1D0LA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
322
structure length
314
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 112
structure length 314
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0lA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0lA02
5AMYA 1A4VA 1EQ4A 2Z12A 4LT3A 1LJIA 2BQAA 2DQCY 1LYZA 1XEIA 3EMSA 4NGJA 4WM2A 1IP3A 1GB8A 5LVJA 3TXIA 1LKSA 1LZEA 2YBHA 1LSZA 2YBJA 4NGKA 1Z55A 134LA 1I20A 1LSEA 1IY3A 1GFTA 4H9IA 4B4JA 1IOQA 4AXTA 1OUGA 4KXIA 1IY4A 1TDYA 4HTQA 2BAAA 4OW1A 1QTEA 1YAPA 4WLYA 1HEPA 1GEVA 2BPUA 4KT3A 1OUDA 5EBHA 1GE0A 5LAGA 3WVXA 1KXXA 2MEBA 5F81A 1LZGA 3WULA 1FLUA 5DL9A 2BQLA 2FBBA 3EBAB 4WL6A 1UIEA 3W6EA 1GFHA 4NGIA 4NGYA 1AKIA 3WUAA 4HTNA 4LGKA 4XENA 1H6MA 1LOZA 1JJ0A 5I4WA 3CB7A 5KY1A 3ZEKA 2HU3A 4DDCA 1CKGA 1JJ3A 4NSHA 3WU8A 4ETAA 4LYOA 5ILCA 4G4BA 3GXKA 1IC5Y 5F9UA 4NWHA 1VATA 3A93A 1UUZC 2RSCA 1I1ZA 4HJZA 3HBHA 1LJEA 4GLVA 3G3BB 1GBOA 4M6DA 4AGAA 1JKBA 2BQOA 3N9CA 4II8A 1BVKC 4WM4A 1RE2A 1YL0X 5HMJA 4PRUA 1BB3A 4ZEEA 2CDSA 5APDA 4J0LA 2HECA 2ZILA 4OWAA 4H93A 1IP7A 1IVMA 4J1BA 4GCDA 1EQEA 1TEWA 1BB7A 2EPEA 1IP2A 1FLWA 4WLTA 1HMKA 1KIPC 1TAYA 1XEJA 2H9KA 4NG1A 5DM9A 1OUCA 2Z39A 1LZRA 2DQJY 4PGJB 3ULRA 1VDSA 3RT5X 4YEOA 1JKAA 1XFPL 2XBSA 3OJPA 4GCEA 5KXRA 1BVXA 207LA 1GF5A 4QGZA 4WM5A 1W08A 4Z3MA 3RZ4A 4FDYA 4WMGA 3CT0A 1IP1A 1DXJA 2Z18A 3A34A 3AW7A 3CT1A 1IEEA 3B6LA 3BKHA 3TXHA 4LT2A 1GF3A 4GCFA 2I6ZA 2W1LA 4TUNA 4I8SA 1YANA 3HFMY 4QY9A 5APCA 208LA 4G49A 5LXWA 1ZVHL 3FE0A 1GFEA 4NSIA 1FDLY 4CGEA 1GF8A 4BAFA 1LZ8A 3WW6A 1HSXA 3B0KA 4H9BA 1LZ9A 4P2EA 3ZVQA 1WTMA 1LHJA 1HC0A 1D9UA 1QUSA 5T3FA 1A2YC 1WQNA 1LZSA 4DD7A 5KXTA 2YSSC 1DQJC 1JTTL 3QY4A 2W1XA 4DD0A 1OUAA 1HEOA 4H1PA 3AZ6A 4WLDA 4MCKA 1ZV5L 4B0DA 1NDGC 1NBYC 2YVBA 1LJ3A 5LYZA 2HTXA 3TXBA 2MEAA 1XSFA 3W6DA 4ETEA 2F2NA 4NSJA 5HLLA 1LHLA 1QSAA 1D6PA 2H5ZA 1DKJA 1LMNA 1GFVA 1GDXA 4WM3A 2Z2FA 1B7OA 5HNLA 4ETCA 1QTKA 4X3BA 3A94A 2BQHA 1OUJA 1GF7A 1NWGA 3TXFA 1YKXX 2ZWBA 5HNCA 3M3UA 3LHMA 1GBSA 3WPKA 1JWRA 3KAMA 1IR8A 3W6BA 3T6UA 1JKCA 4NGVA 1FLQA 1JPOA 2LYOA 5D5FA 1B7QA 4GN4A 1FN5A 5F9XA 1QDTA 1B5ZA 1IWVA 1GHLA 1GE2A 1VDTA 1YL1X 1IC7Y 1OQMA 1JUGA 1JEFA 2ZQ3A 1B5UA 1GAZA 1AT6A 1JKDA 3RU5A 5M1YA 1B9OA 1HMLA 2MEIA 4YEMA 1JISA 1KXYA 1LMAA 1D0LA 4DD2A 5APEA 4ANRA 4ZIXA 4WG7A 1LZ4A 5B1GA 2G4QA 2YBMA 4W96A 1B7MA 3F6ZA 3WU9A 5I54A 1LSBA 1BQLY 3ZVQB 4BAPA 1GFUA 3CSRA 4G9SA 1G7LC 135LA 3N9EA 2YDGA 1LZNA 3B0IA 1LSYA 1P2CC 4NGWA 1CJ6A 4NG8A 4LYZA 3WU7A 6LYTA 1GB5A 1HEWA 1LJHA 3IJVA 1DZBX 2BQNA 4H94A 1OUIA 1DPXA 1B7PA 1BWIA 1B7NA 1GFRA 1KXWA 2I26L 3CQLA 5LVKA 1MELL 1GF4A 1DI4A 2ZYPA 1C46A 3TMWA 1LZYA 2HUBA 2DQGY 3WYHA 4N9RA 1PZYA 1WVVA 1HFZA 2BQGA 5KXYA 1NBZC 4XN6A 1ZMYL 4H8XA 1WQMA 5LVIA 1IO5A 1REZA 2DQIY 3A90A 4E3UA 3LYZA 1IP6A 4H9FA 1LZBA 4N0JA 5KXSA 2GV0A 3A96A 4NY5A 1JSFA 1YIKA 2BQBA 4J1AA 1CKDA 4LYBA 4TWSA 4KL7A 2BQCA 1LYOA 5B05A 4TX7A 1B5YA 3A3RX 5DN4A 2MEHA 2ZNXY 3P64A 2MEEA 4DD3A 2ZYCA 1LYYA 3A3QA 4H9CA 3LZTA 2D4IA 3TXGA 5I4XA 2MEGA 5LVGA 5ILFA 4HSFA 1TBYA 3MGWA 1LHIA 1LSMA 1XGRC 4HV2A 3WPJA 3D9AC 4DYGA 2VB1A 154LA 1B7SA 3SP3A 1GBWA 1LSAA 3AZ4A 1E8LA 1IORA 1FBIX 1LSDA 1YKYX 2MECA 1LHMA 5J7CA 3AGIA 1IWYA 1VFBC 1JIYA 3P4ZA 4WLXA 1KIRC 2D4JA 4XADA 4H8ZA 4MSTA 1OUFA 4OOTA 4WL7A 1TCYA 1VDQA 3HBDA 1LSGA 3QNGA 3TXDA 3WPLA 4NHSA 1OUEA 1RCMA 4H9HA 4LFXA 5II3A 2NWDX 1QUTA 2ZNWY 1CJ8A 2MEDA 1JITA 1LMCA 2D6BA 4R6CA 1IWUA 5KXZA 1BB6A 2PC2A 1GBYA 3AGGG 3T36A 1GEZA 5LA5A 2A7DA 1IWTA 1HF4A 1REYA 2Z2EA 1GD6A 4H9AA 5B59A 5B06A 4XJDA 3TMXA 3TXKA 3WH1A 2FYCA 1LZ1A 1C45A 3LN2A 4IJ4A 1IP5A 2X0AA 3A6CY 2CGIA 3N9AA 4H90A 5KXWA 1IWZA 3J6KA 1C43A 5JENB 1HENA 4WM1A 1WQPA 5IDDA 1LZTA 4XJFA 3TMUA 4C5FA 4KPMA 4ET9A 3WUMA 4B1AA 4ML7A 1CJ9A 1IC4Y 1XGPC 1B7LA 2XJWA 4J7VA 5I53A 4HTKA 4HPIA 4GN5C 4N5RA 4I0CA 4EOFA 2AUBA 4G4CA 5KJ9A 1LZ6A 1YQVY 1RFPA 4CFPA 5DN5A 4H9EA 1T3PA 3WUNA 2CJLA 1C7PA 3RNXA 2D4KA 1ZVYB 1GFKA 4QDNA 3FI7A 4NGZA 1OUBA 2Y8PA 1LJGA 4CJ2A 5KKIA 1B2KA 4TTDA 1UICA 2DKVA 4RLNA 1F0WA 4O34A 1HFYA 1IIZA 2MEFA 1GXV2 4IATA 1GB3A 4NHTA 1HEQA 1UC0A 2IFFY 4DDBA 2EQLA 133LA 3P68A 5KXXA 4LFPA 2HEEA 2LZ2A 1O23A 1LMQA 1WQRA 1C10A 2BQJA 4GN3A 2F4GA 3E3DA 5FSTA 1YROA 1HNLA 1T6VL 2DQEY 1H87A 1W6ZA 2XBRA 3ATOA 3D3DA 4GLAA 2LYMA 3WXTA 2H9JA 5K7OA 1OP9B 5LYMA 1BB4A 3WXUA 4DD9A 1DI3A 1HEMA 5L9JA 1LJNA 1UBZA 3CT5A 1IOSA 1LKRA 3LYOA 3W6CA 4D9ZA 4Z46A 2WARA 5B07A 4B49A 4DT3A 4XJHA 5LYTA 4LYCA 4WO6A 3A67Y 1JHLA 4G4HA 1BHZA 1AZFA 4OWBA 1LMPA 4N1EI 1JSEA 5FEKA 1BB5A 2C8OA 4WOAA 2LHMA 2F4AA 4YM8A 2BLYA 1FKQA 4PJ2C 1BGIA 4H92A 3A92A 1HFXA 2F30A 2ZIKA 3G3AB 4LYTA 3OK0A 1CNSA 1LZCA 2CWIA 4W94A 1CKFA 1LZ5A 4OWCA 1LAAA 1LSPA 1YAQA 4HJYA 1B5WA 1HHLA 2BQDA 4C3WA 4LZTA 1CKCA 1RJCB 1REXA 4NHIA 1PS5A 1GB6A 4YF2A 3LYMA 1AM7A 1VDPA 4UWUA 5LAFA 1B0DA 3AJNA 1UIDA 4RLMA 5F14A 2YBLA 2Z38A 5LA8A 1KIQC 1F10A 5L3IA 1GDWA 3BKVA 1IOTA 3M18B 3W6AA 1NQIA 5DLAA 4RDSA 1DPWA 4XYYA 1LJJA 4FJRA 4RW1A 1REMA 2ZQ4A 5I4YA 5LVHA 1QSWA 1GF0A 1INUA 2DBTA 3P65A 4H91A 9LYZA 1AT5A 4DD1A 1LZAA 3A95A 5LIOA 1NHEA 3TMVA 4A7DA 2C8PA 4NWEA 3QE8A 1LYSA 2A7FA 2G4PA 5B1FA 4NGLA 194LA 4NHPA 1YILA 4WM6A 2YBNA 3TXJA 4ETDA 3WVYA 4ETBA 4TSCA 1LMTA 1BWHA 1EL1A 1LMOA 1UIFA 4MR1A 5C6JA 5FCPA 3LZ2A 1CJ7A 5E9RA 4M4OA 1GPQC 3CSQA 1BWJA 3AZ7A 3B0OA 4N1CC 4OWEA 1GE3A 1GF6A 2XTHA 3WW5A 4BS7A 5KKJA 1N4FA 1CKHA 1WVUA 4R0FA 4YENA 4ET8A 1HERA 1D0MA 5F16A 5E4PA 1IWXA 5L3HA 1GFAA 1IR7A 5A3ZA 4XJGA 1G7HC 4HPEA 5HQ1A 1I56A 2LZTA 1FKVA 4CFOA 3WMKA 1NF5A 2FBDA 3EO5A 2LYZA 3A91A 4B4EA 1JTPL 1UIHA 3A6BY 3CSZA 4XJBA 2YBIA 2FYDA 2W1YA 3B72A 8LYZA 4N8ZA 4WG1A 3AGHA 4RW2A 4YOPA 4H8YA 4L41A 4DWXA 2IHLA 5C6IA 5KXKA 4UWNA 4TSBA 1GBXA 4XJIA 1UIAA 1F6RA 1UACY 5D5CA 1J1XY 1GB0A 1LCNA 3AYQA 1GFJA 1XEKA 2HEFA 3IWRA 2DQFC 193LA 4EMNA 2HEAA 1GF9A 5HMVA 1YAOA 2W1MA 3WL2A 2BQEA 1XGUC 4OOOA 4OWHA 2I25L 1DI5A 4PPOA 1G7JC 4NEBA 4WO9A 1OUHA 5I5QA 132LA 1QIOA 4LT0A 4LYMA 4ZFPA 2B5ZA 2HEDA 3AB6A 1LPIA 1QDRA 1LSNA 4CHXA 1IOCA 1GB9A 1GWDA 4PHIA 1GXXA 1YAMA 1B7RA 1GE1A 1LHHA 2N5ZA 4DC4A 1GB7A 2Q0MX 3K3TA 1V7SA 3ATNA 3J4GA 5C6LA 1UCOA 5LINA 1GBZA 4NIJA 5APFA 2BQIA 2Z19A 5KXNA 5KXOA 3VWOA 4U3XB 4NHQA 4UWVA 5A3EA 3A8ZA 3W6FA 2DQHY 1D0KA 2HU1A 3LYTA 4QEQA 3W3EA 1LZDA 1J1OY 1QQYA 2HEBA 1LSCA 2BQMA 4Z41A 1LSFA 5FELA 4HJVA 3HBEX 1LJFA 5FDJA 5KXMA 1J1PY 2BLXA 1C08C 1D6QA 1GE4A 4NFVA 4DDAA 3RW8A 5IELA 5KXLA 1GB2A 1YKZX 1GAYA 4HV1A 3AW6A 1HSWA 1DKKA 1FLYA 2G4NA 1VEDA 4NGOA 3IJUA 4Z98A 3AZ5A 7LYZA 1V7TA 1NDMC 1IX0A 1G7MC 1UIGA 2DQDY 1B5XA 5KXPA 1IWWA 1GFGA 1MLCE 1WQQA 2BQKA 1RI8B 1LJ4A 2Z37A 1VAUA 2EKSC 4B4IA 2ZIJA 1UA6Y 3P66A 4HP0A 4IASA 1LJKA 1B5VA 1WQOA 1HELA 3EXDA 4GCBA 1XGTC 4BADA 6LYZA 4GCCA 2D91A 5FHWA 1UIBA 3TXEA 4NSGA 1WTNA 153LA 1LTMA 1F6SA 1EQ5A 1NKHA 1NMMA 1ALCA 1SLYA 4LT1A 2EIZC 5IHGA 1JTOL 2BQFA 1XGQC 1SQ2L 2DQAA 1LHKA 4PRQA 1IP4A 1G7IC 1JJ1A 3GXRA 1IR9A
chains in the Genus database with same CATH superfamily
1L69A 4W52A 262LA 3K1JA 1LYHA 2OU0X 2Z12A 1L02A 1LGWA 1XEIA 1PJSA 2UUAM 237LA 1LKSA 1CU3A 3U6LA 1I20A 1IY3A 1IY4A 1TDYA 2KNAA 3KOXE 3A46A 123LA 2OU9A 1CV6A 4OW1A 1OVJA 5ITRA 4KT3A 4LF9M 1L13A 3AOGA 5LAGA 2G8LA 2MEBA 3WULA 3GRRA 1XWIA 1FLUA 2FBBA 2B3TA 1CX6A 1XJTA 4HTNA 3R8FA 4XENA 1QT3A 3ZEKA 1CKGA 3WU8A 4GEWA 4NWHA 4DV0M 2RSCA 1I1ZA 1L34A 1DYFA 2BQOA 2F2QA 3N9CA 4II8A 1YL0X 118LA 5APDA 4J0LA 1G59A 220LA 2ZILA 3C7WA 2Y21A 4MGYE 2EA0A 226LA 2EPEA 1BB7A 1FLWA 4NG1A 4NOOB 2Z39A 170LA 3SFZA 3RT5X 4YEOA 1JKAA 184LA 3HHWA 1XFPL 1L75A 207LA 4A3VB 1PRBA 4WM5A 1G8PA 4FDYA 4WMGA 2RBPA 1IXRC 2RRUA 2O79A 3A34A 5E26A 2B6YA 3TXHA 3K92A 1GF3A 1L94A 4GCFA 4LJ6A 3NBIA 4TUNA 4I8SA 1Z5BA 4P17A 3L25A 3GLHA 131LA 4QY9A 5LXWA 4I81A 4G49A 1QZMA 248LA 1GFEA 4G4NA 4CGEA 1GF8A 4BAFA 1L39A 1LZ8A 4ARJA 4H9BA 3L27A 112LA 1LZ9A 2RGHA 1WTMA 2DZNB 4XK8F 1DYGA 1LHJA 5T3FA 1XJUA 3L2AA 1LZSA 3NWLA 1L83A 2YSSC 3B7ZA 1B6IA 1OUAA 195LA 1QTZA 4B0DA 125LA 3GLHE 1NDGC 2YVBA 2A5YB 1C62A 5LYZA 2LTUA 3TXBA 4Z8XA 3W6DA 2B72A 4MGHA 4ETEA 5HLLA 1D6PA 2HAKA 1DYBA 1DKJA 1GFVA 1CV1A 1GDXA 239LA 3KOYE 5HNLA 4ETCA 4X3BA 1LYJA 2BQHA 1OUJA 2JP7A 1G0MA 3LHMA 3AOEA 1L1TA 3GLGA 4II7A 4I7NA 2DNAA 1JPOA 3SMSA 2X8AA 3SATA 1GHLA 1IWVA 1D3FA 1GE2A 254LA 1L76A 4JI6M 1JTMA 4DQJA 1JUGA 2ZQ3A 2L7IA 1AT6A 1B9OA 1HMLA 3QAUA 2RB0X 2MEIA 4CHTB 1I4WA 1ORYB 4WG7A 2Y0QA 3GLGE 2G4QA 4I7MA 1J5EM 1HNWM 3ZVQB 5ITXE 4DV2M 3CSRA 229LA 135LA 2W82A 1LZNA 1C6JA 1OV7A 4I7SA 4LYZA 1GB5A 2QHOB 2KHHA 2CP8A 1HEWA 1OKSA 3IJVA 1W5SA 1OUIA 1LI6A 1GABA 1B7NA 5LVKA 1MELL 4LF7M 1P3NA 1LZYA 2Y0TA 1L06A 2BQGA 243LA 2OOBA 1C6IA 4H8XA 4DQ5A 4D81A 5JI2E 1PQOA 1REZA 4AW4A 2LVAA 4FCTA 3C83A 1JSFA 1YIKA 4J1AA 2L7HA 1EIJA 4LYBA 2OE7X 2ERCA 2BQCA 4HEOA 4TX7A 5B05A 3DZDA 4JI7M 258LA 2ZYCA 3K9OA 4H9CA 4GITA 227LA 5LVGA 161LA 1TBYA 3MGWA 1D3NA 1XGRC 4HV2A 3WPJA 3D9AC 3LVWA 2QBYB 1B7SA 3SP3A 1E8LA 1FBIX 3J27B 4L8RC 4LGYA 3AGIA 2G3QA 1IWYA 4WLXA 1KIRC 1WGNA 3SBAA 4G6ZA 4DV5M 4MSTA 3M0EA 4AQYM 1L71A 2Q9DA 3J7BA 1WTHA 4ARQB 4H9HA 4LFXA 3W67A 3KS8A 5II3A 2HUKA 1CJ8A 3THGA 3JR4A 1DGBA 1JITA 1TGUA 4RF0A 5KQ8A 3T36A 2C9CA 1GEZA 253LA 3PFIA 3SYLA 1REYA 3C7ZA 5B59A 5B06A 1L61A 1IY0A 1L1ZA 3RZEA 5EJCA 1C45A 3U6SA 1N32M 4B3TM 1HNZM 2J5YA 2Z4RA 4C5FA 4B3SM 5FLXS 3HJ8A 2OPFA 2O4WA 4ML7A 1L90A 4I7OA 3HH3A 2DWZB 3DKEX 2QCUA 4I0CA 1L26A 249LA 4EOFA 4DKLA 1LZ6A 1YQVY 2IGCA 2UUCM 4CFPA 4H9EA 4DR5M 3QAKA 3WUNA 2CJLA 1L23A 1TH4A 5F3WA 2D4KA 2M60A 4QDNA 4CJ2A 2Y8PA 3U6DA 2JY7A 3TPZA 2HUMA 1YLAA 2LVPC 4IJEA 1L29A 1C65A 3ILKA 2DXIA 4MGZE 1C6GA 4EKSA 176LA 4M9ZA 4OW0A 4IATA 1HEQA 156LA 1UC0A 1KS3A 2EQLA 2N35A 4R7GA 2LZ2A 1VDLA 5LZMA 1T8GA 2KXEA 4GN3A 205LA 1L66A 5FSTA 1Y8GA 1SXJC 1L01A 1JB0F 4EIWA 256LA 2XBRA 146LA 5K7OA 4GLAA 2LYMA 1BB4A 5L9JA 1UBZA 2XQOA 3DN1A 4D9ZA 4LJ4A 4CGYB 5LYTA 4LJ8A 4G4HA 3CDOA 1L17A 5FEKA 1BB5A 107LA 1L80A 2DI0A 2B70A 1FKQA 4PJ2C 217LA 1CNSA 3HY5A 4W94A 1CKFA 1LZ5A 4OU7A 4OWCA 1QT8A 3GLFA 1LSPA 1YAQA 1B5WA 4LZTA 1TR8A 1REXA 4YF2A 4JV5M 3MMPA 3PDSA 3GP1A 1K3XA 2HWJA 5LA8A 2M5ZA 1F10A 2R4JA 1GF0A 1IN6A 1ZV1A 2OE9X 2CV1A 3MK6A 174LA 1LZAA 5LIOA 3HU8A 1LYSA 2G4PA 4NHPA 2CUZA 1NHBA 4EPFA 4LF4M 1VDDA 4AG6A 1LMTA 1BWHA 1LMOA 240LA 1GPQC 2JWSA 1GE3A 1GF6A 2XTHA 4BS7A 5DFLA 3UMMA 1G1VA 2ZTDA 4OVZB 3GPYA 2QARC 3U5ZA 1G7HC 5HQ1A 3HU1A 2E5LM 1I56A 4CFOA 3WMKA 2FBDA 3A91A 2XF3A 1JTPL 1I94M 1SXJD 3A6BY 3BXWA 3CSZA 2YBIA 2W1YA 3B72A 8LYZA 3OTOM 2MROB 2QB0B 2IHLA 4TSBA 1C6NA 5D5CA 1CU5A 1J1XY 1GO5A 2KA6B 2KNZA 4X64M 3IWRA 4LF6M 4LDLA 5EP4A 1PQKA 1XGUC 4PPOA 4NEBA 4WO9A 4AKIA 132LA 5ITTA 3GUPA 1LSNA 2FNAA 1IOCA 1GB9A 3FI5A 3C58A 4GKJM 3ATNA 3GUNA 2Q2EB 1GBZA 5KXNA 5KXOA 4U3XB 4NHQA 1SXJE 5A3EA 3GLIE 3W6FA 212LA 260LA 1PJIA 3DMZA 4PK0A 3VW7A 4QEQA 4S12A 3DMXA 1N77A 1AIPC 1QUDA 1P36A 1GE4A 1SWZA 119LA 4I7LA 3KP1E 4I5SA 4LRSA 1HSWA 2YQZA 2G4NA 1L44A 1NNJA 3HDEA 7LYZA 1IX0A 1UIGA 2DQDY 5FTJA 251LA 4EKRA 1RI8B 2V1CA 3HH5A 1VAUA 2EKSC 257LA 3P66A 206LA 2B6WA 4BADA 3CDQA 3DN4A 1UIBA 4NSGA 1L56A 3LQRA 1EQ5A 1NKHA 4DUZM 2UXDM 1L58A 1NMMA 1NJGA 4R3DA 1JR3A 1JTOL 2BQFA 3T1YM 3A90A 5AMYA 3HWSA 3GLHB 4GMQA 4LF5M 4LT3A 1LJIA 1LYZA 4LCBA 4OO9A 1G0JA 3EMSA 4WM2A 1IP3A 5LVJA 3TXIA 1ZWNA 1LZEA 111LA 4NGKA 134LA 2KEBA 1PQIA 4AXTA 4GC9A 2F5QA 120LA 3OE9A 2XEPA 200LA 4HTQA 3WHKA 3HUQA 3LCVB 2X4AA 3V2YA 3TL4X 4WLYA 1GEVA 5C1BA 1OUDA 5FTKA 5EBHA 1CX7A 3HJQA 5F81A 2KRUA 1LZGA 4Z6YA 2DAKA 5LMNM 1UIEA 4EXMA 4NGIA 4GBRB 1AKIA 1C61A 216LA 2LBCA 1H6MA 5KY1A 222LA 1JJ3A 2OTZX 4LYOA 4G4BA 3DA1A 3GXKA 1QVRA 1I6SA 3C80A 3HBHA 1T97A 3DOAA 4GLVA 3G3BB 245LA 4GH9A 3HGIA 1P5CA 5HMJA 2DZLA 6LZMA 2CDSA 1C6MA 4H93A 1IP7A 1EQEA 4WLTA 4MGIE 1DYCA 3DN0A 4NSRA 1KIPC 1TAYA 1G0KA 1LZRA 3ULRA 1P37A 2K6BA 3BBZA 4DV3M 2XBSA 3OJPA 2AHMA 2FH0A 4JI5M 4QGZA 1QT7A 2KW0A 3HKPA 3K8ZA 4FCWA 4FCVA 1GJSA 1DXJA 177LA 1LWKA 3ZC7B 4LT2A 1L49A 2I6ZA 2B7XA 1P6YA 7CATA 3FADA 4W51A 1C6KA 1GL7A 3FE0A 1FDLY 3K2RA 3B0KA 1NY6A 1QUSA 246LA 1WQNA 4KLNA 1C6TA 3VDUA 1DQJC 1X37A 2XZFA 1SG9A 2W1XA 4WLDA 115LA 4MCKA 1IXSA 1XSFA 2F2NA 1A5TA 1QSAA 175LA 3C82A 3L2XA 192LA 1P7SA 3KP0E 172LA 4W58A 4PDGA 4E97A 1TH2A 3H4JA 1CV4A 2Z2FA 4WM3A 3A94A 1QAMA 3BOSA 1PJTA 1GF7A 2FOIC 173LA 4NRWA 4I8OA 3W68A 2ZWBA 3TXFA 3C3EA 1L21A 3M3UA 5I14A 1L19A 2OTYX 3WPKA 3KAMA 3SASA 4ARMB 2LYOA 4I7RA 1B7QA 1G06A 1DV0A 1L25A 2UXCM 1JEFA 4CIZA 1QT5A 1JKDA 5M1YA 4FVMA 4YEMA 1NY5A 1L43A 1LMAA 2UU9M 1L52A 2JY6B 151LA 210LA 4W96A 3WU9A 4LJ7A 1LSBA 4NRVA 2F5OA 4BAPA 1C69A 3HWLA 3N9EA 2YDGA 4GHLA 1LYDA 1DGHB 189LA 3WU7A 1LJHA 1DZBX 3PXGA 1H6UA 1MN3A 1B7PA 4JXJA 1GFRA 3AOEC 1QT4A 3FUVA 5KPZA 2ZYPA 2DQGY 4IBDA 5DYGA 4S0WA 1HFZA 3IG8A 3OE6A 3Q8XA 3FRHA 2CHGA 4E3UA 1XHBA 2Y20A 2ANVA 4N0JA 2YR0A 2GV0A 4NY5A 188LA 2BQBA 225LA 2DVWB 1LYOA 3A3RX 5DN4A 2ZNXY 4DD3A 3U61A 3TXGA 5I4XA 2ZTCA 4BBAA 1VQ1A 3QYBA 2K0BX 2UXBM 4DR7M 2L2DA 4HLQA 165LA 1IM2A 3P4ZA 1ZAEA 2EKKA 4G4QA 1ZYTA 2D4JA 4XADA 4LF8M 1TCYA 1VDQA 4PD2A 3HBDA 3QNGA 3TXDA 1GKIA 127LA 3FUTA 2QSFX 2K47A 1OUEA 1RCMA 4I7TA 4LJ5A 3FYCA 3LQQA 3U6OA 1QUTA 2ZNWY 3VFDA 1LGXA 1L22A 3HU2A 2KZSA 1LMCA 3H4MA 1IWUA 4I7JA 3AGGG 5KXZA 4G4OA 2A7DA 1CU2A 4IBIA 2JXNA 4LJAA 3WH1A 232LA 4IJ4A 1JQJC 3N9AA 1IWZA 5JENB 1IN5A 138LA 4OX9M 3TMUA 4KPMA 3WUMA 4L15A 1CJ9A 2R4EA 2B73A 2XJWA 1FNNA 4AQNA 211LA 2CWBA 3HT8A 1XMOM 3KFUG 4B08A 4KHPM 1CV5A 3Q8GA 1RFPA 1L96A 4I7PA 3R9XB 1C7PA 3AFHA 1D3MA 1GFKA 3FI7A 114LA 1OUBA 1LJGA 4TTDA 1PQJA 191LA 1F0WA 4O34A 2B74A 1IIZA 148LE 3MHVC 3U5ZB 4NHTA 2IFFY 4Y28F 4IBEA 3P68A 4LZMA 4LFPA 2HEEA 157LA 4P16A 1L2DA 2DWLA 1LMQA 1C10A 3E3DA 5A2QS 1XMQM 2WZJA 1W6ZA 3WXTA 2OU8A 1HEMA 2LVNC 2Z6BA 1IOSA 4DT3A 2FFJA 4DV4M 4XJHA 4WO6A 3MJ5A 1TLAA 1JHLA 1L74A 1BHZA 3QWLA 1L84A 1AZFA 3I4VA 1QTBA 2F5SA 2RH1A 4OWBA 1SXJB 3FTFA 2C8OA 3GLIB 2F4AA 2LHMA 1DO0A 4YM8A 1CV0A 2B6ZA 2F30A 2ZIKA 4LYTA 3OK0A 3HZJA 1K82A 2BQDA 2QNJA 1GB6A 2BNKA 5LAFA 1B0DA 3T15A 2JY8A 1SSWA 197LA 113LA 1E9SA 4DV1M 1DYEA 1L16A 1OYUA 1V34A 2Z38A 4EJ4A 2RB1X 3W6AA 3G3WA 1NQIA 4RDSA 1DPWA 3HU9A 1DYAA 3AL0C 4F2LA 1ZMVA 2CV2A 1LJJA 5LVHA 1INUA 139LA 1AT5A 141LA 2ANXA 1NHEA 4NWEA 3QE8A 2A7FA 1E94E 3SB6A 1NVMA 1YILA 3TXJA 5KQDA 4W56A 1EL1A 4D82A 4M4OA 1ZMUA 2HCBA 3AZ7A 2LXEA 1L03A 3SAUA 2C98A 1N4FA 1YSYA 4ET8A 1OAOC 2YNMD 1IWXA 5L3HA 4JI0M 1IR7A 3HT6A 4XJGA 5EXSA 1FKVA 2QPAA 1WJ7A 1L37A 1NF5A 3EO5A 2LYZA 4IBJA 4B4EA 4LG2A 2VIIA 3ODUA 5EXPA 1C66A 4WG1A 4DR2M 3AGHA 4I7QA 5C6IA 2CFOA 4XJIA 1F6RA 3GUMA 1C6CA 1GFJA 1XEKA 185LA 3T6PA 2WSEF 2HEAA 4W55A 2W1MA 1L27A 2VF8A 1G7JC 2D7EA 4ZFPA 2B5ZA 3TE6A 3AB6A 1T8FA 1GWDA 4PHIA 2VQFM 3FTEA 3U60A 1YAMA 1GE1A 1KFVA 1L38A 2DHYA 1GB7A 5C6LA 4GHAA 2BQIA 1IXZA 1QSBA 2H5XA 1SWYA 1IQPA 150LA 3PVSA 2DQHY 1D0KA 3B9PA 2DAEA 4YX7C 1RU3A 3LW5F 1P56A 3W3EA 1LZDA 3LCUA 1N33M 1LSCA 4QHSA 4MH0E 1QT6A 1LSFA 5FELA 3U6QA 2LZMA 3HBEX 2H1RA 4PDIA 1LJFA 2HULA 1BVSA 1V92A 2BLXA 3NYAA 4AG5A 1HQYE 3C3DA 4L6V6 4HV1A 3IJUA 1G0GA 4B7FA 3AZ5A 1NDMC 2XLJA 1QQWA 1B5XA 1MLCE 1T6OA 180LA 3TWLA 3I51A 1L68A 1LJ4A 1OVHA 1L12A 3HDFA 4IASA 1Z5CA 3IHPA 3EXDA 2JA2A 1IY1A 209LA 2D91A 1WTNA 236LA 1F6SA 1IN4A 4W54A 1SLYA 1ALCA 5KPTA 160LA 2UUBM 4MM3B 2L78A 3SBBC 1JJ1A 1L64A 1L92A 3F8VA 1IR9A 4HSFA 1LWGA 1OJLA 1EQ4A 1G4AE 3D8LA 142LA 3I04M 1L2BA 3KSJA 2BQAA 2DQCY 2OEAX 4IBCA 1UM8A 1PJQA 4ZPUA 1GB8A 152LA 2G5GX 3D8BA 234LA 2YBHA 2YBJA 2HKJA 4FW9A 3HTDA 3B7NA 3GLFE 1QUHA 1IOQA 1SX7A 1OUGA 3DFZA 1Z6TA 1L45A 2JZ1A 1L85A 4L78A 1HEPA 1OV5A 2BPUA 1C6BA 3FUUA 3WVXA 3I01M 1VEJA 5DL9A 3W6EA 3E21A 3EBAB 1GFHA 4NGYA 3NY8A 3DN3A 4AZFA 1OFHA 2WSFF 4LGKA 109LA 5I4WA 1HJPA 3CB7A 214LA 2HU3A 4DDCA 4NSHA 4DJHA 4ETAA 5ILCA 4B7GA 7LZMA 2LHGA 1IC5Y 5F9UA 3UZUA 2XSZA 3A93A 1UUZC 4HJZA 1LJEA 1E32A 2DAGA 1GBOA 3FUWA 2CEAA 1JKBA 2FE8A 4W53A 1QTHA 4WM4A 1RE2A 4PRUA 4AKGA 238LA 4ZEEA 187LA 3HTGA 2HECA 3LZMA 1IVMA 4J1BA 1KNIA 4LGMA 3SN6R 4QOSA 4DV6M 1L99A 4REZA 1L54A 1XEJA 5DM9A 1C68A 1C6EA 1OUCA 4M0DA 2DQJY 1VDSA 1L42A 1XNRM 3EMLA 2F5NA 5KXRA 2ZBKB 4GCEA 5FTNA 2EKFA 1LLHA 1W08A 4Z3MA 3RZ4A 1SSYA 3F92A 1NJFA 1HNXM 1IP1A 3AW7A 1LGUA 3BKHA 2W1LA 4W57A 1YANA 3RFWA 3HFMY 108LA 2D7GA 5APCA 166LA 1ZVHL 3PNYA 5LMUM 3ZVQA 2CV0A 1HC0A 1D9UA 3HJSA 1L59A 168LA 1L82A 4DD7A 2J7NA 3DN6A 3SARA 3QY4A 3J2PB 5E6JA 3U6EA 1HEOA 3AZ6A 3UONA 1CVKA 1C60A 1ZV5L 1OTRA 2MH8A 1NBYC 1KY1A 1G41A 2JNHA 2HTXA 1LHLA 3VKGA 3K2LA 2H5ZA 4PJZA 1V33A 5DNYA 4FD2A 1L87A 1L60A 4HL4A 1JR3D 1QYRA 4EPIA 1B7OA 1PM5A 2BWEA 3FTDA 1C6LA 3AV0A 1NWGA 5HNCA 1L91A 3C9PA 1NHWC 1GBSA 1QUGA 1JWRA 1QANA 3W6BA 3T6UA 1JKCA 1FLQA 261LA 2Z8YM 2Z4SA 5D5FA 4GN4A 5F9XA 1QDTA 1B5ZA 3V2WA 3NBXX 1B5UA 1GAZA 3RU5A 1XXHA 4XGIA 2R18A 1JISA 4L16A 3VLFB 3ZH9B 3ZQJA 1TDHA 1R2ZA 2XGNA 4ANRA 4ZIXA 4LJ9A 5B1GA 1L93A 2YBMA 5I54A 1BQLY 2ZAMA 3G3VA 1G7LC 1L97A 4X65M 4ARQA 3GRYA 1JR3E 1LSYA 4NGWA 1CJ6A 6LYTA 2LNHC 1XXHE 2BQNA 4H94A 1HT1E 1SX2A 235LA 2I26L 3CQLA 1L77A 1GF4A 1WIVA 3UJNA 1C46A 5EP3A 3TMWA 2HUBA 3WYHA 4N9RA 1PZYA 1WVVA 4LRTA 1NBZC 2I7NA 1ZMYL 4XN6A 1WQMA 3DN2A 1N75A 1E9RA 3L29A 1IO5A 1KW5A 4B3RM 3LYZA 5KXSA 3A96A 1IBLM 2NTGA 3FD9A 1CKDA 3GLGB 4KL7A 2RKOA 1L48A 3P64A 3FRIA 3KSXA 3JR6A 3A3QA 3LZTA 2YFQA 2RB2X 1L30A 2MEGA 2JY5A 1WR1B 3NY9A 1LHIA 1VEKA 3C7YA 3GUIA 4DYGA 5KPRA 2VB1A 3SAWA 2QP9X 1GBWA 1LSAA 4JI2M 1LSDA 1YKYX 2MECA 1LHMA 2EJSA 5J7CA 1VFBC 3K9PA 3KXEC 2EUCA 1D2NA 4D80A 4H8ZA 1OUFA 4OOTA 1LSGA 5EXTA 2DWNA 4JYAM 3IECA 2LCBA 2R62A 2DENA 1LV7A 2R46A 2MEDA 2MGWA 2XFSA 199LA 1R7RA 1C67A 2F47A 4R6CA 1C6AA 1GBYA 5LA5A 2MR9A 1L10A 3M6AA 1GD6A 4H9AA 3TMXA 2FYCA 3LN2A 4GC5A 1IP5A 4YHHM 5KXWA 1CUKA 1C43A 182LA 1HENA 4WM1A 1WQPA 4JN6A 1LZTA 4XJFA 1L18A 3G3XA 1CV3A 1B7LA 5I53A 4HTKA 4GRIA 3JR5A 4LZZA 2AUBA 2L09A 2J7OA 4G4CA 5KJ9A 2DWMA 1L09A 1L57A 1LYEA 3RNXA 1ZVYB 4NGZA 128LA 1L15A 1DYDA 1NO1A 104LA 1UICA 3SHGB 3GO8A 1L32A 4RF1A 1IN7A 2RBQA 4MB7A 1C1KA 1HFYA 1NHGC 2MEFA 5IWAM 1GB3A 1C6QA 4LFAM 3HT9A 3RGSA 1O23A 4MGKE 1WQRA 4IJFA 4RKUF 1L20A 3L64A 2MJ5B 1T6VL 2DQEY 3ATOA 2H9JA 1OP9B 4JI8M 4F1IA 1G0QA 3WXUA 1J09A 1IBMM 4DD9A 3VKHA 3CT5A 1LKRA 3LYOA 4BB9A 3W6CA 5B07A 4B49A 1D9WA 1CUPA 4LYCA 3A67Y 1K28A 4OVZA 1LMPA 1JSEA 4R71A 2RAYX 2V1UA 1BGIA 4H92A 4JI1M 4UN2B 3A92A 3G3AB 233LA 1LAAA 1T6HA 4HJYA 4C3WA 1RJCB 1QTCA 3HHZA 4NHIA 4M0WA 3HHYA 1AM7A 1L53A 3VK7A 1D2YA 1L46A 5F14A 242LA 3OE8A 3GUJA 3M18B 1ZMWA 1OIPA 1YUBA 4RW1A 1REMA 2ZQ4A 3DNAA 5I4YA 3KS4A 2DBTA 3P65A 163LA 2DHRA 2O01F 3TMVA 2C8PA 4PCZA 5B1FA 1IY2A 194LA 1XNQM 2YBNA 4ETBA 4TSCA 5C6JA 4MR1A 2DAIA 1UIFA 5FCPA 5E9RA 4XBOA 167LA 1D2WA 1T8AA 4OWEA 3WW5A 1L89A 2RAZX 4R0FA 4LFBM 1HERA 1D0MA 5F16A 3U6MA 143LA 1GFAA 3ZCBB 1L72A 4W5WA 4HPEA 3GLFB 4YXAC 1UIHA 4DR6M 1R5LA 2FYDA 3L26A 2DAMA 5GKNA 183LA 4YOPA 4H8YA 3T1HM 4ITQA 4L41A 5KXKA 4UWNA 3KW6A 2XZUA 4IBGA 1DO2A 3FE3A 1GB0A 3AYQA 1GVNA 3OE0A 1OQYA 3HH6A 2VF7A 193LA 3TQSA 5EP1A 4OOOA 4OWHA 1L0KA 4LT0A 2HEDA 3SAVA 129LA 1LPIA 1QDRA 2QZ4A 5IZ7D 186LA 1QUOA 1PJJA 3KOZE 1B7RA 1LHHA 4DC4A 2R6FA 4KT0F 1C63A 2Q0MX 4X66M 1V7SA 3J4GA 3K3TA 4NIJA 5APFA 2Z19A 3PNVA 158LA 3UK6A 4UWVA 3VWOA 1Q39A 1L62A 3LYTA 1G0PA 1OWYA 3F9LA 1QQYA 223LA 1LYIA 3HH4A 2RBNA 4HJVA 1L05A 4RNAA 5FDJA 1J1PY 4M9XA 4NFVA 1LI3A 5IELA 5KXLA 1GB2A 1YKZX 3J81S 1L51A 1PQDA 2EO2A 5FSWA 4I4LA 2FS1A 1FLYA 1VEDA 255LA 1N34M 1YE9A 4Z98A 1G7MC 2BJWA 3FKEA 5KXPA 1IWWA 213LA 2BQKA 2F32A 1GLNA 1UA6Y 1WQOA 2Z7JA 1G1WA 1XGTC 3HUAA 1G3IA 3CDTA 3TXEA 4FWDA 2QQ8A 1N78A 5ITXA 2L4EA 4NL4H 3A45A 4QNMA 1MX0A 1KY0A 2DQAA 4JI4M 1SQ2L 1LHKA 3GULA 4PRQA 1IP4A 1G7IC 3GXRA 1A4VA 4NGJA 4LZJA 4DV7M 4IBBA 4ARPA 2KRKA 1XC8A 3CDVA 3FA0A 1LSZA 1Z55A 1IBKM 2R65A 1GFTA 2R45A 1L41A 1LSEA 4H9IA 1P64A 4B4JA 3JAMS 4KXIA 3KVWA 2BAAA 1QTEA 1YAPA 3SB9A 4K0KM 1L8QA 1GE0A 149LA 4DUYM 4FWHA 3SMPA 1KXXA 3EIEA 2V6ZM 5EP2A 171LA 2BQLA 2NTHA 4WL6A 2B75A 1LW9A 4NXNM 3SBJA 3WUAA 259LA 247LA 5BPVA 1LOZA 1JJ0A 228LA 2CUUA 3VK8A 3SB5A 4M9SA 4KODA 1VATA 1EFUB 1QSQA 3V76A 3HT7A 1R4GA 3GQ5A 4G3OA 2F4VM 1VEGA 3J7AS 4M6DA 4AGAA 1BVKC 5EXXA 102LA 1BB3A 2CHQA 1XXHB 4OWAA 2D7HA 1UFZA 4GCDA 1TEWA 3U6PA 1IP2A 1HMKA 2H9KA 1WXQA 3VDPA 5IREB 2RBOA 4PGJB 1FJGM 2C99A 2LH0A 3GPUA 1BVXA 3W0FA 1MJGM 1GF5A 2VDBB 3B74A 5FTMA 4ARMA 5JI3E 1EE8A 3E4RA 2O25A 3CT0A 2Z18A 3GUKA 3CT1A 1IEEA 3B6LA 2VQEM 3FUXA 4IBFA 1C6FA 2DZOB 162LA 4EKQA 2LVQD 4B7HA 1P2LA 1QS9A 4WP2A 208LA 4NSIA 1KYIA 3WW6A 1HSXA 4P2EA 2CHVA 2NQ8C 1HQCA 1L63A 1A2YC 3M7GA 144LA 1WHCA 1JTTL 1DGHA 3KDSE 4DD0A 4H1PA 3W0LB 1OFIA 1LI2A 215LA 1LJ3A 4LDEA 2MEAA 231LA 4NSJA 1LMNA 2RGOA 3B89A 1L95A 3AKZA 1TF0B 1P2RA 1QTKA 4CISA 1C64A 1WGLA 5BR8M 1YKXX 3E46A 4X62M 5ITQA 1IR8A 4JI3M 4NGVA 169LA 1C6DA 1FN5A 8CATA 1L0JA 2BJVA 1VDTA 2APLA 2R0IA 1NV9A 1YL1X 1IC7Y 1OQMA 3GPPA 1L2CA 1L70A 2DKLA 4DAJA 4WW0A 1DGGA 1KXYA 1D0LA 4DD2A 5APEA 1LZ4A 1LYGA 3FYDA 4DR3M 1B7MA 3F6ZA 2XFTA 1GFUA 3IG5A 4G9SA 3B0IA 1P2CC 1CUQA 4NG8A 5EQTA 3D4SA 1JQUA 1DPXA 1BWIA 1KXWA 1IXSB 2XSZD 3CTWB 1DI4A 155LA 1G07A 1ZURA 3SHFA 5KXYA 1G71A 2ZM6M 1T43A 159LA 5LVIA 2DQIY 3KOWE 1IP6A 4IAPA 4H9FA 1P3QQ 1LZBA 4IIWA 1HT2E 201LA 2L4FA 4IBKA 1MU5A 3UGJA 252LA 1L65A 4TWSA 2A4TA 1B5YA 1L04A 1Q02A 2MEHA 2MEEA 1LYYA 2D4IA 130LA 1J7KA 5ILFA 1L11A 2RBSA 1G0LA 126LA 1LSMA 2R44A 2ZAOA 1QTVA 4NSOB 3U6CA 2HHHM 154LA 1QAQA 1DGFA 3CF0A 3AZ4A 1IORA 4G4RA 1JIYA 1LPYA 198LA 2BWBA 4WL7A 3FTCA 3A98B 2F5PA 1F4IA 1TTEA 1NV8A 4FWGA 181LA 4NHSA 2LHCA 3WPLA 2NWDX 122LA 2KNVA 2LVOC 1L50A 1L08A 3TWMA 2Z3XA 1W5TA 2D6BA 4YXCA 1BB6A 2PC2A 1IWTA 1HF4A 1NSFA 2JZ0A 2Z2EA 4GKKM 4XJDA 3TXKA 3C8QA 1LZ1A 2O7AA 2X0AA 3A6CY 2CGIA 3DMVA 4QNRA 4H90A 3J6KA 5IDDA 1C6HA 2C5RA 1SXJA 2GNOA 3GLIA 1L07A 4DQ7A 4ET9A 4B1AA 2L6OA 1IN8A 2OQ4A 3I4YA 1IC4Y 1XGPC 1CU6A 4J7VA 3U61B 1L67A 1PGYA 4HPIA 4GN5C 4N5RA 5H37D 2O5RA 4AI6A 5DN5A 2Q9EA 1T3PA 1N36M 2C96A 1ZQ9A 2CE7A 3HX3A 224LA 4ARLA 4DR1M 5KKIA 1B2KA 2OOAA 2DKVA 4RLNA 1KW7A 2JUJA 1GXV2 4AKHA 4DDBA 5KXXA 133LA 3LMMA 1C6PA 3CF6E 2OE4X 219LA 2BQJA 2F4GA 4LY6A 3J80S 103LA 1YROA 1HNLA 1H87A 1P46A 3D3DA 4KO8A 4B3MM 5LYMA 1Z59A 1L55A 1L28A 1DI3A 3E9SA 3GQ3A 230LA 1LJNA 4WURA 2QBYA 1KSFX 4Z46A 2WARA 2LWXA 1QTDA 1XEPA 190LA 3C8RA 4YY3M 244LA 5KXTA 4N1EI 3LVVA 4WOAA 4TUWA 2BLYA 5ITYA 1HFXA 1L79A 1LZCA 2CWIA 1HHLA 1CKCA 1T3TA 3WHLA 1PS5A 3GPXA 110LA 1L47A 3LYMA 1VDPA 4UWUA 1L86A 1QS5A 1Q3CA 3AJNA 2HL7A 5DYIA 1UIDA 4RLMA 3B7QA 2YBLA 2K9DA 1KIQC 5L3IA 1GDWA 3BKVA 1GJTA 1IOTA 5DLAA 1OAIA 3HUKA 4XYYA 1GL6A 2ZANA 4FJRA 4QHTA 1QSWA 4H91A 9LYZA 3GQ4A 4DD1A 3A95A 4A7DA 4EKPA 3HTFA 4NGLA 4WM6A 1L88A 4ETDA 178LA 3WVYA 3AJIB 3HTBA 1QAOA 221LA 3LZ2A 2X49A 145LA 1CJ7A 1L33A 3SB8A 3CSQA 1BWJA 3B0OA 4N1CC 5KKJA 1Q3BA 2I7PA 1NNUC 1CKHA 1XB2B 1WVUA 1R6BX 2RBRA 4YENA 164LA 5E4PA 3RGPA 3HHXA 3T38A 1EPYA 1OVKA 1TH3A 4PT5A 5A3ZA 2WSCF 4ZPXA 1TDZA 2LZTA 4L4UA 1L36A 2B6XA 5L8RF 2KDLA 4XJBA 3QYEA 1JTNA 4N8ZA 1S3SA 1HR0M 4RW2A 4K5YA 4DWXA 1GBXA 3CDRA 1UIAA 1UACY 1LCNA 1L14A 2HEFA 4DBGB 147LA 2DQFC 4EMNA 1PQMA 1GF9A 5HMVA 1YAOA 3WL2A 2BQEA 1Z5AA 2I25L 1DI5A 1OIZA 1OUHA 2LC9A 5I5QA 3RUNA 1QIOA 4LYMA 1VG5A 1D3JA 4CHXA 4NC6A 1GXXA 4GRVA 3GUOA 2KZUA 2N5ZA 3L28A 196LA 1UCOA 5LINA 140LA 2CRUA 1K3WA 4DR4M 3A8ZA 4Q7JA 4CJ6A 3C8SA 3CGWA 1QZEA 1L00A 2HU1A 218LA 1J1OY 2OO9A 1L24A 1L98A 1OWZA 2BQMA 2HEBA 4I7KA 4Z41A 3RE8A 3SB7A 4LFCM 250LA 4W59A 2B6TA 5KXMA 1C08C 1D6QA 1IFYA 4BLCA 2C9OA 4DDAA 3RW8A 5KO3A 1L81A 2P5TA 3DN8A 3EIHA 1GAYA 5ITUA 3HU3A 3AW6A 5C18A 1DKKA 1L73A 4NGOA 241LA 137LA 1V7TA 3C81A 2XH9A 1L40A 2QENA 3A42A 1GFGA 4LDOA 1WQQA 1R2YA 2Z37A 4B4IA 3SC3A 2ZIJA 4HP0A 1LJKA 1B5VA 1HELA 4GCBA 3GRVA 3TWKA 6LYZA 4GCCA 5FHWA 1L31A 3SYKA 4GIPA 5FTLA 4NXMM 3PBLA 3GRUA 2GQFA 153LA 1LTMA 1LYFA 4LT1A 1CTWA 3U60B 2EIZC 5IHGA 1CU0A 1XGQC 5IT9S 1L35A 1C7YA 3CF2A 4QOZC 1AUAA
chains in the Genus database with same CATH topology
1L69A 4W52A 262LA 1LYHA 2OU0X 2Z12A 1L02A 1LGWA 1XEIA 237LA 1LKSA 1CU3A 1I20A 1IY3A 1IY4A 1TDYA 123LA 2OU9A 1CV6A 4OW1A 1OVJA 4KT3A 1L13A 5LAGA 2MEBA 3WULA 1FLUA 2FBBA 1CX6A 1XJTA 4HTNA 4XENA 1QT3A 3ZEKA 1CKGA 3WU8A 4NWHA 2RSCA 1I1ZA 1L34A 1DYFA 2BQOA 2F2QA 3N9CA 4II8A 1YL0X 118LA 5APDA 4J0LA 220LA 2ZILA 3C7WA 226LA 2EPEA 1BB7A 1FLWA 4NG1A 2Z39A 170LA 3RT5X 4YEOA 1JKAA 184LA 1XFPL 1L75A 207LA 4WM5A 4FDYA 4WMGA 2RBPA 2O79A 3A34A 2B6YA 3TXHA 1L94A 1GF3A 4GCFA 4TUNA 4I8SA 131LA 4QY9A 5LXWA 4G49A 248LA 1GFEA 4CGEA 1GF8A 4BAFA 1L39A 1LZ8A 4ARJA 4H9BA 112LA 1LZ9A 1WTMA 1DYGA 1LHJA 5T3FA 1XJUA 1LZSA 1L83A 2YSSC 1B6IA 1OUAA 195LA 1QTZA 4B0DA 125LA 1NDGC 2YVBA 1C62A 5LYZA 3TXBA 3W6DA 4ETEA 5HLLA 2B72A 1D6PA 1DYBA 1DKJA 1GFVA 1CV1A 1GDXA 239LA 5HNLA 4ETCA 4X3BA 1LYJA 2BQHA 1OUJA 1G0MA 3LHMA 4I7NA 1JPOA 1GHLA 1IWVA 1D3FA 1GE2A 254LA 1L76A 1JTMA 4DQJA 1JUGA 2ZQ3A 1AT6A 1B9OA 1HMLA 2RB0X 2MEIA 4WG7A 2G4QA 4I7MA 3ZVQB 3CSRA 229LA 135LA 1LZNA 1C6JA 1OV7A 4I7SA 4LYZA 1GB5A 1HEWA 3IJVA 1OUIA 1LI6A 1B7NA 5LVKA 1MELL 1P3NA 1LZYA 1L06A 2BQGA 243LA 1C6IA 4H8XA 4DQ5A 1PQOA 1REZA 3C83A 1JSFA 1YIKA 4J1AA 4LYBA 2OE7X 2BQCA 5B05A 4TX7A 2ZYCA 258LA 4H9CA 227LA 5LVGA 161LA 1TBYA 3MGWA 1D3NA 1XGRC 4HV2A 3WPJA 3D9AC 1B7SA 3SP3A 1E8LA 1FBIX 3AGIA 1IWYA 4WLXA 1KIRC 3SBAA 4MSTA 1L71A 2Q9DA 1WTHA 4ARQB 4H9HA 4LFXA 5II3A 2HUKA 1CJ8A 1JITA 3T36A 1GEZA 253LA 1REYA 3C7ZA 5B59A 5B06A 1L61A 3RZEA 1C45A 4C5FA 2O4WA 4ML7A 1L90A 4I7OA 3HH3A 3DKEX 4I0CA 1L26A 249LA 4EOFA 4DKLA 1LZ6A 1YQVY 2IGCA 4CFPA 4H9EA 3QAKA 3WUNA 2CJLA 1L23A 2D4KA 4QDNA 4CJ2A 2Y8PA 2HUMA 1L29A 1C65A 1C6GA 4EKSA 176LA 4IATA 1HEQA 156LA 1UC0A 1KS3A 2EQLA 2LZ2A 5LZMA 1T8GA 4GN3A 205LA 1L66A 5FSTA 1L01A 256LA 2XBRA 146LA 5K7OA 4GLAA 2LYMA 1BB4A 5L9JA 1UBZA 2XQOA 3DN1A 4D9ZA 5LYTA 4G4HA 3CDOA 1L17A 5FEKA 1BB5A 107LA 1L80A 2B70A 1FKQA 4PJ2C 217LA 1CNSA 4W94A 1CKFA 1LZ5A 4OWCA 1QT8A 1LSPA 1YAQA 1B5WA 4LZTA 1REXA 4YF2A 3PDSA 5LA8A 1F10A 1GF0A 2OE9X 174LA 1LZAA 5LIOA 3HU8A 1LYSA 2G4PA 4NHPA 4EPFA 1NHBA 1LMTA 1BWHA 1LMOA 240LA 1GPQC 1GE3A 1GF6A 2XTHA 4BS7A 1G1VA 2QARC 1G7HC 5HQ1A 1I56A 4CFOA 3WMKA 2FBDA 3A91A 1JTPL 3A6BY 3CSZA 2YBIA 2W1YA 3B72A 8LYZA 2QB0B 2IHLA 4TSBA 1C6NA 5D5CA 1CU5A 1J1XY 3IWRA 4LDLA 1PQKA 1XGUC 4PPOA 4NEBA 4WO9A 132LA 3GUPA 1LSNA 1IOCA 1GB9A 3FI5A 3ATNA 3GUNA 1GBZA 5KXNA 5KXOA 4U3XB 4NHQA 5A3EA 3W6FA 212LA 260LA 3DMZA 3VW7A 4PK0A 4QEQA 3DMXA 1QUDA 1P36A 1GE4A 1SWZA 119LA 4I7LA 1HSWA 2G4NA 1L44A 3HDEA 7LYZA 1IX0A 1UIGA 2DQDY 251LA 4EKRA 1RI8B 3HH5A 1VAUA 2EKSC 257LA 3P66A 206LA 2B6WA 4BADA 3CDQA 3DN4A 1UIBA 4NSGA 1L56A 1EQ5A 1NKHA 1NMMA 1L58A 1JTOL 2BQFA 3A90A 5AMYA 4LT3A 1LJIA 1LYZA 4OO9A 1G0JA 3EMSA 4WM2A 1IP3A 5LVJA 3TXIA 1ZWNA 1LZEA 111LA 4NGKA 134LA 1PQIA 4AXTA 120LA 3OE9A 200LA 4HTQA 3HUQA 3V2YA 4WLYA 1GEVA 1OUDA 5EBHA 1CX7A 5F81A 1LZGA 1UIEA 4EXMA 4NGIA 4GBRB 1AKIA 1C61A 216LA 1H6MA 5KY1A 222LA 1JJ3A 2OTZX 4LYOA 4G4BA 3GXKA 1I6SA 3C80A 3HBHA 1T97A 4GLVA 3G3BB 245LA 1P5CA 5HMJA 6LZMA 2CDSA 1C6MA 4H93A 1IP7A 1EQEA 4WLTA 3DN0A 1DYCA 1KIPC 1TAYA 1G0KA 1LZRA 3ULRA 1P37A 2XBSA 3OJPA 4QGZA 1QT7A 1DXJA 177LA 1LWKA 4LT2A 1L49A 2I6ZA 2B7XA 1P6YA 3FADA 4W51A 1C6KA 3FE0A 1FDLY 3K2RA 3B0KA 1QUSA 246LA 1WQNA 1C6TA 1DQJC 2W1XA 4WLDA 115LA 4MCKA 1XSFA 2F2NA 1QSAA 175LA 3C82A 3L2XA 192LA 1P7SA 172LA 4W58A 4E97A 4WM3A 1CV4A 2Z2FA 3A94A 1GF7A 173LA 3TXFA 2ZWBA 5I14A 3M3UA 1L21A 1L19A 2OTYX 3WPKA 3KAMA 4ARMB 2LYOA 4I7RA 1B7QA 1G06A 1L25A 1JEFA 1QT5A 1JKDA 5M1YA 4YEMA 1L43A 1LMAA 1L52A 151LA 210LA 4W96A 3WU9A 1LSBA 4BAPA 1C69A 3HWLA 3N9EA 2YDGA 1LYDA 189LA 3WU7A 1LJHA 1DZBX 1B7PA 1GFRA 1QT4A 2ZYPA 2DQGY 4S0WA 1HFZA 3OE6A 4E3UA 2ANVA 4N0JA 2GV0A 4NY5A 188LA 2BQBA 225LA 1LYOA 3A3RX 5DN4A 2ZNXY 4DD3A 3TXGA 5I4XA 165LA 3P4ZA 1ZYTA 2D4JA 4XADA 1TCYA 1VDQA 3HBDA 3QNGA 3TXDA 127LA 1OUEA 1RCMA 4I7TA 1QUTA 2ZNWY 1LGXA 1L22A 1LMCA 1IWUA 5KXZA 4I7JA 3AGGG 2A7DA 1CU2A 3WH1A 232LA 4IJ4A 3N9AA 1IWZA 5JENB 138LA 3TMUA 4KPMA 3WUMA 1CJ9A 2B73A 2XJWA 4AQNA 211LA 3HT8A 1CV5A 1RFPA 1L96A 4I7PA 1C7PA 1D3MA 1GFKA 3FI7A 114LA 1OUBA 1LJGA 4TTDA 1PQJA 191LA 1F0WA 4O34A 2B74A 1IIZA 148LE 4NHTA 2IFFY 3P68A 4LZMA 4LFPA 2HEEA 157LA 1LMQA 1C10A 3E3DA 1W6ZA 3WXTA 2OU8A 1HEMA 2Z6BA 1IOSA 4DT3A 4XJHA 4WO6A 1TLAA 1JHLA 1L74A 1BHZA 1QTBA 1L84A 1AZFA 4OWBA 2RH1A 2C8OA 2LHMA 2F4AA 4YM8A 1CV0A 2B6ZA 2F30A 2ZIKA 4LYTA 3OK0A 2BQDA 1GB6A 5LAFA 1B0DA 1SSWA 197LA 113LA 1L16A 1DYEA 1OYUA 2Z38A 4EJ4A 2RB1X 3W6AA 3G3WA 1NQIA 4RDSA 1DPWA 3HU9A 1DYAA 1LJJA 5LVHA 1INUA 139LA 1AT5A 141LA 2ANXA 1NHEA 4NWEA 3QE8A 2A7FA 3SB6A 1YILA 3TXJA 4W56A 1EL1A 4M4OA 3AZ7A 1L03A 1N4FA 4ET8A 1IWXA 5L3HA 1IR7A 3HT6A 4XJGA 1FKVA 1L37A 1NF5A 3EO5A 2LYZA 4B4EA 3ODUA 1C66A 4WG1A 3AGHA 4I7QA 5C6IA 4XJIA 1F6RA 3GUMA 1C6CA 1GFJA 1XEKA 185LA 2HEAA 4W55A 2W1MA 1L27A 1G7JC 4ZFPA 2B5ZA 3AB6A 1T8FA 1GWDA 4PHIA 1YAMA 1GE1A 1L38A 1GB7A 5C6LA 2BQIA 1QSBA 1SWYA 150LA 2DQHY 1D0KA 4YX7C 1P56A 3W3EA 1LZDA 1LSCA 1QT6A 1LSFA 5FELA 3HBEX 2LZMA 1LJFA 2HULA 2BLXA 3NYAA 4HV1A 3IJUA 1G0GA 3AZ5A 1NDMC 1B5XA 1MLCE 180LA 1L68A 1LJ4A 1OVHA 1L12A 3HDFA 4IASA 3EXDA 209LA 2D91A 1WTNA 236LA 1F6SA 4W54A 1SLYA 1ALCA 160LA 2L78A 3SBBC 1L64A 1L92A 4HSFA 1JJ1A 3F8VA 1IR9A 1LWGA 1EQ4A 142LA 2BQAA 2DQCY 2OEAX 4ZPUA 1GB8A 152LA 234LA 2YBHA 2YBJA 3HTDA 1QUHA 1IOQA 1SX7A 1OUGA 1L45A 1L85A 1HEPA 1OV5A 2BPUA 1C6BA 3WVXA 5DL9A 3W6EA 3EBAB 1GFHA 4NGYA 3NY8A 3DN3A 4LGKA 5I4WA 109LA 3CB7A 214LA 2HU3A 4DDCA 4NSHA 4DJHA 4ETAA 5ILCA 7LZMA 1IC5Y 5F9UA 3A93A 1UUZC 4HJZA 1LJEA 1GBOA 1JKBA 4W53A 1QTHA 4WM4A 1RE2A 4PRUA 238LA 4ZEEA 187LA 3HTGA 2HECA 3LZMA 1IVMA 4J1BA 1KNIA 3SN6R 1L99A 1L54A 1XEJA 5DM9A 1C68A 1C6EA 1OUCA 2DQJY 1VDSA 1L42A 3EMLA 5KXRA 4GCEA 1LLHA 1W08A 4Z3MA 3RZ4A 1SSYA 1IP1A 3AW7A 1LGUA 3BKHA 2W1LA 4W57A 1YANA 3HFMY 108LA 5APCA 166LA 1ZVHL 3ZVQA 1HC0A 1D9UA 1L59A 168LA 1L82A 4DD7A 3DN6A 3QY4A 1HEOA 3AZ6A 3UONA 1CVKA 1C60A 1ZV5L 1NBYC 1KY1A 2HTXA 1LHLA 2H5ZA 4PJZA 1L87A 1L60A 4EPIA 1B7OA 1C6LA 1NWGA 5HNCA 1L91A 1GBSA 1QUGA 1JWRA 3W6BA 3T6UA 1JKCA 1FLQA 261LA 5D5FA 4GN4A 5F9XA 1QDTA 1B5ZA 3V2WA 1B5UA 1GAZA 3RU5A 1JISA 4ANRA 4ZIXA 5B1GA 1L93A 2YBMA 5I54A 1BQLY 3G3VA 1G7LC 1L97A 4ARQA 1LSYA 4NGWA 1CJ6A 6LYTA 2BQNA 4H94A 1SX2A 235LA 2I26L 3CQLA 1L77A 1GF4A 1C46A 3TMWA 3WYHA 2HUBA 4N9RA 1PZYA 1WVVA 1NBZC 4XN6A 1ZMYL 1WQMA 3DN2A 1IO5A 1KW5A 3LYZA 5KXSA 3A96A 2NTGA 1CKDA 4KL7A 1L48A 3P64A 3JR6A 3A3QA 3LZTA 2RB2X 1L30A 2MEGA 3NY9A 1LHIA 3C7YA 3GUIA 4DYGA 2VB1A 1GBWA 1LSAA 1LSDA 1YKYX 2MECA 1LHMA 5J7CA 1VFBC 4H8ZA 4OOTA 1OUFA 1LSGA 2LCBA 2MEDA 199LA 1C67A 2F47A 4R6CA 1C6AA 1GBYA 5LA5A 1L10A 1GD6A 4H9AA 3TMXA 2FYCA 3LN2A 1IP5A 5KXWA 1C43A 182LA 1HENA 4WM1A 1WQPA 1LZTA 4XJFA 1L18A 3G3XA 1CV3A 1B7LA 5I53A 4HTKA 2AUBA 4G4CA 5KJ9A 1L09A 1L57A 1LYEA 3RNXA 1ZVYB 4NGZA 128LA 1L15A 1DYDA 104LA 1UICA 1L32A 2RBQA 1HFYA 2MEFA 1GB3A 1C6QA 3HT9A 1O23A 1WQRA 1L20A 3L64A 1T6VL 2DQEY 3ATOA 2H9JA 1OP9B 1G0QA 4DD9A 3WXUA 3CT5A 1LKRA 3LYOA 3W6CA 5B07A 4B49A 1D9WA 1CUPA 4LYCA 3A67Y 1K28A 1LMPA 1JSEA 2RAYX 1BGIA 4H92A 3A92A 3G3AB 233LA 1LAAA 1T6HA 4HJYA 4C3WA 1RJCB 1QTCA 4NHIA 1AM7A 1L53A 1D2YA 1L46A 5F14A 242LA 3OE8A 3GUJA 3M18B 5I4YA 4RW1A 1REMA 2ZQ4A 3DNAA 2DBTA 3P65A 163LA 3TMVA 2C8PA 5B1FA 194LA 2YBNA 4ETBA 4TSCA 5C6JA 4MR1A 1UIFA 5FCPA 5E9RA 1D2WA 167LA 1T8AA 4OWEA 3WW5A 1L89A 2RAZX 4R0FA 1HERA 1D0MA 5F16A 143LA 1GFAA 1L72A 4HPEA 4YXAC 1UIHA 2FYDA 183LA 4YOPA 4H8YA 4L41A 5KXKA 4UWNA 3AYQA 1GB0A 3OE0A 3HH6A 193LA 4OOOA 4OWHA 1L0KA 4LT0A 2HEDA 129LA 1LPIA 1QDRA 186LA 1QUOA 1B7RA 1LHHA 4DC4A 1C63A 2Q0MX 3K3TA 1V7SA 3J4GA 4NIJA 5APFA 2Z19A 158LA 3VWOA 4UWVA 1L62A 3LYTA 1G0PA 1OWYA 3F9LA 1QQYA 223LA 1LYIA 3HH4A 2RBNA 4HJVA 1L05A 5FDJA 1J1PY 4NFVA 1LI3A 5IELA 5KXLA 1GB2A 1YKZX 1L51A 1PQDA 1FLYA 1VEDA 255LA 4Z98A 1G7MC 5KXPA 1IWWA 213LA 2BQKA 2F32A 1UA6Y 1WQOA 1G1WA 1XGTC 3HUAA 3CDTA 3TXEA 1KY0A 2DQAA 1SQ2L 1LHKA 3GULA 4PRQA 1IP4A 1G7IC 3GXRA 1A4VA 4NGJA 4ARPA 3CDVA 3FA0A 1LSZA 1Z55A 1LSEA 1GFTA 1L41A 4H9IA 4B4JA 1P64A 4KXIA 2BAAA 1QTEA 1YAPA 3SB9A 1GE0A 149LA 1KXXA 171LA 2BQLA 2NTHA 4WL6A 2B75A 1LW9A 3WUAA 259LA 247LA 1LOZA 1JJ0A 228LA 2CUUA 3SB5A 1VATA 1QSQA 3HT7A 4M6DA 4AGAA 1BVKC 102LA 1BB3A 4OWAA 4GCDA 1TEWA 1IP2A 1HMKA 2H9KA 2RBOA 4PGJB 1BVXA 1GF5A 4ARMA 3CT0A 2Z18A 3GUKA 3CT1A 1IEEA 3B6LA 1C6FA 162LA 4EKQA 1P2LA 1QS9A 208LA 4NSIA 3WW6A 1HSXA 4P2EA 1L63A 1A2YC 144LA 1JTTL 4DD0A 4H1PA 1LI2A 215LA 1LJ3A 4LDEA 2MEAA 231LA 4NSJA 1LMNA 1L95A 1P2RA 1QTKA 1C64A 1YKXX 1IR8A 4NGVA 169LA 1C6DA 1FN5A 1L0JA 1VDTA 1YL1X 1IC7Y 1OQMA 1L70A 4DAJA 1KXYA 1D0LA 4DD2A 5APEA 1LZ4A 1LYGA 1B7MA 3F6ZA 1GFUA 4G9SA 3B0IA 1P2CC 1CUQA 4NG8A 3D4SA 1JQUA 1DPXA 1BWIA 1KXWA 1DI4A 155LA 1G07A 1ZURA 5KXYA 159LA 5LVIA 2DQIY 1IP6A 4IAPA 4H9FA 1LZBA 201LA 252LA 4TWSA 1L65A 2A4TA 1B5YA 1L04A 2MEHA 2MEEA 1LYYA 2D4IA 130LA 5ILFA 1L11A 2RBSA 1G0LA 126LA 1LSMA 1QTVA 154LA 3AZ4A 1IORA 1JIYA 1LPYA 198LA 4WL7A 3WPLA 181LA 4NHSA 2NWDX 122LA 1L50A 1L08A 2D6BA 4YXCA 1BB6A 2PC2A 1IWTA 1HF4A 2Z2EA 4XJDA 3TXKA 3C8QA 1LZ1A 2O7AA 2X0AA 3A6CY 2CGIA 3DMVA 4H90A 3J6KA 5IDDA 1C6HA 1L07A 4DQ7A 4ET9A 4B1AA 1IC4Y 1XGPC 1CU6A 4J7VA 1L67A 4HPIA 4GN5C 4N5RA 5DN5A 2Q9EA 1T3PA 224LA 4ARLA 5KKIA 1B2KA 2DKVA 4RLNA 1KW7A 1GXV2 4DDBA 5KXXA 133LA 1C6PA 2OE4X 219LA 2BQJA 2F4GA 103LA 1YROA 1HNLA 1H87A 1P46A 3D3DA 5LYMA 1L55A 1L28A 1DI3A 230LA 1LJNA 4Z46A 2WARA 1QTDA 1XEPA 190LA 3C8RA 244LA 5KXTA 4N1EI 4WOAA 2BLYA 1HFXA 1L79A 1LZCA 2CWIA 1HHLA 1CKCA 1PS5A 110LA 1L47A 3LYMA 1VDPA 4UWUA 1L86A 1QS5A 3AJNA 1UIDA 4RLMA 2YBLA 1KIQC 5L3IA 1GDWA 3BKVA 1IOTA 5DLAA 3HUKA 4XYYA 4FJRA 1QSWA 4H91A 9LYZA 4DD1A 3A95A 4A7DA 4EKPA 3HTFA 4NGLA 4WM6A 1L88A 4ETDA 178LA 3WVYA 3HTBA 221LA 3LZ2A 1CJ7A 145LA 1L33A 3SB8A 3CSQA 1BWJA 3B0OA 4N1CC 5KKJA 1WVUA 1CKHA 2RBRA 4YENA 164LA 5E4PA 1EPYA 1OVKA 5A3ZA 2LZTA 1L36A 2B6XA 4XJBA 1JTNA 4N8ZA 4RW2A 4K5YA 4DWXA 1GBXA 3CDRA 1UIAA 1UACY 1LCNA 1L14A 2HEFA 147LA 2DQFC 4EMNA 1PQMA 1GF9A 5HMVA 1YAOA 3WL2A 2BQEA 2I25L 1DI5A 1OUHA 2LC9A 5I5QA 3RUNA 1QIOA 4LYMA 1D3JA 4CHXA 1GXXA 4GRVA 3GUOA 2N5ZA 196LA 1UCOA 5LINA 140LA 3A8ZA 3C8SA 1L00A 2HU1A 218LA 1J1OY 1L24A 1L98A 1OWZA 2BQMA 2HEBA 4I7KA 4Z41A 3SB7A 250LA 4W59A 2B6TA 5KXMA 1C08C 1D6QA 4DDAA 3RW8A 1L81A 3DN8A 1GAYA 3AW6A 1DKKA 1L73A 4NGOA 241LA 137LA 1V7TA 3C81A 1L40A 1GFGA 4LDOA 1WQQA 2Z37A 4B4IA 2ZIJA 4HP0A 1LJKA 1B5VA 1HELA 4GCBA 6LYZA 4GCCA 5FHWA 1L31A 3PBLA 153LA 1LTMA 1LYFA 4LT1A 1CTWA 2EIZC 5IHGA 1CU0A 1XGQC 1L35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AMY A;  1A4V A;  1EQ4 A;  2Z12 A;  4LT3 A;  1LJI A;  2BQA A;  2DQC Y;  1LYZ A;  1XEI A;  3EMS A;  4NGJ A;  4WM2 A;  1IP3 A;  1GB8 A;  5LVJ A;  3TXI A;  1LKS A;  1LZE A;  2YBH A;  1LSZ A;  2YBJ A;  4NGK A;  1Z55 A;  134L A;  1I20 A;  1LSE A;  1IY3 A;  1GFT A;  4H9I A;  4B4J A;  1IOQ A;  4AXT A;  1OUG A;  4KXI A;  1IY4 A;  1TDY A;  4HTQ A;  2BAA A;  4OW1 A;  1QTE A;  1YAP A;  4WLY A;  1HEP A;  1GEV A;  2BPU A;  4KT3 A;  1OUD A;  5EBH A;  1GE0 A;  5LAG A;  3WVX A;  1KXX A;  2MEB A;  5F81 A;  1LZG A;  3WUL A;  1FLU A;  5DL9 A;  2BQL A;  2FBB A;  3EBA B;  4WL6 A;  1UIE A;  3W6E A;  1GFH A;  4NGI A;  4NGY A;  1AKI A;  3WUA A;  4HTN A;  4LGK A;  4XEN A;  1H6M A;  1LOZ A;  1JJ0 A;  5I4W A;  3CB7 A;  5KY1 A;  3ZEK A;  2HU3 A;  4DDC A;  1CKG A;  1JJ3 A;  4NSH A;  3WU8 A;  4ETA A;  4LYO A;  5ILC A;  4G4B A;  3GXK A;  1IC5 Y;  5F9U A;  4NWH A;  1VAT A;  3A93 A;  1UUZ C;  2RSC A;  1I1Z A;  4HJZ A;  3HBH A;  1LJE A;  4GLV A;  3G3B B;  1GBO A;  4M6D A;  4AGA A;  1JKB A;  2BQO A;  3N9C A;  4II8 A;  1BVK C;  4WM4 A;  1RE2 A;  1YL0 X;  5HMJ A;  4PRU A;  1BB3 A;  4ZEE A;  2CDS A;  5APD A;  4J0L A;  2HEC A;  2ZIL A;  4OWA A;  4H93 A;  1IP7 A;  1IVM A;  4J1B A;  4GCD A;  1EQE A;  1TEW A;  1BB7 A;  2EPE A;  1IP2 A;  1FLW A;  4WLT A;  1HMK A;  1KIP C;  1TAY A;  1XEJ A;  2H9K A;  4NG1 A;  5DM9 A;  1OUC A;  2Z39 A;  1LZR A;  2DQJ Y;  4PGJ B;  3ULR A;  1VDS A;  3RT5 X;  4YEO A;  1JKA A;  1XFP L;  2XBS A;  3OJP A;  4GCE A;  5KXR A;  1BVX A;  207L A;  1GF5 A;  4QGZ A;  4WM5 A;  1W08 A;  4Z3M A;  3RZ4 A;  4FDY A;  4WMG A;  3CT0 A;  1IP1 A;  1DXJ A;  2Z18 A;  3A34 A;  3AW7 A;  3CT1 A;  1IEE A;  3B6L A;  3BKH A;  3TXH A;  4LT2 A;  1GF3 A;  4GCF A;  2I6Z A;  2W1L A;  4TUN A;  4I8S A;  1YAN A;  3HFM Y;  4QY9 A;  5APC A;  208L A;  4G49 A;  5LXW A;  1ZVH L;  3FE0 A;  1GFE A;  4NSI A;  1FDL Y;  4CGE A;  1GF8 A;  4BAF A;  1LZ8 A;  3WW6 A;  1HSX A;  3B0K A;  4H9B A;  1LZ9 A;  4P2E A;  3ZVQ A;  1WTM A;  1LHJ A;  1HC0 A;  1D9U A;  1QUS A;  5T3F A;  1A2Y C;  1WQN A;  1LZS A;  4DD7 A;  5KXT A;  2YSS C;  1DQJ C;  1JTT L;  3QY4 A;  2W1X A;  4DD0 A;  1OUA A;  1HEO A;  4H1P A;  3AZ6 A;  4WLD A;  4MCK A;  1ZV5 L;  4B0D A;  1NDG C;  1NBY C;  2YVB A;  1LJ3 A;  5LYZ A;  2HTX A;  3TXB A;  2MEA A;  1XSF A;  3W6D A;  4ETE A;  2F2N A;  4NSJ A;  5HLL A;  1LHL A;  1QSA A;  1D6P A;  2H5Z A;  1DKJ A;  1LMN A;  1GFV A;  1GDX A;  4WM3 A;  2Z2F A;  1B7O A;  5HNL A;  4ETC A;  1QTK A;  4X3B A;  3A94 A;  2BQH A;  1OUJ A;  1GF7 A;  1NWG A;  3TXF A;  1YKX X;  2ZWB A;  5HNC A;  3M3U A;  3LHM A;  1GBS A;  3WPK A;  1JWR A;  3KAM A;  1IR8 A;  3W6B A;  3T6U A;  1JKC A;  4NGV A;  1FLQ A;  1JPO A;  2LYO A;  5D5F A;  1B7Q A;  4GN4 A;  1FN5 A;  5F9X A;  1QDT A;  1B5Z A;  1IWV A;  1GHL A;  1GE2 A;  1VDT A;  1YL1 X;  1IC7 Y;  1OQM A;  1JUG A;  1JEF A;  2ZQ3 A;  1B5U A;  1GAZ A;  1AT6 A;  1JKD A;  3RU5 A;  5M1Y A;  1B9O A;  1HML A;  2MEI A;  4YEM A;  1JIS A;  1KXY A;  1LMA A;  1D0L A;  4DD2 A;  5APE A;  4ANR A;  4ZIX A;  4WG7 A;  1LZ4 A;  5B1G A;  2G4Q A;  2YBM A;  4W96 A;  1B7M A;  3F6Z A;  3WU9 A;  5I54 A;  1LSB A;  1BQL Y;  3ZVQ B;  4BAP A;  1GFU A;  3CSR A;  4G9S A;  1G7L C;  135L A;  3N9E A;  2YDG A;  1LZN A;  3B0I A;  1LSY A;  1P2C C;  4NGW A;  1CJ6 A;  4NG8 A;  4LYZ A;  3WU7 A;  6LYT A;  1GB5 A;  1HEW A;  1LJH A;  3IJV A;  1DZB X;  2BQN A;  4H94 A;  1OUI A;  1DPX A;  1B7P A;  1BWI A;  1B7N A;  1GFR A;  1KXW A;  2I26 L;  3CQL A;  5LVK A;  1MEL L;  1GF4 A;  1DI4 A;  2ZYP A;  1C46 A;  3TMW A;  1LZY A;  2HUB A;  2DQG Y;  3WYH A;  4N9R A;  1PZY A;  1WVV A;  1HFZ A;  2BQG A;  5KXY A;  1NBZ C;  4XN6 A;  1ZMY L;  4H8X A;  1WQM A;  5LVI A;  1IO5 A;  1REZ A;  2DQI Y;  3A90 A;  4E3U A;  3LYZ A;  1IP6 A;  4H9F A;  1LZB A;  4N0J A;  5KXS A;  2GV0 A;  3A96 A;  4NY5 A;  1JSF A;  1YIK A;  2BQB A;  4J1A A;  1CKD A;  4LYB A;  4TWS A;  4KL7 A;  2BQC A;  1LYO A;  5B05 A;  4TX7 A;  1B5Y A;  3A3R X;  5DN4 A;  2MEH A;  2ZNX Y;  3P64 A;  2MEE A;  4DD3 A;  2ZYC A;  1LYY A;  3A3Q A;  4H9C A;  3LZT A;  2D4I A;  3TXG A;  5I4X A;  2MEG A;  5LVG A;  5ILF A;  4HSF A;  1TBY A;  3MGW A;  1LHI A;  1LSM A;  1XGR C;  4HV2 A;  3WPJ A;  3D9A C;  4DYG A;  2VB1 A;  154L A;  1B7S A;  3SP3 A;  1GBW A;  1LSA A;  3AZ4 A;  1E8L A;  1IOR A;  1FBI X;  1LSD A;  1YKY X;  2MEC A;  1LHM A;  5J7C A;  3AGI A;  1IWY A;  1VFB C;  1JIY A;  3P4Z A;  4WLX A;  1KIR C;  2D4J A;  4XAD A;  4H8Z A;  4MST A;  1OUF A;  4OOT A;  4WL7 A;  1TCY A;  1VDQ A;  3HBD A;  1LSG A;  3QNG A;  3TXD A;  3WPL A;  4NHS A;  1OUE A;  1RCM A;  4H9H A;  4LFX A;  5II3 A;  2NWD X;  1QUT A;  2ZNW Y;  1CJ8 A;  2MED A;  1JIT A;  1LMC A;  2D6B A;  4R6C A;  1IWU A;  5KXZ A;  1BB6 A;  2PC2 A;  1GBY A;  3AGG G;  3T36 A;  1GEZ A;  5LA5 A;  2A7D A;  1IWT A;  1HF4 A;  1REY A;  2Z2E A;  1GD6 A;  4H9A A;  5B59 A;  5B06 A;  4XJD A;  3TMX A;  3TXK A;  3WH1 A;  2FYC A;  1LZ1 A;  1C45 A;  3LN2 A;  4IJ4 A;  1IP5 A;  2X0A A;  3A6C Y;  2CGI A;  3N9A A;  4H90 A;  5KXW A;  1IWZ A;  3J6K A;  1C43 A;  5JEN B;  1HEN A;  4WM1 A;  1WQP A;  5IDD A;  1LZT A;  4XJF A;  3TMU A;  4C5F A;  4KPM A;  4ET9 A;  3WUM A;  4B1A A;  4ML7 A;  1CJ9 A;  1IC4 Y;  1XGP C;  1B7L A;  2XJW A;  4J7V A;  5I53 A;  4HTK A;  4HPI A;  4GN5 C;  4N5R A;  4I0C A;  4EOF A;  2AUB A;  4G4C A;  5KJ9 A;  1LZ6 A;  1YQV Y;  1RFP A;  4CFP A;  5DN5 A;  4H9E A;  1T3P A;  3WUN A;  2CJL A;  1C7P A;  3RNX A;  2D4K A;  1ZVY B;  1GFK A;  4QDN A;  3FI7 A;  4NGZ A;  1OUB A;  2Y8P A;  1LJG A;  4CJ2 A;  5KKI A;  1B2K A;  4TTD A;  1UIC A;  2DKV A;  4RLN A;  1F0W A;  4O34 A;  1HFY A;  1IIZ A;  2MEF A;  1GXV 2;  4IAT A;  1GB3 A;  4NHT A;  1HEQ A;  1UC0 A;  2IFF Y;  4DDB A;  2EQL A;  133L A;  3P68 A;  5KXX A;  4LFP A;  2HEE A;  2LZ2 A;  1O23 A;  1LMQ A;  1WQR A;  1C10 A;  2BQJ A;  4GN3 A;  2F4G A;  3E3D A;  5FST A;  1YRO A;  1HNL A;  1T6V L;  2DQE Y;  1H87 A;  1W6Z A;  2XBR A;  3ATO A;  3D3D A;  4GLA A;  2LYM A;  3WXT A;  2H9J A;  5K7O A;  1OP9 B;  5LYM A;  1BB4 A;  3WXU A;  4DD9 A;  1DI3 A;  1HEM A;  5L9J A;  1LJN A;  1UBZ A;  3CT5 A;  1IOS A;  1LKR A;  3LYO A;  3W6C A;  4D9Z A;  4Z46 A;  2WAR A;  5B07 A;  4B49 A;  4DT3 A;  4XJH A;  5LYT A;  4LYC A;  4WO6 A;  3A67 Y;  1JHL A;  4G4H A;  1BHZ A;  1AZF A;  4OWB A;  1LMP A;  4N1E I;  1JSE A;  5FEK A;  1BB5 A;  2C8O A;  4WOA A;  2LHM A;  2F4A A;  4YM8 A;  2BLY A;  1FKQ A;  4PJ2 C;  1BGI A;  4H92 A;  3A92 A;  1HFX A;  2F30 A;  2ZIK A;  3G3A B;  4LYT A;  3OK0 A;  1CNS A;  1LZC A;  2CWI A;  4W94 A;  1CKF A;  1LZ5 A;  4OWC A;  1LAA A;  1LSP A;  1YAQ A;  4HJY A;  1B5W A;  1HHL A;  2BQD A;  4C3W A;  4LZT A;  1CKC A;  1RJC B;  1REX A;  4NHI A;  1PS5 A;  1GB6 A;  4YF2 A;  3LYM A;  1AM7 A;  1VDP A;  4UWU A;  5LAF A;  1B0D A;  3AJN A;  1UID A;  4RLM A;  5F14 A;  2YBL A;  2Z38 A;  5LA8 A;  1KIQ C;  1F10 A;  5L3I A;  1GDW A;  3BKV A;  1IOT A;  3M18 B;  3W6A A;  1NQI A;  5DLA A;  4RDS A;  1DPW A;  4XYY A;  1LJJ A;  4FJR A;  4RW1 A;  1REM A;  2ZQ4 A;  5I4Y A;  5LVH A;  1QSW A;  1GF0 A;  1INU A;  2DBT A;  3P65 A;  4H91 A;  9LYZ A;  1AT5 A;  4DD1 A;  1LZA A;  3A95 A;  5LIO A;  1NHE A;  3TMV A;  4A7D A;  2C8P A;  4NWE A;  3QE8 A;  1LYS A;  2A7F A;  2G4P A;  5B1F A;  4NGL A;  194L A;  4NHP A;  1YIL A;  4WM6 A;  2YBN A;  3TXJ A;  4ETD A;  3WVY A;  4ETB A;  4TSC A;  1LMT A;  1BWH A;  1EL1 A;  1LMO A;  1UIF A;  4MR1 A;  5C6J A;  5FCP A;  3LZ2 A;  1CJ7 A;  5E9R A;  4M4O A;  1GPQ C;  3CSQ A;  1BWJ A;  3AZ7 A;  3B0O A;  4N1C C;  4OWE A;  1GE3 A;  1GF6 A;  2XTH A;  3WW5 A;  4BS7 A;  5KKJ A;  1N4F A;  1CKH A;  1WVU A;  4R0F A;  4YEN A;  4ET8 A;  1HER A;  1D0M A;  5F16 A;  5E4P A;  1IWX A;  5L3H A;  1GFA A;  1IR7 A;  5A3Z A;  4XJG A;  1G7H C;  4HPE A;  5HQ1 A;  1I56 A;  2LZT A;  1FKV A;  4CFO A;  3WMK A;  1NF5 A;  2FBD A;  3EO5 A;  2LYZ A;  3A91 A;  4B4E A;  1JTP L;  1UIH A;  3A6B Y;  3CSZ A;  4XJB A;  2YBI A;  2FYD A;  2W1Y A;  3B72 A;  8LYZ A;  4N8Z A;  4WG1 A;  3AGH A;  4RW2 A;  4YOP A;  4H8Y A;  4L41 A;  4DWX A;  2IHL A;  5C6I A;  5KXK A;  4UWN A;  4TSB A;  1GBX A;  4XJI A;  1UIA A;  1F6R A;  1UAC Y;  5D5C A;  1J1X Y;  1GB0 A;  1LCN A;  3AYQ A;  1GFJ A;  1XEK A;  2HEF A;  3IWR A;  2DQF C;  193L A;  4EMN A;  2HEA A;  1GF9 A;  5HMV A;  1YAO A;  2W1M A;  3WL2 A;  2BQE A;  1XGU C;  4OOO A;  4OWH A;  2I25 L;  1DI5 A;  4PPO A;  1G7J C;  4NEB A;  4WO9 A;  1OUH A;  5I5Q A;  132L A;  1QIO A;  4LT0 A;  4LYM A;  4ZFP A;  2B5Z A;  2HED A;  3AB6 A;  1LPI A;  1QDR A;  1LSN A;  4CHX A;  1IOC A;  1GB9 A;  1GWD A;  4PHI A;  1GXX A;  1YAM A;  1B7R A;  1GE1 A;  1LHH A;  2N5Z A;  4DC4 A;  1GB7 A;  2Q0M X;  3K3T A;  1V7S A;  3ATN A;  3J4G A;  5C6L A;  1UCO A;  5LIN A;  1GBZ A;  4NIJ A;  5APF A;  2BQI A;  2Z19 A;  5KXN A;  5KXO A;  3VWO A;  4U3X B;  4NHQ A;  4UWV A;  5A3E A;  3A8Z A;  3W6F A;  2DQH Y;  1D0K A;  2HU1 A;  3LYT A;  4QEQ A;  3W3E A;  1LZD A;  1J1O Y;  1QQY A;  2HEB A;  1LSC A;  2BQM A;  4Z41 A;  1LSF A;  5FEL A;  4HJV A;  3HBE X;  1LJF A;  5FDJ A;  5KXM A;  1J1P Y;  2BLX A;  1C08 C;  1D6Q A;  1GE4 A;  4NFV A;  4DDA A;  3RW8 A;  5IEL A;  5KXL A;  1GB2 A;  1YKZ X;  1GAY A;  4HV1 A;  3AW6 A;  1HSW A;  1DKK A;  1FLY A;  2G4N A;  1VED A;  4NGO A;  3IJU A;  4Z98 A;  3AZ5 A;  7LYZ A;  1V7T A;  1NDM C;  1IX0 A;  1G7M C;  1UIG A;  2DQD Y;  1B5X A;  5KXP A;  1IWW A;  1GFG A;  1MLC E;  1WQQ A;  2BQK A;  1RI8 B;  1LJ4 A;  2Z37 A;  1VAU A;  2EKS C;  4B4I A;  2ZIJ A;  1UA6 Y;  3P66 A;  4HP0 A;  4IAS A;  1LJK A;  1B5V A;  1WQO A;  1HEL A;  3EXD A;  4GCB A;  1XGT C;  4BAD A;  6LYZ A;  4GCC A;  2D91 A;  5FHW A;  1UIB A;  3TXE A;  4NSG A;  1WTN A;  153L A;  1LTM A;  1F6S A;  1EQ5 A;  1NKH A;  1NMM A;  1ALC A;  1SLY A;  4LT1 A;  2EIZ C;  5IHG A;  1JTO L;  2BQF A;  1XGQ C;  1SQ2 L;  2DQA A;  1LHK A;  4PRQ A;  1IP4 A;  1G7I C;  1JJ1 A;  3GXR A;  1IR9 A; 
#chains in the Genus database with same CATH topology
 1L69 A;  4W52 A;  262L A;  3K1J A;  1LYH A;  2OU0 X;  2Z12 A;  1L02 A;  1LGW A;  1XEI A;  1PJS A;  2UUA M;  237L A;  1LKS A;  1CU3 A;  3U6L A;  1I20 A;  1IY3 A;  1IY4 A;  1TDY A;  2KNA A;  3KOX E;  3A46 A;  123L A;  2OU9 A;  1CV6 A;  4OW1 A;  1OVJ A;  5ITR A;  4KT3 A;  4LF9 M;  1L13 A;  3AOG A;  5LAG A;  2G8L A;  2MEB A;  3WUL A;  3GRR A;  1XWI A;  1FLU A;  2FBB A;  2B3T A;  1CX6 A;  1XJT A;  4HTN A;  3R8F A;  4XEN A;  1QT3 A;  3ZEK A;  1CKG A;  3WU8 A;  4GEW A;  4NWH A;  4DV0 M;  2RSC A;  1I1Z A;  1L34 A;  1DYF A;  2BQO A;  2F2Q A;  3N9C A;  4II8 A;  1YL0 X;  118L A;  5APD A;  4J0L A;  1G59 A;  220L A;  2ZIL A;  3C7W A;  2Y21 A;  4MGY E;  2EA0 A;  226L A;  2EPE A;  1BB7 A;  1FLW A;  4NG1 A;  4NOO B;  2Z39 A;  170L A;  3SFZ A;  3RT5 X;  4YEO A;  1JKA A;  184L A;  3HHW A;  1XFP L;  1L75 A;  207L A;  4A3V B;  1PRB A;  4WM5 A;  1G8P A;  4FDY A;  4WMG A;  2RBP A;  1IXR C;  2RRU A;  2O79 A;  3A34 A;  5E26 A;  2B6Y A;  3TXH A;  3K92 A;  1GF3 A;  1L94 A;  4GCF A;  4LJ6 A;  3NBI A;  4TUN A;  4I8S A;  1Z5B A;  4P17 A;  3L25 A;  3GLH A;  131L A;  4QY9 A;  5LXW A;  4I81 A;  4G49 A;  1QZM A;  248L A;  1GFE A;  4G4N A;  4CGE A;  1GF8 A;  4BAF A;  1L39 A;  1LZ8 A;  4ARJ A;  4H9B A;  3L27 A;  112L A;  1LZ9 A;  2RGH A;  1WTM A;  2DZN B;  4XK8 F;  1DYG A;  1LHJ A;  5T3F A;  1XJU A;  3L2A A;  1LZS A;  3NWL A;  1L83 A;  2YSS C;  3B7Z A;  1B6I A;  1OUA A;  195L A;  1QTZ A;  4B0D A;  125L A;  3GLH E;  1NDG C;  2YVB A;  2A5Y B;  1C62 A;  5LYZ A;  2LTU A;  3TXB A;  4Z8X A;  3W6D A;  2B72 A;  4MGH A;  4ETE A;  5HLL A;  1D6P A;  2HAK A;  1DYB A;  1DKJ A;  1GFV A;  1CV1 A;  1GDX A;  239L A;  3KOY E;  5HNL A;  4ETC A;  4X3B A;  1LYJ A;  2BQH A;  1OUJ A;  2JP7 A;  1G0M A;  3LHM A;  3AOE A;  1L1T A;  3GLG A;  4II7 A;  4I7N A;  2DNA A;  1JPO A;  3SMS A;  2X8A A;  3SAT A;  1GHL A;  1IWV A;  1D3F A;  1GE2 A;  254L A;  1L76 A;  4JI6 M;  1JTM A;  4DQJ A;  1JUG A;  2ZQ3 A;  2L7I A;  1AT6 A;  1B9O A;  1HML A;  3QAU A;  2RB0 X;  2MEI A;  4CHT B;  1I4W A;  1ORY B;  4WG7 A;  2Y0Q A;  3GLG E;  2G4Q A;  4I7M A;  1J5E M;  1HNW M;  3ZVQ B;  5ITX E;  4DV2 M;  3CSR A;  229L A;  135L A;  2W82 A;  1LZN A;  1C6J A;  1OV7 A;  4I7S A;  4LYZ A;  1GB5 A;  2QHO B;  2KHH A;  2CP8 A;  1HEW A;  1OKS A;  3IJV A;  1W5S A;  1OUI A;  1LI6 A;  1GAB A;  1B7N A;  5LVK A;  1MEL L;  4LF7 M;  1P3N A;  1LZY A;  2Y0T A;  1L06 A;  2BQG A;  243L A;  2OOB A;  1C6I A;  4H8X A;  4DQ5 A;  4D81 A;  5JI2 E;  1PQO A;  1REZ A;  4AW4 A;  2LVA A;  4FCT A;  3C83 A;  1JSF A;  1YIK A;  4J1A A;  2L7H A;  1EIJ A;  4LYB A;  2OE7 X;  2ERC A;  2BQC A;  4HEO A;  4TX7 A;  5B05 A;  3DZD A;  4JI7 M;  258L A;  2ZYC A;  3K9O A;  4H9C A;  4GIT A;  227L A;  5LVG A;  161L A;  1TBY A;  3MGW A;  1D3N A;  1XGR C;  4HV2 A;  3WPJ A;  3D9A C;  3LVW A;  2QBY B;  1B7S A;  3SP3 A;  1E8L A;  1FBI X;  3J27 B;  4L8R C;  4LGY A;  3AGI A;  2G3Q A;  1IWY A;  4WLX A;  1KIR C;  1WGN A;  3SBA A;  4G6Z A;  4DV5 M;  4MST A;  3M0E A;  4AQY M;  1L71 A;  2Q9D A;  3J7B A;  1WTH A;  4ARQ B;  4H9H A;  4LFX A;  3W67 A;  3KS8 A;  5II3 A;  2HUK A;  1CJ8 A;  3THG A;  3JR4 A;  1DGB A;  1JIT A;  1TGU A;  4RF0 A;  5KQ8 A;  3T36 A;  2C9C A;  1GEZ A;  253L A;  3PFI A;  3SYL A;  1REY A;  3C7Z A;  5B59 A;  5B06 A;  1L61 A;  1IY0 A;  1L1Z A;  3RZE A;  5EJC A;  1C45 A;  3U6S A;  1N32 M;  4B3T M;  1HNZ M;  2J5Y A;  2Z4R A;  4C5F A;  4B3S M;  5FLX S;  3HJ8 A;  2OPF A;  2O4W A;  4ML7 A;  1L90 A;  4I7O A;  3HH3 A;  2DWZ B;  3DKE X;  2QCU A;  4I0C A;  1L26 A;  249L A;  4EOF A;  4DKL A;  1LZ6 A;  1YQV Y;  2IGC A;  2UUC M;  4CFP A;  4H9E A;  4DR5 M;  3QAK A;  3WUN A;  2CJL A;  1L23 A;  1TH4 A;  5F3W A;  2D4K A;  2M60 A;  4QDN A;  4CJ2 A;  2Y8P A;  3U6D A;  2JY7 A;  3TPZ A;  2HUM A;  1YLA A;  2LVP C;  4IJE A;  1L29 A;  1C65 A;  3ILK A;  2DXI A;  4MGZ E;  1C6G A;  4EKS A;  176L A;  4M9Z A;  4OW0 A;  4IAT A;  1HEQ A;  156L A;  1UC0 A;  1KS3 A;  2EQL A;  2N35 A;  4R7G A;  2LZ2 A;  1VDL A;  5LZM A;  1T8G A;  2KXE A;  4GN3 A;  205L A;  1L66 A;  5FST A;  1Y8G A;  1SXJ C;  1L01 A;  1JB0 F;  4EIW A;  256L A;  2XBR A;  146L A;  5K7O A;  4GLA A;  2LYM A;  1BB4 A;  5L9J A;  1UBZ A;  2XQO A;  3DN1 A;  4D9Z A;  4LJ4 A;  4CGY B;  5LYT A;  4LJ8 A;  4G4H A;  3CDO A;  1L17 A;  5FEK A;  1BB5 A;  107L A;  1L80 A;  2DI0 A;  2B70 A;  1FKQ A;  4PJ2 C;  217L A;  1CNS A;  3HY5 A;  4W94 A;  1CKF A;  1LZ5 A;  4OU7 A;  4OWC A;  1QT8 A;  3GLF A;  1LSP A;  1YAQ A;  1B5W A;  4LZT A;  1TR8 A;  1REX A;  4YF2 A;  4JV5 M;  3MMP A;  3PDS A;  3GP1 A;  1K3X A;  2HWJ A;  5LA8 A;  2M5Z A;  1F10 A;  2R4J A;  1GF0 A;  1IN6 A;  1ZV1 A;  2OE9 X;  2CV1 A;  3MK6 A;  174L A;  1LZA A;  5LIO A;  3HU8 A;  1LYS A;  2G4P A;  4NHP A;  2CUZ A;  1NHB A;  4EPF A;  4LF4 M;  1VDD A;  4AG6 A;  1LMT A;  1BWH A;  1LMO A;  240L A;  1GPQ C;  2JWS A;  1GE3 A;  1GF6 A;  2XTH A;  4BS7 A;  5DFL A;  3UMM A;  1G1V A;  2ZTD A;  4OVZ B;  3GPY A;  2QAR C;  3U5Z A;  1G7H C;  5HQ1 A;  3HU1 A;  2E5L M;  1I56 A;  4CFO A;  3WMK A;  2FBD A;  3A91 A;  2XF3 A;  1JTP L;  1I94 M;  1SXJ D;  3A6B Y;  3BXW A;  3CSZ A;  2YBI A;  2W1Y A;  3B72 A;  8LYZ A;  3OTO M;  2MRO B;  2QB0 B;  2IHL A;  4TSB A;  1C6N A;  5D5C A;  1CU5 A;  1J1X Y;  1GO5 A;  2KA6 B;  2KNZ A;  4X64 M;  3IWR A;  4LF6 M;  4LDL A;  5EP4 A;  1PQK A;  1XGU C;  4PPO A;  4NEB A;  4WO9 A;  4AKI A;  132L A;  5ITT A;  3GUP A;  1LSN A;  2FNA A;  1IOC A;  1GB9 A;  3FI5 A;  3C58 A;  4GKJ M;  3ATN A;  3GUN A;  2Q2E B;  1GBZ A;  5KXN A;  5KXO A;  4U3X B;  4NHQ A;  1SXJ E;  5A3E A;  3GLI E;  3W6F A;  212L A;  260L A;  1PJI A;  3DMZ A;  4PK0 A;  3VW7 A;  4QEQ A;  4S12 A;  3DMX A;  1N77 A;  1AIP C;  1QUD A;  1P36 A;  1GE4 A;  1SWZ A;  119L A;  4I7L A;  3KP1 E;  4I5S A;  4LRS A;  1HSW A;  2YQZ A;  2G4N A;  1L44 A;  1NNJ A;  3HDE A;  7LYZ A;  1IX0 A;  1UIG A;  2DQD Y;  5FTJ A;  251L A;  4EKR A;  1RI8 B;  2V1C A;  3HH5 A;  1VAU A;  2EKS C;  257L A;  3P66 A;  206L A;  2B6W A;  4BAD A;  3CDQ A;  3DN4 A;  1UIB A;  4NSG A;  1L56 A;  3LQR A;  1EQ5 A;  1NKH A;  4DUZ M;  2UXD M;  1L58 A;  1NMM A;  1NJG A;  4R3D A;  1JR3 A;  1JTO L;  2BQF A;  3T1Y M;  3A90 A;  5AMY A;  3HWS A;  3GLH B;  4GMQ A;  4LF5 M;  4LT3 A;  1LJI A;  1LYZ A;  4LCB A;  4OO9 A;  1G0J A;  3EMS A;  4WM2 A;  1IP3 A;  5LVJ A;  3TXI A;  1ZWN A;  1LZE A;  111L A;  4NGK A;  134L A;  2KEB A;  1PQI A;  4AXT A;  4GC9 A;  2F5Q A;  120L A;  3OE9 A;  2XEP A;  200L A;  4HTQ A;  3WHK A;  3HUQ A;  3LCV B;  2X4A A;  3V2Y A;  3TL4 X;  4WLY A;  1GEV A;  5C1B A;  1OUD A;  5FTK A;  5EBH A;  1CX7 A;  3HJQ A;  5F81 A;  2KRU A;  1LZG A;  4Z6Y A;  2DAK A;  5LMN M;  1UIE A;  4EXM A;  4NGI A;  4GBR B;  1AKI A;  1C61 A;  216L A;  2LBC A;  1H6M A;  5KY1 A;  222L A;  1JJ3 A;  2OTZ X;  4LYO A;  4G4B A;  3DA1 A;  3GXK A;  1QVR A;  1I6S A;  3C80 A;  3HBH A;  1T97 A;  3DOA A;  4GLV A;  3G3B B;  245L A;  4GH9 A;  3HGI A;  1P5C A;  5HMJ A;  2DZL A;  6LZM A;  2CDS A;  1C6M A;  4H93 A;  1IP7 A;  1EQE A;  4WLT A;  4MGI E;  1DYC A;  3DN0 A;  4NSR A;  1KIP C;  1TAY A;  1G0K A;  1LZR A;  3ULR A;  1P37 A;  2K6B A;  3BBZ A;  4DV3 M;  2XBS A;  3OJP A;  2AHM A;  2FH0 A;  4JI5 M;  4QGZ A;  1QT7 A;  2KW0 A;  3HKP A;  3K8Z A;  4FCW A;  4FCV A;  1GJS A;  1DXJ A;  177L A;  1LWK A;  3ZC7 B;  4LT2 A;  1L49 A;  2I6Z A;  2B7X A;  1P6Y A;  7CAT A;  3FAD A;  4W51 A;  1C6K A;  1GL7 A;  3FE0 A;  1FDL Y;  3K2R A;  3B0K A;  1NY6 A;  1QUS A;  246L A;  1WQN A;  4KLN A;  1C6T A;  3VDU A;  1DQJ C;  1X37 A;  2XZF A;  1SG9 A;  2W1X A;  4WLD A;  115L A;  4MCK A;  1IXS A;  1XSF A;  2F2N A;  1A5T A;  1QSA A;  175L A;  3C82 A;  3L2X A;  192L A;  1P7S A;  3KP0 E;  172L A;  4W58 A;  4PDG A;  4E97 A;  1TH2 A;  3H4J A;  1CV4 A;  2Z2F A;  4WM3 A;  3A94 A;  1QAM A;  3BOS A;  1PJT A;  1GF7 A;  2FOI C;  173L A;  4NRW A;  4I8O A;  3W68 A;  2ZWB A;  3TXF A;  3C3E A;  1L21 A;  3M3U A;  5I14 A;  1L19 A;  2OTY X;  3WPK A;  3KAM A;  3SAS A;  4ARM B;  2LYO A;  4I7R A;  1B7Q A;  1G06 A;  1DV0 A;  1L25 A;  2UXC M;  1JEF A;  4CIZ A;  1QT5 A;  1JKD A;  5M1Y A;  4FVM A;  4YEM A;  1NY5 A;  1L43 A;  1LMA A;  2UU9 M;  1L52 A;  2JY6 B;  151L A;  210L A;  4W96 A;  3WU9 A;  4LJ7 A;  1LSB A;  4NRV A;  2F5O A;  4BAP A;  1C69 A;  3HWL A;  3N9E A;  2YDG A;  4GHL A;  1LYD A;  1DGH B;  189L A;  3WU7 A;  1LJH A;  1DZB X;  3PXG A;  1H6U A;  1MN3 A;  1B7P A;  4JXJ A;  1GFR A;  3AOE C;  1QT4 A;  3FUV A;  5KPZ A;  2ZYP A;  2DQG Y;  4IBD A;  5DYG A;  4S0W A;  1HFZ A;  3IG8 A;  3OE6 A;  3Q8X A;  3FRH A;  2CHG A;  4E3U A;  1XHB A;  2Y20 A;  2ANV A;  4N0J A;  2YR0 A;  2GV0 A;  4NY5 A;  188L A;  2BQB A;  225L A;  2DVW B;  1LYO A;  3A3R X;  5DN4 A;  2ZNX Y;  4DD3 A;  3U61 A;  3TXG A;  5I4X A;  2ZTC A;  4BBA A;  1VQ1 A;  3QYB A;  2K0B X;  2UXB M;  4DR7 M;  2L2D A;  4HLQ A;  165L A;  1IM2 A;  3P4Z A;  1ZAE A;  2EKK A;  4G4Q A;  1ZYT A;  2D4J A;  4XAD A;  4LF8 M;  1TCY A;  1VDQ A;  4PD2 A;  3HBD A;  3QNG A;  3TXD A;  1GKI A;  127L A;  3FUT A;  2QSF X;  2K47 A;  1OUE A;  1RCM A;  4I7T A;  4LJ5 A;  3FYC A;  3LQQ A;  3U6O A;  1QUT A;  2ZNW Y;  3VFD A;  1LGX A;  1L22 A;  3HU2 A;  2KZS A;  1LMC A;  3H4M A;  1IWU A;  4I7J A;  3AGG G;  5KXZ A;  4G4O A;  2A7D A;  1CU2 A;  4IBI A;  2JXN A;  4LJA A;  3WH1 A;  232L A;  4IJ4 A;  1JQJ C;  3N9A A;  1IWZ A;  5JEN B;  1IN5 A;  138L A;  4OX9 M;  3TMU A;  4KPM A;  3WUM A;  4L15 A;  1CJ9 A;  2R4E A;  2B73 A;  2XJW A;  1FNN A;  4AQN A;  211L A;  2CWB A;  3HT8 A;  1XMO M;  3KFU G;  4B08 A;  4KHP M;  1CV5 A;  3Q8G A;  1RFP A;  1L96 A;  4I7P A;  3R9X B;  1C7P A;  3AFH A;  1D3M A;  1GFK A;  3FI7 A;  114L A;  1OUB A;  1LJG A;  4TTD A;  1PQJ A;  191L A;  1F0W A;  4O34 A;  2B74 A;  1IIZ A;  148L E;  3MHV C;  3U5Z B;  4NHT A;  2IFF Y;  4Y28 F;  4IBE A;  3P68 A;  4LZM A;  4LFP A;  2HEE A;  157L A;  4P16 A;  1L2D A;  2DWL A;  1LMQ A;  1C10 A;  3E3D A;  5A2Q S;  1XMQ M;  2WZJ A;  1W6Z A;  3WXT A;  2OU8 A;  1HEM A;  2LVN C;  2Z6B A;  1IOS A;  4DT3 A;  2FFJ A;  4DV4 M;  4XJH A;  4WO6 A;  3MJ5 A;  1TLA A;  1JHL A;  1L74 A;  1BHZ A;  3QWL A;  1L84 A;  1AZF A;  3I4V A;  1QTB A;  2F5S A;  2RH1 A;  4OWB A;  1SXJ B;  3FTF A;  2C8O A;  3GLI B;  2F4A A;  2LHM A;  1DO0 A;  4YM8 A;  1CV0 A;  2B6Z A;  2F30 A;  2ZIK A;  4LYT A;  3OK0 A;  3HZJ A;  1K82 A;  2BQD A;  2QNJ A;  1GB6 A;  2BNK A;  5LAF A;  1B0D A;  3T15 A;  2JY8 A;  1SSW A;  197L A;  113L A;  1E9S A;  4DV1 M;  1DYE A;  1L16 A;  1OYU A;  1V34 A;  2Z38 A;  4EJ4 A;  2RB1 X;  3W6A A;  3G3W A;  1NQI A;  4RDS A;  1DPW A;  3HU9 A;  1DYA A;  3AL0 C;  4F2L A;  1ZMV A;  2CV2 A;  1LJJ A;  5LVH A;  1INU A;  139L A;  1AT5 A;  141L A;  2ANX A;  1NHE A;  4NWE A;  3QE8 A;  2A7F A;  1E94 E;  3SB6 A;  1NVM A;  1YIL A;  3TXJ A;  5KQD A;  4W56 A;  1EL1 A;  4D82 A;  4M4O A;  1ZMU A;  2HCB A;  3AZ7 A;  2LXE A;  1L03 A;  3SAU A;  2C98 A;  1N4F A;  1YSY A;  4ET8 A;  1OAO C;  2YNM D;  1IWX A;  5L3H A;  4JI0 M;  1IR7 A;  3HT6 A;  4XJG A;  5EXS A;  1FKV A;  2QPA A;  1WJ7 A;  1L37 A;  1NF5 A;  3EO5 A;  2LYZ A;  4IBJ A;  4B4E A;  4LG2 A;  2VII A;  3ODU A;  5EXP A;  1C66 A;  4WG1 A;  4DR2 M;  3AGH A;  4I7Q A;  5C6I A;  2CFO A;  4XJI A;  1F6R A;  3GUM A;  1C6C A;  1GFJ A;  1XEK A;  185L A;  3T6P A;  2WSE F;  2HEA A;  4W55 A;  2W1M A;  1L27 A;  2VF8 A;  1G7J C;  2D7E A;  4ZFP A;  2B5Z A;  3TE6 A;  3AB6 A;  1T8F A;  1GWD A;  4PHI A;  2VQF M;  3FTE A;  3U60 A;  1YAM A;  1GE1 A;  1KFV A;  1L38 A;  2DHY A;  1GB7 A;  5C6L A;  4GHA A;  2BQI A;  1IXZ A;  1QSB A;  2H5X A;  1SWY A;  1IQP A;  150L A;  3PVS A;  2DQH Y;  1D0K A;  3B9P A;  2DAE A;  4YX7 C;  1RU3 A;  3LW5 F;  1P56 A;  3W3E A;  1LZD A;  3LCU A;  1N33 M;  1LSC A;  4QHS A;  4MH0 E;  1QT6 A;  1LSF A;  5FEL A;  3U6Q A;  2LZM A;  3HBE X;  2H1R A;  4PDI A;  1LJF A;  2HUL A;  1BVS A;  1V92 A;  2BLX A;  3NYA A;  4AG5 A;  1HQY E;  3C3D A;  4L6V 6;  4HV1 A;  3IJU A;  1G0G A;  4B7F A;  3AZ5 A;  1NDM C;  2XLJ A;  1QQW A;  1B5X A;  1MLC E;  1T6O A;  180L A;  3TWL A;  3I51 A;  1L68 A;  1LJ4 A;  1OVH A;  1L12 A;  3HDF A;  4IAS A;  1Z5C A;  3IHP A;  3EXD A;  2JA2 A;  1IY1 A;  209L A;  2D91 A;  1WTN A;  236L A;  1F6S A;  1IN4 A;  4W54 A;  1SLY A;  1ALC A;  5KPT A;  160L A;  2UUB M;  4MM3 B;  2L78 A;  3SBB C;  1JJ1 A;  1L64 A;  1L92 A;  3F8V A;  1IR9 A;  4HSF A;  1LWG A;  1OJL A;  1EQ4 A;  1G4A E;  3D8L A;  142L A;  3I04 M;  1L2B A;  3KSJ A;  2BQA A;  2DQC Y;  2OEA X;  4IBC A;  1UM8 A;  1PJQ A;  4ZPU A;  1GB8 A;  152L A;  2G5G X;  3D8B A;  234L A;  2YBH A;  2YBJ A;  2HKJ A;  4FW9 A;  3HTD A;  3B7N A;  3GLF E;  1QUH A;  1IOQ A;  1SX7 A;  1OUG A;  3DFZ A;  1Z6T A;  1L45 A;  2JZ1 A;  1L85 A;  4L78 A;  1HEP A;  1OV5 A;  2BPU A;  1C6B A;  3FUU A;  3WVX A;  3I01 M;  1VEJ A;  5DL9 A;  3W6E A;  3E21 A;  3EBA B;  1GFH A;  4NGY A;  3NY8 A;  3DN3 A;  4AZF A;  1OFH A;  2WSF F;  4LGK A;  109L A;  5I4W A;  1HJP A;  3CB7 A;  214L A;  2HU3 A;  4DDC A;  4NSH A;  4DJH A;  4ETA A;  5ILC A;  4B7G A;  7LZM A;  2LHG A;  1IC5 Y;  5F9U A;  3UZU A;  2XSZ A;  3A93 A;  1UUZ C;  4HJZ A;  1LJE A;  1E32 A;  2DAG A;  1GBO A;  3FUW A;  2CEA A;  1JKB A;  2FE8 A;  4W53 A;  1QTH A;  4WM4 A;  1RE2 A;  4PRU A;  4AKG A;  238L A;  4ZEE A;  187L A;  3HTG A;  2HEC A;  3LZM A;  1IVM A;  4J1B A;  1KNI A;  4LGM A;  3SN6 R;  4QOS A;  4DV6 M;  1L99 A;  4REZ A;  1L54 A;  1XEJ A;  5DM9 A;  1C68 A;  1C6E A;  1OUC A;  4M0D A;  2DQJ Y;  1VDS A;  1L42 A;  1XNR M;  3EML A;  2F5N A;  5KXR A;  2ZBK B;  4GCE A;  5FTN A;  2EKF A;  1LLH A;  1W08 A;  4Z3M A;  3RZ4 A;  1SSY A;  3F92 A;  1NJF A;  1HNX M;  1IP1 A;  3AW7 A;  1LGU A;  3BKH A;  2W1L A;  4W57 A;  1YAN A;  3RFW A;  3HFM Y;  108L A;  2D7G A;  5APC A;  166L A;  1ZVH L;  3PNY A;  5LMU M;  3ZVQ A;  2CV0 A;  1HC0 A;  1D9U A;  3HJS A;  1L59 A;  168L A;  1L82 A;  4DD7 A;  2J7N A;  3DN6 A;  3SAR A;  3QY4 A;  3J2P B;  5E6J A;  3U6E A;  1HEO A;  3AZ6 A;  3UON A;  1CVK A;  1C60 A;  1ZV5 L;  1OTR A;  2MH8 A;  1NBY C;  1KY1 A;  1G41 A;  2JNH A;  2HTX A;  1LHL A;  3VKG A;  3K2L A;  2H5Z A;  4PJZ A;  1V33 A;  5DNY A;  4FD2 A;  1L87 A;  1L60 A;  4HL4 A;  1JR3 D;  1QYR A;  4EPI A;  1B7O A;  1PM5 A;  2BWE A;  3FTD A;  1C6L A;  3AV0 A;  1NWG A;  5HNC A;  1L91 A;  3C9P A;  1NHW C;  1GBS A;  1QUG A;  1JWR A;  1QAN A;  3W6B A;  3T6U A;  1JKC A;  1FLQ A;  261L A;  2Z8Y M;  2Z4S A;  5D5F A;  4GN4 A;  5F9X A;  1QDT A;  1B5Z A;  3V2W A;  3NBX X;  1B5U A;  1GAZ A;  3RU5 A;  1XXH A;  4XGI A;  2R18 A;  1JIS A;  4L16 A;  3VLF B;  3ZH9 B;  3ZQJ A;  1TDH A;  1R2Z A;  2XGN A;  4ANR A;  4ZIX A;  4LJ9 A;  5B1G A;  1L93 A;  2YBM A;  5I54 A;  1BQL Y;  2ZAM A;  3G3V A;  1G7L C;  1L97 A;  4X65 M;  4ARQ A;  3GRY A;  1JR3 E;  1LSY A;  4NGW A;  1CJ6 A;  6LYT A;  2LNH C;  1XXH E;  2BQN A;  4H94 A;  1HT1 E;  1SX2 A;  235L A;  2I26 L;  3CQL A;  1L77 A;  1GF4 A;  1WIV A;  3UJN A;  1C46 A;  5EP3 A;  3TMW A;  2HUB A;  3WYH A;  4N9R A;  1PZY A;  1WVV A;  4LRT A;  1NBZ C;  2I7N A;  1ZMY L;  4XN6 A;  1WQM A;  3DN2 A;  1N75 A;  1E9R A;  3L29 A;  1IO5 A;  1KW5 A;  4B3R M;  3LYZ A;  5KXS A;  3A96 A;  1IBL M;  2NTG A;  3FD9 A;  1CKD A;  3GLG B;  4KL7 A;  2RKO A;  1L48 A;  3P64 A;  3FRI A;  3KSX A;  3JR6 A;  3A3Q A;  3LZT A;  2YFQ A;  2RB2 X;  1L30 A;  2MEG A;  2JY5 A;  1WR1 B;  3NY9 A;  1LHI A;  1VEK A;  3C7Y A;  3GUI A;  4DYG A;  5KPR A;  2VB1 A;  3SAW A;  2QP9 X;  1GBW A;  1LSA A;  4JI2 M;  1LSD A;  1YKY X;  2MEC A;  1LHM A;  2EJS A;  5J7C A;  1VFB C;  3K9P A;  3KXE C;  2EUC A;  1D2N A;  4D80 A;  4H8Z A;  1OUF A;  4OOT A;  1LSG A;  5EXT A;  2DWN A;  4JYA M;  3IEC A;  2LCB A;  2R62 A;  2DEN A;  1LV7 A;  2R46 A;  2MED A;  2MGW A;  2XFS A;  199L A;  1R7R A;  1C67 A;  2F47 A;  4R6C A;  1C6A A;  1GBY A;  5LA5 A;  2MR9 A;  1L10 A;  3M6A A;  1GD6 A;  4H9A A;  3TMX A;  2FYC A;  3LN2 A;  4GC5 A;  1IP5 A;  4YHH M;  5KXW A;  1CUK A;  1C43 A;  182L A;  1HEN A;  4WM1 A;  1WQP A;  4JN6 A;  1LZT A;  4XJF A;  1L18 A;  3G3X A;  1CV3 A;  1B7L A;  5I53 A;  4HTK A;  4GRI A;  3JR5 A;  4LZZ A;  2AUB A;  2L09 A;  2J7O A;  4G4C A;  5KJ9 A;  2DWM A;  1L09 A;  1L57 A;  1LYE A;  3RNX A;  1ZVY B;  4NGZ A;  128L A;  1L15 A;  1DYD A;  1NO1 A;  104L A;  1UIC A;  3SHG B;  3GO8 A;  1L32 A;  4RF1 A;  1IN7 A;  2RBQ A;  4MB7 A;  1C1K A;  1HFY A;  1NHG C;  2MEF A;  5IWA M;  1GB3 A;  1C6Q A;  4LFA M;  3HT9 A;  3RGS A;  1O23 A;  4MGK E;  1WQR A;  4IJF A;  4RKU F;  1L20 A;  3L64 A;  2MJ5 B;  1T6V L;  2DQE Y;  3ATO A;  2H9J A;  1OP9 B;  4JI8 M;  4F1I A;  1G0Q A;  3WXU A;  1J09 A;  1IBM M;  4DD9 A;  3VKH A;  3CT5 A;  1LKR A;  3LYO A;  4BB9 A;  3W6C A;  5B07 A;  4B49 A;  1D9W A;  1CUP A;  4LYC A;  3A67 Y;  1K28 A;  4OVZ A;  1LMP A;  1JSE A;  4R71 A;  2RAY X;  2V1U A;  1BGI A;  4H92 A;  4JI1 M;  4UN2 B;  3A92 A;  3G3A B;  233L A;  1LAA A;  1T6H A;  4HJY A;  4C3W A;  1RJC B;  1QTC A;  3HHZ A;  4NHI A;  4M0W A;  3HHY A;  1AM7 A;  1L53 A;  3VK7 A;  1D2Y A;  1L46 A;  5F14 A;  242L A;  3OE8 A;  3GUJ A;  3M18 B;  1ZMW A;  1OIP A;  1YUB A;  4RW1 A;  1REM A;  2ZQ4 A;  3DNA A;  5I4Y A;  3KS4 A;  2DBT A;  3P65 A;  163L A;  2DHR A;  2O01 F;  3TMV A;  2C8P A;  4PCZ A;  5B1F A;  1IY2 A;  194L A;  1XNQ M;  2YBN A;  4ETB A;  4TSC A;  5C6J A;  4MR1 A;  2DAI A;  1UIF A;  5FCP A;  5E9R A;  4XBO A;  167L A;  1D2W A;  1T8A A;  4OWE A;  3WW5 A;  1L89 A;  2RAZ X;  4R0F A;  4LFB M;  1HER A;  1D0M A;  5F16 A;  3U6M A;  143L A;  1GFA A;  3ZCB B;  1L72 A;  4W5W A;  4HPE A;  3GLF B;  4YXA C;  1UIH A;  4DR6 M;  1R5L A;  2FYD A;  3L26 A;  2DAM A;  5GKN A;  183L A;  4YOP A;  4H8Y A;  3T1H M;  4ITQ A;  4L41 A;  5KXK A;  4UWN A;  3KW6 A;  2XZU A;  4IBG A;  1DO2 A;  3FE3 A;  1GB0 A;  3AYQ A;  1GVN A;  3OE0 A;  1OQY A;  3HH6 A;  2VF7 A;  193L A;  3TQS A;  5EP1 A;  4OOO A;  4OWH A;  1L0K A;  4LT0 A;  2HED A;  3SAV A;  129L A;  1LPI A;  1QDR A;  2QZ4 A;  5IZ7 D;  186L A;  1QUO A;  1PJJ A;  3KOZ E;  1B7R A;  1LHH A;  4DC4 A;  2R6F A;  4KT0 F;  1C63 A;  2Q0M X;  4X66 M;  1V7S A;  3J4G A;  3K3T A;  4NIJ A;  5APF A;  2Z19 A;  3PNV A;  158L A;  3UK6 A;  4UWV A;  3VWO A;  1Q39 A;  1L62 A;  3LYT A;  1G0P A;  1OWY A;  3F9L A;  1QQY A;  223L A;  1LYI A;  3HH4 A;  2RBN A;  4HJV A;  1L05 A;  4RNA A;  5FDJ A;  1J1P Y;  4M9X A;  4NFV A;  1LI3 A;  5IEL A;  5KXL A;  1GB2 A;  1YKZ X;  3J81 S;  1L51 A;  1PQD A;  2EO2 A;  5FSW A;  4I4L A;  2FS1 A;  1FLY A;  1VED A;  255L A;  1N34 M;  1YE9 A;  4Z98 A;  1G7M C;  2BJW A;  3FKE A;  5KXP A;  1IWW A;  213L A;  2BQK A;  2F32 A;  1GLN A;  1UA6 Y;  1WQO A;  2Z7J A;  1G1W A;  1XGT C;  3HUA A;  1G3I A;  3CDT A;  3TXE A;  4FWD A;  2QQ8 A;  1N78 A;  5ITX A;  2L4E A;  4NL4 H;  3A45 A;  4QNM A;  1MX0 A;  1KY0 A;  2DQA A;  4JI4 M;  1SQ2 L;  1LHK A;  3GUL A;  4PRQ A;  1IP4 A;  1G7I C;  3GXR A;  1A4V A;  4NGJ A;  4LZJ A;  4DV7 M;  4IBB A;  4ARP A;  2KRK A;  1XC8 A;  3CDV A;  3FA0 A;  1LSZ A;  1Z55 A;  1IBK M;  2R65 A;  1GFT A;  2R45 A;  1L41 A;  1LSE A;  4H9I A;  1P64 A;  4B4J A;  3JAM S;  4KXI A;  3KVW A;  2BAA A;  1QTE A;  1YAP A;  3SB9 A;  4K0K M;  1L8Q A;  1GE0 A;  149L A;  4DUY M;  4FWH A;  3SMP A;  1KXX A;  3EIE A;  2V6Z M;  5EP2 A;  171L A;  2BQL A;  2NTH A;  4WL6 A;  2B75 A;  1LW9 A;  4NXN M;  3SBJ A;  3WUA A;  259L A;  247L A;  5BPV A;  1LOZ A;  1JJ0 A;  228L A;  2CUU A;  3VK8 A;  3SB5 A;  4M9S A;  4KOD A;  1VAT A;  1EFU B;  1QSQ A;  3V76 A;  3HT7 A;  1R4G A;  3GQ5 A;  4G3O A;  2F4V M;  1VEG A;  3J7A S;  4M6D A;  4AGA A;  1BVK C;  5EXX A;  102L A;  1BB3 A;  2CHQ A;  1XXH B;  4OWA A;  2D7H A;  1UFZ A;  4GCD A;  1TEW A;  3U6P A;  1IP2 A;  1HMK A;  2H9K A;  1WXQ A;  3VDP A;  5IRE B;  2RBO A;  4PGJ B;  1FJG M;  2C99 A;  2LH0 A;  3GPU A;  1BVX A;  3W0F A;  1MJG M;  1GF5 A;  2VDB B;  3B74 A;  5FTM A;  4ARM A;  5JI3 E;  1EE8 A;  3E4R A;  2O25 A;  3CT0 A;  2Z18 A;  3GUK A;  3CT1 A;  1IEE A;  3B6L A;  2VQE M;  3FUX A;  4IBF A;  1C6F A;  2DZO B;  162L A;  4EKQ A;  2LVQ D;  4B7H A;  1P2L A;  1QS9 A;  4WP2 A;  208L A;  4NSI A;  1KYI A;  3WW6 A;  1HSX A;  4P2E A;  2CHV A;  2NQ8 C;  1HQC A;  1L63 A;  1A2Y C;  3M7G A;  144L A;  1WHC A;  1JTT L;  1DGH A;  3KDS E;  4DD0 A;  4H1P A;  3W0L B;  1OFI A;  1LI2 A;  215L A;  1LJ3 A;  4LDE A;  2MEA A;  231L A;  4NSJ A;  1LMN A;  2RGO A;  3B89 A;  1L95 A;  3AKZ A;  1TF0 B;  1P2R A;  1QTK A;  4CIS A;  1C64 A;  1WGL A;  5BR8 M;  1YKX X;  3E46 A;  4X62 M;  5ITQ A;  1IR8 A;  4JI3 M;  4NGV A;  169L A;  1C6D A;  1FN5 A;  8CAT A;  1L0J A;  2BJV A;  1VDT A;  2APL A;  2R0I A;  1NV9 A;  1YL1 X;  1IC7 Y;  1OQM A;  3GPP A;  1L2C A;  1L70 A;  2DKL A;  4DAJ A;  4WW0 A;  1DGG A;  1KXY A;  1D0L A;  4DD2 A;  5APE A;  1LZ4 A;  1LYG A;  3FYD A;  4DR3 M;  1B7M A;  3F6Z A;  2XFT A;  1GFU A;  3IG5 A;  4G9S A;  3B0I A;  1P2C C;  1CUQ A;  4NG8 A;  5EQT A;  3D4S A;  1JQU A;  1DPX A;  1BWI A;  1KXW A;  1IXS B;  2XSZ D;  3CTW B;  1DI4 A;  155L A;  1G07 A;  1ZUR A;  3SHF A;  5KXY A;  1G71 A;  2ZM6 M;  1T43 A;  159L A;  5LVI A;  2DQI Y;  3KOW E;  1IP6 A;  4IAP A;  4H9F A;  1P3Q Q;  1LZB A;  4IIW A;  1HT2 E;  201L A;  2L4F A;  4IBK A;  1MU5 A;  3UGJ A;  252L A;  1L65 A;  4TWS A;  2A4T A;  1B5Y A;  1L04 A;  1Q02 A;  2MEH A;  2MEE A;  1LYY A;  2D4I A;  130L A;  1J7K A;  5ILF A;  1L11 A;  2RBS A;  1G0L A;  126L A;  1LSM A;  2R44 A;  2ZAO A;  1QTV A;  4NSO B;  3U6C A;  2HHH M;  154L A;  1QAQ A;  1DGF A;  3CF0 A;  3AZ4 A;  1IOR A;  4G4R A;  1JIY A;  1LPY A;  198L A;  2BWB A;  4WL7 A;  3FTC A;  3A98 B;  2F5P A;  1F4I A;  1TTE A;  1NV8 A;  4FWG A;  181L A;  4NHS A;  2LHC A;  3WPL A;  2NWD X;  122L A;  2KNV A;  2LVO C;  1L50 A;  1L08 A;  3TWM A;  2Z3X A;  1W5T A;  2D6B A;  4YXC A;  1BB6 A;  2PC2 A;  1IWT A;  1HF4 A;  1NSF A;  2JZ0 A;  2Z2E A;  4GKK M;  4XJD A;  3TXK A;  3C8Q A;  1LZ1 A;  2O7A A;  2X0A A;  3A6C Y;  2CGI A;  3DMV A;  4QNR A;  4H90 A;  3J6K A;  5IDD A;  1C6H A;  2C5R A;  1SXJ A;  2GNO A;  3GLI A;  1L07 A;  4DQ7 A;  4ET9 A;  4B1A A;  2L6O A;  1IN8 A;  2OQ4 A;  3I4Y A;  1IC4 Y;  1XGP C;  1CU6 A;  4J7V A;  3U61 B;  1L67 A;  1PGY A;  4HPI A;  4GN5 C;  4N5R A;  5H37 D;  2O5R A;  4AI6 A;  5DN5 A;  2Q9E A;  1T3P A;  1N36 M;  2C96 A;  1ZQ9 A;  2CE7 A;  3HX3 A;  224L A;  4ARL A;  4DR1 M;  5KKI A;  1B2K A;  2OOA A;  2DKV A;  4RLN A;  1KW7 A;  2JUJ A;  1GXV 2;  4AKH A;  4DDB A;  5KXX A;  133L A;  3LMM A;  1C6P A;  3CF6 E;  2OE4 X;  219L A;  2BQJ A;  2F4G A;  4LY6 A;  3J80 S;  103L A;  1YRO A;  1HNL A;  1H87 A;  1P46 A;  3D3D A;  4KO8 A;  4B3M M;  5LYM A;  1Z59 A;  1L55 A;  1L28 A;  1DI3 A;  3E9S A;  3GQ3 A;  230L A;  1LJN A;  4WUR A;  2QBY A;  1KSF X;  4Z46 A;  2WAR A;  2LWX A;  1QTD A;  1XEP A;  190L A;  3C8R A;  4YY3 M;  244L A;  5KXT A;  4N1E I;  3LVV A;  4WOA A;  4TUW A;  2BLY A;  5ITY A;  1HFX A;  1L79 A;  1LZC A;  2CWI A;  1HHL A;  1CKC A;  1T3T A;  3WHL A;  1PS5 A;  3GPX A;  110L A;  1L47 A;  3LYM A;  1VDP A;  4UWU A;  1L86 A;  1QS5 A;  1Q3C A;  3AJN A;  2HL7 A;  5DYI A;  1UID A;  4RLM A;  3B7Q A;  2YBL A;  2K9D A;  1KIQ C;  5L3I A;  1GDW A;  3BKV A;  1GJT A;  1IOT A;  5DLA A;  1OAI A;  3HUK A;  4XYY A;  1GL6 A;  2ZAN A;  4FJR A;  4QHT A;  1QSW A;  4H91 A;  9LYZ A;  3GQ4 A;  4DD1 A;  3A95 A;  4A7D A;  4EKP A;  3HTF A;  4NGL A;  4WM6 A;  1L88 A;  4ETD A;  178L A;  3WVY A;  3AJI B;  3HTB A;  1QAO A;  221L A;  3LZ2 A;  2X49 A;  145L A;  1CJ7 A;  1L33 A;  3SB8 A;  3CSQ A;  1BWJ A;  3B0O A;  4N1C C;  5KKJ A;  1Q3B A;  2I7P A;  1NNU C;  1CKH A;  1XB2 B;  1WVU A;  1R6B X;  2RBR A;  4YEN A;  164L A;  5E4P A;  3RGP A;  3HHX A;  3T38 A;  1EPY A;  1OVK A;  1TH3 A;  4PT5 A;  5A3Z A;  2WSC F;  4ZPX A;  1TDZ A;  2LZT A;  4L4U A;  1L36 A;  2B6X A;  5L8R F;  2KDL A;  4XJB A;  3QYE A;  1JTN A;  4N8Z A;  1S3S A;  1HR0 M;  4RW2 A;  4K5Y A;  4DWX A;  1GBX A;  3CDR A;  1UIA A;  1UAC Y;  1LCN A;  1L14 A;  2HEF A;  4DBG B;  147L A;  2DQF C;  4EMN A;  1PQM A;  1GF9 A;  5HMV A;  1YAO A;  3WL2 A;  2BQE A;  1Z5A A;  2I25 L;  1DI5 A;  1OIZ A;  1OUH A;  2LC9 A;  5I5Q A;  3RUN A;  1QIO A;  4LYM A;  1VG5 A;  1D3J A;  4CHX A;  4NC6 A;  1GXX A;  4GRV A;  3GUO A;  2KZU A;  2N5Z A;  3L28 A;  196L A;  1UCO A;  5LIN A;  140L A;  2CRU A;  1K3W A;  4DR4 M;  3A8Z A;  4Q7J A;  4CJ6 A;  3C8S A;  3CGW A;  1QZE A;  1L00 A;  2HU1 A;  218L A;  1J1O Y;  2OO9 A;  1L24 A;  1L98 A;  1OWZ A;  2BQM A;  2HEB A;  4I7K A;  4Z41 A;  3RE8 A;  3SB7 A;  4LFC M;  250L A;  4W59 A;  2B6T A;  5KXM A;  1C08 C;  1D6Q A;  1IFY A;  4BLC A;  2C9O A;  4DDA A;  3RW8 A;  5KO3 A;  1L81 A;  2P5T A;  3DN8 A;  3EIH A;  1GAY A;  5ITU A;  3HU3 A;  3AW6 A;  5C18 A;  1DKK A;  1L73 A;  4NGO A;  241L A;  137L A;  1V7T A;  3C81 A;  2XH9 A;  1L40 A;  2QEN A;  3A42 A;  1GFG A;  4LDO A;  1WQQ A;  1R2Y A;  2Z37 A;  4B4I A;  3SC3 A;  2ZIJ A;  4HP0 A;  1LJK A;  1B5V A;  1HEL A;  4GCB A;  3GRV A;  3TWK A;  6LYZ A;  4GCC A;  5FHW A;  1L31 A;  3SYK A;  4GIP A;  5FTL A;  4NXM M;  3PBL A;  3GRU A;  2GQF A;  153L A;  1LTM A;  1LYF A;  4LT1 A;  1CTW A;  3U60 B;  2EIZ C;  5IHG A;  1CU0 A;  1XGQ C;  5IT9 S;  1L35 A;  1C7Y A;  3CF2 A;  4QOZ C;  1AUA A; 
#chains in the Genus database with same CATH homology
 1L69 A;  4W52 A;  262L A;  1LYH A;  2OU0 X;  2Z12 A;  1L02 A;  1LGW A;  1XEI A;  237L A;  1LKS A;  1CU3 A;  1I20 A;  1IY3 A;  1IY4 A;  1TDY A;  123L A;  2OU9 A;  1CV6 A;  4OW1 A;  1OVJ A;  4KT3 A;  1L13 A;  5LAG A;  2MEB A;  3WUL A;  1FLU A;  2FBB A;  1CX6 A;  1XJT A;  4HTN A;  4XEN A;  1QT3 A;  3ZEK A;  1CKG A;  3WU8 A;  4NWH A;  2RSC A;  1I1Z A;  1L34 A;  1DYF A;  2BQO A;  2F2Q A;  3N9C A;  4II8 A;  1YL0 X;  118L A;  5APD A;  4J0L A;  220L A;  2ZIL A;  3C7W A;  226L A;  2EPE A;  1BB7 A;  1FLW A;  4NG1 A;  2Z39 A;  170L A;  3RT5 X;  4YEO A;  1JKA A;  184L A;  1XFP L;  1L75 A;  207L A;  4WM5 A;  4FDY A;  4WMG A;  2RBP A;  2O79 A;  3A34 A;  2B6Y A;  3TXH A;  1L94 A;  1GF3 A;  4GCF A;  4TUN A;  4I8S A;  131L A;  4QY9 A;  5LXW A;  4G49 A;  248L A;  1GFE A;  4CGE A;  1GF8 A;  4BAF A;  1L39 A;  1LZ8 A;  4ARJ A;  4H9B A;  112L A;  1LZ9 A;  1WTM A;  1DYG A;  1LHJ A;  5T3F A;  1XJU A;  1LZS A;  1L83 A;  2YSS C;  1B6I A;  1OUA A;  195L A;  1QTZ A;  4B0D A;  125L A;  1NDG C;  2YVB A;  1C62 A;  5LYZ A;  3TXB A;  3W6D A;  4ETE A;  5HLL A;  2B72 A;  1D6P A;  1DYB A;  1DKJ A;  1GFV A;  1CV1 A;  1GDX A;  239L A;  5HNL A;  4ETC A;  4X3B A;  1LYJ A;  2BQH A;  1OUJ A;  1G0M A;  3LHM A;  4I7N A;  1JPO A;  1GHL A;  1IWV A;  1D3F A;  1GE2 A;  254L A;  1L76 A;  1JTM A;  4DQJ A;  1JUG A;  2ZQ3 A;  1AT6 A;  1B9O A;  1HML A;  2RB0 X;  2MEI A;  4WG7 A;  2G4Q A;  4I7M A;  3ZVQ B;  3CSR A;  229L A;  135L A;  1LZN A;  1C6J A;  1OV7 A;  4I7S A;  4LYZ A;  1GB5 A;  1HEW A;  3IJV A;  1OUI A;  1LI6 A;  1B7N A;  5LVK A;  1MEL L;  1P3N A;  1LZY A;  1L06 A;  2BQG A;  243L A;  1C6I A;  4H8X A;  4DQ5 A;  1PQO A;  1REZ A;  3C83 A;  1JSF A;  1YIK A;  4J1A A;  4LYB A;  2OE7 X;  2BQC A;  5B05 A;  4TX7 A;  2ZYC A;  258L A;  4H9C A;  227L A;  5LVG A;  161L A;  1TBY A;  3MGW A;  1D3N A;  1XGR C;  4HV2 A;  3WPJ A;  3D9A C;  1B7S A;  3SP3 A;  1E8L A;  1FBI X;  3AGI A;  1IWY A;  4WLX A;  1KIR C;  3SBA A;  4MST A;  1L71 A;  2Q9D A;  1WTH A;  4ARQ B;  4H9H A;  4LFX A;  5II3 A;  2HUK A;  1CJ8 A;  1JIT A;  3T36 A;  1GEZ A;  253L A;  1REY A;  3C7Z A;  5B59 A;  5B06 A;  1L61 A;  3RZE A;  1C45 A;  4C5F A;  2O4W A;  4ML7 A;  1L90 A;  4I7O A;  3HH3 A;  3DKE X;  4I0C A;  1L26 A;  249L A;  4EOF A;  4DKL A;  1LZ6 A;  1YQV Y;  2IGC A;  4CFP A;  4H9E A;  3QAK A;  3WUN A;  2CJL A;  1L23 A;  2D4K A;  4QDN A;  4CJ2 A;  2Y8P A;  2HUM A;  1L29 A;  1C65 A;  1C6G A;  4EKS A;  176L A;  4IAT A;  1HEQ A;  156L A;  1UC0 A;  1KS3 A;  2EQL A;  2LZ2 A;  5LZM A;  1T8G A;  4GN3 A;  205L A;  1L66 A;  5FST A;  1L01 A;  256L A;  2XBR A;  146L A;  5K7O A;  4GLA A;  2LYM A;  1BB4 A;  5L9J A;  1UBZ A;  2XQO A;  3DN1 A;  4D9Z A;  5LYT A;  4G4H A;  3CDO A;  1L17 A;  5FEK A;  1BB5 A;  107L A;  1L80 A;  2B70 A;  1FKQ A;  4PJ2 C;  217L A;  1CNS A;  4W94 A;  1CKF A;  1LZ5 A;  4OWC A;  1QT8 A;  1LSP A;  1YAQ A;  1B5W A;  4LZT A;  1REX A;  4YF2 A;  3PDS A;  5LA8 A;  1F10 A;  1GF0 A;  2OE9 X;  174L A;  1LZA A;  5LIO A;  3HU8 A;  1LYS A;  2G4P A;  4NHP A;  4EPF A;  1NHB A;  1LMT A;  1BWH A;  1LMO A;  240L A;  1GPQ C;  1GE3 A;  1GF6 A;  2XTH A;  4BS7 A;  1G1V A;  2QAR C;  1G7H C;  5HQ1 A;  1I56 A;  4CFO A;  3WMK A;  2FBD A;  3A91 A;  1JTP L;  3A6B Y;  3CSZ A;  2YBI A;  2W1Y A;  3B72 A;  8LYZ A;  2QB0 B;  2IHL A;  4TSB A;  1C6N A;  5D5C A;  1CU5 A;  1J1X Y;  3IWR A;  4LDL A;  1PQK A;  1XGU C;  4PPO A;  4NEB A;  4WO9 A;  132L A;  3GUP A;  1LSN A;  1IOC A;  1GB9 A;  3FI5 A;  3ATN A;  3GUN A;  1GBZ A;  5KXN A;  5KXO A;  4U3X B;  4NHQ A;  5A3E A;  3W6F A;  212L A;  260L A;  3DMZ A;  3VW7 A;  4PK0 A;  4QEQ A;  3DMX A;  1QUD A;  1P36 A;  1GE4 A;  1SWZ A;  119L A;  4I7L A;  1HSW A;  2G4N A;  1L44 A;  3HDE A;  7LYZ A;  1IX0 A;  1UIG A;  2DQD Y;  251L A;  4EKR A;  1RI8 B;  3HH5 A;  1VAU A;  2EKS C;  257L A;  3P66 A;  206L A;  2B6W A;  4BAD A;  3CDQ A;  3DN4 A;  1UIB A;  4NSG A;  1L56 A;  1EQ5 A;  1NKH A;  1NMM A;  1L58 A;  1JTO L;  2BQF A;  3A90 A;  5AMY A;  4LT3 A;  1LJI A;  1LYZ A;  4OO9 A;  1G0J A;  3EMS A;  4WM2 A;  1IP3 A;  5LVJ A;  3TXI A;  1ZWN A;  1LZE A;  111L A;  4NGK A;  134L A;  1PQI A;  4AXT A;  120L A;  3OE9 A;  200L A;  4HTQ A;  3HUQ A;  3V2Y A;  4WLY A;  1GEV A;  1OUD A;  5EBH A;  1CX7 A;  5F81 A;  1LZG A;  1UIE A;  4EXM A;  4NGI A;  4GBR B;  1AKI A;  1C61 A;  216L A;  1H6M A;  5KY1 A;  222L A;  1JJ3 A;  2OTZ X;  4LYO A;  4G4B A;  3GXK A;  1I6S A;  3C80 A;  3HBH A;  1T97 A;  4GLV A;  3G3B B;  245L A;  1P5C A;  5HMJ A;  6LZM A;  2CDS A;  1C6M A;  4H93 A;  1IP7 A;  1EQE A;  4WLT A;  3DN0 A;  1DYC A;  1KIP C;  1TAY A;  1G0K A;  1LZR A;  3ULR A;  1P37 A;  2XBS A;  3OJP A;  4QGZ A;  1QT7 A;  1DXJ A;  177L A;  1LWK A;  4LT2 A;  1L49 A;  2I6Z A;  2B7X A;  1P6Y A;  3FAD A;  4W51 A;  1C6K A;  3FE0 A;  1FDL Y;  3K2R A;  3B0K A;  1QUS A;  246L A;  1WQN A;  1C6T A;  1DQJ C;  2W1X A;  4WLD A;  115L A;  4MCK A;  1XSF A;  2F2N A;  1QSA A;  175L A;  3C82 A;  3L2X A;  192L A;  1P7S A;  172L A;  4W58 A;  4E97 A;  4WM3 A;  1CV4 A;  2Z2F A;  3A94 A;  1GF7 A;  173L A;  3TXF A;  2ZWB A;  5I14 A;  3M3U A;  1L21 A;  1L19 A;  2OTY X;  3WPK A;  3KAM A;  4ARM B;  2LYO A;  4I7R A;  1B7Q A;  1G06 A;  1L25 A;  1JEF A;  1QT5 A;  1JKD A;  5M1Y A;  4YEM A;  1L43 A;  1LMA A;  1L52 A;  151L A;  210L A;  4W96 A;  3WU9 A;  1LSB A;  4BAP A;  1C69 A;  3HWL A;  3N9E A;  2YDG A;  1LYD A;  189L A;  3WU7 A;  1LJH A;  1DZB X;  1B7P A;  1GFR A;  1QT4 A;  2ZYP A;  2DQG Y;  4S0W A;  1HFZ A;  3OE6 A;  4E3U A;  2ANV A;  4N0J A;  2GV0 A;  4NY5 A;  188L A;  2BQB A;  225L A;  1LYO A;  3A3R X;  5DN4 A;  2ZNX Y;  4DD3 A;  3TXG A;  5I4X A;  165L A;  3P4Z A;  1ZYT A;  2D4J A;  4XAD A;  1TCY A;  1VDQ A;  3HBD A;  3QNG A;  3TXD A;  127L A;  1OUE A;  1RCM A;  4I7T A;  1QUT A;  2ZNW Y;  1LGX A;  1L22 A;  1LMC A;  1IWU A;  5KXZ A;  4I7J A;  3AGG G;  2A7D A;  1CU2 A;  3WH1 A;  232L A;  4IJ4 A;  3N9A A;  1IWZ A;  5JEN B;  138L A;  3TMU A;  4KPM A;  3WUM A;  1CJ9 A;  2B73 A;  2XJW A;  4AQN A;  211L A;  3HT8 A;  1CV5 A;  1RFP A;  1L96 A;  4I7P A;  1C7P A;  1D3M A;  1GFK A;  3FI7 A;  114L A;  1OUB A;  1LJG A;  4TTD A;  1PQJ A;  191L A;  1F0W A;  4O34 A;  2B74 A;  1IIZ A;  148L E;  4NHT A;  2IFF Y;  3P68 A;  4LZM A;  4LFP A;  2HEE A;  157L A;  1LMQ A;  1C10 A;  3E3D A;  1W6Z A;  3WXT A;  2OU8 A;  1HEM A;  2Z6B A;  1IOS A;  4DT3 A;  4XJH A;  4WO6 A;  1TLA A;  1JHL A;  1L74 A;  1BHZ A;  1QTB A;  1L84 A;  1AZF A;  4OWB A;  2RH1 A;  2C8O A;  2LHM A;  2F4A A;  4YM8 A;  1CV0 A;  2B6Z A;  2F30 A;  2ZIK A;  4LYT A;  3OK0 A;  2BQD A;  1GB6 A;  5LAF A;  1B0D A;  1SSW A;  197L A;  113L A;  1L16 A;  1DYE A;  1OYU A;  2Z38 A;  4EJ4 A;  2RB1 X;  3W6A A;  3G3W A;  1NQI A;  4RDS A;  1DPW A;  3HU9 A;  1DYA A;  1LJJ A;  5LVH A;  1INU A;  139L A;  1AT5 A;  141L A;  2ANX A;  1NHE A;  4NWE A;  3QE8 A;  2A7F A;  3SB6 A;  1YIL A;  3TXJ A;  4W56 A;  1EL1 A;  4M4O A;  3AZ7 A;  1L03 A;  1N4F A;  4ET8 A;  1IWX A;  5L3H A;  1IR7 A;  3HT6 A;  4XJG A;  1FKV A;  1L37 A;  1NF5 A;  3EO5 A;  2LYZ A;  4B4E A;  3ODU A;  1C66 A;  4WG1 A;  3AGH A;  4I7Q A;  5C6I A;  4XJI A;  1F6R A;  3GUM A;  1C6C A;  1GFJ A;  1XEK A;  185L A;  2HEA A;  4W55 A;  2W1M A;  1L27 A;  1G7J C;  4ZFP A;  2B5Z A;  3AB6 A;  1T8F A;  1GWD A;  4PHI A;  1YAM A;  1GE1 A;  1L38 A;  1GB7 A;  5C6L A;  2BQI A;  1QSB A;  1SWY A;  150L A;  2DQH Y;  1D0K A;  4YX7 C;  1P56 A;  3W3E A;  1LZD A;  1LSC A;  1QT6 A;  1LSF A;  5FEL A;  3HBE X;  2LZM A;  1LJF A;  2HUL A;  2BLX A;  3NYA A;  4HV1 A;  3IJU A;  1G0G A;  3AZ5 A;  1NDM C;  1B5X A;  1MLC E;  180L A;  1L68 A;  1LJ4 A;  1OVH A;  1L12 A;  3HDF A;  4IAS A;  3EXD A;  209L A;  2D91 A;  1WTN A;  236L A;  1F6S A;  4W54 A;  1SLY A;  1ALC A;  160L A;  2L78 A;  3SBB C;  1L64 A;  1L92 A;  4HSF A;  1JJ1 A;  3F8V A;  1IR9 A;  1LWG A;  1EQ4 A;  142L A;  2BQA A;  2DQC Y;  2OEA X;  4ZPU A;  1GB8 A;  152L A;  234L A;  2YBH A;  2YBJ A;  3HTD A;  1QUH A;  1IOQ A;  1SX7 A;  1OUG A;  1L45 A;  1L85 A;  1HEP A;  1OV5 A;  2BPU A;  1C6B A;  3WVX A;  5DL9 A;  3W6E A;  3EBA B;  1GFH A;  4NGY A;  3NY8 A;  3DN3 A;  4LGK A;  5I4W A;  109L A;  3CB7 A;  214L A;  2HU3 A;  4DDC A;  4NSH A;  4DJH A;  4ETA A;  5ILC A;  7LZM A;  1IC5 Y;  5F9U A;  3A93 A;  1UUZ C;  4HJZ A;  1LJE A;  1GBO A;  1JKB A;  4W53 A;  1QTH A;  4WM4 A;  1RE2 A;  4PRU A;  238L A;  4ZEE A;  187L A;  3HTG A;  2HEC A;  3LZM A;  1IVM A;  4J1B A;  1KNI A;  3SN6 R;  1L99 A;  1L54 A;  1XEJ A;  5DM9 A;  1C68 A;  1C6E A;  1OUC A;  2DQJ Y;  1VDS A;  1L42 A;  3EML A;  5KXR A;  4GCE A;  1LLH A;  1W08 A;  4Z3M A;  3RZ4 A;  1SSY A;  1IP1 A;  3AW7 A;  1LGU A;  3BKH A;  2W1L A;  4W57 A;  1YAN A;  3HFM Y;  108L A;  5APC A;  166L A;  1ZVH L;  3ZVQ A;  1HC0 A;  1D9U A;  1L59 A;  168L A;  1L82 A;  4DD7 A;  3DN6 A;  3QY4 A;  1HEO A;  3AZ6 A;  3UON A;  1CVK A;  1C60 A;  1ZV5 L;  1NBY C;  1KY1 A;  2HTX A;  1LHL A;  2H5Z A;  4PJZ A;  1L87 A;  1L60 A;  4EPI A;  1B7O A;  1C6L A;  1NWG A;  5HNC A;  1L91 A;  1GBS A;  1QUG A;  1JWR A;  3W6B A;  3T6U A;  1JKC A;  1FLQ A;  261L A;  5D5F A;  4GN4 A;  5F9X A;  1QDT A;  1B5Z A;  3V2W A;  1B5U A;  1GAZ A;  3RU5 A;  1JIS A;  4ANR A;  4ZIX A;  5B1G A;  1L93 A;  2YBM A;  5I54 A;  1BQL Y;  3G3V A;  1G7L C;  1L97 A;  4ARQ A;  1LSY A;  4NGW A;  1CJ6 A;  6LYT A;  2BQN A;  4H94 A;  1SX2 A;  235L A;  2I26 L;  3CQL A;  1L77 A;  1GF4 A;  1C46 A;  3TMW A;  3WYH A;  2HUB A;  4N9R A;  1PZY A;  1WVV A;  1NBZ C;  4XN6 A;  1ZMY L;  1WQM A;  3DN2 A;  1IO5 A;  1KW5 A;  3LYZ A;  5KXS A;  3A96 A;  2NTG A;  1CKD A;  4KL7 A;  1L48 A;  3P64 A;  3JR6 A;  3A3Q A;  3LZT A;  2RB2 X;  1L30 A;  2MEG A;  3NY9 A;  1LHI A;  3C7Y A;  3GUI A;  4DYG A;  2VB1 A;  1GBW A;  1LSA A;  1LSD A;  1YKY X;  2MEC A;  1LHM A;  5J7C A;  1VFB C;  4H8Z A;  4OOT A;  1OUF A;  1LSG A;  2LCB A;  2MED A;  199L A;  1C67 A;  2F47 A;  4R6C A;  1C6A A;  1GBY A;  5LA5 A;  1L10 A;  1GD6 A;  4H9A A;  3TMX A;  2FYC A;  3LN2 A;  1IP5 A;  5KXW A;  1C43 A;  182L A;  1HEN A;  4WM1 A;  1WQP A;  1LZT A;  4XJF A;  1L18 A;  3G3X A;  1CV3 A;  1B7L A;  5I53 A;  4HTK A;  2AUB A;  4G4C A;  5KJ9 A;  1L09 A;  1L57 A;  1LYE A;  3RNX A;  1ZVY B;  4NGZ A;  128L A;  1L15 A;  1DYD A;  104L A;  1UIC A;  1L32 A;  2RBQ A;  1HFY A;  2MEF A;  1GB3 A;  1C6Q A;  3HT9 A;  1O23 A;  1WQR A;  1L20 A;  3L64 A;  1T6V L;  2DQE Y;  3ATO A;  2H9J A;  1OP9 B;  1G0Q A;  4DD9 A;  3WXU A;  3CT5 A;  1LKR A;  3LYO A;  3W6C A;  5B07 A;  4B49 A;  1D9W A;  1CUP A;  4LYC A;  3A67 Y;  1K28 A;  1LMP A;  1JSE A;  2RAY X;  1BGI A;  4H92 A;  3A92 A;  3G3A B;  233L A;  1LAA A;  1T6H A;  4HJY A;  4C3W A;  1RJC B;  1QTC A;  4NHI A;  1AM7 A;  1L53 A;  1D2Y A;  1L46 A;  5F14 A;  242L A;  3OE8 A;  3GUJ A;  3M18 B;  5I4Y A;  4RW1 A;  1REM A;  2ZQ4 A;  3DNA A;  2DBT A;  3P65 A;  163L A;  3TMV A;  2C8P A;  5B1F A;  194L A;  2YBN A;  4ETB A;  4TSC A;  5C6J A;  4MR1 A;  1UIF A;  5FCP A;  5E9R A;  1D2W A;  167L A;  1T8A A;  4OWE A;  3WW5 A;  1L89 A;  2RAZ X;  4R0F A;  1HER A;  1D0M A;  5F16 A;  143L A;  1GFA A;  1L72 A;  4HPE A;  4YXA C;  1UIH A;  2FYD A;  183L A;  4YOP A;  4H8Y A;  4L41 A;  5KXK A;  4UWN A;  3AYQ A;  1GB0 A;  3OE0 A;  3HH6 A;  193L A;  4OOO A;  4OWH A;  1L0K A;  4LT0 A;  2HED A;  129L A;  1LPI A;  1QDR A;  186L A;  1QUO A;  1B7R A;  1LHH A;  4DC4 A;  1C63 A;  2Q0M X;  3K3T A;  1V7S A;  3J4G A;  4NIJ A;  5APF A;  2Z19 A;  158L A;  3VWO A;  4UWV A;  1L62 A;  3LYT A;  1G0P A;  1OWY A;  3F9L A;  1QQY A;  223L A;  1LYI A;  3HH4 A;  2RBN A;  4HJV A;  1L05 A;  5FDJ A;  1J1P Y;  4NFV A;  1LI3 A;  5IEL A;  5KXL A;  1GB2 A;  1YKZ X;  1L51 A;  1PQD A;  1FLY A;  1VED A;  255L A;  4Z98 A;  1G7M C;  5KXP A;  1IWW A;  213L A;  2BQK A;  2F32 A;  1UA6 Y;  1WQO A;  1G1W A;  1XGT C;  3HUA A;  3CDT A;  3TXE A;  1KY0 A;  2DQA A;  1SQ2 L;  1LHK A;  3GUL A;  4PRQ A;  1IP4 A;  1G7I C;  3GXR A;  1A4V A;  4NGJ A;  4ARP A;  3CDV A;  3FA0 A;  1LSZ A;  1Z55 A;  1LSE A;  1GFT A;  1L41 A;  4H9I A;  4B4J A;  1P64 A;  4KXI A;  2BAA A;  1QTE A;  1YAP A;  3SB9 A;  1GE0 A;  149L A;  1KXX A;  171L A;  2BQL A;  2NTH A;  4WL6 A;  2B75 A;  1LW9 A;  3WUA A;  259L A;  247L A;  1LOZ A;  1JJ0 A;  228L A;  2CUU A;  3SB5 A;  1VAT A;  1QSQ A;  3HT7 A;  4M6D A;  4AGA A;  1BVK C;  102L A;  1BB3 A;  4OWA A;  4GCD A;  1TEW A;  1IP2 A;  1HMK A;  2H9K A;  2RBO A;  4PGJ B;  1BVX A;  1GF5 A;  4ARM A;  3CT0 A;  2Z18 A;  3GUK A;  3CT1 A;  1IEE A;  3B6L A;  1C6F A;  162L A;  4EKQ A;  1P2L A;  1QS9 A;  208L A;  4NSI A;  3WW6 A;  1HSX A;  4P2E A;  1L63 A;  1A2Y C;  144L A;  1JTT L;  4DD0 A;  4H1P A;  1LI2 A;  215L A;  1LJ3 A;  4LDE A;  2MEA A;  231L A;  4NSJ A;  1LMN A;  1L95 A;  1P2R A;  1QTK A;  1C64 A;  1YKX X;  1IR8 A;  4NGV A;  169L A;  1C6D A;  1FN5 A;  1L0J A;  1VDT A;  1YL1 X;  1IC7 Y;  1OQM A;  1L70 A;  4DAJ A;  1KXY A;  1D0L A;  4DD2 A;  5APE A;  1LZ4 A;  1LYG A;  1B7M A;  3F6Z A;  1GFU A;  4G9S A;  3B0I A;  1P2C C;  1CUQ A;  4NG8 A;  3D4S A;  1JQU A;  1DPX A;  1BWI A;  1KXW A;  1DI4 A;  155L A;  1G07 A;  1ZUR A;  5KXY A;  159L A;  5LVI A;  2DQI Y;  1IP6 A;  4IAP A;  4H9F A;  1LZB A;  201L A;  252L A;  4TWS A;  1L65 A;  2A4T A;  1B5Y A;  1L04 A;  2MEH A;  2MEE A;  1LYY A;  2D4I A;  130L A;  5ILF A;  1L11 A;  2RBS A;  1G0L A;  126L A;  1LSM A;  1QTV A;  154L A;  3AZ4 A;  1IOR A;  1JIY A;  1LPY A;  198L A;  4WL7 A;  3WPL A;  181L A;  4NHS A;  2NWD X;  122L A;  1L50 A;  1L08 A;  2D6B A;  4YXC A;  1BB6 A;  2PC2 A;  1IWT A;  1HF4 A;  2Z2E A;  4XJD A;  3TXK A;  3C8Q A;  1LZ1 A;  2O7A A;  2X0A A;  3A6C Y;  2CGI A;  3DMV A;  4H90 A;  3J6K A;  5IDD A;  1C6H A;  1L07 A;  4DQ7 A;  4ET9 A;  4B1A A;  1IC4 Y;  1XGP C;  1CU6 A;  4J7V A;  1L67 A;  4HPI A;  4GN5 C;  4N5R A;  5DN5 A;  2Q9E A;  1T3P A;  224L A;  4ARL A;  5KKI A;  1B2K A;  2DKV A;  4RLN A;  1KW7 A;  1GXV 2;  4DDB A;  5KXX A;  133L A;  1C6P A;  2OE4 X;  219L A;  2BQJ A;  2F4G A;  103L A;  1YRO A;  1HNL A;  1H87 A;  1P46 A;  3D3D A;  5LYM A;  1L55 A;  1L28 A;  1DI3 A;  230L A;  1LJN A;  4Z46 A;  2WAR A;  1QTD A;  1XEP A;  190L A;  3C8R A;  244L A;  5KXT A;  4N1E I;  4WOA A;  2BLY A;  1HFX A;  1L79 A;  1LZC A;  2CWI A;  1HHL A;  1CKC A;  1PS5 A;  110L A;  1L47 A;  3LYM A;  1VDP A;  4UWU A;  1L86 A;  1QS5 A;  3AJN A;  1UID A;  4RLM A;  2YBL A;  1KIQ C;  5L3I A;  1GDW A;  3BKV A;  1IOT A;  5DLA A;  3HUK A;  4XYY A;  4FJR A;  1QSW A;  4H91 A;  9LYZ A;  4DD1 A;  3A95 A;  4A7D A;  4EKP A;  3HTF A;  4NGL A;  4WM6 A;  1L88 A;  4ETD A;  178L A;  3WVY A;  3HTB A;  221L A;  3LZ2 A;  1CJ7 A;  145L A;  1L33 A;  3SB8 A;  3CSQ A;  1BWJ A;  3B0O A;  4N1C C;  5KKJ A;  1WVU A;  1CKH A;  2RBR A;  4YEN A;  164L A;  5E4P A;  1EPY A;  1OVK A;  5A3Z A;  2LZT A;  1L36 A;  2B6X A;  4XJB A;  1JTN A;  4N8Z A;  4RW2 A;  4K5Y A;  4DWX A;  1GBX A;  3CDR A;  1UIA A;  1UAC Y;  1LCN A;  1L14 A;  2HEF A;  147L A;  2DQF C;  4EMN A;  1PQM A;  1GF9 A;  5HMV A;  1YAO A;  3WL2 A;  2BQE A;  2I25 L;  1DI5 A;  1OUH A;  2LC9 A;  5I5Q A;  3RUN A;  1QIO A;  4LYM A;  1D3J A;  4CHX A;  1GXX A;  4GRV A;  3GUO A;  2N5Z A;  196L A;  1UCO A;  5LIN A;  140L A;  3A8Z A;  3C8S A;  1L00 A;  2HU1 A;  218L A;  1J1O Y;  1L24 A;  1L98 A;  1OWZ A;  2BQM A;  2HEB A;  4I7K A;  4Z41 A;  3SB7 A;  250L A;  4W59 A;  2B6T A;  5KXM A;  1C08 C;  1D6Q A;  4DDA A;  3RW8 A;  1L81 A;  3DN8 A;  1GAY A;  3AW6 A;  1DKK A;  1L73 A;  4NGO A;  241L A;  137L A;  1V7T A;  3C81 A;  1L40 A;  1GFG A;  4LDO A;  1WQQ A;  2Z37 A;  4B4I A;  2ZIJ A;  4HP0 A;  1LJK A;  1B5V A;  1HEL A;  4GCB A;  6LYZ A;  4GCC A;  5FHW A;  1L31 A;  3PBL A;  153L A;  1LTM A;  1LYF A;  4LT1 A;  1CTW A;  2EIZ C;  5IHG A;  1CU0 A;  1XGQ C;  1L35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...