J6K A;  5IHG A;  1G7I C;  159L A;  1LLH A;  4QY9 A;  1L55 A;  3TXH A;  2OEA X;  1L0J A;  2VB1 A;  1NQI A;  1GXV 2;  1IO5 A;  3K3T A;  5F14 A;  1CKG A;  3HUK A;  1DKK A;  3HBD A;  185L A;  234L A;  130L A;  1UCO A;  4ML7 A;  1KXW A;  4KXI A;  1REM A;  3HH5 A;  1L88 A;  1KW7 A;  4FDY A;  2F4G A;  1IC7 Y;  1DXJ A;  3ATO A;  1CVK A;  3QAK A;  1HER A;  1W6Z A;  3DN6 A;  3WUL A;  3WVY A;  1QTD A;  4ET8 A;  1PQJ A;  3W6D A;  173L A;  4KL7 A;  1B5V A;  1C6M A;  5I4W A;  3TMV A;  7LYZ A;  3ZVQ A;  1JKA A;  127L A;  4WM6 A;  2BQF A;  1QUD A;  5APF A;  1LZ8 A;  2YBN A;  4B4I A;  114L A;  182L A;  1GHL A;  2XBR A;  2G4N A;  1LZ1 A;  2RSC A;  3OK0 A;  1UAC Y;  224L A;  1CU6 A;  4PJZ A;  3HT9 A;  1C6P A;  2DQG Y;  3T36 A;  1GPQ C;  1F6R A;  1L84 A;  1H6M A;  1L71 A;  1LTM A;  1L47 A;  3DMZ A;  5HLL A;  4LYT A;  3A92 A;  3B0K A;  3HU8 A;  2Q0M X;  1OVK A;  1LMQ A;  1DKJ A;  1BB5 A;  3HH3 A;  2D4I A;  4WLX A;  4NSH A;  257L A;  1LPY A;  2H9J A;  1C6N A;  4CHX A;  3FA0 A;  1L49 A;  1XJT A;  1GE4 A;  3A93 A;  1GFK A;  4HP0 A;  4WG7 A;  4OOT A;  2I26 L;  5HNC A;  2RBP A;  3AB6 A;  2ZNW Y;  2YVB A;  4UWV A;  245L A;  1L92 A;  2C8O A;  3A6B Y;  4HJY A;  1IR9 A;  3LZM A;  1C6D A;  1L06 A;  1QT8 A;  3D4S A;  1DZB X;  3HTB A;  156L A;  1D3F A;  1EQ5 A;  3TXK A;  3GXK A;  1C67 A;  1JKB A;  2EIZ C;  1G0P A;  1L77 A;  1LSF A;  1QT3 A;  115L A;  2LCB A;  2L78 A;  1L29 A;  1L85 A;  1LZG A;  4ZEE A;  3EO5 A;  1L61 A;  1XGP C;  3LYM A;  3WU8 A;  5LYM A;  1L22 A;  1LMN A;  2BQO A;  1LZA A;  1LZS A;  4OWH A;  1PS5 A;  5HNL A;  1T6V L;  2HTX A;  3F9L A;  1LAA A;  1LJI A;  2GV0 A;  1CX6 A;  1L56 A;  1UBZ A;  1UIC A;  4MST A;  1JWR A;  220L A;  1QSW A;  1L59 A;  3D3D A;  1BVK C;  1GAZ A;  1L53 A;  3WMK A;  2ZQ3 A;  5DL9 A;  1C6J A;  4GN3 A;  1L0K A;  1L39 A;  198L A;  1YL0 X;  1CJ6 A;  2D4K A;  2EKS C;  143L A;  262L A;  4G4C A;  2RH1 A;  3AGH A;  5HMV A;  5LYT A;  1IP5 A;  1BB7 A;  1I6S A;  1G7L C;  1HEP A;  2Z12 A;  1LCN A;  1D3N A;  1XGT C;  1QUS A;  3C82 A;  2OU9 A;  2HU1 A;  108L A;  4H9C A;  244L A;  3BKV A;  1P7S A;  1SX7 A;  3BKH A;  3WXU A;  3A34 A;  4I7T A;  1OYU A;  2F47 A;  1L95 A;  1XGU C;  5LIO A;  1KXY A;  1NHB A;  1QUH A;  1P6Y A;  3C7Y A;  2F4A A;  1L05 A;  1L46 A;  120L A;  3HTD A;  4GBR B;  4YEM A;  1LYI A;  4EKS A;  4IAS A;  1VED A;  3DN8 A;  1JTN A;  1KXX A;  1HEQ A;  4DYG A;  2MEE A;  3E3D A;  2A7D A;  4NGZ A;  1P3N A;  3RT5 X;  4QEQ A;  1L67 A;  1L37 A;  1QUT A;  1UIG A;  1QDT A;  4XJI A;  4NHI A;  4OWB A;  1REY A;  4N0J A;  4N1C C;  1D6Q A;  4GCB A;  1GDW A;  1JUG A;  4ARM B;  260L A;  2EPE A;  141L A;  1L75 A;  3HTG A;  1CV5 A;  3TMU A;  1IP3 A;  3TMX A;  3HT8 A;  1LJK A;  1HSX A;  1QTZ A;  2DQE Y;  1DYA A;  3HDE A;  1OVH A;  1VDP A;  3LYT A;  1HFX A;  1C65 A;  2B75 A;  3A96 A;  1B5W A;  1DYC A;  1KS3 A;  1GB8 A;  1LHK A;  3CDQ A;  4MCK A;  1WVV A;  1CUP A;  1GB9 A;  147L A;  4G4H A;  1L48 A;  1L10 A;  1D3M A;  2B72 A;  4G9S A;  3C8S A;  153L A;  1C6H A;  3AZ6 A;  1P2C C;  2HU3 A;  1BWH A;  5B05 A;  1OUB A;  5HQ1 A;  3WPJ A;  1D0L A;  4AGA A;  4NSJ A;  1L83 A;  2BAA A;  2G4P A;  1F10 A;  5C6L A;  1B7L A;  2OE4 X;  3WW5 A;  1TAY A;  2QB0 B;  1YAO A;  5KXS A;  3LHM A;  212L A;  4LFP A;  4A7D A;  2CUU A;  236L A;  2ZWB A;  1DI4 A;  5FEK A;  1IC4 Y;  3CT0 A;  5KY1 A;  1C6Q A;  4EJ4 A;  1LZC A;  210L A;  5KJ9 A;  1L45 A;  246L A;  3C83 A;  3JR6 A;  1UIB A;  2DQJ Y;  1GB2 A;  2Z38 A;  3RNX A;  1QT6 A;  3CDR A;  175L A;  1LPI A;  3G3A B;  1XGR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...