1D0KA

The escherichia coli lytic transglycosylase slt35 in complex with two murodipeptides (glcnac-murnac-l-ala-d-glu)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
314
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 108
structure length 314
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0kA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0kA02
2I6ZA 1G7HC 2HU1A 3QE8A 1I20A 1QTKA 1JKDA 1YAMA 1WVVA 2HEFA 4PHIA 4NHQA 1B5XA 2DQFC 4GLVA 4PPOA 4WM6A 4WM4A 1LMOA 1LAAA 4CFOA 1LSFA 5IDDA 1HEWA 1VDQA 2LYOA 4W96A 3A91A 3VWOA 4DT3A 1HEPA 1HFZA 4NGYA 4KPMA 2CWIA 4NGLA 1HF4A 1CJ8A 4B4EA 1F6RA 1YKZX 3P66A 4ETEA 1GFVA 1LZYA 3AZ7A 2BQHA 1B5WA 1IC4Y 2MEDA 3WULA 3QNGA 1LHIA 3B6LA 1W6ZA 3TMWA 3ATOA 4GN5C 4B4JA 1XEJA 1GE0A 3AGHA 4J0LA 5B06A 2DQEY 1OUGA 4IJ4A 5FELA 4NEBA 1B7SA 1DKJA 1JISA 1GF4A 1LSCA 1FDLY 4C5FA 1NKHA 1HENA 4H9AA 1JPOA 3CSQA 4DD9A 1OUJA 1HEMA 2EKSC 3WW6A 1GFAA 2DQJY 1GD6A 1VATA 2XJWA 3LN2A 3B0OA 1C46A 1UIBA 1TAYA 1GFHA 1B2KA 2MEAA 4DD7A 4NHIA 1WQRA 1FBIX 3CT5A 1GAZA 4N9RA 4TSBA 4YOPA 2BQKA 3A67Y 5A3EA 2XTHA 1NWGA 4WL6A 1LSBA 1GWDA 2DKVA 4WM2A 1LSAA 1FLYA 3HFMY 3EXDA 1QDRA 2BQCA 4GCCA 1JKAA 4OWBA 1UIAA 1IORA 1EQ5A 2FBDA 4WLDA 1MLCE 4H91A 3WU9A 1INUA 1GB9A 1I56A 1YANA 3J4GA 1G7MC 1OP9B 4PRUA 4DDAA 1YAOA 4N1EI 1KIRC 2D4JA 3P64A 4LGKA 4LYMA 1GB8A 1WVUA 2F30A 1CKDA 3WL2A 4Z41A 1D0KA 2A7FA 3D9AC 5LVHA 2BQGA 1GF9A 4H8XA 1IP4A 1OUHA 1BQLY 2A7DA 4HJZA 1HFXA 3M18B 5KKIA 5J7CA 4ETDA 3A95A 1LYOA 3LYTA 3ZVQA 6LYTA 133LA 1LJGA 4W94A 4UWUA 1J1OY 5HLLA 1HC0A 4H9EA 1XGQC 1CKHA 1NHEA 1YIKA 2LHMA 4NG1A 5KY1A 1B5UA 1LZTA 2WARA 4QDNA 3RW8A 194LA 4H9IA 2ZIJA 4H9HA 1IP2A 1UA6Y 2X0AA 2EIZC 3QY4A 3AGIA 1F6SA 2XBSA 5DLAA 5FDJA 1OUBA 3TMVA 1BB4A 1LZ5A 2MEIA 4E3UA 1WQPA 1DPXA 4BS7A 3WVYA 2HEBA 4YENA 3AZ6A 1IP6A 1LHLA 4CFPA 2ZYCA 3WW5A 3TXJA 1VDPA 3M3UA 4LT2A 3A93A 1OUCA 3B72A 1E8LA 1FKQA 4M4OA 2Z2FA 3RNXA 4GCFA 1XFPL 1CKGA 2MEHA 5APDA 2BPUA 1NMMA 1VEDA 1A2YC 2DQHY 1JUGA 3A8ZA 5DM9A 1YL1X 3AZ4A 4EOFA 1VDSA 1JKBA 4DD1A 1JITA 3EO5A 4H90A 4I0CA 4GN3A 2W1XA 1H6MA 4I8SA 4DC4A 2DQAA 4L41A 3HBDA 5LA5A 5F16A 5HMVA 1GF3A 5C6JA 1IY4A 1NBZC 2C8PA 4TTDA 2BQFA 3A6CY 1JSEA 1QSWA 3BKVA 4QGZA 1IO5A 5HMJA 1BB7A 4NGIA 4TWSA 1GF8A 4XYYA 4NGZA 3WPLA 4MR1A 5HQ1A 2W1LA 5E9RA 3WUAA 1O23A 2W1MA 1SQ2L 1CKCA 1DI5A 1BB5A 4HP0A 1J1XY 1LZRA 4GN4A 4KL7A 2BLXA 4CJ2A 3A90A 1LSDA 1ALCA 1TBYA 2CDSA 2YBNA 4WO6A 5APFA 1KXXA 3WPKA 5KJ9A 4LFPA 4R0FA 5LIOA 4B4IA 4G4CA 4LYCA 2DQGY 2MEBA 3ATNA 4GCBA 1ZMYL 1BWJA 2G4QA 4ETBA 4OWAA 1B7LA 1DZBX 1LHMA 3IJVA 4KXIA 1GEZA 5I54A 2MECA 4LYOA 1VDTA 1LZ6A 3WPJA 5ILCA 1JTTL 5KXKA 1GBOA 1GFEA 1QSAA 2LYMA 4HPEA 4XJBA 5KXOA 2BAAA 4A7DA 4G4BA 3TMXA 135LA 4HSFA 4PGJB 6LYZA 1DXJA 1JHLA 3LHMA 2ZIKA 5LA8A 4H9CA 1GF6A 2BQOA 2D91A 4IATA 5I5QA 3IWRA 1UC0A 4ZEEA 4H94A 5II3A 5DN5A 2AUBA 1IOTA 1T3PA 3N9AA 4OOOA 4XJDA 2ZWBA 5F9XA 2ZYPA 1V7SA 4NSJA 3WVXA 1YKYX 2NWDX 5HNCA 1LHKA 1C43A 1YROA 1YAQA 5M1YA 1B9OA 1BWIA 1HEQA 1LSPA 1OQMA 2BQDA 2Y8PA 4HJYA 4NGWA 1JEFA 1OUAA 2LZTA 2XBRA 132LA 1LMTA 4NSHA 4ET8A 1B7MA 1IOCA 2MEGA 154LA 4H93A 4NHSA 1UUZC 2CJLA 4O34A 4ET9A 4WL7A 1LZAA 1RCMA 4EMNA 5KXRA 3CT0A 4XN6A 2W1YA 4RLMA 1IP1A 3BKHA 1NBYC 2MEEA 2ZQ3A 4J1BA 2HEDA 1KXYA 1QDTA 1UACY 2DBTA 1XGPC 3RT5X 1JWRA 5B05A 2BQMA 207LA 2MEFA 4HTKA 4B49A 3CQLA 4NSGA 4DYGA 1DQJC 3P65A 4N5RA 4UWNA 5KXPA 3ZVQB 1CKFA 1JTOL 4NGOA 3AW7A 2EPEA 4G49A 4OWCA 1HERA 2EQLA 4II8A 2HUBA 1LTMA 1QQYA 4NGVA 1IWZA 1GXV2 4NGKA 3AB6A 4BAFA 2BQLA 2YVBA 1IR7A 2Z38A 1IC5Y 1MELL 1REYA 1OUDA 1IEEA 1HSXA 1REMA 1B5YA 1IY3A 1HNLA 3AJNA 1BB6A 3N9EA 3ZEKA 1LSGA 1W08A 4MSTA 4WLYA 1AZFA 4DD3A 1LZEA 1YKXX 5FCPA 1GB6A 3E3DA 2B5ZA 1GB5A 1LYSA 3FE0A 1IIZA 1KIPC 1GPQC 2N5ZA 1C10A 3OJPA 2ZQ4A 2BQBA 1LSNA 3K3TA 5F81A 2H5ZA 4AGAA 1B7OA 4G9SA 2F4AA 1BHZA 4NHTA 3W3EA 1BWHA 2FBBA 5KXXA 1D6QA 5KXLA 1IC7Y 5A3ZA 3P68A 2YSSC 4ANRA 2YBJA 5F14A 5LVJA 4HTQA 1GF0A 1LJFA 3J6KA 1I1ZA 4WM3A 5HNLA 3KAMA 3W6FA 1EL1A 3F6ZA 2YBHA 3WU8A 3CT1A 2HTXA 2BQEA 1AT6A 3OK0A 5AMYA 2YBLA 3AW6A 1VAUA 2RSCA 1ZV5L 4NHPA 3TMUA 3AZ5A 1GB7A 1D9UA 3AGGG 4FDYA 1GB2A 3LZTA 1LZ8A 2Z37A 4LFXA 1GE4A 1LMQA 1GFGA 1VFBC 3A92A 4PRQA 3ULRA 2HEAA 3W6AA 1JTPL 4OWEA 3N9CA 3TXDA 2G4PA 4AXTA 4ZFPA 2ZNWY 1YAPA 1QIOA 4RW2A 5L3HA 1LJHA 3CSRA 3LYOA 1HHLA 3D3DA 4N1CC 1FN5A 2HEEA 1ZVHL 3T6UA 4YEMA 5D5FA 5I4XA 4LT1A 1HMKA 1D6PA 3WU7A 1GE2A 5KXSA 5LAGA 4P2EA 1B0DA 1NDGC 4NG8A 1C45A 1TEWA 4LZTA 1LJNA 1GE3A 1WQQA 3P4ZA 4GCDA 4NGJA 4WG1A 1TCYA 5KXNA 9LYZA 1UBZA 1HSWA 4N0JA 4TUNA 4Z3MA 1LJ3A 1RE2A 1F10A 1LSEA 4XJHA 5IELA 3WXTA 1HELA 1LSMA 2D6BA 1B7QA 4LYZA 193LA 3A6BY 1OUIA 4WLXA 1LOZA 1LZ1A 1G7IC 2BQIA 5KXWA 2Z19A 3G3BB 5B1FA 3G3AB 3W6DA 1IWUA 5KXMA 5APEA 5C6IA 1GF7A 5F9UA 1LHJA 3CB7A 1GBWA 1REXA 5FSTA 1LJEA 4J1AA 1LYYA 1LZBA 2H9JA 2Z12A 4NY5A 4RDSA 1LMAA 5LVGA 5L3IA 1D0LA 2LZ2A 2Z18A 2HU3A 3A3QA 4LT0A 3RU5A 1IOQA 1J1PY 3TXFA 2D4IA 1IP5A 7LYZA 1NDMC 4D9ZA 3TXKA 1LZ9A 4H8ZA 3WXUA 1JJ3A 2C8OA 3W6CA 1UIGA 1XGRC 3WH1A 5DN4A 1YQVY 1FKVA 1LZNA 5T3FA 1Z55A 4ETAA 1LSZA 2LYZA 4IASA 1CJ7A 5B59A 1KIQC 5KXTA 4B0DA 1IR9A 5FHWA 5KXYA 1GBXA 4WLTA 4ETCA 5LVKA 1P2CC 2G4NA 2BQAA 4FJRA 208LA 4YM8A 1FLWA 1B7RA 3MGWA 5L9JA 2HECA 3B0KA 4RW1A 1B7NA 2F4GA 4N8ZA 5B07A 1GFTA 4C3WA 1IR8A 1XEKA 1D0MA 4NFVA 4J7VA 1JKCA 2GV0A 1GDXA 2Z39A 4CGEA 3HBEX 4BADA 1BB3A 1BGIA 1IWXA 1RI8B 1ZVYB 1HEOA 1LCNA 2FYDA 1GB3A 2YBIA 1LKRA 2Z2EA 2PC2A 3IJUA 3T36A 1RFPA 1UCOA 4LYTA 153LA 2BQJA 1AM7A 1OUFA 3A94A 4MCKA 4XJFA 4YEOA 4NSIA 5FEKA 1F0WA 5LYZA 4Z46A 1IOSA 4TX7A 1LZGA 1QUTA 4LT3A 1IWTA 3HBHA 4WOAA 4X3BA 3WUNA 5I53A 1GFJA 1LYZA 1HFYA 4DD2A 5LYMA 3LYZA 5K7OA 1IVMA 1DI3A 1UICA 1XSFA 4R6CA 2VB1A 4DDCA 1C7PA 4NWHA 4M6DA 2DQDY 2I25L 1FLQA 4YF2A 3SP3A 1V7TA 1A4VA 1RJCB 4Z98A 5KXZA 5IHGA 5LVIA 1GBZA 1JJ0A 1LSYA 1CJ6A 1FLUA 3GXKA 4DWXA 1GBYA 1XEIA 1GDWA 4WO9A 1XGUC 4H9BA 1QTEA 2CGIA 4U3XB 1UIHA 5LINA 1HMLA 1NQIA 2IFFY 134LA 4XENA 1UIEA 5JENB 4XJGA 1GEVA 2IHLA 3W6EA 1IWWA 4ZIXA 4GCEA 3TXBA 1REZA 2ZILA 3TXIA 1N4FA 4RLNA 4B1AA 2Q0MX 5APCA 3WMKA 1LZ4A 4H8YA 3CSZA 4G4HA 3B0IA 4OWHA 1DI4A 1B7PA 1LJIA 4DDBA 1AKIA 1AT5A 1EQ4A 1DKKA 5C6LA 1G7LC 1LKSA 4WG7A 1JJ1A 4NIJA 1GHLA 4WM1A 8LYZA 5KKJA 1GBSA 1IWYA 1LJJA 1IP3A 1B5VA 3LYMA 1B5ZA 1LZDA 2DQCY 2ZNXY 1GFKA 5DL9A 5B1GA 5D5CA 3EMSA 2DQIY 1GF5A 1TDYA 1GFUA 1LMNA 3A96A 2FYCA 1LPIA 1IWVA 3AYQA 4NWEA 1GB0A 1SLYA 4TSCA 2BQNA 4PJ2C 1WQMA 4LYBA 3WYHA 1CNSA 4QY9A 5LYTA 1NF5A 1QUSA 3FI7A 1JIYA 3TXGA 4OOTA 2H9KA 4BAPA 1LJKA 1LJ4A 1XGTC 4DD0A 1BVKC 4HTNA 4XJIA 4UWVA 4ML7A 1WQNA 1IP7A 1H87A 4XADA 1PZYA 1LMPA 2BLYA 1G7JC 1WTNA 2YDGA 4QEQA 1C08C 1GFRA 4H9FA 1CJ9A 1GE1A 1EQEA 1LZSA 1YILA 2I26L 3A3RX 5E4PA 3A34A 5LAFA 3W6BA 4WM5A 4WMGA 1GXXA 1T6VL 5I4WA 4H92A 4HV2A 1YL0X 3TXEA 1IX0A 1LHHA 2F2NA 1WTMA 3GXRA 1DPWA 4GLAA 1LZCA 1KXWA 1OUEA 4HJVA 5EBHA 2YBMA 5ILFA 1LMCA 3RZ4A 2D4KA 3TXHA 4CHXA 1GAYA 3EBAB 3LZ2A 4KT3A 4HV1A 3WUMA 4HPIA 4OW1A 1PS5A 1BVXA 1UIFA 1WQOA 5LXWA 5I4YA 1JSFA 1UIDA 4H1PA
chains in the Genus database with same CATH superfamily
1PQMA 2I6ZA 1G7HC 1DV0A 1ZYTA 4PHIA 1JKDA 3KOYE 4WM6A 1B5XA 1ZMVA 1L68A 4NXMM 4CFOA 1LSFA 4G4NA 4GH9A 4DT3A 4NGLA 2CWIA 1F6RA 3P66A 1EPYA 198LA 1LGWA 2LVPC 1B5WA 1IC4Y 3QNGA 1L55A 4GN5C 3DN3A 1GE0A 1W5TA 5FELA 4IJ4A 3EIEA 254LA 1DKJA 1IY1A 1JISA 1OQYA 4JI7M 1NKHA 4H9AA 3LW5F 3CSQA 2EKSC 1TF0B 2CE7A 2F5OA 1R2ZA 4LF9M 1B2KA 2UUCM 3SARA 4NHIA 2I7NA 2BNKA 3CT5A 1QZEA 1LW9A 4Z6YA 4YOPA 2BQKA 4PCZA 3GQ5A 1JR3E 3K2LA 3HHWA 3B7QA 3EXDA 1JTMA 2BQCA 2ZAMA 109LA 4OWBA 1L32A 1UIAA 4MB7A 178LA 4DR1M 1L94A 3HHXA 1QS5A 4H91A 1YANA 3GLIE 2B6ZA 3M6AA 1L1TA 229LA 1DYAA 4NC6A 3C7WA 1CKDA 2B73A 3WL2A 1KY0A 1L62A 3D9AC 167LA 1IP4A 2A7DA 4WURA 1HFXA 4HJZA 4LDEA 4KT0F 3LYTA 4L8RC 4W94A 3ZQJA 1FJGM 8CATA 3I4YA 5HLLA 4FWDA 3HX3A 3L28A 3JR4A 4QDNA 3RW8A 3NY9A 2ZIJA 173LA 4NL4H 3QY4A 3AGIA 3DOAA 5DLAA 3DN2A 4E3UA 2HUMA 3AZ6A 1DYCA 4JXJA 3WW5A 1QTCA 1VDPA 1OWZA 5ITQA 2LVNC 4LT2A 3CTWB 1FKQA 4M4OA 2Z2FA 3VK7A 139LA 1DGGA 1IBKM 3C82A 1K3XA 1CKGA 2BPUA 3A8ZA 3DMXA 4EOFA 2LCBA 1VDSA 1JKBA 2Y0TA 2O4WA 2C98A 3VLFB 2UUBM 3HU1A 2OOAA 4TUWA 1N78A 1L27A 228LA 4L41A 5F16A 5HMVA 4TTDA 1Z59A 1JSEA 1LYFA 1TTEA 2R6FA 2Z4RA 1T6OA 2WSFF 1PJIA 206LA 3TWLA 166LA 3GUMA 1LGUA 1NSFA 1BB5A 3KVWA 1LZRA 4CJ2A 5KJ9A 2M60A 4EKQA 1X37A 174LA 3F92A 5IT9S 3JR5A 161LA 1L81A 1BWJA 5I54A 4LYOA 5ILCA 1C6KA 2JWSA 1LZ6A 2OTYX 3GLHE 4DUYM 1QSAA 4G4RA 2BAAA 1PQKA 2QENA 4G4BA 3TMXA 2CUUA 6LYZA 189LA 4LRTA 1P6YA 2EA0A 1GF6A 2BQOA 3IWRA 2CRUA 5II3A 2AUBA 1L70A 4MGYE 2VQFM 1LWKA 2ZYPA 2L7IA 4NSJA 3FRHA 1YROA 3W0LB 1BWIA 1HEQA 1SXJD 1L89A 1D3NA 2XBRA 4MGZE 4ET8A 1L22A 2J7NA 1L69A 3GLGE 4H93A 2CJLA 4LY6A 5C1BA 1RCMA 4EMNA 1QT5A 3GPUA 1L8QA 1NBYC 2ZQ3A 2A5YB 4J1BA 4NSOB 3SBBC 2HCBA 2DBTA 1L02A 207LA 4W52A 3PVSA 3U6SA 2VDBB 4GMQA 3ZVQB 158LA 1JTOL 1L18A 3F9LA 3HH5A 3AW7A 1QSQA 2CV0A 164LA 2HUBA 4NGVA 1IWZA 1GXV2 4GKJM 1IC5Y 1ZV1A 2DENA 3JAMS 1XXHB 2JY7A 4F1IA 1HNLA 4DD3A 4GRIA 3EMLA 3JR6A 4WLYA 1L95A 1YKXX 1SWZA 2XSZD 1HNWM 2B5ZA 2OTZX 2N5ZA 2RBRA 1C10A 1LYHA 2ZQ4A 2RBPA 4DUZM 3C9PA 1L49A 5F81A 1B7OA 2OE4X 4I7QA 1GJSA 5KXLA 3PBLA 1D2YA 4PJZA 2YBJA 3THGA 5F14A 1C6QA 4HTQA 1L92A 3KDSE 1I1ZA 1OV5A 5HNLA 2FNAA 3CT1A 2HTXA 1QZMA 2O01F 3OK0A 2L6OA 1N32M 1G0JA 1NY6A 1VAUA 2DZLA 1IFYA 3RFWA 4FDYA 1L96A 2JUJA 1MN3A 1NJGA 1GE4A 1GFGA 3WHLA 1JTPL 4OWEA 3N9CA 4AXTA 1L10A 4ZFPA 3TWKA 1YAPA 1EIJA 219LA 1T6HA 4LF8M 2L78A 3CSRA 3HT6A 3D3DA 3LYOA 3LCUA 4YEMA 3GRRA 156LA 3LZMA 2Q9EA 2HL7A 1GE2A 5KXSA 3D8LA 1C45A 4LZTA 5KXNA 1L2DA 1GE3A 1ZURA 1TCYA 176LA 1WR1B 1HSWA 1L16A 3VDPA 4TUNA 5I14A 1L19A 5IELA 1F10A 1LSEA 4ARPA 2C96A 1LSMA 1VDDA 1HT1E 2D6BA 4IJFA 4WLXA 1LOZA 5KXWA 1WXQA 217LA 1DGHB 1NNJA 5B1FA 4B3MM 3W6DA 5APEA 1LHJA 2XGNA 1J09A 4CISA 1LYYA 2B6WA 1OJLA 1LMAA 2BJWA 3FA0A 1L51A 225LA 2Z18A 4LT0A 1J1PY 1G06A 1L30A 2D4IA 1IP5A 2F2QA 7LYZA 1L63A 1GKIA 4RF0A 3WXUA 1L14A 2R18A 163LA 1YQVY 1FKVA 3KW6A 1PJSA 3PNVA 1L08A 4ETAA 200LA 4M0DA 2LYZA 1L74A 1CJ7A 1D9WA 1KIQC 1WJ7A 4KLNA 260LA 4B0DA 1V33A 1HQCA 2Z7JA 3C7ZA 5LVKA 3T1HM 4FJRA 4I7TA 2Z4SA 3G3VA 1B7RA 1L39A 5L9JA 3B0KA 1B7NA 2RKOA 3HUQA 4C3WA 1D0MA 3MK6A 2Z39A 2MJ5B 4BADA 1ZMUA 2Z2EA 5KQDA 1ZAEA 147LA 1UCOA 2BQJA 1OUFA 4YEOA 4DQ5A 4LF6M 4NRWA 1C69A 2R62A 4LT3A 214LA 2CP8A 2DVWB 4AQYM 1CV4A 1LYZA 1G59A 4P17A 3W68A 3HHZA 1DI3A 1IVMA 4R6CA 1L79A 3BBZA 1C7PA 4NWHA 4M6DA 1L60A 3KP0E 3DN0A 3SP3A 1V7TA 4W5WA 1A4VA 3HTGA 1DYFA 4K0KM 2DZOB 5LVIA 1GBZA 3GXKA 1L97A 1GBYA 1L67A 5BPVA 2LH0A 2FS1A 4U3XB 1ZQ9A 1HMLA 4PK0A 199LA 1L56A 1T8AA 2IHLA 4ZIXA 157LA 3TXIA 1N4FA 4LRSA 3L29A 227LA 3GPXA 4EIWA 3CSZA 4UN2B 3B0IA 4I7OA 2Q2EB 1L33A 4WM1A 1GHLA 4LZZA 2DI0A 1LZDA 5B1GA 2R65A 4QOZC 1XXHA 3GRYA 175LA 1D2WA 1Q39A 2DWMA 2D7HA 2DHYA 3AYQA 1LPIA 1IWVA 5DYGA 5H37D 3KS4A 1SLYA 1L0JA 2F5SA 4ARQB 1C6AA 4B3SM 220LA 2H9KA 4DR7M 1SSYA 3GLFE 4XJIA 1YE9A 1WQNA 1IP7A 2OE7X 1PZYA 1OIPA 3KOWE 1PGYA 1G7JC 1WTNA 2YDGA 1C08C 1GFRA 231LA 4B3TM 2I26L 2LVQD 2B72A 2OO9A 2RGOA 226LA 1L86A 1VG5A 3CF6E 107LA 3SB9A 1YL0X 1CU3A 1GLNA 1IX0A 2KA6B 2A4TA 2F2NA 3GXRA 4GLAA 1OUEA 3PNYA 1LMCA 2D4KA 4CHXA 3U60A 3EBAB 4HV1A 1QTBA 1WQOA 4X64M 2Z6BA 4L6V6 3J80S 2HEFA 4NHQA 4DV2M 3HGIA 2F4VM 1LMOA 2L09A 5IDDA 3CGWA 4LDLA 3A91A 4L15A 3VWOA 1C6GA 1G07A 2ANVA 261LA 4L4UA 1HF4A 1CJ8A 4W53A 234LA 1I6SA 3AZ7A 2BQHA 1E9SA 1LHIA 1CV5A 1W6ZA 3TMWA 3ATOA 1OFIA 2Q9DA 3AGHA 5B06A 1OUGA 3H4MA 4NEBA 5EJCA 2O25A 3ODUA 2XFTA 1HENA 2L2DA 4FWHA 1OUJA 1HEMA 150LA 3WW6A 2BWBA 2DQJY 2O79A 2XJWA 4LJAA 1VATA 3I01M 3GQ4A 1G8PA 2QPAA 1G0MA 1NV8A 2MEAA 239LA 4DBGB 4N9RA 3CDRA 2RAYX 3SAWA 1WGNA 5A3EA 2R46A 1NWGA 2DKVA 165LA 1IXZA 2RBQA 1L36A 1QDRA 1IORA 4I7PA 221LA 1A5TA 1KY1A 3WU9A 3U61A 1I56A 4DDAA 1G7MC 1OP9B 1YAOA 4N1EI 4LYMA 2LZMA 3L27A 1CUKA 1QANA 2A7FA 1QT8A 1GF9A 4H8XA 2JZ1A 2X49A 1ZWNA 3A95A 6LYTA 2KRKA 133LA 3ZCBB 3UMMA 5FTNA 4UWUA 4JI1M 1HC0A 1XGQC 3HT9A 1L05A 1L13A 5KY1A 2WARA 1HR0M 1LZTA 4H9IA 1LYEA 122LA 4M0WA 2XEPA 4DV4M 2EIZC 2XBSA 3D4SA 1C60A 4BS7A 3WVYA 1N77A 103LA 4GHAA 1LHLA 4YENA 4CFPA 3J27B 2ZYCA 5EQTA 1XHBA 2FFJA 3M3UA 1J5EM 3A93A 4JI2M 1E8LA 3FUWA 2RBNA 1XFPL 3K9PA 1UFZA 1VEDA 3T15A 111LA 3NWLA 1QYRA 1YL1X 3AZ4A 1SXJA 1LI2A 4AI6A 1QSBA 4H90A 4I0CA 2W1XA 4DC4A 2DQAA 2F5PA 5LA5A 1PQJA 5C6JA 1NBZC 2C8PA 5GKNA 112LA 2B3TA 1I4WA 2LNHC 1JQUA 1IO5A 4K5YA 4NGZA 151LA 1TGUA 5E9RA 3WUAA 3FADA 2AHMA 2HWJA 1C68A 1HQYE 1L09A 2BLXA 3J7AS 3A90A 1TBYA 1ALCA 2CDSA 4AKGA 4DKLA 4S12A 3KP1E 1SX2A 2G4QA 4ETBA 1XNQM 4OWAA 4EJ4A 1B7LA 2MECA 2LTUA 5KXKA 1GBOA 2LYMA 4HPEA 4JV5M 5FSWA 4LF7M 2XSZA 1IN5A 1CV0A 3KSXA 1DXJA 1L72A 1JHLA 4G4QA 3SB6A 2F32A 1IN7A 3K9OA 1L15A 4IATA 3IG5A 1MX0A 4H94A 3M7GA 3SHFA 1LYDA 1T3PA 4XJDA 3WVXA 1V7SA 1NHWC 1LHKA 1YAQA 2Y8PA 4OVZB 1IBMM 1OQMA 2J5YA 2LZTA 2GQFA 132LA 1LMTA 4NSHA 3U6QA 3CF0A 3L25A 2MEGA 4W56A 3V2YA 154LA 4JI5M 4NHSA 3FTCA 3LCVB 4YXCA 5KXRA 190LA 3HU3A 2W1YA 1IP1A 1G1WA 3BKHA 4DR6M 1TH4A 3C83A 1C6NA 1L75A 1XGPC 3RT5X 4NSRA 140LA 2EKKA 1JWRA 4II7A 5B05A 3VDUA 3GLIB 3U6LA 4DYGA 1DQJC 2V6ZM 2UXCM 4UWNA 1OWYA 2Y20A 2DWZB 3DKEX 1VQ1A 2ZTCA 2JZ0A 1L54A 2EPEA 4OWCA 2EQLA 4FCVA 255LA 1QQYA 1IXRC 4R3DA 3AB6A 4NGKA 2CFOA 4QHSA 1EFUB 1L90A 1IN6A 1OUDA 1B5YA 1L77A 3ZEKA 4MSTA 2HULA 1SWYA 119LA 5E26A 3HZJA 4KHPM 1GB5A 1LYSA 3CDTA 2NTGA 2KW0A 1L31A 7LZMA 2O5RA 4M9XA 2F5QA 1G0PA 1D2NA 3W3EA 1BWHA 1MJGM 4LGYA 3P68A 2YSSC 4B3RM 3EIHA 5LVJA 2KRUA 1GF0A 1LJFA 3W6FA 3KAMA 3WU8A 3F6ZA 2YBHA 4ARMA 2X4AA 5AMYA 4GITA 1UM8A 3GUKA 3HU2A 2K47A 2RSCA 3PXGA 4PDGA 1AIPC 1ZV5L 3TMUA 191LA 1D9UA 3LZTA 237LA 1OAOC 170LA 1G0GA 1LZ8A 2Z37A 3QYBA 1VFBC 2CUZA 2P5TA 4PRQA 3ULRA 3W6AA 1R5LA 2G4PA 3FTDA 1YSYA 3MJ5A 2ZNWY 4NXNM 1N36M 4QNMA 2ZM6M 1ZVHL 5D5FA 5I4XA 3A46A 1HMKA 148LE 4IBFA 1B0DA 1JTNA 1WQQA 4GCDA 1L01A 1L61A 1ORYB 4N0JA 1QT4A 4I7MA 3WXTA 3H4JA 3KFUG 7CATA 5E6JA 3A6BY 1EE8A 3GRUA 1LZ1A 2QP9X 3MHVC 3B9PA 1TH2A 1CV1A 2Z19A 3G3BB 3ZH9B 1IWUA 1QUOA 1GF7A 249LA 3CB7A 1REXA 3GLHB 3Q8GA 4B08A 1QTHA 4NY5A 3HY5A 4OW0A 5L3IA 3A3QA 4W54A 3RU5A 1L48A 2DNAA 1G4AE 2DXIA 3TXKA 1L47A 3TQSA 1UIGA 1XGRC 3WH1A 3AJIB 1LZNA 1LSZA 3GO8A 1XJTA 5KXTA 2QBYB 3U5ZB 5FTJA 2UXDM 1G0KA 4FW9A 1P46A 250LA 2G4NA 1FLWA 1N34M 3MGWA 155LA 2KNVA 2F4GA 4I5SA 1IR8A 1XEKA 4NFVA 4J7VA 3SMSA 1QAOA 3KSJA 1BB3A 2FYDA 1LCNA 3T36A 2PC2A 2Z3XA 1AM7A 3E21A 4MCKA 4XJFA 4NSIA 2I7PA 5FEKA 1F0WA 2XZFA 3GP1A 1IOSA 4TX7A 1IWTA 2LWXA 3WUNA 4JI0M 1GFJA 4PD2A 3LYZA 5K7OA 3DN4A 1L91A 2DQDY 2I25L 1KSFX 1IN4A 1G0LA 4LZMA 3HTDA 126LA 5KXZA 3SMPA 4B7HA 2KZUA 4JI3M 4LJ4A 1LSYA 1CJ6A 1FLUA 3HT7A 4DWXA 2Y21A 3KS8A 4H9BA 1IXSB 2CGIA 3U6OA 5LINA 1NQIA 4YHHM 1R7RA 130LA 4XJGA 1GEVA 1IWWA 162LA 3TXBA 2ZILA 2JA2A 1LGXA 3WMKA 1C6IA 4H8YA 4G4HA 1B7PA 1LJIA 1EQ4A 1L85A 2JY5A 4EKPA 253LA 1NVMA 1WGLA 2RB2X 4JN6A 1RU3A 1LKSA 3HH3A 4WG7A 4E97A 4XK8F 5KKJA 4AW4A 1IP3A 3KXEC 1B5VA 3LYMA 2DQCY 2ZNXY 3QAKA 1GFKA 2ANXA 2WSCF 2RH1A 3EMSA 5D5CA 3FUUA 2DQIY 1GFUA 1DYBA 3SATA 2B6TA 2FYCA 4NOOB 5EP4A 1GB0A 1FNNA 3FUVA 3DN1A 1D3JA 5BR8M 3DMVA 4LYBA 2B74A 4QY9A 1NF5A 3HKPA 3FI7A 1C62A 2IGCA 3VFDA 3UK6A 1LJKA 1LJ4A 1NHGC 2HUKA 4DD0A 1L84A 1IN8A 1L41A 5DYIA 1H87A 5IWAM 3FYCA 1L43A 3OE8A 1OYUA 2BLYA 2DWLA 4QEQA 4B7FA 1XMOM 2MH8A 1XNRM 1D3MA 4H9FA 3GUIA 3U6DA 3A34A 1C6BA 3U6EA 4WM5A 152LA 3B74A 4OU7A 2LC9A 1V92A 1L25A 1L46A 1LI6A 4H92A 3DFZA 180LA 1L29A 1LHHA 3L2AA 2DHRA 1CX7A 5ILFA 1DPWA 5EBHA 1QT6A 2YBMA 2C9OA 3RZ4A 3LZ2A 4KT3A 3WUMA 1CV6A 1UIFA 4ARLA 1QS9A 1L66A 3HTBA 3I51A 246LA 2HU1A 1L06A 1QTKA 142LA 1YAMA 1WVVA 4PPOA 3DMZA 4WM4A 2LHCA 1LAAA 1HEPA 4B4EA 4ETEA 2KEBA 3C3EA 4QNRA 1YKZX 3KOZE 1QAQA 4W57A 2BJVA 1LI3A 2MEDA 1GO5A 3HWSA 2E5LM 3B6LA 4B4JA 4DV7M 2DQEY 1QTDA 1GABA 2R4JA 1GF4A 1PM5A 1PQDA 1JPOA 2ZBKB 1L28A 2ZTDA 1GFAA 2L4FA 3LN2A 1TAYA 3AOEC 1GFHA 1CVKA 145LA 1FBIX 1GAZA 1L98A 4TSBA 2XTHA 1LSBA 1GWDA 2HHHM 4WM2A 1LSAA 1FLYA 2XH9A 3HFMY 1PQOA 3FD9A 2KNZA 4GCCA 4DQJA 3I4VA 1EQ5A 1QTZA 3ZC7B 177LA 169LA 196LA 4FCTA 1MLCE 1INUA 1GB9A 3J4GA 4PRUA 4OX9M 2XLJA 2D4JA 1L21A 3T6PA 1WVUA 1L76A 2F30A 4Z41A 1D0KA 3RGSA 4DJHA 3VKGA 2VF8A 4AG6A 2BQGA 3OE0A 5LVHA 1BQLY 1C67A 3UONA 3ZVQA 5KPTA 1XJUA 3HJ8A 1H6UA 4H9EA 1C6DA 1YIKA 4LJ9A 4NG1A 137LA 2YQZA 2V1UA 1P7SA 1L35A 194LA 4LF4M 1XC8A 4H9HA 1IP2A 1UA6Y 1NHBA 2X0AA 4LGMA 3GUJA 4LJ5A 1XMQM 5FDJA 1DYGA 1OUBA 1BB4A 2MEIA 5EP3A 1IP6A 2D7EA 3HTFA 2QARC 1E32A 4OO9A 2R44A 3RNXA 1SXJE 4ZPXA 4CJ6A 113LA 1L34A 1C6EA 4GCFA 3I04M 1NMMA 3M0EA 1JUGA 3RGPA 1L59A 143LA 3EO5A 1JR3D 2JXNA 4BB9A 4I8SA 3DZDA 1F4IA 3HBDA 195LA 1IY4A 4GHLA 256LA 4L16A 3BKVA 4QGZA 5HMJA 1BB7A 2LVAA 183LA 4XYYA 210LA 4XGIA 4MR1A 120LA 1T97A 5HQ1A 2W1LA 2GNOA 3FUXA 5KPZA 2W1MA 1SQ2L 1J1XY 4GN4A 3HUKA 4KL7A 4LFAM 247LA 1LSDA 1TR8A 3WPKA 3AFHA 1KXXA 3J81S 5LIOA 4B4IA 2EUCA 4G4CA 4LYCA 2DQGY 2MEBA 3ATNA 3C58A 3CF2A 3R9XB 4RNAA 1PJTA 1C7YA 3IJVA 1GEZA 3GPYA 1VDTA 3WPJA 1JTTL 4I7NA 1PJJA 2V1CA 3PDSA 5KXOA 1C6TA 4A7DA 1DGHA 3FI5A 3LQRA 4LJ8A 2OE9X 3LHMA 2W82A 2ZIKA 3GULA 4H9CA 3BOSA 1WHCA 2D91A 5I5QA 1C65A 1UC0A 4ZEEA 3N9AA 5F9XA 4RF1A 3RE8A 4CGYB 1YKYX 4P16A 3L2XA 3U6PA 114LA 4HJYA 1JEFA 1L82A 1L80A 1T8GA 3QWLA 1B7MA 4ET9A 5EP2A 171LA 3TPZA 4WL7A 1L83A 4FVMA 3CT0A 3SB8A 118LA 5A2QS 6LZMA 3GQ3A 2JNHA 110LA 1CV3A 2LXEA 1L73A 2HEDA 5DNYA 3B7NA 1QAMA 1LYGA 3SN6R 2MEFA 3CQLA 4NSGA 2VQEM 3KOXE 1C61A 3P65A 1GL7A 4N5RA 5KXPA 4NGOA 3FTEA 3F8VA 240LA 1HERA 5JI2E 4II8A 1G3IA 1LTMA 3T38A 3CDOA 3C80A 4BAFA 1JB0F 1IR7A 5EXTA 3SB7A 1HSXA 1REMA 1W08A 168LA 4IBCA 3FE0A 4EXMA 3NBIA 1GPQC 1L2BA 3OJPA 1QQWA 2BQBA 2H5ZA 3K1JA 1YLAA 5A3ZA 3IG8A 5FTMA 3SBJA 2YFQA 3J6KA 4WM3A 2F47A 2BQEA 131LA 2MR9A 3AW6A 1PRBA 4RKUF 1L00A 1ZMWA 3W0FA 4GKKM 2CEAA 4NHPA 2Z8YM 3AZ5A 1AUAA 1GB7A 4I8OA 1CU5A 3FE3A 2OU8A 3NBXX 2RB0X 3TXDA 123LA 1QIOA 1G1VA 1K28A 2RRUA 1LJHA 1PJQA 5EXSA 1T3TA 2CHGA 2HEEA 1QT3A 127LA 4LT1A 1D6PA 3TE6A 4P2EA 1GVNA 1NDGC 181LA 1DGBA 4MM3B 3L26A 257LA 4WG1A 2WZJA 9LYZA 4CHTB 4Z3MA 3HWLA 2MGWA 1RE2A 1D3FA 4ARQA 1HELA 2YNMD 2UUAM 3E9SA 1VEJA 1B7QA 4LYZA 193LA 1OUIA 4EPFA 2KZSA 3K92A 1L50A 3G3AB 5KXMA 2KDLA 1GBWA 5FSTA 1LZBA 2H9JA 4NRVA 4RDSA 5LVGA 2FE8A 2LZ2A 2HU3A 1CTWA 1N33M 1LZ9A 3LMMA 2C8OA 241LA 3FTFA 3W6CA 1C64A 128LA 5DN4A 3RZEA 5T3FA 5ITXA 1SX7A 1L20A 1Z55A 1PQIA 1P3QQ 1QVRA 5FHWA 242LA 1GBXA 4ETCA 4IAPA 2OOBA 1P2CC 1L38A 4DR2M 2BQAA 208LA 3SAVA 4YM8A 1L04A 2HECA 1E9RA 4N8ZA 5ITTA 2DAGA 5B07A 1GFTA 2M5ZA 1GL6A 1L93A 1QUHA 1JKCA 2GV0A 1GDXA 4M9SA 262LA 1BGIA 1IWXA 4DV0M 1OTRA 1HEOA 4W55A 3WULA 1LKRA 3IJUA 153LA 2HAKA 1RFPA 4QHTA 1W5SA 1LV7A 1DO2A 3RUNA 4PDIA 4FWGA 5LYZA 4W58A 4Z46A 1R2YA 3WHKA 1LZGA 1QUTA 4AG5A 4WOAA 4DD2A 5LYMA 1VEGA 3GUPA 1P2RA 3J7BA 3IECA 2MROB 2B7XA 1FLQA 4EPIA 251LA 1RJCB 5KPRA 2L7HA 258LA 4YX7C 3HDFA 4FD2A 4LZJA 1VDLA 3K2RA 4JYAM 1XEIA 1GDWA 1XGUC 4B7GA 4I7LA 4AQNA 1L11A 134LA 4XENA 5JENB 2B6XA 4GCEA 141LA 4RLNA 1L23A 2BWEA 2QHOB 3VKHA 3SYKA 1LZ4A 4OWHA 2OU0X 4DDBA 1AKIA 4JI6M 4KODA 1DKKA 1Z5BA 232LA 5C6LA 1G7LC 3D8BA 4EKSA 5FTLA 1GBSA 1LJJA 138LA 5DL9A 4IBEA 3SYLA 4X65M 2DAEA 4DR3M 1NO1A 1LMNA 3G3XA 1P3NA 3TL4X 4NWEA 2BQNA 1L40A 3LVVA 1CNSA 3WYHA 1OFHA 5FTKA 222LA 4GBRB 1XGTC 1BVKC 4UWVA 223LA 4ML7A 1J7KA 2X8AA 4XADA 1SXJC 1LMPA 3HUAA 1CJ9A 1KS3A 3A98B 1EQEA 1GE1A 5F3WA 3A3RX 5E4PA 5LAFA 3W6BA 104LA 182LA 1C6JA 1OAIA 3SASA 4WMGA 1GXXA 5KO3A 1T6VL 248LA 2K9DA 2R45A 5I4WA 5FLXS 3SAUA 4HV2A 4LDOA 3TXEA 4HEOA 5ITRA 233LA 1WTMA 1C66A 1LZCA 4HJVA 3PFIA 1L0KA 1P64A 1GAYA 4HPIA 3OE6A 4OW1A 5LXWA 5I4YA 1KYIA 1JSFA 1UIDA 1TH3A 4X62M 1L88A 3HU8A 3QE8A 5C18A 1XEPA 1I20A 2DAIA 3FKEA 2DQFC 4GLVA 3SHGB 2CHQA 2XF3A 2XFSA 3HDEA 1K82A 2OEAX 187LA 1HEWA 1VDQA 2LYOA 4W96A 3VK8A 3GLGB 1HFZA 4NGYA 4KPMA 1T43A 1GFVA 1LZYA 1L52A 2YR0A 1XEJA 4J0LA 1P36A 1T8FA 1P37A 1TLAA 1B7SA 1R6BX 1LSCA 1FDLY 4C5FA 1QT7A 2R0IA 235LA 1NJFA 4DD9A 3E46A 1L64A 1GD6A 4LF5M 1TDHA 2JY8A 1C46A 1UIBA 3B0OA 159LA 184LA 3AOEA 2QCUA 4DD7A 3DA1A 1WQRA 2B70A 1NY5A 3C8RA 1C6MA 3A45A 3W67A 4I81A 4OVZA 4X66M 3A67Y 4WP2A 4WL6A 1WIVA 1L99A 3DNAA 1WTHA 1G41A 1L58A 4G4OA 1JKAA 4GRVA 1JR3A 1CX6A 1C6LA 2FBDA 4WLDA 2OU9A 1NV9A 4AKHA 1OIZA 4CIZA 1HNZM 1KIRC 3P64A 1L24A 2B6YA 2RBSA 4LGKA 1CU2A 1GB8A 236LA 2FH0A 205LA 2DZNB 1OUHA 3GLIA 245LA 230LA 4YY3M 1N75A 4KO8A 2RB1X 3M18B 5KKIA 5J7CA 4ETDA 1LYOA 2KXEA 1LJGA 1XWIA 3J2PB 4D82A 1XXHE 3QAUA 1J1OY 1IQPA 1CKHA 1NHEA 2LHMA 1CU0A 4G6ZA 1B5UA 213LA 2LBCA 4LJ6A 1F6SA 3TMVA 1LZ5A 115LA 1Q02A 3GPPA 1DPXA 4GC9A 1SSWA 1WQPA 2HEBA 1P2LA 4WW0A 1K3WA 201LA 3TXJA 1L2CA 1OUCA 3B72A 3HJSA 4IBKA 3R8FA 1CUQA 5APDA 2MEHA 4Z8XA 1A2YC 2DQHY 2QSFX 5DM9A 4DD1A 1JITA 2APLA 4GN3A 1H6MA 4Y28F 5ITYA 1GJTA 1XB2B 3U60B 3HHYA 1GF3A 1IY0A 4LJ7A 4W51A 2BQFA 1L45A 1C6HA 3A6CY 1QSWA 3DN8A 2RGHA 4YXAC 4NGIA 4TWSA 3SB5A 1GF8A 1KW5A 3WPLA 160LA 4PT5A 224LA 144LA 1O23A 4HL4A 2CV1A 2OPFA 1CKCA 1DI5A 4HP0A 4ARJA 1YUBA 4WO6A 5APFA 2YBNA 1L12A 2L4EA 2H1RA 4AZFA 4LFPA 4R0FA 1KW7A 4GCBA 1ZMYL 3FYDA 4IIWA 5EP1A 4KXIA 1DZBX 1LHMA 4QOSA 2RAZX 1GFEA 1L37A 4XJBA 4LFBM 135LA 4LCBA 4HSFA 4PGJB 5JI3E 3B7ZA 2CHVA 1HNXM 1LYIA 3AKZA 3GLHA 5LA8A 4MGKE 2F5NA 5DN5A 4OOOA 4BBAA 1IOTA 4I4LA 4IBJA 1OVKA 2ZWBA 209LA 4MGHA 3SBAA 5HNCA 2NWDX 4D81A 2ZAOA 172LA 1C43A 5M1YA 4I7RA 1B9OA 1LSPA 2BQDA 4NGWA 1OUAA 2NTHA 1IOCA 3OE9A 2VF7A 1UUZC 4O34A 2G3QA 1LZAA 2QBYA 1BVSA 252LA 4XN6A 4RLMA 3IHPA 2CWBA 3U5ZA 1L71A 2MEEA 3GLGA 4DR5M 3U61B 1KXYA 1QDTA 1UACY 1LLHA 2BQMA 1Y8GA 2DAMA 4HTKA 4B49A 1I94M 4JI4M 3NYAA 1L42A 2QB0B 3TWMA 1CKFA 185LA 4G49A 4L78A 2DKLA 4D80A 1L1ZA 243LA 1LYJA 2BQLA 2YVBA 3E4RA 2Z38A 4I7JA 2EKFA 1MELL 1REYA 2G5GX 1IEEA 2H5XA 1IY3A 3AJNA 3N9EA 3SFZA 2DWNA 1BB6A 1LSGA 5FCPA 1AZFA 2JP7A 1LZEA 4DV5M 1GB6A 3E3DA 2VIIA 3C3DA 4ZPUA 4GC5A 1IIZA 1QUGA 1KIPC 2EO2A 4IBIA 2C5RA 2WSEF 2JY6B 1LSNA 3K3TA 4F2LA 4AGAA 186LA 3GRVA 1L53A 1BHZA 2F4AA 4G9SA 244LA 4NHTA 2FBBA 5KXXA 1D6QA 1IC7Y 1L03A 4ANRA 1IM2A 1IXSA 5LMUM 1EL1A 1SXJB 4MH0E 3GLFB 1AT6A 1L07A 5KQ8A 2YBLA 1OKSA 4AKIA 212LA 1DO0A 1Q3CA 1Z5CA 3GUNA 1TDZA 3AV0A 3AGGG 3BXWA 1GB2A 1SG9A 2KHHA 149LA 3MMPA 218LA 4LFXA 1LMQA 3A92A 3B89A 2HEAA 1L26A 1HT2E 4RW2A 1G0QA 5L3HA 215LA 1HHLA 1S3SA 4N1CC 1FN5A 3C8QA 3T6UA 2HKJA 2NQ8C 3WU7A 5LAGA 1JQJC 5DFLA 4NG8A 1TEWA 2EJSA 1LJNA 3P4ZA 4NGJA 1LPYA 4DQ7A 5L8RF 1IBLM 1UBZA 1LJ3A 4XJHA 4W59A 3U6CA 1L44A 1G7IC 2BQIA 4I7KA 3OTOM 2DAKA 3ILKA 1Q3BA 2OQ4A 5F9UA 5C6IA 3Q8XA 129LA 1C6CA 1LJEA 3HU9A 4I7SA 3NY8A 4J1AA 2Z12A 4M9ZA 2K0BX 1D0LA 1CU6A 5ITXE 1IOQA 3TXFA 1NDMC 4D9ZA 5LZMA 2UU9M 4H8ZA 2ERCA 4DV3M 1JJ3A 3HH6A 3G3WA 1Z6TA 1DYEA 1B6IA 3T1YM 1CUPA 1L87A 1IY2A 259LA 4IASA 5B59A 1IR9A 2Y0QA 3GUOA 5KXYA 3HH4A 4WLTA 4IBGA 2R4EA 5IZ7D 2FOIC 2C9CA 3FUTA 2RBOA 4JI8M 5ITUA 4RW1A 1HJPA 2ZANA 1OVJA 3C7YA 4CGEA 3U6MA 2UXBM 3HBEX 1RI8B 1ZVYB 2YBIA 3UGJA 1GB3A 1P56A 4LYTA 5EXXA 3A94A 238LA 2K6BA 1OV7A 1OVHA 4X3BA 3HBHA 5I53A 188LA 1HFYA 2XQOA 4LG2A 1C1KA 1UICA 1XSFA 2CV2A 2VB1A 3CDVA 4DDCA 3FRIA 4DR4M 4FCWA 1VEKA 5EXPA 1KFVA 4YF2A 2LVOC 3CDQA 2LHGA 1R4GA 4Z98A 2D7GA 5IHGA 1DGFA 1JJ0A 4GIPA 1NNUC 4WO9A 3LVWA 1QTEA 1UIHA 3HT8A 102LA 3V76A 2N35A 4G3OA 2IFFY 4ARMB 3AL0C 4ITQA 1UIEA 3W6EA 3AOGA 4IBBA 1REZA 4B1AA 1V34A 5LMNM 2Q0MX 4DAJA 4REZA 4IJEA 3C81A 1L65A 5APCA 1Z5AA 5IREB 1DI4A 3LQQA 4R71A 1AT5A 4DV1M 1P5CA 4MGIE 1JJ1A 1L17A 4NIJA 2XZUA 8LYZA 3UZUA 1IWYA 4A3VB 1B5ZA 197LA 4LFCM 1GF5A 216LA 1TDYA 1E94E 3HJQA 146LA 1C63A 2KNAA 2QQ8A 3A96A 1LWGA 4XBOA 211LA 2G8LA 4IBDA 1L57A 3K8ZA 2B75A 4TSCA 4PJ2C 1WQMA 2O7AA 4EKRA 5LYTA 1QUSA 1JIYA 3TXGA 4OOTA 1KNIA 4BAPA 192LA 1C6PA 4HTNA 4R7GA 1QTVA 2QZ4A 3VW7A 1QUDA 4DV6M 3UJNA 3GLFA 4S0WA 3QYEA 1LZSA 1YILA 1DYDA 4BLCA 1MU5A 4Q7JA 1C6FA 2QNJA 3V2WA 108LA 1G71A 3C8SA 3L64A 4GEWA 2J7OA 2C99A 3DN6A 1KXWA 4HLQA 3TXHA 3A42A 125LA 1PS5A 3SC3A 1BVXA 4H1PA
chains in the Genus database with same CATH topology
1PQMA 2I6ZA 1G7HC 1ZYTA 4PHIA 1JKDA 4WM6A 1B5XA 1L68A 4CFOA 1LSFA 4DT3A 4NGLA 2CWIA 1F6RA 3P66A 1EPYA 198LA 1LGWA 1B5WA 1IC4Y 3QNGA 1L55A 4GN5C 3DN3A 1GE0A 5FELA 4IJ4A 254LA 1DKJA 1JISA 1NKHA 4H9AA 3CSQA 2EKSC 1B2KA 4NHIA 3CT5A 1LW9A 4YOPA 2BQKA 3EXDA 1JTMA 2BQCA 109LA 4OWBA 1L32A 1UIAA 178LA 1L94A 1QS5A 4H91A 1YANA 2B6ZA 229LA 1DYAA 3C7WA 1CKDA 2B73A 3WL2A 1KY0A 1L62A 3D9AC 167LA 1IP4A 2A7DA 4HJZA 1HFXA 4LDEA 3LYTA 4W94A 5HLLA 4QDNA 3RW8A 3NY9A 2ZIJA 173LA 3QY4A 3AGIA 5DLAA 3DN2A 4E3UA 2HUMA 3AZ6A 1DYCA 3WW5A 1QTCA 1VDPA 1OWZA 4LT2A 1FKQA 4M4OA 2Z2FA 139LA 3C82A 1CKGA 2BPUA 3A8ZA 3DMXA 4EOFA 2LCBA 1VDSA 1JKBA 2O4WA 1L27A 228LA 4L41A 5F16A 5HMVA 4TTDA 1JSEA 1LYFA 206LA 166LA 3GUMA 1LGUA 1BB5A 1LZRA 4CJ2A 5KJ9A 4EKQA 174LA 161LA 1L81A 1BWJA 5I54A 4LYOA 5ILCA 1C6KA 1LZ6A 2OTYX 1QSAA 2BAAA 1PQKA 4G4BA 3TMXA 2CUUA 6LYZA 189LA 1P6YA 1GF6A 2BQOA 3IWRA 5II3A 2AUBA 1L70A 1LWKA 2ZYPA 4NSJA 1YROA 1BWIA 1HEQA 1L89A 1D3NA 2XBRA 4ET8A 1L22A 1L69A 4H93A 2CJLA 1RCMA 4EMNA 1QT5A 1NBYC 2ZQ3A 4J1BA 3SBBC 2DBTA 1L02A 207LA 4W52A 3ZVQB 158LA 1JTOL 1L18A 3F9LA 3HH5A 3AW7A 1QSQA 164LA 2HUBA 4NGVA 1IWZA 1GXV2 1IC5Y 1HNLA 4DD3A 3EMLA 3JR6A 4WLYA 1L95A 1YKXX 1SWZA 2B5ZA 2OTZX 2N5ZA 2RBRA 1C10A 1LYHA 2ZQ4A 2RBPA 1L49A 5F81A 1B7OA 2OE4X 4I7QA 5KXLA 3PBLA 1D2YA 4PJZA 2YBJA 5F14A 1C6QA 4HTQA 1L92A 1I1ZA 1OV5A 5HNLA 3CT1A 2HTXA 3OK0A 1G0JA 1VAUA 4FDYA 1L96A 1GE4A 1GFGA 4AXTA 1JTPL 4OWEA 3N9CA 1L10A 4ZFPA 1YAPA 219LA 1T6HA 3CSRA 2L78A 3HT6A 3LYOA 3D3DA 4YEMA 156LA 3LZMA 2Q9EA 1GE2A 5KXSA 1C45A 4LZTA 5KXNA 1GE3A 1ZURA 1TCYA 176LA 1L16A 1HSWA 4TUNA 5I14A 1L19A 5IELA 1F10A 1LSEA 4ARPA 1LSMA 2D6BA 4WLXA 1LOZA 5KXWA 217LA 5B1FA 3W6DA 5APEA 1LHJA 1LYYA 2B6WA 1LMAA 3FA0A 1L51A 225LA 2Z18A 4LT0A 1J1PY 1G06A 1L30A 2D4IA 1IP5A 2F2QA 7LYZA 1L63A 3WXUA 1L14A 163LA 1YQVY 1FKVA 1L08A 4ETAA 200LA 2LYZA 1L74A 1CJ7A 1D9WA 1KIQC 4B0DA 260LA 3C7ZA 5LVKA 4FJRA 4I7TA 3G3VA 1B7RA 1L39A 5L9JA 3B0KA 1B7NA 3HUQA 4C3WA 1D0MA 2Z39A 4BADA 2Z2EA 147LA 1UCOA 2BQJA 1OUFA 4YEOA 4DQ5A 1C69A 4LT3A 214LA 1CV4A 1LYZA 1IVMA 1DI3A 4R6CA 1L79A 1C7PA 4NWHA 4M6DA 1L60A 3DN0A 3SP3A 1V7TA 3HTGA 1A4VA 1DYFA 5LVIA 1GBZA 3GXKA 1L97A 1GBYA 1L67A 4U3XB 1HMLA 4PK0A 199LA 1L56A 1T8AA 2IHLA 4ZIXA 157LA 3TXIA 1N4FA 227LA 3CSZA 3B0IA 4I7OA 1L33A 4WM1A 1GHLA 1LZDA 5B1GA 175LA 1D2WA 3AYQA 1LPIA 1IWVA 1SLYA 1L0JA 4ARQB 1C6AA 220LA 2H9KA 1SSYA 4XJIA 1WQNA 1IP7A 2OE7X 1PZYA 1G7JC 1WTNA 2YDGA 1C08C 1GFRA 231LA 2I26L 2B72A 226LA 1L86A 107LA 3SB9A 1YL0X 1CU3A 1IX0A 2A4TA 2F2NA 3GXRA 4GLAA 1OUEA 1LMCA 2D4KA 4CHXA 3EBAB 4HV1A 1QTBA 1WQOA 2Z6BA 2HEFA 4NHQA 1LMOA 5IDDA 4LDLA 3A91A 3VWOA 1C6GA 1G07A 2ANVA 261LA 1HF4A 1CJ8A 4W53A 234LA 1I6SA 3AZ7A 2BQHA 1LHIA 1CV5A 1W6ZA 3TMWA 3ATOA 2Q9DA 3AGHA 5B06A 1OUGA 4NEBA 3ODUA 1HENA 1OUJA 1HEMA 150LA 3WW6A 2DQJY 2O79A 2XJWA 1VATA 1G0MA 2MEAA 239LA 4N9RA 3CDRA 2RAYX 5A3EA 1NWGA 2DKVA 165LA 2RBQA 1L36A 1QDRA 1IORA 4I7PA 221LA 1KY1A 3WU9A 1I56A 4DDAA 1G7MC 1OP9B 1YAOA 4N1EI 4LYMA 2LZMA 2A7FA 1QT8A 1GF9A 4H8XA 1ZWNA 3A95A 6LYTA 133LA 4UWUA 1HC0A 1XGQC 3HT9A 1L05A 1L13A 5KY1A 2WARA 1LZTA 4H9IA 1LYEA 122LA 2EIZC 2XBSA 3D4SA 1C60A 4BS7A 3WVYA 103LA 4YENA 1LHLA 4CFPA 2ZYCA 3M3UA 3A93A 1E8LA 2RBNA 1XFPL 1VEDA 111LA 1YL1X 3AZ4A 1LI2A 1QSBA 4H90A 4I0CA 2W1XA 4DC4A 2DQAA 5LA5A 1PQJA 5C6JA 1NBZC 2C8PA 112LA 1JQUA 1IO5A 4K5YA 4NGZA 151LA 5E9RA 3WUAA 3FADA 1C68A 1L09A 2BLXA 3A90A 1TBYA 1ALCA 2CDSA 4DKLA 1SX2A 2G4QA 4ETBA 4OWAA 4EJ4A 1B7LA 2MECA 5KXKA 1GBOA 2LYMA 4HPEA 1CV0A 1DXJA 1L72A 1JHLA 3SB6A 2F32A 1L15A 4IATA 4H94A 1LYDA 1T3PA 4XJDA 3WVXA 1V7SA 1LHKA 1YAQA 2Y8PA 1OQMA 2LZTA 132LA 1LMTA 4NSHA 2MEGA 4W56A 3V2YA 154LA 4NHSA 4YXCA 5KXRA 190LA 2W1YA 1IP1A 1G1WA 3BKHA 3C83A 1C6NA 1L75A 1XGPC 3RT5X 140LA 1JWRA 5B05A 4DYGA 1DQJC 4UWNA 1OWYA 3DKEX 1L54A 2EPEA 4OWCA 2EQLA 255LA 1QQYA 4NGKA 3AB6A 1L90A 1OUDA 1B5YA 1L77A 3ZEKA 4MSTA 2HULA 1SWYA 119LA 1GB5A 3CDTA 1LYSA 2NTGA 1L31A 7LZMA 1G0PA 3W3EA 1BWHA 3P68A 2YSSC 5LVJA 1GF0A 1LJFA 3W6FA 3KAMA 3WU8A 3F6ZA 2YBHA 4ARMA 5AMYA 3GUKA 2RSCA 1ZV5L 3TMUA 191LA 1D9UA 3LZTA 237LA 170LA 1G0GA 1LZ8A 2Z37A 1VFBC 4PRQA 3ULRA 3W6AA 2G4PA 2ZNWY 1ZVHL 5D5FA 5I4XA 1HMKA 148LE 1B0DA 1JTNA 1WQQA 4GCDA 1L01A 1L61A 4N0JA 1QT4A 4I7MA 3WXTA 3A6BY 1LZ1A 1CV1A 2Z19A 3G3BB 1IWUA 1QUOA 1GF7A 249LA 3CB7A 1REXA 1QTHA 4NY5A 5L3IA 3A3QA 4W54A 3RU5A 1L48A 3TXKA 1L47A 1UIGA 1XGRC 3WH1A 1LZNA 1LSZA 1XJTA 5KXTA 1G0KA 1P46A 250LA 2G4NA 1FLWA 3MGWA 155LA 2F4GA 1IR8A 1XEKA 4NFVA 4J7VA 1BB3A 2FYDA 1LCNA 3T36A 2PC2A 1AM7A 4MCKA 4XJFA 4NSIA 5FEKA 1F0WA 1IOSA 4TX7A 1IWTA 3WUNA 1GFJA 3LYZA 5K7OA 3DN4A 1L91A 2DQDY 2I25L 1G0LA 4LZMA 3HTDA 126LA 5KXZA 1LSYA 1CJ6A 1FLUA 3HT7A 4DWXA 4H9BA 2CGIA 5LINA 1NQIA 130LA 4XJGA 1GEVA 1IWWA 162LA 3TXBA 2ZILA 1LGXA 3WMKA 1C6IA 4H8YA 4G4HA 1B7PA 1LJIA 1EQ4A 1L85A 4EKPA 253LA 2RB2X 1LKSA 4WG7A 3HH3A 4E97A 5KKJA 3LYMA 1IP3A 1B5VA 3QAKA 2DQCY 2ZNXY 1GFKA 2ANXA 5D5CA 2RH1A 3EMSA 2DQIY 1GFUA 1DYBA 2B6TA 2FYCA 1GB0A 3DN1A 1D3JA 3DMVA 4LYBA 2B74A 4QY9A 1NF5A 3FI7A 1C62A 2IGCA 1LJKA 1LJ4A 2HUKA 4DD0A 1L84A 1L41A 1H87A 1L43A 3OE8A 1OYUA 2BLYA 4QEQA 1D3MA 4H9FA 3GUIA 3A34A 1C6BA 4WM5A 152LA 2LC9A 1L25A 1L46A 1LI6A 4H92A 180LA 1L29A 1LHHA 1CX7A 5ILFA 1DPWA 5EBHA 1QT6A 2YBMA 3RZ4A 3LZ2A 4KT3A 3WUMA 1CV6A 1UIFA 4ARLA 1QS9A 1L66A 3HTBA 246LA 2HU1A 1L06A 1QTKA 142LA 1YAMA 1WVVA 4PPOA 3DMZA 4WM4A 1LAAA 1HEPA 4B4EA 4ETEA 1YKZX 4W57A 1LI3A 2MEDA 3B6LA 4B4JA 2DQEY 1QTDA 1GF4A 1PQDA 1JPOA 1L28A 1GFAA 3LN2A 1TAYA 1GFHA 1CVKA 145LA 1FBIX 1GAZA 1L98A 4TSBA 2XTHA 1LSBA 1GWDA 4WM2A 1LSAA 1FLYA 3HFMY 1PQOA 4GCCA 4DQJA 1QTZA 1EQ5A 177LA 169LA 196LA 1MLCE 1INUA 1GB9A 3J4GA 4PRUA 2D4JA 1L21A 1WVUA 1L76A 2F30A 4Z41A 1D0KA 4DJHA 5LVHA 2BQGA 3OE0A 1BQLY 1C67A 3UONA 3ZVQA 1XJUA 4H9EA 1C6DA 1YIKA 4NG1A 137LA 1P7SA 1L35A 194LA 4H9HA 1IP2A 1UA6Y 1NHBA 2X0AA 3GUJA 5FDJA 1DYGA 1OUBA 1BB4A 2MEIA 1IP6A 3HTFA 2QARC 4OO9A 3RNXA 1L34A 113LA 1C6EA 4GCFA 1NMMA 1JUGA 1L59A 143LA 3EO5A 4I8SA 3HBDA 195LA 1IY4A 256LA 3BKVA 4QGZA 5HMJA 1BB7A 183LA 4XYYA 210LA 4MR1A 120LA 1T97A 5HQ1A 2W1LA 2W1MA 1SQ2L 1J1XY 4GN4A 3HUKA 4KL7A 247LA 1LSDA 3WPKA 1KXXA 5LIOA 4B4IA 4G4CA 4LYCA 2DQGY 2MEBA 3ATNA 3IJVA 1GEZA 1VDTA 3WPJA 1JTTL 4I7NA 3PDSA 5KXOA 1C6TA 4A7DA 3FI5A 2OE9X 3LHMA 2ZIKA 3GULA 4H9CA 2D91A 5I5QA 1C65A 1UC0A 4ZEEA 3N9AA 5F9XA 1YKYX 3L2XA 114LA 4HJYA 1JEFA 1L82A 1L80A 1T8GA 1B7MA 4ET9A 171LA 4WL7A 1L83A 3SB8A 3CT0A 118LA 6LZMA 110LA 1CV3A 1L73A 2HEDA 1LYGA 3SN6R 2MEFA 3CQLA 4NSGA 1C61A 3P65A 4N5RA 5KXPA 4NGOA 3F8VA 240LA 1HERA 4II8A 1LTMA 3CDOA 3C80A 4BAFA 1IR7A 3SB7A 1HSXA 1REMA 1W08A 168LA 3FE0A 4EXMA 1GPQC 3OJPA 2BQBA 2H5ZA 5A3ZA 3J6KA 4WM3A 2F47A 2BQEA 131LA 3AW6A 1L00A 4NHPA 3AZ5A 1GB7A 1CU5A 2OU8A 2RB0X 3TXDA 123LA 1QIOA 1G1VA 1K28A 1LJHA 2HEEA 1QT3A 127LA 4LT1A 1D6PA 4P2EA 1NDGC 181LA 257LA 4WG1A 9LYZA 4Z3MA 3HWLA 1RE2A 1D3FA 4ARQA 1HELA 1B7QA 4LYZA 193LA 1OUIA 4EPFA 1L50A 3G3AB 5KXMA 1GBWA 5FSTA 1LZBA 2H9JA 4RDSA 5LVGA 2LZ2A 2HU3A 1CTWA 1LZ9A 2C8OA 241LA 3W6CA 1C64A 128LA 5DN4A 3RZEA 5T3FA 1SX7A 1L20A 1Z55A 1PQIA 5FHWA 242LA 1GBXA 4ETCA 4IAPA 1P2CC 1L38A 2BQAA 208LA 4YM8A 1L04A 2HECA 4N8ZA 5B07A 1GFTA 1L93A 1QUHA 1JKCA 2GV0A 1GDXA 262LA 1BGIA 1IWXA 3WULA 1HEOA 4W55A 1LKRA 3IJUA 153LA 1RFPA 3RUNA 5LYZA 4W58A 4Z46A 1LZGA 1QUTA 4WOAA 4DD2A 5LYMA 3GUPA 1P2RA 2B7XA 1FLQA 4EPIA 251LA 1RJCB 258LA 4YX7C 3HDFA 3K2RA 1XEIA 1GDWA 1XGUC 4I7LA 4AQNA 1L11A 134LA 4XENA 5JENB 2B6XA 4GCEA 141LA 4RLNA 1L23A 1LZ4A 4OWHA 2OU0X 4DDBA 1AKIA 1DKKA 232LA 5C6LA 1G7LC 4EKSA 1GBSA 1LJJA 138LA 5DL9A 1LMNA 3G3XA 1P3NA 4NWEA 2BQNA 1L40A 3WYHA 1CNSA 222LA 4GBRB 1XGTC 1BVKC 4UWVA 223LA 4ML7A 4XADA 1LMPA 3HUAA 1CJ9A 1KS3A 1GE1A 1EQEA 3A3RX 5LAFA 5E4PA 3W6BA 104LA 182LA 1C6JA 4WMGA 1GXXA 1T6VL 248LA 5I4WA 4LDOA 4HV2A 3TXEA 233LA 1WTMA 1C66A 1LZCA 4HJVA 1L0KA 1P64A 1GAYA 4HPIA 3OE6A 4OW1A 5LXWA 5I4YA 1JSFA 1UIDA 1L88A 3HU8A 3QE8A 1XEPA 1I20A 2DQFC 4GLVA 3HDEA 2OEAX 187LA 1HEWA 1VDQA 2LYOA 4W96A 1HFZA 4NGYA 4KPMA 1GFVA 1LZYA 1L52A 1XEJA 4J0LA 1P36A 1T8FA 1P37A 1TLAA 1B7SA 1LSCA 1FDLY 4C5FA 1QT7A 235LA 4DD9A 1L64A 1GD6A 3B0OA 1C46A 1UIBA 159LA 184LA 4DD7A 3C8RA 1WQRA 2B70A 1C6MA 3A67Y 4WL6A 1L99A 3DNAA 1WTHA 1L58A 1JKAA 4GRVA 1CX6A 1C6LA 2FBDA 4WLDA 2OU9A 1KIRC 3P64A 1L24A 2B6YA 2RBSA 4LGKA 1CU2A 1GB8A 236LA 205LA 1OUHA 245LA 230LA 2RB1X 3M18B 5KKIA 5J7CA 4ETDA 1LYOA 1LJGA 1J1OY 1CKHA 1NHEA 2LHMA 1CU0A 1B5UA 213LA 1F6SA 3TMVA 1LZ5A 115LA 1DPXA 1SSWA 1WQPA 2HEBA 1P2LA 201LA 3TXJA 1OUCA 3B72A 1CUQA 5APDA 2MEHA 1A2YC 2DQHY 5DM9A 4DD1A 1JITA 4GN3A 1H6MA 1GF3A 4W51A 2BQFA 1L45A 1C6HA 3A6CY 1QSWA 3DN8A 4YXAC 4NGIA 4TWSA 3SB5A 1GF8A 1KW5A 3WPLA 160LA 224LA 144LA 1O23A 1CKCA 1DI5A 4HP0A 4ARJA 4WO6A 5APFA 2YBNA 1L12A 4LFPA 4R0FA 1KW7A 4GCBA 1ZMYL 4KXIA 1DZBX 1LHMA 2RAZX 1GFEA 1L37A 4XJBA 135LA 4HSFA 4PGJB 1LYIA 5LA8A 5DN5A 4OOOA 1IOTA 1OVKA 2ZWBA 209LA 3SBAA 5HNCA 2NWDX 1C43A 172LA 5M1YA 4I7RA 1B9OA 1LSPA 2BQDA 4NGWA 1OUAA 2NTHA 1IOCA 3OE9A 1UUZC 4O34A 1LZAA 252LA 4XN6A 4RLMA 1L71A 2MEEA 1KXYA 1QDTA 1UACY 1LLHA 2BQMA 4HTKA 4B49A 3NYAA 1L42A 2QB0B 1CKFA 185LA 4G49A 243LA 1LYJA 2BQLA 2YVBA 2Z38A 4I7JA 1MELL 1REYA 1IEEA 3AJNA 1IY3A 3N9EA 1BB6A 1LSGA 5FCPA 1AZFA 1LZEA 1GB6A 3E3DA 4ZPUA 1IIZA 1QUGA 1KIPC 1LSNA 3K3TA 4AGAA 186LA 4G9SA 1L53A 1BHZA 2F4AA 4NHTA 244LA 5KXXA 2FBBA 1D6QA 1IC7Y 1L03A 4ANRA 1EL1A 1AT6A 1L07A 2YBLA 212LA 3GUNA 3AGGG 1GB2A 149LA 218LA 4LFXA 1LMQA 3A92A 2HEAA 1L26A 4RW2A 1G0QA 5L3HA 215LA 1HHLA 4N1CC 1FN5A 3C8QA 3T6UA 3WU7A 5LAGA 4NG8A 1TEWA 1LJNA 3P4ZA 4NGJA 1LPYA 4DQ7A 1UBZA 1LJ3A 4XJHA 4W59A 1L44A 1G7IC 2BQIA 4I7KA 5C6IA 5F9UA 129LA 1C6CA 1LJEA 3HU9A 4I7SA 3NY8A 4J1AA 2Z12A 1D0LA 1CU6A 1IOQA 3TXFA 1NDMC 4D9ZA 5LZMA 4H8ZA 1JJ3A 3HH6A 3G3WA 1DYEA 1B6IA 1CUPA 1L87A 259LA 4IASA 5B59A 1IR9A 3GUOA 5KXYA 3HH4A 4WLTA 2RBOA 4RW1A 1OVJA 3C7YA 4CGEA 3HBEX 1RI8B 1ZVYB 2YBIA 1P56A 1GB3A 4LYTA 3A94A 238LA 1OV7A 1OVHA 4X3BA 3HBHA 5I53A 188LA 1HFYA 2XQOA 1UICA 1XSFA 3CDVA 2VB1A 4DDCA 4YF2A 3CDQA 4Z98A 5IHGA 1JJ0A 4WO9A 1QTEA 1UIHA 3HT8A 102LA 2IFFY 4ARMB 1UIEA 3W6EA 1REZA 4B1AA 2Q0MX 4DAJA 3C81A 5APCA 1L65A 1DI4A 1AT5A 1P5CA 1JJ1A 1L17A 4NIJA 8LYZA 1IWYA 1B5ZA 197LA 1GF5A 216LA 1TDYA 146LA 1C63A 3A96A 1LWGA 211LA 1L57A 2B75A 4TSCA 4PJ2C 1WQMA 2O7AA 4EKRA 5LYTA 1QUSA 1JIYA 3TXGA 4OOTA 1KNIA 4BAPA 192LA 1C6PA 4HTNA 1QTVA 3VW7A 1QUDA 4S0WA 1LZSA 1YILA 1DYDA 1C6FA 3V2WA 108LA 3C8SA 3L64A 3DN6A 1KXWA 3TXHA 125LA 1PS5A 1BVXA 4H1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6Z A;  1G7H C;  2HU1 A;  3QE8 A;  1I20 A;  1QTK A;  1JKD A;  1YAM A;  1WVV A;  2HEF A;  4PHI A;  4NHQ A;  1B5X A;  2DQF C;  4GLV A;  4PPO A;  4WM6 A;  4WM4 A;  1LMO A;  1LAA A;  4CFO A;  1LSF A;  5IDD A;  1HEW A;  1VDQ A;  2LYO A;  4W96 A;  3A91 A;  3VWO A;  4DT3 A;  1HEP A;  1HFZ A;  4NGY A;  4KPM A;  2CWI A;  4NGL A;  1HF4 A;  1CJ8 A;  4B4E A;  1F6R A;  1YKZ X;  3P66 A;  4ETE A;  1GFV A;  1LZY A;  3AZ7 A;  2BQH A;  1B5W A;  1IC4 Y;  2MED A;  3WUL A;  3QNG A;  1LHI A;  3B6L A;  1W6Z A;  3TMW A;  3ATO A;  4GN5 C;  4B4J A;  1XEJ A;  1GE0 A;  3AGH A;  4J0L A;  5B06 A;  2DQE Y;  1OUG A;  4IJ4 A;  5FEL A;  4NEB A;  1B7S A;  1DKJ A;  1JIS A;  1GF4 A;  1LSC A;  1FDL Y;  4C5F A;  1NKH A;  1HEN A;  4H9A A;  1JPO A;  3CSQ A;  4DD9 A;  1OUJ A;  1HEM A;  2EKS C;  3WW6 A;  1GFA A;  2DQJ Y;  1GD6 A;  1VAT A;  2XJW A;  3LN2 A;  3B0O A;  1C46 A;  1UIB A;  1TAY A;  1GFH A;  1B2K A;  2MEA A;  4DD7 A;  4NHI A;  1WQR A;  1FBI X;  3CT5 A;  1GAZ A;  4N9R A;  4TSB A;  4YOP A;  2BQK A;  3A67 Y;  5A3E A;  2XTH A;  1NWG A;  4WL6 A;  1LSB A;  1GWD A;  2DKV A;  4WM2 A;  1LSA A;  1FLY A;  3HFM Y;  3EXD A;  1QDR A;  2BQC A;  4GCC A;  1JKA A;  4OWB A;  1UIA A;  1IOR A;  1EQ5 A;  2FBD A;  4WLD A;  1MLC E;  4H91 A;  3WU9 A;  1INU A;  1GB9 A;  1I56 A;  1YAN A;  3J4G A;  1G7M C;  1OP9 B;  4PRU A;  4DDA A;  1YAO A;  4N1E I;  1KIR C;  2D4J A;  3P64 A;  4LGK A;  4LYM A;  1GB8 A;  1WVU A;  2F30 A;  1CKD A;  3WL2 A;  4Z41 A;  1D0K A;  2A7F A;  3D9A C;  5LVH A;  2BQG A;  1GF9 A;  4H8X A;  1IP4 A;  1OUH A;  1BQL Y;  2A7D A;  4HJZ A;  1HFX A;  3M18 B;  5KKI A;  5J7C A;  4ETD A;  3A95 A;  1LYO A;  3LYT A;  3ZVQ A;  6LYT A;  133L A;  1LJG A;  4W94 A;  4UWU A;  1J1O Y;  5HLL A;  1HC0 A;  4H9E A;  1XGQ C;  1CKH A;  1NHE A;  1YIK A;  2LHM A;  4NG1 A;  5KY1 A;  1B5U A;  1LZT A;  2WAR A;  4QDN A;  3RW8 A;  194L A;  4H9I A;  2ZIJ A;  4H9H A;  1IP2 A;  1UA6 Y;  2X0A A;  2EIZ C;  3QY4 A;  3AGI A;  1F6S A;  2XBS A;  5DLA A;  5FDJ A;  1OUB A;  3TMV A;  1BB4 A;  1LZ5 A;  2MEI A;  4E3U A;  1WQP A;  1DPX A;  4BS7 A;  3WVY A;  2HEB A;  4YEN A;  3AZ6 A;  1IP6 A;  1LHL A;  4CFP A;  2ZYC A;  3WW5 A;  3TXJ A;  1VDP A;  3M3U A;  4LT2 A;  3A93 A;  1OUC A;  3B72 A;  1E8L A;  1FKQ A;  4M4O A;  2Z2F A;  3RNX A;  4GCF A;  1XFP L;  1CKG A;  2MEH A;  5APD A;  2BPU A;  1NMM A;  1VED A;  1A2Y C;  2DQH Y;  1JUG A;  3A8Z A;  5DM9 A;  1YL1 X;  3AZ4 A;  4EOF A;  1VDS A;  1JKB A;  4DD1 A;  1JIT A;  3EO5 A;  4H90 A;  4I0C A;  4GN3 A;  2W1X A;  1H6M A;  4I8S A;  4DC4 A;  2DQA A;  4L41 A;  3HBD A;  5LA5 A;  5F16 A;  5HMV A;  1GF3 A;  5C6J A;  1IY4 A;  1NBZ C;  2C8P A;  4TTD A;  2BQF A;  3A6C Y;  1JSE A;  1QSW A;  3BKV A;  4QGZ A;  1IO5 A;  5HMJ A;  1BB7 A;  4NGI A;  4TWS A;  1GF8 A;  4XYY A;  4NGZ A;  3WPL A;  4MR1 A;  5HQ1 A;  2W1L A;  5E9R A;  3WUA A;  1O23 A;  2W1M A;  1SQ2 L;  1CKC A;  1DI5 A;  1BB5 A;  4HP0 A;  1J1X Y;  1LZR A;  4GN4 A;  4KL7 A;  2BLX A;  4CJ2 A;  3A90 A;  1LSD A;  1ALC A;  1TBY A;  2CDS A;  2YBN A;  4WO6 A;  5APF A;  1KXX A;  3WPK A;  5KJ9 A;  4LFP A;  4R0F A;  5LIO A;  4B4I A;  4G4C A;  4LYC A;  2DQG Y;  2MEB A;  3ATN A;  4GCB A;  1ZMY L;  1BWJ A;  2G4Q A;  4ETB A;  4OWA A;  1B7L A;  1DZB X;  1LHM A;  3IJV A;  4KXI A;  1GEZ A;  5I54 A;  2MEC A;  4LYO A;  1VDT A;  1LZ6 A;  3WPJ A;  5ILC A;  1JTT L;  5KXK A;  1GBO A;  1GFE A;  1QSA A;  2LYM A;  4HPE A;  4XJB A;  5KXO A;  2BAA A;  4A7D A;  4G4B A;  3TMX A;  135L A;  4HSF A;  4PGJ B;  6LYZ A;  1DXJ A;  1JHL A;  3LHM A;  2ZIK A;  5LA8 A;  4H9C A;  1GF6 A;  2BQO A;  2D91 A;  4IAT A;  5I5Q A;  3IWR A;  1UC0 A;  4ZEE A;  4H94 A;  5II3 A;  5DN5 A;  2AUB A;  1IOT A;  1T3P A;  3N9A A;  4OOO A;  4XJD A;  2ZWB A;  5F9X A;  2ZYP A;  1V7S A;  4NSJ A;  3WVX A;  1YKY X;  2NWD X;  5HNC A;  1LHK A;  1C43 A;  1YRO A;  1YAQ A;  5M1Y A;  1B9O A;  1BWI A;  1HEQ A;  1LSP A;  1OQM A;  2BQD A;  2Y8P A;  4HJY A;  4NGW A;  1JEF A;  1OUA A;  2LZT A;  2XBR A;  132L A;  1LMT A;  4NSH A;  4ET8 A;  1B7M A;  1IOC A;  2MEG A;  154L A;  4H93 A;  4NHS A;  1UUZ C;  2CJL A;  4O34 A;  4ET9 A;  4WL7 A;  1LZA A;  1RCM A;  4EMN A;  5KXR A;  3CT0 A;  4XN6 A;  2W1Y A;  4RLM A;  1IP1 A;  3BKH A;  1NBY C;  2MEE A;  2ZQ3 A;  4J1B A;  2HED A;  1KXY A;  1QDT A;  1UAC Y;  2DBT A;  1XGP C;  3RT5 X;  1JWR A;  5B05 A;  2BQM A;  207L A;  2MEF A;  4HTK A;  4B49 A;  3CQL A;  4NSG A;  4DYG A;  1DQJ C;  3P65 A;  4N5R A;  4UWN A;  5KXP A;  3ZVQ B;  1CKF A;  1JTO L;  4NGO A;  3AW7 A;  2EPE A;  4G49 A;  4OWC A;  1HER A;  2EQL A;  4II8 A;  2HUB A;  1LTM A;  1QQY A;  4NGV A;  1IWZ A;  1GXV 2;  4NGK A;  3AB6 A;  4BAF A;  2BQL A;  2YVB A;  1IR7 A;  2Z38 A;  1IC5 Y;  1MEL L;  1REY A;  1OUD A;  1IEE A;  1HSX A;  1REM A;  1B5Y A;  1IY3 A;  1HNL A;  3AJN A;  1BB6 A;  3N9E A;  3ZEK A;  1LSG A;  1W08 A;  4MST A;  4WLY A;  1AZF A;  4DD3 A;  1LZE A;  1YKX X;  5FCP A;  1GB6 A;  3E3D A;  2B5Z A;  1GB5 A;  1LYS A;  3FE0 A;  1IIZ A;  1KIP C;  1GPQ C;  2N5Z A;  1C10 A;  3OJP A;  2ZQ4 A;  2BQB A;  1LSN A;  3K3T A;  5F81 A;  2H5Z A;  4AGA A;  1B7O A;  4G9S A;  2F4A A;  1BHZ A;  4NHT A;  3W3E A;  1BWH A;  2FBB A;  5KXX A;  1D6Q A;  5KXL A;  1IC7 Y;  5A3Z A;  3P68 A;  2YSS C;  4ANR A;  2YBJ A;  5F14 A;  5LVJ A;  4HTQ A;  1GF0 A;  1LJF A;  3J6K A;  1I1Z A;  4WM3 A;  5HNL A;  3KAM A;  3W6F A;  1EL1 A;  3F6Z A;  2YBH A;  3WU8 A;  3CT1 A;  2HTX A;  2BQE A;  1AT6 A;  3OK0 A;  5AMY A;  2YBL A;  3AW6 A;  1VAU A;  2RSC A;  1ZV5 L;  4NHP A;  3TMU A;  3AZ5 A;  1GB7 A;  1D9U A;  3AGG G;  4FDY A;  1GB2 A;  3LZT A;  1LZ8 A;  2Z37 A;  4LFX A;  1GE4 A;  1LMQ A;  1GFG A;  1VFB C;  3A92 A;  4PRQ A;  3ULR A;  2HEA A;  3W6A A;  1JTP L;  4OWE A;  3N9C A;  3TXD A;  2G4P A;  4AXT A;  4ZFP A;  2ZNW Y;  1YAP A;  1QIO A;  4RW2 A;  5L3H A;  1LJH A;  3CSR A;  3LYO A;  1HHL A;  3D3D A;  4N1C C;  1FN5 A;  2HEE A;  1ZVH L;  3T6U A;  4YEM A;  5D5F A;  5I4X A;  4LT1 A;  1HMK A;  1D6P A;  3WU7 A;  1GE2 A;  5KXS A;  5LAG A;  4P2E A;  1B0D A;  1NDG C;  4NG8 A;  1C45 A;  1TEW A;  4LZT A;  1LJN A;  1GE3 A;  1WQQ A;  3P4Z A;  4GCD A;  4NGJ A;  4WG1 A;  1TCY A;  5KXN A;  9LYZ A;  1UBZ A;  1HSW A;  4N0J A;  4TUN A;  4Z3M A;  1LJ3 A;  1RE2 A;  1F10 A;  1LSE A;  4XJH A;  5IEL A;  3WXT A;  1HEL A;  1LSM A;  2D6B A;  1B7Q A;  4LYZ A;  193L A;  3A6B Y;  1OUI A;  4WLX A;  1LOZ A;  1LZ1 A;  1G7I C;  2BQI A;  5KXW A;  2Z19 A;  3G3B B;  5B1F A;  3G3A B;  3W6D A;  1IWU A;  5KXM A;  5APE A;  5C6I A;  1GF7 A;  5F9U A;  1LHJ A;  3CB7 A;  1GBW A;  1REX A;  5FST A;  1LJE A;  4J1A A;  1LYY A;  1LZB A;  2H9J A;  2Z12 A;  4NY5 A;  4RDS A;  1LMA A;  5LVG A;  5L3I A;  1D0L A;  2LZ2 A;  2Z18 A;  2HU3 A;  3A3Q A;  4LT0 A;  3RU5 A;  1IOQ A;  1J1P Y;  3TXF A;  2D4I A;  1IP5 A;  7LYZ A;  1NDM C;  4D9Z A;  3TXK A;  1LZ9 A;  4H8Z A;  3WXU A;  1JJ3 A;  2C8O A;  3W6C A;  1UIG A;  1XGR C;  3WH1 A;  5DN4 A;  1YQV Y;  1FKV A;  1LZN A;  5T3F A;  1Z55 A;  4ETA A;  1LSZ A;  2LYZ A;  4IAS A;  1CJ7 A;  5B59 A;  1KIQ C;  5KXT A;  4B0D A;  1IR9 A;  5FHW A;  5KXY A;  1GBX A;  4WLT A;  4ETC A;  5LVK A;  1P2C C;  2G4N A;  2BQA A;  4FJR A;  208L A;  4YM8 A;  1FLW A;  1B7R A;  3MGW A;  5L9J A;  2HEC A;  3B0K A;  4RW1 A;  1B7N A;  2F4G A;  4N8Z A;  5B07 A;  1GFT A;  4C3W A;  1IR8 A;  1XEK A;  1D0M A;  4NFV A;  4J7V A;  1JKC A;  2GV0 A;  1GDX A;  2Z39 A;  4CGE A;  3HBE X;  4BAD A;  1BB3 A;  1BGI A;  1IWX A;  1RI8 B;  1ZVY B;  1HEO A;  1LCN A;  2FYD A;  1GB3 A;  2YBI A;  1LKR A;  2Z2E A;  2PC2 A;  3IJU A;  3T36 A;  1RFP A;  1UCO A;  4LYT A;  153L A;  2BQJ A;  1AM7 A;  1OUF A;  3A94 A;  4MCK A;  4XJF A;  4YEO A;  4NSI A;  5FEK A;  1F0W A;  5LYZ A;  4Z46 A;  1IOS A;  4TX7 A;  1LZG A;  1QUT A;  4LT3 A;  1IWT A;  3HBH A;  4WOA A;  4X3B A;  3WUN A;  5I53 A;  1GFJ A;  1LYZ A;  1HFY A;  4DD2 A;  5LYM A;  3LYZ A;  5K7O A;  1IVM A;  1DI3 A;  1UIC A;  1XSF A;  4R6C A;  2VB1 A;  4DDC A;  1C7P A;  4NWH A;  4M6D A;  2DQD Y;  2I25 L;  1FLQ A;  4YF2 A;  3SP3 A;  1V7T A;  1A4V A;  1RJC B;  4Z98 A;  5KXZ A;  5IHG A;  5LVI A;  1GBZ A;  1JJ0 A;  1LSY A;  1CJ6 A;  1FLU A;  3GXK A;  4DWX A;  1GBY A;  1XEI A;  1GDW A;  4WO9 A;  1XGU C;  4H9B A;  1QTE A;  2CGI A;  4U3X B;  1UIH A;  5LIN A;  1HML A;  1NQI A;  2IFF Y;  134L A;  4XEN A;  1UIE A;  5JEN B;  4XJG A;  1GEV A;  2IHL A;  3W6E A;  1IWW A;  4ZIX A;  4GCE A;  3TXB A;  1REZ A;  2ZIL A;  3TXI A;  1N4F A;  4RLN A;  4B1A A;  2Q0M X;  5APC A;  3WMK A;  1LZ4 A;  4H8Y A;  3CSZ A;  4G4H A;  3B0I A;  4OWH A;  1DI4 A;  1B7P A;  1LJI A;  4DDB A;  1AKI A;  1AT5 A;  1EQ4 A;  1DKK A;  5C6L A;  1G7L C;  1LKS A;  4WG7 A;  1JJ1 A;  4NIJ A;  1GHL A;  4WM1 A;  8LYZ A;  5KKJ A;  1GBS A;  1IWY A;  1LJJ A;  1IP3 A;  1B5V A;  3LYM A;  1B5Z A;  1LZD A;  2DQC Y;  2ZNX Y;  1GFK A;  5DL9 A;  5B1G A;  5D5C A;  3EMS A;  2DQI Y;  1GF5 A;  1TDY A;  1GFU A;  1LMN A;  3A96 A;  2FYC A;  1LPI A;  1IWV A;  3AYQ A;  4NWE A;  1GB0 A;  1SLY A;  4TSC A;  2BQN A;  4PJ2 C;  1WQM A;  4LYB A;  3WYH A;  1CNS A;  4QY9 A;  5LYT A;  1NF5 A;  1QUS A;  3FI7 A;  1JIY A;  3TXG A;  4OOT A;  2H9K A;  4BAP A;  1LJK A;  1LJ4 A;  1XGT C;  4DD0 A;  1BVK C;  4HTN A;  4XJI A;  4UWV A;  4ML7 A;  1WQN A;  1IP7 A;  1H87 A;  4XAD A;  1PZY A;  1LMP A;  2BLY A;  1G7J C;  1WTN A;  2YDG A;  4QEQ A;  1C08 C;  1GFR A;  4H9F A;  1CJ9 A;  1GE1 A;  1EQE A;  1LZS A;  1YIL A;  2I26 L;  3A3R X;  5E4P A;  3A34 A;  5LAF A;  3W6B A;  4WM5 A;  4WMG A;  1GXX A;  1T6V L;  5I4W A;  4H92 A;  4HV2 A;  1YL0 X;  3TXE A;  1IX0 A;  1LHH A;  2F2N A;  1WTM A;  3GXR A;  1DPW A;  4GLA A;  1LZC A;  1KXW A;  1OUE A;  4HJV A;  5EBH A;  2YBM A;  5ILF A;  1LMC A;  3RZ4 A;  2D4K A;  3TXH A;  4CHX A;  1GAY A;  3EBA B;  3LZ2 A;  4KT3 A;  4HV1 A;  3WUM A;  4HPI A;  4OW1 A;  1PS5 A;  1BVX A;  1UIF A;  1WQO A;  5LXW A;  5I4Y A;  1JSF A;  1UID A;  4H1P A; 
#chains in the Genus database with same CATH topology
 1PQM A;  2I6Z A;  1G7H C;  1DV0 A;  1ZYT A;  4PHI A;  1JKD A;  3KOY E;  4WM6 A;  1B5X A;  1ZMV A;  1L68 A;  4NXM M;  4CFO A;  1LSF A;  4G4N A;  4GH9 A;  4DT3 A;  4NGL A;  2CWI A;  1F6R A;  3P66 A;  1EPY A;  198L A;  1LGW A;  2LVP C;  1B5W A;  1IC4 Y;  3QNG A;  1L55 A;  4GN5 C;  3DN3 A;  1GE0 A;  1W5T A;  5FEL A;  4IJ4 A;  3EIE A;  254L A;  1DKJ A;  1IY1 A;  1JIS A;  1OQY A;  4JI7 M;  1NKH A;  4H9A A;  3LW5 F;  3CSQ A;  2EKS C;  1TF0 B;  2CE7 A;  2F5O A;  1R2Z A;  4LF9 M;  1B2K A;  2UUC M;  3SAR A;  4NHI A;  2I7N A;  2BNK A;  3CT5 A;  1QZE A;  1LW9 A;  4Z6Y A;  4YOP A;  2BQK A;  4PCZ A;  3GQ5 A;  1JR3 E;  3K2L A;  3HHW A;  3B7Q A;  3EXD A;  1JTM A;  2BQC A;  2ZAM A;  109L A;  4OWB A;  1L32 A;  1UIA A;  4MB7 A;  178L A;  4DR1 M;  1L94 A;  3HHX A;  1QS5 A;  4H91 A;  1YAN A;  3GLI E;  2B6Z A;  3M6A A;  1L1T A;  229L A;  1DYA A;  4NC6 A;  3C7W A;  1CKD A;  2B73 A;  3WL2 A;  1KY0 A;  1L62 A;  3D9A C;  167L A;  1IP4 A;  2A7D A;  4WUR A;  1HFX A;  4HJZ A;  4LDE A;  4KT0 F;  3LYT A;  4L8R C;  4W94 A;  3ZQJ A;  1FJG M;  8CAT A;  3I4Y A;  5HLL A;  4FWD A;  3HX3 A;  3L28 A;  3JR4 A;  4QDN A;  3RW8 A;  3NY9 A;  2ZIJ A;  173L A;  4NL4 H;  3QY4 A;  3AGI A;  3DOA A;  5DLA A;  3DN2 A;  4E3U A;  2HUM A;  3AZ6 A;  1DYC A;  4JXJ A;  3WW5 A;  1QTC A;  1VDP A;  1OWZ A;  5ITQ A;  2LVN C;  4LT2 A;  3CTW B;  1FKQ A;  4M4O A;  2Z2F A;  3VK7 A;  139L A;  1DGG A;  1IBK M;  3C82 A;  1K3X A;  1CKG A;  2BPU A;  3A8Z A;  3DMX A;  4EOF A;  2LCB A;  1VDS A;  1JKB A;  2Y0T A;  2O4W A;  2C98 A;  3VLF B;  2UUB M;  3HU1 A;  2OOA A;  4TUW A;  1N78 A;  1L27 A;  228L A;  4L41 A;  5F16 A;  5HMV A;  4TTD A;  1Z59 A;  1JSE A;  1LYF A;  1TTE A;  2R6F A;  2Z4R A;  1T6O A;  2WSF F;  1PJI A;  206L A;  3TWL A;  166L A;  3GUM A;  1LGU A;  1NSF A;  1BB5 A;  3KVW A;  1LZR A;  4CJ2 A;  5KJ9 A;  2M60 A;  4EKQ A;  1X37 A;  174L A;  3F92 A;  5IT9 S;  3JR5 A;  161L A;  1L81 A;  1BWJ A;  5I54 A;  4LYO A;  5ILC A;  1C6K A;  2JWS A;  1LZ6 A;  2OTY X;  3GLH E;  4DUY M;  1QSA A;  4G4R A;  2BAA A;  1PQK A;  2QEN A;  4G4B A;  3TMX A;  2CUU A;  6LYZ A;  189L A;  4LRT A;  1P6Y A;  2EA0 A;  1GF6 A;  2BQO A;  3IWR A;  2CRU A;  5II3 A;  2AUB A;  1L70 A;  4MGY E;  2VQF M;  1LWK A;  2ZYP A;  2L7I A;  4NSJ A;  3FRH A;  1YRO A;  3W0L B;  1BWI A;  1HEQ A;  1SXJ D;  1L89 A;  1D3N A;  2XBR A;  4MGZ E;  4ET8 A;  1L22 A;  2J7N A;  1L69 A;  3GLG E;  4H93 A;  2CJL A;  4LY6 A;  5C1B A;  1RCM A;  4EMN A;  1QT5 A;  3GPU A;  1L8Q A;  1NBY C;  2ZQ3 A;  2A5Y B;  4J1B A;  4NSO B;  3SBB C;  2HCB A;  2DBT A;  1L02 A;  207L A;  4W52 A;  3PVS A;  3U6S A;  2VDB B;  4GMQ A;  3ZVQ B;  158L A;  1JTO L;  1L18 A;  3F9L A;  3HH5 A;  3AW7 A;  1QSQ A;  2CV0 A;  164L A;  2HUB A;  4NGV A;  1IWZ A;  1GXV 2;  4GKJ M;  1IC5 Y;  1ZV1 A;  2DEN A;  3JAM S;  1XXH B;  2JY7 A;  4F1I A;  1HNL A;  4DD3 A;  4GRI A;  3EML A;  3JR6 A;  4WLY A;  1L95 A;  1YKX X;  1SWZ A;  2XSZ D;  1HNW M;  2B5Z A;  2OTZ X;  2N5Z A;  2RBR A;  1C10 A;  1LYH A;  2ZQ4 A;  2RBP A;  4DUZ M;  3C9P A;  1L49 A;  5F81 A;  1B7O A;  2OE4 X;  4I7Q A;  1GJS A;  5KXL A;  3PBL A;  1D2Y A;  4PJZ A;  2YBJ A;  3THG A;  5F14 A;  1C6Q A;  4HTQ A;  1L92 A;  3KDS E;  1I1Z A;  1OV5 A;  5HNL A;  2FNA A;  3CT1 A;  2HTX A;  1QZM A;  2O01 F;  3OK0 A;  2L6O A;  1N32 M;  1G0J A;  1NY6 A;  1VAU A;  2DZL A;  1IFY A;  3RFW A;  4FDY A;  1L96 A;  2JUJ A;  1MN3 A;  1NJG A;  1GE4 A;  1GFG A;  3WHL A;  1JTP L;  4OWE A;  3N9C A;  4AXT A;  1L10 A;  4ZFP A;  3TWK A;  1YAP A;  1EIJ A;  219L A;  1T6H A;  4LF8 M;  2L78 A;  3CSR A;  3HT6 A;  3D3D A;  3LYO A;  3LCU A;  4YEM A;  3GRR A;  156L A;  3LZM A;  2Q9E A;  2HL7 A;  1GE2 A;  5KXS A;  3D8L A;  1C45 A;  4LZT A;  5KXN A;  1L2D A;  1GE3 A;  1ZUR A;  1TCY A;  176L A;  1WR1 B;  1HSW A;  1L16 A;  3VDP A;  4TUN A;  5I14 A;  1L19 A;  5IEL A;  1F10 A;  1LSE A;  4ARP A;  2C96 A;  1LSM A;  1VDD A;  1HT1 E;  2D6B A;  4IJF A;  4WLX A;  1LOZ A;  5KXW A;  1WXQ A;  217L A;  1DGH B;  1NNJ A;  5B1F A;  4B3M M;  3W6D A;  5APE A;  1LHJ A;  2XGN A;  1J09 A;  4CIS A;  1LYY A;  2B6W A;  1OJL A;  1LMA A;  2BJW A;  3FA0 A;  1L51 A;  225L A;  2Z18 A;  4LT0 A;  1J1P Y;  1G06 A;  1L30 A;  2D4I A;  1IP5 A;  2F2Q A;  7LYZ A;  1L63 A;  1GKI A;  4RF0 A;  3WXU A;  1L14 A;  2R18 A;  163L A;  1YQV Y;  1FKV A;  3KW6 A;  1PJS A;  3PNV A;  1L08 A;  4ETA A;  200L A;  4M0D A;  2LYZ A;  1L74 A;  1CJ7 A;  1D9W A;  1KIQ C;  1WJ7 A;  4KLN A;  260L A;  4B0D A;  1V33 A;  1HQC A;  2Z7J A;  3C7Z A;  5LVK A;  3T1H M;  4FJR A;  4I7T A;  2Z4S A;  3G3V A;  1B7R A;  1L39 A;  5L9J A;  3B0K A;  1B7N A;  2RKO A;  3HUQ A;  4C3W A;  1D0M A;  3MK6 A;  2Z39 A;  2MJ5 B;  4BAD A;  1ZMU A;  2Z2E A;  5KQD A;  1ZAE A;  147L A;  1UCO A;  2BQJ A;  1OUF A;  4YEO A;  4DQ5 A;  4LF6 M;  4NRW A;  1C69 A;  2R62 A;  4LT3 A;  214L A;  2CP8 A;  2DVW B;  4AQY M;  1CV4 A;  1LYZ A;  1G59 A;  4P17 A;  3W68 A;  3HHZ A;  1DI3 A;  1IVM A;  4R6C A;  1L79 A;  3BBZ A;  1C7P A;  4NWH A;  4M6D A;  1L60 A;  3KP0 E;  3DN0 A;  3SP3 A;  1V7T A;  4W5W A;  1A4V A;  3HTG A;  1DYF A;  4K0K M;  2DZO B;  5LVI A;  1GBZ A;  3GXK A;  1L97 A;  1GBY A;  1L67 A;  5BPV A;  2LH0 A;  2FS1 A;  4U3X B;  1ZQ9 A;  1HML A;  4PK0 A;  199L A;  1L56 A;  1T8A A;  2IHL A;  4ZIX A;  157L A;  3TXI A;  1N4F A;  4LRS A;  3L29 A;  227L A;  3GPX A;  4EIW A;  3CSZ A;  4UN2 B;  3B0I A;  4I7O A;  2Q2E B;  1L33 A;  4WM1 A;  1GHL A;  4LZZ A;  2DI0 A;  1LZD A;  5B1G A;  2R65 A;  4QOZ C;  1XXH A;  3GRY A;  175L A;  1D2W A;  1Q39 A;  2DWM A;  2D7H A;  2DHY A;  3AYQ A;  1LPI A;  1IWV A;  5DYG A;  5H37 D;  3KS4 A;  1SLY A;  1L0J A;  2F5S A;  4ARQ B;  1C6A A;  4B3S M;  220L A;  2H9K A;  4DR7 M;  1SSY A;  3GLF E;  4XJI A;  1YE9 A;  1WQN A;  1IP7 A;  2OE7 X;  1PZY A;  1OIP A;  3KOW E;  1PGY A;  1G7J C;  1WTN A;  2YDG A;  1C08 C;  1GFR A;  231L A;  4B3T M;  2I26 L;  2LVQ D;  2B72 A;  2OO9 A;  2RGO A;  226L A;  1L86 A;  1VG5 A;  3CF6 E;  107L A;  3SB9 A;  1YL0 X;  1CU3 A;  1GLN A;  1IX0 A;  2KA6 B;  2A4T A;  2F2N A;  3GXR A;  4GLA A;  1OUE A;  3PNY A;  1LMC A;  2D4K A;  4CHX A;  3U60 A;  3EBA B;  4HV1 A;  1QTB A;  1WQO A;  4X64 M;  2Z6B A;  4L6V 6;  3J80 S;  2HEF A;  4NHQ A;  4DV2 M;  3HGI A;  2F4V M;  1LMO A;  2L09 A;  5IDD A;  3CGW A;  4LDL A;  3A91 A;  4L15 A;  3VWO A;  1C6G A;  1G07 A;  2ANV A;  261L A;  4L4U A;  1HF4 A;  1CJ8 A;  4W53 A;  234L A;  1I6S A;  3AZ7 A;  2BQH A;  1E9S A;  1LHI A;  1CV5 A;  1W6Z A;  3TMW A;  3ATO A;  1OFI A;  2Q9D A;  3AGH A;  5B06 A;  1OUG A;  3H4M A;  4NEB A;  5EJC A;  2O25 A;  3ODU A;  2XFT A;  1HEN A;  2L2D A;  4FWH A;  1OUJ A;  1HEM A;  150L A;  3WW6 A;  2BWB A;  2DQJ Y;  2O79 A;  2XJW A;  4LJA A;  1VAT A;  3I01 M;  3GQ4 A;  1G8P A;  2QPA A;  1G0M A;  1NV8 A;  2MEA A;  239L A;  4DBG B;  4N9R A;  3CDR A;  2RAY X;  3SAW A;  1WGN A;  5A3E A;  2R46 A;  1NWG A;  2DKV A;  165L A;  1IXZ A;  2RBQ A;  1L36 A;  1QDR A;  1IOR A;  4I7P A;  221L A;  1A5T A;  1KY1 A;  3WU9 A;  3U61 A;  1I56 A;  4DDA A;  1G7M C;  1OP9 B;  1YAO A;  4N1E I;  4LYM A;  2LZM A;  3L27 A;  1CUK A;  1QAN A;  2A7F A;  1QT8 A;  1GF9 A;  4H8X A;  2JZ1 A;  2X49 A;  1ZWN A;  3A95 A;  6LYT A;  2KRK A;  133L A;  3ZCB B;  3UMM A;  5FTN A;  4UWU A;  4JI1 M;  1HC0 A;  1XGQ C;  3HT9 A;  1L05 A;  1L13 A;  5KY1 A;  2WAR A;  1HR0 M;  1LZT A;  4H9I A;  1LYE A;  122L A;  4M0W A;  2XEP A;  4DV4 M;  2EIZ C;  2XBS A;  3D4S A;  1C60 A;  4BS7 A;  3WVY A;  1N77 A;  103L A;  4GHA A;  1LHL A;  4YEN A;  4CFP A;  3J27 B;  2ZYC A;  5EQT A;  1XHB A;  2FFJ A;  3M3U A;  1J5E M;  3A93 A;  4JI2 M;  1E8L A;  3FUW A;  2RBN A;  1XFP L;  3K9P A;  1UFZ A;  1VED A;  3T15 A;  111L A;  3NWL A;  1QYR A;  1YL1 X;  3AZ4 A;  1SXJ A;  1LI2 A;  4AI6 A;  1QSB A;  4H90 A;  4I0C A;  2W1X A;  4DC4 A;  2DQA A;  2F5P A;  5LA5 A;  1PQJ A;  5C6J A;  1NBZ C;  2C8P A;  5GKN A;  112L A;  2B3T A;  1I4W A;  2LNH C;  1JQU A;  1IO5 A;  4K5Y A;  4NGZ A;  151L A;  1TGU A;  5E9R A;  3WUA A;  3FAD A;  2AHM A;  2HWJ A;  1C68 A;  1HQY E;  1L09 A;  2BLX A;  3J7A S;  3A90 A;  1TBY A;  1ALC A;  2CDS A;  4AKG A;  4DKL A;  4S12 A;  3KP1 E;  1SX2 A;  2G4Q A;  4ETB A;  1XNQ M;  4OWA A;  4EJ4 A;  1B7L A;  2MEC A;  2LTU A;  5KXK A;  1GBO A;  2LYM A;  4HPE A;  4JV5 M;  5FSW A;  4LF7 M;  2XSZ A;  1IN5 A;  1CV0 A;  3KSX A;  1DXJ A;  1L72 A;  1JHL A;  4G4Q A;  3SB6 A;  2F32 A;  1IN7 A;  3K9O A;  1L15 A;  4IAT A;  3IG5 A;  1MX0 A;  4H94 A;  3M7G A;  3SHF A;  1LYD A;  1T3P A;  4XJD A;  3WVX A;  1V7S A;  1NHW C;  1LHK A;  1YAQ A;  2Y8P A;  4OVZ B;  1IBM M;  1OQM A;  2J5Y A;  2LZT A;  2GQF A;  132L A;  1LMT A;  4NSH A;  3U6Q A;  3CF0 A;  3L25 A;  2MEG A;  4W56 A;  3V2Y A;  154L A;  4JI5 M;  4NHS A;  3FTC A;  3LCV B;  4YXC A;  5KXR A;  190L A;  3HU3 A;  2W1Y A;  1IP1 A;  1G1W A;  3BKH A;  4DR6 M;  1TH4 A;  3C83 A;  1C6N A;  1L75 A;  1XGP C;  3RT5 X;  4NSR A;  140L A;  2EKK A;  1JWR A;  4II7 A;  5B05 A;  3VDU A;  3GLI B;  3U6L A;  4DYG A;  1DQJ C;  2V6Z M;  2UXC M;  4UWN A;  1OWY A;  2Y20 A;  2DWZ B;  3DKE X;  1VQ1 A;  2ZTC A;  2JZ0 A;  1L54 A;  2EPE A;  4OWC A;  2EQL A;  4FCV A;  255L A;  1QQY A;  1IXR C;  4R3D A;  3AB6 A;  4NGK A;  2CFO A;  4QHS A;  1EFU B;  1L90 A;  1IN6 A;  1OUD A;  1B5Y A;  1L77 A;  3ZEK A;  4MST A;  2HUL A;  1SWY A;  119L A;  5E26 A;  3HZJ A;  4KHP M;  1GB5 A;  1LYS A;  3CDT A;  2NTG A;  2KW0 A;  1L31 A;  7LZM A;  2O5R A;  4M9X A;  2F5Q A;  1G0P A;  1D2N A;  3W3E A;  1BWH A;  1MJG M;  4LGY A;  3P68 A;  2YSS C;  4B3R M;  3EIH A;  5LVJ A;  2KRU A;  1GF0 A;  1LJF A;  3W6F A;  3KAM A;  3WU8 A;  3F6Z A;  2YBH A;  4ARM A;  2X4A A;  5AMY A;  4GIT A;  1UM8 A;  3GUK A;  3HU2 A;  2K47 A;  2RSC A;  3PXG A;  4PDG A;  1AIP C;  1ZV5 L;  3TMU A;  191L A;  1D9U A;  3LZT A;  237L A;  1OAO C;  170L A;  1G0G A;  1LZ8 A;  2Z37 A;  3QYB A;  1VFB C;  2CUZ A;  2P5T A;  4PRQ A;  3ULR A;  3W6A A;  1R5L A;  2G4P A;  3FTD A;  1YSY A;  3MJ5 A;  2ZNW Y;  4NXN M;  1N36 M;  4QNM A;  2ZM6 M;  1ZVH L;  5D5F A;  5I4X A;  3A46 A;  1HMK A;  148L E;  4IBF A;  1B0D A;  1JTN A;  1WQQ A;  4GCD A;  1L01 A;  1L61 A;  1ORY B;  4N0J A;  1QT4 A;  4I7M A;  3WXT A;  3H4J A;  3KFU G;  7CAT A;  5E6J A;  3A6B Y;  1EE8 A;  3GRU A;  1LZ1 A;  2QP9 X;  3MHV C;  3B9P A;  1TH2 A;  1CV1 A;  2Z19 A;  3G3B B;  3ZH9 B;  1IWU A;  1QUO A;  1GF7 A;  249L A;  3CB7 A;  1REX A;  3GLH B;  3Q8G A;  4B08 A;  1QTH A;  4NY5 A;  3HY5 A;  4OW0 A;  5L3I A;  3A3Q A;  4W54 A;  3RU5 A;  1L48 A;  2DNA A;  1G4A E;  2DXI A;  3TXK A;  1L47 A;  3TQS A;  1UIG A;  1XGR C;  3WH1 A;  3AJI B;  1LZN A;  1LSZ A;  3GO8 A;  1XJT A;  5KXT A;  2QBY B;  3U5Z B;  5FTJ A;  2UXD M;  1G0K A;  4FW9 A;  1P46 A;  250L A;  2G4N A;  1FLW A;  1N34 M;  3MGW A;  155L A;  2KNV A;  2F4G A;  4I5S A;  1IR8 A;  1XEK A;  4NFV A;  4J7V A;  3SMS A;  1QAO A;  3KSJ A;  1BB3 A;  2FYD A;  1LCN A;  3T36 A;  2PC2 A;  2Z3X A;  1AM7 A;  3E21 A;  4MCK A;  4XJF A;  4NSI A;  2I7P A;  5FEK A;  1F0W A;  2XZF A;  3GP1 A;  1IOS A;  4TX7 A;  1IWT A;  2LWX A;  3WUN A;  4JI0 M;  1GFJ A;  4PD2 A;  3LYZ A;  5K7O A;  3DN4 A;  1L91 A;  2DQD Y;  2I25 L;  1KSF X;  1IN4 A;  1G0L A;  4LZM A;  3HTD A;  126L A;  5KXZ A;  3SMP A;  4B7H A;  2KZU A;  4JI3 M;  4LJ4 A;  1LSY A;  1CJ6 A;  1FLU A;  3HT7 A;  4DWX A;  2Y21 A;  3KS8 A;  4H9B A;  1IXS B;  2CGI A;  3U6O A;  5LIN A;  1NQI A;  4YHH M;  1R7R A;  130L A;  4XJG A;  1GEV A;  1IWW A;  162L A;  3TXB A;  2ZIL A;  2JA2 A;  1LGX A;  3WMK A;  1C6I A;  4H8Y A;  4G4H A;  1B7P A;  1LJI A;  1EQ4 A;  1L85 A;  2JY5 A;  4EKP A;  253L A;  1NVM A;  1WGL A;  2RB2 X;  4JN6 A;  1RU3 A;  1LKS A;  3HH3 A;  4WG7 A;  4E97 A;  4XK8 F;  5KKJ A;  4AW4 A;  1IP3 A;  3KXE C;  1B5V A;  3LYM A;  2DQC Y;  2ZNX Y;  3QAK A;  1GFK A;  2ANX A;  2WSC F;  2RH1 A;  3EMS A;  5D5C A;  3FUU A;  2DQI Y;  1GFU A;  1DYB A;  3SAT A;  2B6T A;  2FYC A;  4NOO B;  5EP4 A;  1GB0 A;  1FNN A;  3FUV A;  3DN1 A;  1D3J A;  5BR8 M;  3DMV A;  4LYB A;  2B74 A;  4QY9 A;  1NF5 A;  3HKP A;  3FI7 A;  1C62 A;  2IGC A;  3VFD A;  3UK6 A;  1LJK A;  1LJ4 A;  1NHG C;  2HUK A;  4DD0 A;  1L84 A;  1IN8 A;  1L41 A;  5DYI A;  1H87 A;  5IWA M;  3FYC A;  1L43 A;  3OE8 A;  1OYU A;  2BLY A;  2DWL A;  4QEQ A;  4B7F A;  1XMO M;  2MH8 A;  1XNR M;  1D3M A;  4H9F A;  3GUI A;  3U6D A;  3A34 A;  1C6B A;  3U6E A;  4WM5 A;  152L A;  3B74 A;  4OU7 A;  2LC9 A;  1V92 A;  1L25 A;  1L46 A;  1LI6 A;  4H92 A;  3DFZ A;  180L A;  1L29 A;  1LHH A;  3L2A A;  2DHR A;  1CX7 A;  5ILF A;  1DPW A;  5EBH A;  1QT6 A;  2YBM A;  2C9O A;  3RZ4 A;  3LZ2 A;  4KT3 A;  3WUM A;  1CV6 A;  1UIF A;  4ARL A;  1QS9 A;  1L66 A;  3HTB A;  3I51 A;  246L A;  2HU1 A;  1L06 A;  1QTK A;  142L A;  1YAM A;  1WVV A;  4PPO A;  3DMZ A;  4WM4 A;  2LHC A;  1LAA A;  1HEP A;  4B4E A;  4ETE A;  2KEB A;  3C3E A;  4QNR A;  1YKZ X;  3KOZ E;  1QAQ A;  4W57 A;  2BJV A;  1LI3 A;  2MED A;  1GO5 A;  3HWS A;  2E5L M;  3B6L A;  4B4J A;  4DV7 M;  2DQE Y;  1QTD A;  1GAB A;  2R4J A;  1GF4 A;  1PM5 A;  1PQD A;  1JPO A;  2ZBK B;  1L28 A;  2ZTD A;  1GFA A;  2L4F A;  3LN2 A;  1TAY A;  3AOE C;  1GFH A;  1CVK A;  145L A;  1FBI X;  1GAZ A;  1L98 A;  4TSB A;  2XTH A;  1LSB A;  1GWD A;  2HHH M;  4WM2 A;  1LSA A;  1FLY A;  2XH9 A;  3HFM Y;  1PQO A;  3FD9 A;  2KNZ A;  4GCC A;  4DQJ A;  3I4V A;  1EQ5 A;  1QTZ A;  3ZC7 B;  177L A;  169L A;  196L A;  4FCT A;  1MLC E;  1INU A;  1GB9 A;  3J4G A;  4PRU A;  4OX9 M;  2XLJ A;  2D4J A;  1L21 A;  3T6P A;  1WVU A;  1L76 A;  2F30 A;  4Z41 A;  1D0K A;  3RGS A;  4DJH A;  3VKG A;  2VF8 A;  4AG6 A;  2BQG A;  3OE0 A;  5LVH A;  1BQL Y;  1C67 A;  3UON A;  3ZVQ A;  5KPT A;  1XJU A;  3HJ8 A;  1H6U A;  4H9E A;  1C6D A;  1YIK A;  4LJ9 A;  4NG1 A;  137L A;  2YQZ A;  2V1U A;  1P7S A;  1L35 A;  194L A;  4LF4 M;  1XC8 A;  4H9H A;  1IP2 A;  1UA6 Y;  1NHB A;  2X0A A;  4LGM A;  3GUJ A;  4LJ5 A;  1XMQ M;  5FDJ A;  1DYG A;  1OUB A;  1BB4 A;  2MEI A;  5EP3 A;  1IP6 A;  2D7E A;  3HTF A;  2QAR C;  1E32 A;  4OO9 A;  2R44 A;  3RNX A;  1SXJ E;  4ZPX A;  4CJ6 A;  113L A;  1L34 A;  1C6E A;  4GCF A;  3I04 M;  1NMM A;  3M0E A;  1JUG A;  3RGP A;  1L59 A;  143L A;  3EO5 A;  1JR3 D;  2JXN A;  4BB9 A;  4I8S A;  3DZD A;  1F4I A;  3HBD A;  195L A;  1IY4 A;  4GHL A;  256L A;  4L16 A;  3BKV A;  4QGZ A;  5HMJ A;  1BB7 A;  2LVA A;  183L A;  4XYY A;  210L A;  4XGI A;  4MR1 A;  120L A;  1T97 A;  5HQ1 A;  2W1L A;  2GNO A;  3FUX A;  5KPZ A;  2W1M A;  1SQ2 L;  1J1X Y;  4GN4 A;  3HUK A;  4KL7 A;  4LFA M;  247L A;  1LSD A;  1TR8 A;  3WPK A;  3AFH A;  1KXX A;  3J81 S;  5LIO A;  4B4I A;  2EUC A;  4G4C A;  4LYC A;  2DQG Y;  2MEB A;  3ATN A;  3C58 A;  3CF2 A;  3R9X B;  4RNA A;  1PJT A;  1C7Y A;  3IJV A;  1GEZ A;  3GPY A;  1VDT A;  3WPJ A;  1JTT L;  4I7N A;  1PJJ A;  2V1C A;  3PDS A;  5KXO A;  1C6T A;  4A7D A;  1DGH A;  3FI5 A;  3LQR A;  4LJ8 A;  2OE9 X;  3LHM A;  2W82 A;  2ZIK A;  3GUL A;  4H9C A;  3BOS A;  1WHC A;  2D91 A;  5I5Q A;  1C65 A;  1UC0 A;  4ZEE A;  3N9A A;  5F9X A;  4RF1 A;  3RE8 A;  4CGY B;  1YKY X;  4P16 A;  3L2X A;  3U6P A;  114L A;  4HJY A;  1JEF A;  1L82 A;  1L80 A;  1T8G A;  3QWL A;  1B7M A;  4ET9 A;  5EP2 A;  171L A;  3TPZ A;  4WL7 A;  1L83 A;  4FVM A;  3CT0 A;  3SB8 A;  118L A;  5A2Q S;  6LZM A;  3GQ3 A;  2JNH A;  110L A;  1CV3 A;  2LXE A;  1L73 A;  2HED A;  5DNY A;  3B7N A;  1QAM A;  1LYG A;  3SN6 R;  2MEF A;  3CQL A;  4NSG A;  2VQE M;  3KOX E;  1C61 A;  3P65 A;  1GL7 A;  4N5R A;  5KXP A;  4NGO A;  3FTE A;  3F8V A;  240L A;  1HER A;  5JI2 E;  4II8 A;  1G3I A;  1LTM A;  3T38 A;  3CDO A;  3C80 A;  4BAF A;  1JB0 F;  1IR7 A;  5EXT A;  3SB7 A;  1HSX A;  1REM A;  1W08 A;  168L A;  4IBC A;  3FE0 A;  4EXM A;  3NBI A;  1GPQ C;  1L2B A;  3OJP A;  1QQW A;  2BQB A;  2H5Z A;  3K1J A;  1YLA A;  5A3Z A;  3IG8 A;  5FTM A;  3SBJ A;  2YFQ A;  3J6K A;  4WM3 A;  2F47 A;  2BQE A;  131L A;  2MR9 A;  3AW6 A;  1PRB A;  4RKU F;  1L00 A;  1ZMW A;  3W0F A;  4GKK M;  2CEA A;  4NHP A;  2Z8Y M;  3AZ5 A;  1AUA A;  1GB7 A;  4I8O A;  1CU5 A;  3FE3 A;  2OU8 A;  3NBX X;  2RB0 X;  3TXD A;  123L A;  1QIO A;  1G1V A;  1K28 A;  2RRU A;  1LJH A;  1PJQ A;  5EXS A;  1T3T A;  2CHG A;  2HEE A;  1QT3 A;  127L A;  4LT1 A;  1D6P A;  3TE6 A;  4P2E A;  1GVN A;  1NDG C;  181L A;  1DGB A;  4MM3 B;  3L26 A;  257L A;  4WG1 A;  2WZJ A;  9LYZ A;  4CHT B;  4Z3M A;  3HWL A;  2MGW A;  1RE2 A;  1D3F A;  4ARQ A;  1HEL A;  2YNM D;  2UUA M;  3E9S A;  1VEJ A;  1B7Q A;  4LYZ A;  193L A;  1OUI A;  4EPF A;  2KZS A;  3K92 A;  1L50 A;  3G3A B;  5KXM A;  2KDL A;  1GBW A;  5FST A;  1LZB A;  2H9J A;  4NRV A;  4RDS A;  5LVG A;  2FE8 A;  2LZ2 A;  2HU3 A;  1CTW A;  1N33 M;  1LZ9 A;  3LMM A;  2C8O A;  241L A;  3FTF A;  3W6C A;  1C64 A;  128L A;  5DN4 A;  3RZE A;  5T3F A;  5ITX A;  1SX7 A;  1L20 A;  1Z55 A;  1PQI A;  1P3Q Q;  1QVR A;  5FHW A;  242L A;  1GBX A;  4ETC A;  4IAP A;  2OOB A;  1P2C C;  1L38 A;  4DR2 M;  2BQA A;  208L A;  3SAV A;  4YM8 A;  1L04 A;  2HEC A;  1E9R A;  4N8Z A;  5ITT A;  2DAG A;  5B07 A;  1GFT A;  2M5Z A;  1GL6 A;  1L93 A;  1QUH A;  1JKC A;  2GV0 A;  1GDX A;  4M9S A;  262L A;  1BGI A;  1IWX A;  4DV0 M;  1OTR A;  1HEO A;  4W55 A;  3WUL A;  1LKR A;  3IJU A;  153L A;  2HAK A;  1RFP A;  4QHT A;  1W5S A;  1LV7 A;  1DO2 A;  3RUN A;  4PDI A;  4FWG A;  5LYZ A;  4W58 A;  4Z46 A;  1R2Y A;  3WHK A;  1LZG A;  1QUT A;  4AG5 A;  4WOA A;  4DD2 A;  5LYM A;  1VEG A;  3GUP A;  1P2R A;  3J7B A;  3IEC A;  2MRO B;  2B7X A;  1FLQ A;  4EPI A;  251L A;  1RJC B;  5KPR A;  2L7H A;  258L A;  4YX7 C;  3HDF A;  4FD2 A;  4LZJ A;  1VDL A;  3K2R A;  4JYA M;  1XEI A;  1GDW A;  1XGU C;  4B7G A;  4I7L A;  4AQN A;  1L11 A;  134L A;  4XEN A;  5JEN B;  2B6X A;  4GCE A;  141L A;  4RLN A;  1L23 A;  2BWE A;  2QHO B;  3VKH A;  3SYK A;  1LZ4 A;  4OWH A;  2OU0 X;  4DDB A;  1AKI A;  4JI6 M;  4KOD A;  1DKK A;  1Z5B A;  232L A;  5C6L A;  1G7L C;  3D8B A;  4EKS A;  5FTL A;  1GBS A;  1LJJ A;  138L A;  5DL9 A;  4IBE A;  3SYL A;  4X65 M;  2DAE A;  4DR3 M;  1NO1 A;  1LMN A;  3G3X A;  1P3N A;  3TL4 X;  4NWE A;  2BQN A;  1L40 A;  3LVV A;  1CNS A;  3WYH A;  1OFH A;  5FTK A;  222L A;  4GBR B;  1XGT C;  1BVK C;  4UWV A;  223L A;  4ML7 A;  1J7K A;  2X8A A;  4XAD A;  1SXJ C;  1LMP A;  3HUA A;  1CJ9 A;  1KS3 A;  3A98 B;  1EQE A;  1GE1 A;  5F3W A;  3A3R X;  5E4P A;  5LAF A;  3W6B A;  104L A;  182L A;  1C6J A;  1OAI A;  3SAS A;  4WMG A;  1GXX A;  5KO3 A;  1T6V L;  248L A;  2K9D A;  2R45 A;  5I4W A;  5FLX S;  3SAU A;  4HV2 A;  4LDO A;  3TXE A;  4HEO A;  5ITR A;  233L A;  1WTM A;  1C66 A;  1LZC A;  4HJV A;  3PFI A;  1L0K A;  1P64 A;  1GAY A;  4HPI A;  3OE6 A;  4OW1 A;  5LXW A;  5I4Y A;  1KYI A;  1JSF A;  1UID A;  1TH3 A;  4X62 M;  1L88 A;  3HU8 A;  3QE8 A;  5C18 A;  1XEP A;  1I20 A;  2DAI A;  3FKE A;  2DQF C;  4GLV A;  3SHG B;  2CHQ A;  2XF3 A;  2XFS A;  3HDE A;  1K82 A;  2OEA X;  187L A;  1HEW A;  1VDQ A;  2LYO A;  4W96 A;  3VK8 A;  3GLG B;  1HFZ A;  4NGY A;  4KPM A;  1T43 A;  1GFV A;  1LZY A;  1L52 A;  2YR0 A;  1XEJ A;  4J0L A;  1P36 A;  1T8F A;  1P37 A;  1TLA A;  1B7S A;  1R6B X;  1LSC A;  1FDL Y;  4C5F A;  1QT7 A;  2R0I A;  235L A;  1NJF A;  4DD9 A;  3E46 A;  1L64 A;  1GD6 A;  4LF5 M;  1TDH A;  2JY8 A;  1C46 A;  1UIB A;  3B0O A;  159L A;  184L A;  3AOE A;  2QCU A;  4DD7 A;  3DA1 A;  1WQR A;  2B70 A;  1NY5 A;  3C8R A;  1C6M A;  3A45 A;  3W67 A;  4I81 A;  4OVZ A;  4X66 M;  3A67 Y;  4WP2 A;  4WL6 A;  1WIV A;  1L99 A;  3DNA A;  1WTH A;  1G41 A;  1L58 A;  4G4O A;  1JKA A;  4GRV A;  1JR3 A;  1CX6 A;  1C6L A;  2FBD A;  4WLD A;  2OU9 A;  1NV9 A;  4AKH A;  1OIZ A;  4CIZ A;  1HNZ M;  1KIR C;  3P64 A;  1L24 A;  2B6Y A;  2RBS A;  4LGK A;  1CU2 A;  1GB8 A;  236L A;  2FH0 A;  205L A;  2DZN B;  1OUH A;  3GLI A;  245L A;  230L A;  4YY3 M;  1N75 A;  4KO8 A;  2RB1 X;  3M18 B;  5KKI A;  5J7C A;  4ETD A;  1LYO A;  2KXE A;  1LJG A;  1XWI A;  3J2P B;  4D82 A;  1XXH E;  3QAU A;  1J1O Y;  1IQP A;  1CKH A;  1NHE A;  2LHM A;  1CU0 A;  4G6Z A;  1B5U A;  213L A;  2LBC A;  4LJ6 A;  1F6S A;  3TMV A;  1LZ5 A;  115L A;  1Q02 A;  3GPP A;  1DPX A;  4GC9 A;  1SSW A;  1WQP A;  2HEB A;  1P2L A;  4WW0 A;  1K3W A;  201L A;  3TXJ A;  1L2C A;  1OUC A;  3B72 A;  3HJS A;  4IBK A;  3R8F A;  1CUQ A;  5APD A;  2MEH A;  4Z8X A;  1A2Y C;  2DQH Y;  2QSF X;  5DM9 A;  4DD1 A;  1JIT A;  2APL A;  4GN3 A;  1H6M A;  4Y28 F;  5ITY A;  1GJT A;  1XB2 B;  3U60 B;  3HHY A;  1GF3 A;  1IY0 A;  4LJ7 A;  4W51 A;  2BQF A;  1L45 A;  1C6H A;  3A6C Y;  1QSW A;  3DN8 A;  2RGH A;  4YXA C;  4NGI A;  4TWS A;  3SB5 A;  1GF8 A;  1KW5 A;  3WPL A;  160L A;  4PT5 A;  224L A;  144L A;  1O23 A;  4HL4 A;  2CV1 A;  2OPF A;  1CKC A;  1DI5 A;  4HP0 A;  4ARJ A;  1YUB A;  4WO6 A;  5APF A;  2YBN A;  1L12 A;  2L4E A;  2H1R A;  4AZF A;  4LFP A;  4R0F A;  1KW7 A;  4GCB A;  1ZMY L;  3FYD A;  4IIW A;  5EP1 A;  4KXI A;  1DZB X;  1LHM A;  4QOS A;  2RAZ X;  1GFE A;  1L37 A;  4XJB A;  4LFB M;  135L A;  4LCB A;  4HSF A;  4PGJ B;  5JI3 E;  3B7Z A;  2CHV A;  1HNX M;  1LYI A;  3AKZ A;  3GLH A;  5LA8 A;  4MGK E;  2F5N A;  5DN5 A;  4OOO A;  4BBA A;  1IOT A;  4I4L A;  4IBJ A;  1OVK A;  2ZWB A;  209L A;  4MGH A;  3SBA A;  5HNC A;  2NWD X;  4D81 A;  2ZAO A;  172L A;  1C43 A;  5M1Y A;  4I7R A;  1B9O A;  1LSP A;  2BQD A;  4NGW A;  1OUA A;  2NTH A;  1IOC A;  3OE9 A;  2VF7 A;  1UUZ C;  4O34 A;  2G3Q A;  1LZA A;  2QBY A;  1BVS A;  252L A;  4XN6 A;  4RLM A;  3IHP A;  2CWB A;  3U5Z A;  1L71 A;  2MEE A;  3GLG A;  4DR5 M;  3U61 B;  1KXY A;  1QDT A;  1UAC Y;  1LLH A;  2BQM A;  1Y8G A;  2DAM A;  4HTK A;  4B49 A;  1I94 M;  4JI4 M;  3NYA A;  1L42 A;  2QB0 B;  3TWM A;  1CKF A;  185L A;  4G49 A;  4L78 A;  2DKL A;  4D80 A;  1L1Z A;  243L A;  1LYJ A;  2BQL A;  2YVB A;  3E4R A;  2Z38 A;  4I7J A;  2EKF A;  1MEL L;  1REY A;  2G5G X;  1IEE A;  2H5X A;  1IY3 A;  3AJN A;  3N9E A;  3SFZ A;  2DWN A;  1BB6 A;  1LSG A;  5FCP A;  1AZF A;  2JP7 A;  1LZE A;  4DV5 M;  1GB6 A;  3E3D A;  2VII A;  3C3D A;  4ZPU A;  4GC5 A;  1IIZ A;  1QUG A;  1KIP C;  2EO2 A;  4IBI A;  2C5R A;  2WSE F;  2JY6 B;  1LSN A;  3K3T A;  4F2L A;  4AGA A;  186L A;  3GRV A;  1L53 A;  1BHZ A;  2F4A A;  4G9S A;  244L A;  4NHT A;  2FBB A;  5KXX A;  1D6Q A;  1IC7 Y;  1L03 A;  4ANR A;  1IM2 A;  1IXS A;  5LMU M;  1EL1 A;  1SXJ B;  4MH0 E;  3GLF B;  1AT6 A;  1L07 A;  5KQ8 A;  2YBL A;  1OKS A;  4AKI A;  212L A;  1DO0 A;  1Q3C A;  1Z5C A;  3GUN A;  1TDZ A;  3AV0 A;  3AGG G;  3BXW A;  1GB2 A;  1SG9 A;  2KHH A;  149L A;  3MMP A;  218L A;  4LFX A;  1LMQ A;  3A92 A;  3B89 A;  2HEA A;  1L26 A;  1HT2 E;  4RW2 A;  1G0Q A;  5L3H A;  215L A;  1HHL A;  1S3S A;  4N1C C;  1FN5 A;  3C8Q A;  3T6U A;  2HKJ A;  2NQ8 C;  3WU7 A;  5LAG A;  1JQJ C;  5DFL A;  4NG8 A;  1TEW A;  2EJS A;  1LJN A;  3P4Z A;  4NGJ A;  1LPY A;  4DQ7 A;  5L8R F;  1IBL M;  1UBZ A;  1LJ3 A;  4XJH A;  4W59 A;  3U6C A;  1L44 A;  1G7I C;  2BQI A;  4I7K A;  3OTO M;  2DAK A;  3ILK A;  1Q3B A;  2OQ4 A;  5F9U A;  5C6I A;  3Q8X A;  129L A;  1C6C A;  1LJE A;  3HU9 A;  4I7S A;  3NY8 A;  4J1A A;  2Z12 A;  4M9Z A;  2K0B X;  1D0L A;  1CU6 A;  5ITX E;  1IOQ A;  3TXF A;  1NDM C;  4D9Z A;  5LZM A;  2UU9 M;  4H8Z A;  2ERC A;  4DV3 M;  1JJ3 A;  3HH6 A;  3G3W A;  1Z6T A;  1DYE A;  1B6I A;  3T1Y M;  1CUP A;  1L87 A;  1IY2 A;  259L A;  4IAS A;  5B59 A;  1IR9 A;  2Y0Q A;  3GUO A;  5KXY A;  3HH4 A;  4WLT A;  4IBG A;  2R4E A;  5IZ7 D;  2FOI C;  2C9C A;  3FUT A;  2RBO A;  4JI8 M;  5ITU A;  4RW1 A;  1HJP A;  2ZAN A;  1OVJ A;  3C7Y A;  4CGE A;  3U6M A;  2UXB M;  3HBE X;  1RI8 B;  1ZVY B;  2YBI A;  3UGJ A;  1GB3 A;  1P56 A;  4LYT A;  5EXX A;  3A94 A;  238L A;  2K6B A;  1OV7 A;  1OVH A;  4X3B A;  3HBH A;  5I53 A;  188L A;  1HFY A;  2XQO A;  4LG2 A;  1C1K A;  1UIC A;  1XSF A;  2CV2 A;  2VB1 A;  3CDV A;  4DDC A;  3FRI A;  4DR4 M;  4FCW A;  1VEK A;  5EXP A;  1KFV A;  4YF2 A;  2LVO C;  3CDQ A;  2LHG A;  1R4G A;  4Z98 A;  2D7G A;  5IHG A;  1DGF A;  1JJ0 A;  4GIP A;  1NNU C;  4WO9 A;  3LVW A;  1QTE A;  1UIH A;  3HT8 A;  102L A;  3V76 A;  2N35 A;  4G3O A;  2IFF Y;  4ARM B;  3AL0 C;  4ITQ A;  1UIE A;  3W6E A;  3AOG A;  4IBB A;  1REZ A;  4B1A A;  1V34 A;  5LMN M;  2Q0M X;  4DAJ A;  4REZ A;  4IJE A;  3C81 A;  1L65 A;  5APC A;  1Z5A A;  5IRE B;  1DI4 A;  3LQQ A;  4R71 A;  1AT5 A;  4DV1 M;  1P5C A;  4MGI E;  1JJ1 A;  1L17 A;  4NIJ A;  2XZU A;  8LYZ A;  3UZU A;  1IWY A;  4A3V B;  1B5Z A;  197L A;  4LFC M;  1GF5 A;  216L A;  1TDY A;  1E94 E;  3HJQ A;  146L A;  1C63 A;  2KNA A;  2QQ8 A;  3A96 A;  1LWG A;  4XBO A;  211L A;  2G8L A;  4IBD A;  1L57 A;  3K8Z A;  2B75 A;  4TSC A;  4PJ2 C;  1WQM A;  2O7A A;  4EKR A;  5LYT A;  1QUS A;  1JIY A;  3TXG A;  4OOT A;  1KNI A;  4BAP A;  192L A;  1C6P A;  4HTN A;  4R7G A;  1QTV A;  2QZ4 A;  3VW7 A;  1QUD A;  4DV6 M;  3UJN A;  3GLF A;  4S0W A;  3QYE A;  1LZS A;  1YIL A;  1DYD A;  4BLC A;  1MU5 A;  4Q7J A;  1C6F A;  2QNJ A;  3V2W A;  108L A;  1G71 A;  3C8S A;  3L64 A;  4GEW A;  2J7O A;  2C99 A;  3DN6 A;  1KXW A;  4HLQ A;  3TXH A;  3A42 A;  125L A;  1PS5 A;  3SC3 A;  1BVX A;  4H1P A; 
#chains in the Genus database with same CATH homology
 1PQM A;  2I6Z A;  1G7H C;  1ZYT A;  4PHI A;  1JKD A;  4WM6 A;  1B5X A;  1L68 A;  4CFO A;  1LSF A;  4DT3 A;  4NGL A;  2CWI A;  1F6R A;  3P66 A;  1EPY A;  198L A;  1LGW A;  1B5W A;  1IC4 Y;  3QNG A;  1L55 A;  4GN5 C;  3DN3 A;  1GE0 A;  5FEL A;  4IJ4 A;  254L A;  1DKJ A;  1JIS A;  1NKH A;  4H9A A;  3CSQ A;  2EKS C;  1B2K A;  4NHI A;  3CT5 A;  1LW9 A;  4YOP A;  2BQK A;  3EXD A;  1JTM A;  2BQC A;  109L A;  4OWB A;  1L32 A;  1UIA A;  178L A;  1L94 A;  1QS5 A;  4H91 A;  1YAN A;  2B6Z A;  229L A;  1DYA A;  3C7W A;  1CKD A;  2B73 A;  3WL2 A;  1KY0 A;  1L62 A;  3D9A C;  167L A;  1IP4 A;  2A7D A;  4HJZ A;  1HFX A;  4LDE A;  3LYT A;  4W94 A;  5HLL A;  4QDN A;  3RW8 A;  3NY9 A;  2ZIJ A;  173L A;  3QY4 A;  3AGI A;  5DLA A;  3DN2 A;  4E3U A;  2HUM A;  3AZ6 A;  1DYC A;  3WW5 A;  1QTC A;  1VDP A;  1OWZ A;  4LT2 A;  1FKQ A;  4M4O A;  2Z2F A;  139L A;  3C82 A;  1CKG A;  2BPU A;  3A8Z A;  3DMX A;  4EOF A;  2LCB A;  1VDS A;  1JKB A;  2O4W A;  1L27 A;  228L A;  4L41 A;  5F16 A;  5HMV A;  4TTD A;  1JSE A;  1LYF A;  206L A;  166L A;  3GUM A;  1LGU A;  1BB5 A;  1LZR A;  4CJ2 A;  5KJ9 A;  4EKQ A;  174L A;  161L A;  1L81 A;  1BWJ A;  5I54 A;  4LYO A;  5ILC A;  1C6K A;  1LZ6 A;  2OTY X;  1QSA A;  2BAA A;  1PQK A;  4G4B A;  3TMX A;  2CUU A;  6LYZ A;  189L A;  1P6Y A;  1GF6 A;  2BQO A;  3IWR A;  5II3 A;  2AUB A;  1L70 A;  1LWK A;  2ZYP A;  4NSJ A;  1YRO A;  1BWI A;  1HEQ A;  1L89 A;  1D3N A;  2XBR A;  4ET8 A;  1L22 A;  1L69 A;  4H93 A;  2CJL A;  1RCM A;  4EMN A;  1QT5 A;  1NBY C;  2ZQ3 A;  4J1B A;  3SBB C;  2DBT A;  1L02 A;  207L A;  4W52 A;  3ZVQ B;  158L A;  1JTO L;  1L18 A;  3F9L A;  3HH5 A;  3AW7 A;  1QSQ A;  164L A;  2HUB A;  4NGV A;  1IWZ A;  1GXV 2;  1IC5 Y;  1HNL A;  4DD3 A;  3EML A;  3JR6 A;  4WLY A;  1L95 A;  1YKX X;  1SWZ A;  2B5Z A;  2OTZ X;  2N5Z A;  2RBR A;  1C10 A;  1LYH A;  2ZQ4 A;  2RBP A;  1L49 A;  5F81 A;  1B7O A;  2OE4 X;  4I7Q A;  5KXL A;  3PBL A;  1D2Y A;  4PJZ A;  2YBJ A;  5F14 A;  1C6Q A;  4HTQ A;  1L92 A;  1I1Z A;  1OV5 A;  5HNL A;  3CT1 A;  2HTX A;  3OK0 A;  1G0J A;  1VAU A;  4FDY A;  1L96 A;  1GE4 A;  1GFG A;  4AXT A;  1JTP L;  4OWE A;  3N9C A;  1L10 A;  4ZFP A;  1YAP A;  219L A;  1T6H A;  3CSR A;  2L78 A;  3HT6 A;  3LYO A;  3D3D A;  4YEM A;  156L A;  3LZM A;  2Q9E A;  1GE2 A;  5KXS A;  1C45 A;  4LZT A;  5KXN A;  1GE3 A;  1ZUR A;  1TCY A;  176L A;  1L16 A;  1HSW A;  4TUN A;  5I14 A;  1L19 A;  5IEL A;  1F10 A;  1LSE A;  4ARP A;  1LSM A;  2D6B A;  4WLX A;  1LOZ A;  5KXW A;  217L A;  5B1F A;  3W6D A;  5APE A;  1LHJ A;  1LYY A;  2B6W A;  1LMA A;  3FA0 A;  1L51 A;  225L A;  2Z18 A;  4LT0 A;  1J1P Y;  1G06 A;  1L30 A;  2D4I A;  1IP5 A;  2F2Q A;  7LYZ A;  1L63 A;  3WXU A;  1L14 A;  163L A;  1YQV Y;  1FKV A;  1L08 A;  4ETA A;  200L A;  2LYZ A;  1L74 A;  1CJ7 A;  1D9W A;  1KIQ C;  4B0D A;  260L A;  3C7Z A;  5LVK A;  4FJR A;  4I7T A;  3G3V A;  1B7R A;  1L39 A;  5L9J A;  3B0K A;  1B7N A;  3HUQ A;  4C3W A;  1D0M A;  2Z39 A;  4BAD A;  2Z2E A;  147L A;  1UCO A;  2BQJ A;  1OUF A;  4YEO A;  4DQ5 A;  1C69 A;  4LT3 A;  214L A;  1CV4 A;  1LYZ A;  1IVM A;  1DI3 A;  4R6C A;  1L79 A;  1C7P A;  4NWH A;  4M6D A;  1L60 A;  3DN0 A;  3SP3 A;  1V7T A;  3HTG A;  1A4V A;  1DYF A;  5LVI A;  1GBZ A;  3GXK A;  1L97 A;  1GBY A;  1L67 A;  4U3X B;  1HML A;  4PK0 A;  199L A;  1L56 A;  1T8A A;  2IHL A;  4ZIX A;  157L A;  3TXI A;  1N4F A;  227L A;  3CSZ A;  3B0I A;  4I7O A;  1L33 A;  4WM1 A;  1GHL A;  1LZD A;  5B1G A;  175L A;  1D2W A;  3AYQ A;  1LPI A;  1IWV A;  1SLY A;  1L0J A;  4ARQ B;  1C6A A;  220L A;  2H9K A;  1SSY A;  4XJI A;  1WQN A;  1IP7 A;  2OE7 X;  1PZY A;  1G7J C;  1WTN A;  2YDG A;  1C08 C;  1GFR A;  231L A;  2I26 L;  2B72 A;  226L A;  1L86 A;  107L A;  3SB9 A;  1YL0 X;  1CU3 A;  1IX0 A;  2A4T A;  2F2N A;  3GXR A;  4GLA A;  1OUE A;  1LMC A;  2D4K A;  4CHX A;  3EBA B;  4HV1 A;  1QTB A;  1WQO A;  2Z6B A;  2HEF A;  4NHQ A;  1LMO A;  5IDD A;  4LDL A;  3A91 A;  3VWO A;  1C6G A;  1G07 A;  2ANV A;  261L A;  1HF4 A;  1CJ8 A;  4W53 A;  234L A;  1I6S A;  3AZ7 A;  2BQH A;  1LHI A;  1CV5 A;  1W6Z A;  3TMW A;  3ATO A;  2Q9D A;  3AGH A;  5B06 A;  1OUG A;  4NEB A;  3ODU A;  1HEN A;  1OUJ A;  1HEM A;  150L A;  3WW6 A;  2DQJ Y;  2O79 A;  2XJW A;  1VAT A;  1G0M A;  2MEA A;  239L A;  4N9R A;  3CDR A;  2RAY X;  5A3E A;  1NWG A;  2DKV A;  165L A;  2RBQ A;  1L36 A;  1QDR A;  1IOR A;  4I7P A;  221L A;  1KY1 A;  3WU9 A;  1I56 A;  4DDA A;  1G7M C;  1OP9 B;  1YAO A;  4N1E I;  4LYM A;  2LZM A;  2A7F A;  1QT8 A;  1GF9 A;  4H8X A;  1ZWN A;  3A95 A;  6LYT A;  133L A;  4UWU A;  1HC0 A;  1XGQ C;  3HT9 A;  1L05 A;  1L13 A;  5KY1 A;  2WAR A;  1LZT A;  4H9I A;  1LYE A;  122L A;  2EIZ C;  2XBS A;  3D4S A;  1C60 A;  4BS7 A;  3WVY A;  103L A;  4YEN A;  1LHL A;  4CFP A;  2ZYC A;  3M3U A;  3A93 A;  1E8L A;  2RBN A;  1XFP L;  1VED A;  111L A;  1YL1 X;  3AZ4 A;  1LI2 A;  1QSB A;  4H90 A;  4I0C A;  2W1X A;  4DC4 A;  2DQA A;  5LA5 A;  1PQJ A;  5C6J A;  1NBZ C;  2C8P A;  112L A;  1JQU A;  1IO5 A;  4K5Y A;  4NGZ A;  151L A;  5E9R A;  3WUA A;  3FAD A;  1C68 A;  1L09 A;  2BLX A;  3A90 A;  1TBY A;  1ALC A;  2CDS A;  4DKL A;  1SX2 A;  2G4Q A;  4ETB A;  4OWA A;  4EJ4 A;  1B7L A;  2MEC A;  5KXK A;  1GBO A;  2LYM A;  4HPE A;  1CV0 A;  1DXJ A;  1L72 A;  1JHL A;  3SB6 A;  2F32 A;  1L15 A;  4IAT A;  4H94 A;  1LYD A;  1T3P A;  4XJD A;  3WVX A;  1V7S A;  1LHK A;  1YAQ A;  2Y8P A;  1OQM A;  2LZT A;  132L A;  1LMT A;  4NSH A;  2MEG A;  4W56 A;  3V2Y A;  154L A;  4NHS A;  4YXC A;  5KXR A;  190L A;  2W1Y A;  1IP1 A;  1G1W A;  3BKH A;  3C83 A;  1C6N A;  1L75 A;  1XGP C;  3RT5 X;  140L A;  1JWR A;  5B05 A;  4DYG A;  1DQJ C;  4UWN A;  1OWY A;  3DKE X;  1L54 A;  2EPE A;  4OWC A;  2EQL A;  255L A;  1QQY A;  4NGK A;  3AB6 A;  1L90 A;  1OUD A;  1B5Y A;  1L77 A;  3ZEK A;  4MST A;  2HUL A;  1SWY A;  119L A;  1GB5 A;  3CDT A;  1LYS A;  2NTG A;  1L31 A;  7LZM A;  1G0P A;  3W3E A;  1BWH A;  3P68 A;  2YSS C;  5LVJ A;  1GF0 A;  1LJF A;  3W6F A;  3KAM A;  3WU8 A;  3F6Z A;  2YBH A;  4ARM A;  5AMY A;  3GUK A;  2RSC A;  1ZV5 L;  3TMU A;  191L A;  1D9U A;  3LZT A;  237L A;  170L A;  1G0G A;  1LZ8 A;  2Z37 A;  1VFB C;  4PRQ A;  3ULR A;  3W6A A;  2G4P A;  2ZNW Y;  1ZVH L;  5D5F A;  5I4X A;  1HMK A;  148L E;  1B0D A;  1JTN A;  1WQQ A;  4GCD A;  1L01 A;  1L61 A;  4N0J A;  1QT4 A;  4I7M A;  3WXT A;  3A6B Y;  1LZ1 A;  1CV1 A;  2Z19 A;  3G3B B;  1IWU A;  1QUO A;  1GF7 A;  249L A;  3CB7 A;  1REX A;  1QTH A;  4NY5 A;  5L3I A;  3A3Q A;  4W54 A;  3RU5 A;  1L48 A;  3TXK A;  1L47 A;  1UIG A;  1XGR C;  3WH1 A;  1LZN A;  1LSZ A;  1XJT A;  5KXT A;  1G0K A;  1P46 A;  250L A;  2G4N A;  1FLW A;  3MGW A;  155L A;  2F4G A;  1IR8 A;  1XEK A;  4NFV A;  4J7V A;  1BB3 A;  2FYD A;  1LCN A;  3T36 A;  2PC2 A;  1AM7 A;  4MCK A;  4XJF A;  4NSI A;  5FEK A;  1F0W A;  1IOS A;  4TX7 A;  1IWT A;  3WUN A;  1GFJ A;  3LYZ A;  5K7O A;  3DN4 A;  1L91 A;  2DQD Y;  2I25 L;  1G0L A;  4LZM A;  3HTD A;  126L A;  5KXZ A;  1LSY A;  1CJ6 A;  1FLU A;  3HT7 A;  4DWX A;  4H9B A;  2CGI A;  5LIN A;  1NQI A;  130L A;  4XJG A;  1GEV A;  1IWW A;  162L A;  3TXB A;  2ZIL A;  1LGX A;  3WMK A;  1C6I A;  4H8Y A;  4G4H A;  1B7P A;  1LJI A;  1EQ4 A;  1L85 A;  4EKP A;  253L A;  2RB2 X;  1LKS A;  4WG7 A;  3HH3 A;  4E97 A;  5KKJ A;  3LYM A;  1IP3 A;  1B5V A;  3QAK A;  2DQC Y;  2ZNX Y;  1GFK A;  2ANX A;  5D5C A;  2RH1 A;  3EMS A;  2DQI Y;  1GFU A;  1DYB A;  2B6T A;  2FYC A;  1GB0 A;  3DN1 A;  1D3J A;  3DMV A;  4LYB A;  2B74 A;  4QY9 A;  1NF5 A;  3FI7 A;  1C62 A;  2IGC A;  1LJK A;  1LJ4 A;  2HUK A;  4DD0 A;  1L84 A;  1L41 A;  1H87 A;  1L43 A;  3OE8 A;  1OYU A;  2BLY A;  4QEQ A;  1D3M A;  4H9F A;  3GUI A;  3A34 A;  1C6B A;  4WM5 A;  152L A;  2LC9 A;  1L25 A;  1L46 A;  1LI6 A;  4H92 A;  180L A;  1L29 A;  1LHH A;  1CX7 A;  5ILF A;  1DPW A;  5EBH A;  1QT6 A;  2YBM A;  3RZ4 A;  3LZ2 A;  4KT3 A;  3WUM A;  1CV6 A;  1UIF A;  4ARL A;  1QS9 A;  1L66 A;  3HTB A;  246L A;  2HU1 A;  1L06 A;  1QTK A;  142L A;  1YAM A;  1WVV A;  4PPO A;  3DMZ A;  4WM4 A;  1LAA A;  1HEP A;  4B4E A;  4ETE A;  1YKZ X;  4W57 A;  1LI3 A;  2MED A;  3B6L A;  4B4J A;  2DQE Y;  1QTD A;  1GF4 A;  1PQD A;  1JPO A;  1L28 A;  1GFA A;  3LN2 A;  1TAY A;  1GFH A;  1CVK A;  145L A;  1FBI X;  1GAZ A;  1L98 A;  4TSB A;  2XTH A;  1LSB A;  1GWD A;  4WM2 A;  1LSA A;  1FLY A;  3HFM Y;  1PQO A;  4GCC A;  4DQJ A;  1QTZ A;  1EQ5 A;  177L A;  169L A;  196L A;  1MLC E;  1INU A;  1GB9 A;  3J4G A;  4PRU A;  2D4J A;  1L21 A;  1WVU A;  1L76 A;  2F30 A;  4Z41 A;  1D0K A;  4DJH A;  5LVH A;  2BQG A;  3OE0 A;  1BQL Y;  1C67 A;  3UON A;  3ZVQ A;  1XJU A;  4H9E A;  1C6D A;  1YIK A;  4NG1 A;  137L A;  1P7S A;  1L35 A;  194L A;  4H9H A;  1IP2 A;  1UA6 Y;  1NHB A;  2X0A A;  3GUJ A;  5FDJ A;  1DYG A;  1OUB A;  1BB4 A;  2MEI A;  1IP6 A;  3HTF A;  2QAR C;  4OO9 A;  3RNX A;  1L34 A;  113L A;  1C6E A;  4GCF A;  1NMM A;  1JUG A;  1L59 A;  143L A;  3EO5 A;  4I8S A;  3HBD A;  195L A;  1IY4 A;  256L A;  3BKV A;  4QGZ A;  5HMJ A;  1BB7 A;  183L A;  4XYY A;  210L A;  4MR1 A;  120L A;  1T97 A;  5HQ1 A;  2W1L A;  2W1M A;  1SQ2 L;  1J1X Y;  4GN4 A;  3HUK A;  4KL7 A;  247L A;  1LSD A;  3WPK A;  1KXX A;  5LIO A;  4B4I A;  4G4C A;  4LYC A;  2DQG Y;  2MEB A;  3ATN A;  3IJV A;  1GEZ A;  1VDT A;  3WPJ A;  1JTT L;  4I7N A;  3PDS A;  5KXO A;  1C6T A;  4A7D A;  3FI5 A;  2OE9 X;  3LHM A;  2ZIK A;  3GUL A;  4H9C A;  2D91 A;  5I5Q A;  1C65 A;  1UC0 A;  4ZEE A;  3N9A A;  5F9X A;  1YKY X;  3L2X A;  114L A;  4HJY A;  1JEF A;  1L82 A;  1L80 A;  1T8G A;  1B7M A;  4ET9 A;  171L A;  4WL7 A;  1L83 A;  3SB8 A;  3CT0 A;  118L A;  6LZM A;  110L A;  1CV3 A;  1L73 A;  2HED A;  1LYG A;  3SN6 R;  2MEF A;  3CQL A;  4NSG A;  1C61 A;  3P65 A;  4N5R A;  5KXP A;  4NGO A;  3F8V A;  240L A;  1HER A;  4II8 A;  1LTM A;  3CDO A;  3C80 A;  4BAF A;  1IR7 A;  3SB7 A;  1HSX A;  1REM A;  1W08 A;  168L A;  3FE0 A;  4EXM A;  1GPQ C;  3OJP A;  2BQB A;  2H5Z A;  5A3Z A;  3J6K A;  4WM3 A;  2F47 A;  2BQE A;  131L A;  3AW6 A;  1L00 A;  4NHP A;  3AZ5 A;  1GB7 A;  1CU5 A;  2OU8 A;  2RB0 X;  3TXD A;  123L A;  1QIO A;  1G1V A;  1K28 A;  1LJH A;  2HEE A;  1QT3 A;  127L A;  4LT1 A;  1D6P A;  4P2E A;  1NDG C;  181L A;  257L A;  4WG1 A;  9LYZ A;  4Z3M A;  3HWL A;  1RE2 A;  1D3F A;  4ARQ A;  1HEL A;  1B7Q A;  4LYZ A;  193L A;  1OUI A;  4EPF A;  1L50 A;  3G3A B;  5KXM A;  1GBW A;  5FST A;  1LZB A;  2H9J A;  4RDS A;  5LVG A;  2LZ2 A;  2HU3 A;  1CTW A;  1LZ9 A;  2C8O A;  241L A;  3W6C A;  1C64 A;  128L A;  5DN4 A;  3RZE A;  5T3F A;  1SX7 A;  1L20 A;  1Z55 A;  1PQI A;  5FHW A;  242L A;  1GBX A;  4ETC A;  4IAP A;  1P2C C;  1L38 A;  2BQA A;  208L A;  4YM8 A;  1L04 A;  2HEC A;  4N8Z A;  5B07 A;  1GFT A;  1L93 A;  1QUH A;  1JKC A;  2GV0 A;  1GDX A;  262L A;  1BGI A;  1IWX A;  3WUL A;  1HEO A;  4W55 A;  1LKR A;  3IJU A;  153L A;  1RFP A;  3RUN A;  5LYZ A;  4W58 A;  4Z46 A;  1LZG A;  1QUT A;  4WOA A;  4DD2 A;  5LYM A;  3GUP A;  1P2R A;  2B7X A;  1FLQ A;  4EPI A;  251L A;  1RJC B;  258L A;  4YX7 C;  3HDF A;  3K2R A;  1XEI A;  1GDW A;  1XGU C;  4I7L A;  4AQN A;  1L11 A;  134L A;  4XEN A;  5JEN B;  2B6X A;  4GCE A;  141L A;  4RLN A;  1L23 A;  1LZ4 A;  4OWH A;  2OU0 X;  4DDB A;  1AKI A;  1DKK A;  232L A;  5C6L A;  1G7L C;  4EKS A;  1GBS A;  1LJJ A;  138L A;  5DL9 A;  1LMN A;  3G3X A;  1P3N A;  4NWE A;  2BQN A;  1L40 A;  3WYH A;  1CNS A;  222L A;  4GBR B;  1XGT C;  1BVK C;  4UWV A;  223L A;  4ML7 A;  4XAD A;  1LMP A;  3HUA A;  1CJ9 A;  1KS3 A;  1GE1 A;  1EQE A;  3A3R X;  5LAF A;  5E4P A;  3W6B A;  104L A;  182L A;  1C6J A;  4WMG A;  1GXX A;  1T6V L;  248L A;  5I4W A;  4LDO A;  4HV2 A;  3TXE A;  233L A;  1WTM A;  1C66 A;  1LZC A;  4HJV A;  1L0K A;  1P64 A;  1GAY A;  4HPI A;  3OE6 A;  4OW1 A;  5LXW A;  5I4Y A;  1JSF A;  1UID A;  1L88 A;  3HU8 A;  3QE8 A;  1XEP A;  1I20 A;  2DQF C;  4GLV A;  3HDE A;  2OEA X;  187L A;  1HEW A;  1VDQ A;  2LYO A;  4W96 A;  1HFZ A;  4NGY A;  4KPM A;  1GFV A;  1LZY A;  1L52 A;  1XEJ A;  4J0L A;  1P36 A;  1T8F A;  1P37 A;  1TLA A;  1B7S A;  1LSC A;  1FDL Y;  4C5F A;  1QT7 A;  235L A;  4DD9 A;  1L64 A;  1GD6 A;  3B0O A;  1C46 A;  1UIB A;  159L A;  184L A;  4DD7 A;  3C8R A;  1WQR A;  2B70 A;  1C6M A;  3A67 Y;  4WL6 A;  1L99 A;  3DNA A;  1WTH A;  1L58 A;  1JKA A;  4GRV A;  1CX6 A;  1C6L A;  2FBD A;  4WLD A;  2OU9 A;  1KIR C;  3P64 A;  1L24 A;  2B6Y A;  2RBS A;  4LGK A;  1CU2 A;  1GB8 A;  236L A;  205L A;  1OUH A;  245L A;  230L A;  2RB1 X;  3M18 B;  5KKI A;  5J7C A;  4ETD A;  1LYO A;  1LJG A;  1J1O Y;  1CKH A;  1NHE A;  2LHM A;  1CU0 A;  1B5U A;  213L A;  1F6S A;  3TMV A;  1LZ5 A;  115L A;  1DPX A;  1SSW A;  1WQP A;  2HEB A;  1P2L A;  201L A;  3TXJ A;  1OUC A;  3B72 A;  1CUQ A;  5APD A;  2MEH A;  1A2Y C;  2DQH Y;  5DM9 A;  4DD1 A;  1JIT A;  4GN3 A;  1H6M A;  1GF3 A;  4W51 A;  2BQF A;  1L45 A;  1C6H A;  3A6C Y;  1QSW A;  3DN8 A;  4YXA C;  4NGI A;  4TWS A;  3SB5 A;  1GF8 A;  1KW5 A;  3WPL A;  160L A;  224L A;  144L A;  1O23 A;  1CKC A;  1DI5 A;  4HP0 A;  4ARJ A;  4WO6 A;  5APF A;  2YBN A;  1L12 A;  4LFP A;  4R0F A;  1KW7 A;  4GCB A;  1ZMY L;  4KXI A;  1DZB X;  1LHM A;  2RAZ X;  1GFE A;  1L37 A;  4XJB A;  135L A;  4HSF A;  4PGJ B;  1LYI A;  5LA8 A;  5DN5 A;  4OOO A;  1IOT A;  1OVK A;  2ZWB A;  209L A;  3SBA A;  5HNC A;  2NWD X;  1C43 A;  172L A;  5M1Y A;  4I7R A;  1B9O A;  1LSP A;  2BQD A;  4NGW A;  1OUA A;  2NTH A;  1IOC A;  3OE9 A;  1UUZ C;  4O34 A;  1LZA A;  252L A;  4XN6 A;  4RLM A;  1L71 A;  2MEE A;  1KXY A;  1QDT A;  1UAC Y;  1LLH A;  2BQM A;  4HTK A;  4B49 A;  3NYA A;  1L42 A;  2QB0 B;  1CKF A;  185L A;  4G49 A;  243L A;  1LYJ A;  2BQL A;  2YVB A;  2Z38 A;  4I7J A;  1MEL L;  1REY A;  1IEE A;  3AJN A;  1IY3 A;  3N9E A;  1BB6 A;  1LSG A;  5FCP A;  1AZF A;  1LZE A;  1GB6 A;  3E3D A;  4ZPU A;  1IIZ A;  1QUG A;  1KIP C;  1LSN A;  3K3T A;  4AGA A;  186L A;  4G9S A;  1L53 A;  1BHZ A;  2F4A A;  4NHT A;  244L A;  5KXX A;  2FBB A;  1D6Q A;  1IC7 Y;  1L03 A;  4ANR A;  1EL1 A;  1AT6 A;  1L07 A;  2YBL A;  212L A;  3GUN A;  3AGG G;  1GB2 A;  149L A;  218L A;  4LFX A;  1LMQ A;  3A92 A;  2HEA A;  1L26 A;  4RW2 A;  1G0Q A;  5L3H A;  215L A;  1HHL A;  4N1C C;  1FN5 A;  3C8Q A;  3T6U A;  3WU7 A;  5LAG A;  4NG8 A;  1TEW A;  1LJN A;  3P4Z A;  4NGJ A;  1LPY A;  4DQ7 A;  1UBZ A;  1LJ3 A;  4XJH A;  4W59 A;  1L44 A;  1G7I C;  2BQI A;  4I7K A;  5C6I A;  5F9U A;  129L A;  1C6C A;  1LJE A;  3HU9 A;  4I7S A;  3NY8 A;  4J1A A;  2Z12 A;  1D0L A;  1CU6 A;  1IOQ A;  3TXF A;  1NDM C;  4D9Z A;  5LZM A;  4H8Z A;  1JJ3 A;  3HH6 A;  3G3W A;  1DYE A;  1B6I A;  1CUP A;  1L87 A;  259L A;  4IAS A;  5B59 A;  1IR9 A;  3GUO A;  5KXY A;  3HH4 A;  4WLT A;  2RBO A;  4RW1 A;  1OVJ A;  3C7Y A;  4CGE A;  3HBE X;  1RI8 B;  1ZVY B;  2YBI A;  1P56 A;  1GB3 A;  4LYT A;  3A94 A;  238L A;  1OV7 A;  1OVH A;  4X3B A;  3HBH A;  5I53 A;  188L A;  1HFY A;  2XQO A;  1UIC A;  1XSF A;  3CDV A;  2VB1 A;  4DDC A;  4YF2 A;  3CDQ A;  4Z98 A;  5IHG A;  1JJ0 A;  4WO9 A;  1QTE A;  1UIH A;  3HT8 A;  102L A;  2IFF Y;  4ARM B;  1UIE A;  3W6E A;  1REZ A;  4B1A A;  2Q0M X;  4DAJ A;  3C81 A;  5APC A;  1L65 A;  1DI4 A;  1AT5 A;  1P5C A;  1JJ1 A;  1L17 A;  4NIJ A;  8LYZ A;  1IWY A;  1B5Z A;  197L A;  1GF5 A;  216L A;  1TDY A;  146L A;  1C63 A;  3A96 A;  1LWG A;  211L A;  1L57 A;  2B75 A;  4TSC A;  4PJ2 C;  1WQM A;  2O7A A;  4EKR A;  5LYT A;  1QUS A;  1JIY A;  3TXG A;  4OOT A;  1KNI A;  4BAP A;  192L A;  1C6P A;  4HTN A;  1QTV A;  3VW7 A;  1QUD A;  4S0W A;  1LZS A;  1YIL A;  1DYD A;  1C6F A;  3V2W A;  108L A;  3C8S A;  3L64 A;  3DN6 A;  1KXW A;  3TXH A;  125L A;  1PS5 A;  1BVX A;  4H1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...