1D0LA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
322
structure length
314
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
total genus 112
structure length 314
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0lA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0lA02
1DI4A 2Q0MX 1LHHA 4C5FA 4ETCA 3IJVA 1EL1A 1DZBX 2EPEA 3A3RX 4H9FA 1LHIA 1N4FA 4GCFA 4WMGA 1LSAA 1YAOA 4N5RA 2FYDA 1LZBA 4GCEA 1REYA 1WQNA 4GLAA 4PRUA 3HBEX 4U3XB 5LYTA 4O34A 3A3QA 3ZVQA 4LGKA 1IP5A 1GBWA 5K7OA 3RZ4A 1BB3A 4ET9A 1JHLA 1HSXA 4WM3A 1GDWA 4NHPA 1YKZX 5APDA 1RI8B 3WU9A 2MEDA 1XGQC 5ILFA 2BQCA 1GFJA 4NGZA 3CSQA 1YAPA 1JTOL 4NWEA 1LJEA 1IVMA 2HEAA 4XN6A 4WO6A 2DQHY 1H6MA 2DBTA 3TMWA 4ETAA 1IOSA 1CKDA 1SLYA 1NHEA 3F6ZA 2XBRA 5LYMA 1YQVY 1UIFA 1BWJA 1GAZA 1HEPA 1VFBC 1OUDA 2DQJY 2HU3A 3J6KA 2ZQ4A 4HJVA 4QEQA 4LYOA 3WUAA 1LJKA 1JKBA 1LZ5A 1MELL 1JKAA 2EIZC 1MLCE 3AZ6A 1J1PY 4H9IA 1HERA 3LYZA 1UIAA 2D6BA 1WQPA 3AGIA 1GE0A 1FLWA 4TTDA 5KXOA 1QTEA 1C45A 1WVUA 5T3FA 3N9CA 1LSYA 1UIHA 3A93A 1DXJA 1LZ1A 3M18B 4IATA 5F9UA 1GE4A 1NBYC 3B6LA 4LYCA 4XJDA 1A4VA 1OUCA 2ZIJA 2DQCY 3GXRA 1F6SA 1LJFA 193LA 8LYZA 3WUNA 1UCOA 2VB1A 4XADA 2MECA 4KL7A 3WUMA 1GB5A 2W1XA 5LVJA 1HMKA 4IASA 2DQGY 3TXFA 4MCKA 5LYZA 1HEWA 1VAUA 5D5CA 4CHXA 3D3DA 1KXWA 4Z3MA 194LA 1ZVHL 3A34A 1LYYA 4GN4A 1D6PA 1GF6A 2DKVA 2G4PA 1NF5A 1QTKA 1UBZA 2YDGA 2Z18A 4YENA 3WVXA 3ZEKA 1IOQA 1C08C 1B0DA 5L9JA 1LMNA 1VEDA 3IWRA 2YBJA 1PS5A 4HPEA 1B7SA 5F81A 4H9AA 5LINA 1EQEA 1IWZA 3CT0A 3KAMA 5FEKA 1TAYA 1LAAA 3TXKA 5KKIA 3WVYA 2BQEA 4WG1A 4WM6A 5AMYA 2DQIY 3ULRA 1IY4A 4H1PA 5I5QA 5KXZA 3A92A 1QSAA 2ZIKA 2ZWBA 3B0KA 4GCCA 5DL9A 5F14A 1VATA 1GB8A 5HNLA 5HQ1A 1GF3A 4H90A 2XJWA 1UACY 1GDXA 5LXWA 3E3DA 1IWUA 4OWBA 1WVVA 4GLVA 2N5ZA 1TCYA 1D6QA 4DD0A 3HFMY 1GFRA 1IIZA 1LZRA 2PC2A 1FDLY 3EXDA 5KXWA 1FBIX 1KXYA 4H8YA 1GBZA 1OUHA 1XGPC 4H8ZA 4LT2A 3AGGG 1GFAA 1JKCA 4HTQA 3MGWA 3WULA 1AT5A 1OUEA 5KXRA 5DN5A 1B7MA 3J4GA 1YIKA 4WM2A 1JTPL 4WLTA 1CKHA 4KPMA 1XSFA 4QGZA 4GCBA 4YOPA 4NGJA 4KT3A 3WPKA 2HEBA 3CQLA 5HMVA 4N1CC 1J1XY 3ATOA 4HP0A 4M6DA 4OWEA 1B7QA 1FKQA 4QDNA 4HJZA 5LAGA 1HELA 4H94A 1DQJC 4G49A 2LYMA 1B5VA 4XJBA 1UC0A 1CKFA 1OUFA 2HEEA 1UIGA 2X0AA 1LMCA 3AZ4A 1GF0A 3WW6A 154LA 1QSWA 1BB7A 4J1AA 4ET8A 1B9OA 4YF2A 1DPWA 3RNXA 2YBMA 5KXTA 1ZV5L 4DD9A 1LSDA 1XGTC 1DPXA 4UWVA 3B0OA 2A7DA 1LHJA 1CJ8A 1LSNA 1LMTA 3OJPA 3LYOA 4HTKA 4LFPA 4LZTA 4PHIA 4WL6A 4GN3A 4WM5A 1YL1X 5I4XA 1IORA 1IC5Y 3BKVA 135LA 2I6ZA 2CGIA 1B5YA 1OUIA 2DQDY 2YBNA 3CB7A 4WLDA 3TMUA 1LJIA 3TMVA 1JJ3A 2HEFA 4OOTA 4ETEA 1JUGA 2W1MA 1G7LC 3VWOA 3BKHA 4DT3A 5DN4A 1LPIA 2BQBA 4DWXA 4H93A 3FE0A 2BLXA 1DI3A 1LSPA 1JSEA 4NSIA 2XTHA 1JIYA 1WTMA 5J7CA 4L41A 1GFGA 1GBSA 1GE3A 1LYOA 5LIOA 2MEHA 5APCA 4NWHA 4ML7A 3G3AB 4RW1A 1FKVA 4B4JA 3WXUA 2C8OA 1LSCA 1WQRA 1XFPL 3AW7A 4ZFPA 5FELA 1BWIA 4NGVA 4OWHA 3AJNA 4MR1A 4WO9A 1GD6A 1LSZA 4NGLA 1LTMA 4EMNA 2Z2FA 4J1BA 2D91A 1RJCB 2Z19A 4MSTA 1LZ9A 1CJ7A 3M3UA 1LHMA 2A7FA 4HJYA 2YBLA 4DDBA 5A3EA 1GF8A 1WQOA 1F0WA 1XGUC 1QUTA 2YBIA 3WU8A 1XEKA 4YEMA 4M4OA 5HMJA 1C10A 4B1AA 1IWTA 4BAPA 2IFFY 1B7RA 2MEEA 2H9KA 2ZNXY 3FI7A 3HBHA 4P2EA 4C3WA 3K3TA 3GXKA 1D0MA 1LZYA 1T6VL 1HFZA 1ALCA 4H9BA 5C6LA 153LA 1YKXX 4LT0A 3EMSA 2F30A 4Z46A 4NG8A 4B0DA 1C7PA 1B7LA 2NWDX 5KJ9A 5KY1A 1GF5A 1DKKA 1GB3A 1GF9A 4D9ZA 4GCDA 1NKHA 3LN2A 4E3UA 3D9AC 3IJUA 2F2NA 2C8PA 1IWVA 2MEIA 5I4WA 1G7MC 2H5ZA 2WARA 1OP9B 2ZNWY 2IHLA 4J7VA 3W6BA 4R6CA 2XBSA 4NGWA 1UIEA 1TBYA 3LHMA 1HEMA 5F9XA 1NBZC 1BB4A 4ZEEA 1NDMC 1IWXA 4B4EA 1YAQA 1I56A 1I20A 3AYQA 1TEWA 2W1LA 3A95A 4TSBA 2HEDA 1EQ4A 3TXGA 5DM9A 4ZIXA 3RU5A 1LZNA 1LZ6A 1BWHA 3WXTA 2AUBA 1LZTA 1GB7A 1CJ6A 1LMPA 2BQKA 1QUSA 4NY5A 3WMKA 2W1YA 2G4QA 5IDDA 1VDSA 4DDAA 4DC4A 1FLQA 4ANRA 1QDTA 1GFVA 1SQ2L 1IY3A 1JITA 134LA 1B7OA 1BQLY 1VDPA 2HUBA 4XENA 1WTNA 1D0KA 1OUJA 1UIDA 3HBDA 2MEGA 4UWUA 1GBXA 1LZ8A 4NGOA 2FYCA 1YL0X 3B72A 5FCPA 4CGEA 3AW6A 5FDJA 1UA6Y 1IX0A 1GF4A 1GFUA 1JTTL 2I26L 4NGIA 1LZDA 2LYOA 2MEFA 1B7PA 5JENB 4H91A 1CKGA 1IO5A 4TUNA 4ETBA 1AM7A 1NQIA 3ATNA 5DLAA 3WPLA 3A91A 3A6CY 4XJFA 5F16A 1JISA 1LKRA 4W96A 1OQMA 4WLYA 5LVIA 1C43A 1LMAA 1HFXA 3A90A 4A7DA 1AKIA 1QQYA 1IR9A 5KXKA 1LYSA 4Z98A 1INUA 1YAMA 2BQLA 4PGJB 2G4NA 4OW1A 1HNLA 4G4BA 4ETDA 4B49A 2ZYPA 1B5UA 5FSTA 2YBHA 4AXTA 4Z41A 1BB5A 2BQDA 2Z39A 1JKDA 1W6ZA 4LYMA 2H9JA 1LYZA 1B5ZA 4OWCA 4NEBA 1IOTA 4LYBA 5LVHA 1DKJA 4NSGA 4TSCA 1NDGC 5KXLA 4UWNA 1I1ZA 2MEAA 1KIRC 4NHTA 1ZVYB 3TMXA 5E4PA 1G7HC 1BGIA 3P4ZA 2HU1A 4BS7A 1KIPC 1WQMA 4YM8A 6LYZA 1XEIA 3RW8A 4NIJA 4R0FA 3LYTA 1HF4A 1OUBA 1LCNA 3P68A 3QY4A 4WM1A 1GHLA 5I53A 1GFTA 1F10A 1IC7Y 1XGRC 2D4IA 3QE8A 2F4AA 5LAFA 2LHMA 1YANA 4BADA 1WQQA 1VDTA 1LKSA 1G7JC 1IP1A 1GB9A 4NHIA 4NFVA 1LJ3A 3RT5X 4G9SA 1C46A 3P64A 3AGHA 5KXNA 4NGYA 4PPOA 1LZAA 1V7TA 1YILA 1GEVA 3LZ2A 2BQNA 3A94A 3N9AA 4N1EI 3WH1A 2ZQ3A 3TXEA 4KXIA 3WPJA 1OUAA 4NGKA 4H9CA 2LZ2A 4XYYA 3AZ7A 3QNGA 4B4IA 1E8LA 1JPOA 1V7SA 2LYZA 1IC4Y 2MEBA 1O23A 2FBDA 3CSRA 2CWIA 3LYMA 5KXYA 1T3PA 3W6CA 4NG1A 3WU7A 1IR8A 1GXXA 3W6AA 1IWYA 2CJLA 2D4KA 4WL7A 1B2KA 1QDRA 1HMLA 4H9HA 2BQGA 1IWWA 3CT5A 1GEZA 4WM4A 5D5FA 1UICA 2B5ZA 1F6RA 4BAFA 5E9RA 1GF7A 1AZFA 1GWDA 4YEOA 5IHGA 1AT6A 1LZGA 2LZTA 1CJ9A 1LZ4A 4TWSA 1IR7A 1LSEA 1GE2A 5KXSA 1FLYA 5M1YA 4TX7A 3T6UA 4OWAA 1BVKC 1G7IC 5IELA 1JJ1A 1RFPA 4N0JA 4PJ2C 1LZCA 1XEJA 4HSFA 1LJHA 4WOAA 1HSWA 5B1FA 1RE2A 2EQLA 2RSCA 1HC0A 1FLUA 1YKYX 4LT1A 1IP4A 1KIQC 4I8SA 5HLLA 4IJ4A 1B7NA 2ZILA 1LHLA 3AZ5A 2BQHA 3T36A 3WW5A 1NMMA 5LA5A 2Y8PA 5KXXA 3A67Y 3WL2A 3B0IA 1NWGA 4NSHA 7LYZA 1ZMYL 3W6EA 3WYHA 4DD2A 4HTNA 1D0LA 208LA 5B59A 1HEOA 1UIBA 1GXV2 2D4JA 1LJ4A 5C6IA 1LSFA 1REZA 4AGAA 2FBBA 2YSSC 4DD1A 1KXXA 2I25L 4CFOA 1GB2A 4PRQA 4W94A 1HFYA 5I54A 5L3IA 4LT3A 5ILCA 2YVBA 2BPUA 3TXDA 4I0CA 1EQ5A 1BHZA 2BLYA 1GFEA 1LJGA 4H92A 3EBAB 4H8XA 5KXPA 5A3ZA 2F4GA 2Z12A 1HEQA 1LHKA 1LZEA 3N9EA 4HV1A 3TXJA 2BQMA 3A8ZA 4LYZA 1DI5A 1GPQC 4NSJA 3TXIA 1H87A 1A2YC 207LA 2CDSA 3G3BB 4J0LA 6LYTA 1JEFA 4HPIA 1JJ0A 3W6FA 5HNCA 1LSGA 4XJGA 1JSFA 4NHQA 3W6DA 1LJJA 1GAYA 3A96A 4NHSA 4XJHA 2DQAA 5EBHA 5KKJA 1OUGA 3W3EA 2BQAA 4QY9A 3P65A 4G4HA 1LZSA 5APFA 1TDYA 1PZYA 4DDCA 1D9UA 2Z2EA 2BQOA 3CSZA 5APEA 5II3A 1GFKA 1HENA 2HTXA 3TXHA 4RLMA 1REXA 2BQFA 1GBYA 1IP3A 4G4CA 5B06A 4HV2A 1J1OY 132LA 2HECA 4FDYA 1LMOA 3A6BY 5C6JA 4DD7A 4WLXA 4II8A 1UUZC 2DQEY 3P66A 5L3HA 3LZTA 3AB6A 1IEEA 1YROA 2ZYCA 4OOOA 5I4YA 1CNSA 1GB6A 1GBOA 1GE1A 1VDQA 5B05A 4XJIA 1CKCA 1JWRA 4H9EA 5B07A 1W08A 2GV0A 5B1GA 1REMA 5LVKA 1LMQA 1IP6A 133LA 3CT1A 4GN5C 1BVXA 4RW2A 4WG7A 5LVGA 1GFHA 2Z38A 5KXMA 3OK0A 4CFPA 1LJNA 2BQIA 4N9RA 3ZVQB 4RLNA 1IOCA 1LOZA 1P2CC 2Z37A 3SP3A 1BB6A 1B5XA 4CJ2A 4LFXA 1FN5A 5LA8A 3TXBA 1Z55A 4DD3A 4RDSA 2DQFC 5FHWA 1IP2A 1LSMA 4EOFA 2BQJA 4FJRA 4X3BA 1HHLA 1RCMA 2BAAA 4LYTA 1LSBA 3EO5A 1B5WA 1QIOA 1IP7A 2EKSC 4N8ZA 4DYGA 1GB0A 9LYZA
chains in the Genus database with same CATH superfamily
228LA 2Q0MX 2X4AA 3SAVA 4ETCA 3A3RX 1L75A 4H9FA 1NHWC 1L03A 1LHIA 4GCFA 4GKKM 4ARMA 3SHFA 2O79A 3HJQA 4GCEA 1AUAA 1REYA 142LA 5LYTA 4O34A 2HL7A 1IP5A 1GBWA 210LA 1L48A 2OO9A 1L94A 2BWBA 2HHHM 160LA 1L95A 3JR6A 1YKZX 5APDA 126LA 1RI8B 1SSWA 2BQCA 1WIVA 158LA 3OE0A 4XN6A 4LDEA 2DQHY 1H6MA 1YE9A 1L55A 251LA 1EE8A 3FKEA 1NHEA 1NV9A 2L78A 1VEGA 1L65A 1PQKA 1UIFA 1VFBC 1GAZA 1OUDA 1TR8A 3AKZA 2DQJY 3HDEA 2RAYX 1LJKA 1JKBA 1LZ5A 1MELL 3AZ6A 5ITUA 4G4RA 1GE0A 1C45A 3W67A 1QUOA 1UIHA 2QBYB 2KEBA 1LZ1A 4IATA 1G0GA 3U6OA 3KS8A 4GH9A 4I5SA 2RBOA 3C8RA 156LA 1UCOA 3C8SA 1OJLA 2XGNA 3DN0A 3MHVC 1HMKA 2Z4RA 4IASA 1IN4A 4MCKA 1T8GA 130LA 1NHGC 4CHXA 3FE3A 1KXWA 3EIHA 1ZVHL 3A34A 1N33M 1GF6A 1NF5A 1L38A 2B6WA 2YDGA 3ZEKA 4AW4A 4IJEA 1P2RA 1L20A 1B0DA 3IWRA 4GEWA 4LJ6A 4H9AA 1L58A 1L54A 1R6BX 1EQEA 1HQCA 2LH0A 2Z7JA 1GO5A 2JY8A 1TAYA 2LCBA 1L81A 3WVYA 143LA 4S12A 4GCCA 5F14A 1VATA 1L33A 1GDXA 225LA 4OWBA 169LA 3GLGE 191LA 3GUOA 1UM8A 1QTHA 2QP9X 1IIZA 3GRRA 2DKLA 4PJZA 5KXWA 4F2LA 4H8YA 1KY0A 1GBZA 2LVNC 1OUHA 3AGGG 1GFAA 4DQJA 1VDDA 1OUEA 161LA 229LA 2UUAM 4AKIA 3J4GA 3U6MA 4AI6A 3IG5A 1FNNA 3FUVA 1CKHA 1JTPL 4WLTA 4A3VB 4QGZA 1R2YA 4KT3A 3WPKA 5HMVA 3CQLA 4M6DA 1N32M 2ZAOA 1OVJA 3TL4X 3WW6A 1OUFA 2X0AA 3DN6A 1GF0A 4ET8A 1N77A 2DAMA 1B9OA 2EKKA 1DO0A 1C64A 1DPWA 4DD9A 1SXJB 1LSDA 4UWVA 1L88A 4HTKA 4LDOA 4WL6A 3LYOA 4LZTA 1IY0A 1YL1X 1IC5Y 2CGIA 1OUIA 1JJ3A 234LA 4HLQA 125LA 4ETEA 1L91A 4BBAA 4DT3A 1CX7A 3UGJA 1QT4A 233LA 5DN4A 2BLXA 1JSEA 3KP0E 3DOAA 1L19A 4EKPA 5J7CA 1ZQ9A 1GFGA 3SB6A 2DAIA 2MEHA 3RZEA 4RW1A 4B4JA 3PXGA 1ZV1A 2C8OA 4DR1M 1X37A 1XFPL 3AW7A 1W5SA 252LA 5FELA 1BWIA 1L02A 4OWHA 1C60A 1LSZA 3HU8A 1NNUC 1LTMA 4UN2B 2JZ1A 2ZM6M 4EMNA 147LA 1L67A 1L76A 2F2QA 5LVJA 1WQOA 1F0WA 1XGUC 2YBIA 4YEMA 2F5PA 5HMJA 1C6MA 4BAPA 2IFFY 4MGIE 2MEEA 3FI5A 2ZNXY 3U60B 2LC9A 1D0MA 4H9BA 1HFZA 1ALCA 3SYLA 4IBKA 4LT0A 3GQ3A 2HKJA 1LGUA 1ZAEA 1G1VA 3MMPA 1GF5A 4DAJA 2O5RA 1G0JA 3LN2A 3D9AC 2F2NA 2MEIA 1PRBA 3U6DA 3W6BA 3W68A 1C6EA 1UIEA 1C1KA 205LA 4ARJA 5F9XA 2C96A 1BB4A 3FUUA 1IWXA 1CU6A 1I56A 3CF2A 3VW7A 1EQ4A 4NL4H 4ZIXA 1SX2A 2C98A 4JI3M 107LA 2XFSA 1LMPA 1QUSA 3GLFE 5IDDA 3KOZE 1L00A 2OE4X 1CU3A 4DC4A 1G0KA 2K6BA 3MJ5A 2HWJA 3FUTA 4GHAA 4Z6YA 4PT5A 2O7AA 2RAZX 1BQLY 1KNIA 5KPRA 5JI3E 2RB1X 1TLAA 3CDQA 3TQSA 4NGOA 1IM2A 1C6LA 5FDJA 3KVWA 1GFUA 2I26L 4NGIA 2P5TA 1C68A 1Z5BA 1CVKA 3FRIA 247LA 4LJ7A 2LVAA 5JENB 4H91A 2OTZX 4ARQB 4TUNA 4FCWA 4XJFA 1L37A 2VF8A 1LKRA 4W96A 1OQMA 1L35A 1C43A 1L72A 1LMAA 1L26A 4P17A 5LMUM 4Z98A 1C6HA 1LI6A 2NQ8C 1Z5AA 1HNLA 4G4BA 4ETDA 4YX7C 3UMMA 1L50A 5FSTA 4LJ9A 3AOEC 5FTKA 3J80S 2WZJA 2X8AA 4LYBA 4QNRA 5KXLA 3TWMA 1QT7A 1YUBA 138LA 1QTZA 4I7QA 148LE 2DWLA 1L59A 1ZVYB 3NY9A 1C6AA 3TMXA 4D81A 2M5ZA 1J09A 1BGIA 2HU1A 3VK7A 4BS7A 5H37D 1NO1A 1L07A 3UJNA 3GPYA 1XEIA 4OO9A 3PNYA 1NVMA 1SXJA 2EKFA 3QY4A 1XXHE 4IAPA 4WM1A 1GHLA 4DR7M 1WGLA 1C6PA 1IC7Y 7LYZA 4DJHA 1WGNA 2QQ8A 1LKSA 4NHIA 1IP1A 3FTCA 3RT5X 5KXNA 1TTEA 1EPYA 4I7SA 4AKGA 1IBLM 4L8RC 1L71A 4KXIA 4LY6A 3QNGA 3AZ7A 3DN8A 5EP3A 166LA 123LA 3G3XA 2JZ0A 4DR4M 1O23A 2FBDA 2NTGA 3LYMA 2ZTCA 4OVZB 3QYEA 4MGHA 2B72A 195LA 4WL7A 256LA 5D5FA 1QZEA 118LA 4BAFA 5E9RA 1AZFA 1LYFA 3NYAA 5LZMA 1LZGA 2CV2A 3FADA 1GE2A 1NSFA 5M1YA 200LA 2F5SA 5IELA 3R8FA 4KLNA 2G5GX 2O25A 1LJHA 2ZANA 4MGYE 1C6QA 1CX6A 3RE8A 1IP4A 1KIQC 1IQPA 5HLLA 4L16A 1B7NA 3T36A 2FH0A 4I7TA 3WW5A 2DWZB 4JI7M 186LA 4DD2A 1OKSA 5B59A 4AQNA 1HEOA 4ARPA 1LSFA 2OE9X 244LA 1KXXA 1L27A 2R0IA 4ARLA 5I54A 1Z59A 3J81S 1HFYA 4JI5M 2KNVA 2JY6B 4H8XA 1GFEA 1LJGA 1C6DA 3EBAB 5KXPA 2Z12A 1HEQA 3L25A 3N9EA 2BQMA 1DI5A 168LA 6LYTA 3G3BB 1D2YA 1JEFA 1C6FA 5FTMA 4JI6M 1JSFA 4M9ZA 2JWSA 4NHQA 1LJJA 1GAYA 1XHBA 4JI4M 4DV0M 1I94M 4M0DA 3GPUA 2BQOA 3CSZA 3DN1A 2CHVA 1GFKA 1P3NA 3U6PA 3TXHA 188LA 1REXA 2BQFA 5B06A 132LA 3LVVA 4FDYA 3RGPA 2L4FA 4LRTA 237LA 1PJIA 3P66A 1E94E 1GB6A 1DGBA 1OVKA 3GUIA 4H9EA 5B07A 2DAKA 1L90A 3ZC7B 2DAEA 4G4QA 1Q39A 133LA 3KOXE 4WG7A 1GFHA 1HNXM 3OE6A 3OK0A 5GKNA 4B3TM 4RLNA 1IOCA 1AIPC 240LA 1L29A 3GLGA 1L21A 1L69A 206LA 3TXBA 1IN5A 2J7NA 3HHYA 1Z55A 2C99A 1IP2A 4EOFA 2BQJA 1HHLA 2F4VM 3CF6E 1JQJC 1C6KA 2LTUA 1OQYA 1B5WA 1QIOA 2XFTA 4DYGA 3VKHA 1DI4A 4C5FA 4GC5A 1DZBX 2EPEA 4WMGA 3B7ZA 3FTEA 2OOAA 3C58A 1L66A 2XF3A 2KZUA 3A3QA 4LGKA 1YLAA 3RZ4A 4FCTA 1JHLA 3AV0A 1GDWA 4NHPA 2MEDA 2LWXA 257LA 1JR3E 2KA6B 1GFJA 182LA 3CSQA 4NWEA 216LA 3GUNA 1C6GA 4W59A 212LA 4WO6A 4W53A 4IBEA 1IOSA 1CKDA 3DN4A 3E4RA 1YQVY 2F5NA 4QEQA 3J6KA 2ZQ4A 3RFWA 1P6YA 4HJVA 1HERA 109LA 4LGMA 2D6BA 1WQPA 1WVUA 2K0BX 238LA 2OU0X 3T6PA 3HH4A 1DXJA 1GE4A 2KDLA 4LYCA 2DQCY 3GXRA 3C7WA 2VB1A 4IJFA 2MECA 4KL7A 1IN8A 1J7KA 5EXTA 1L64A 1L84A 2QZ4A 1T6HA 2DQGY 5D5CA 194LA 3GQ5A 2G4PA 2XEPA 1L77A 1QTKA 185LA 2HUMA 2QSFX 1CV0A 1LGWA 149LA 2LVPC 4L78A 1P46A 4ARQA 3CT0A 2H1RA 1WHCA 1MX0A 5KKIA 1OAIA 3V2YA 2DQIY 2FS1A 2LHGA 1IY4A 4H1PA 4ET9A 3PBLA 5DL9A 4CIZA 3B0KA 4L15A 1JB0F 1LV7A 4W54A 1CUQA 1BVSA 3UK6A 3U61B 2XJWA 1G71A 5LXWA 1L61A 3E3DA 4DR5M 1WVVA 3SAWA 2N5ZA 3HT7A 1D3FA 4DD0A 1CV6A 3Q8GA 4P16A 2CV1A 1L0KA 4M9SA 1XGPC 4LT2A 3WULA 3IECA 2R45A 4HTQA 3SB8A 3C81A 2QPAA 1QT3A 167LA 1T8FA 4EKSA 5KXRA 4WM2A 4B08A 1C69A 3HJ8A 5FLXS 254LA 120LA 4KPMA 4YOPA 4GCBA 145LA 4NGJA 4G4NA 236LA 1KY1A 4HP0A 3ATOA 4QDNA 4DKLA 1HELA 4H94A 1DQJC 1SG9A 2FOIC 5EXSA 4XJBA 1GL7A 2LZMA 4D80A 1LMCA 154LA 4X62M 2KHHA 1BB7A 1P64A 1QSWA 1L06A 4YF2A 3RNXA 2WSFF 3B0OA 2RH1A 4LFPA 3KXEC 135LA 3TMVA 2HEFA 1DYGA 211LA 4OOTA 1JUGA 1L70A 1HT1E 4B7FA 2BQBA 3FE0A 1LSPA 3HWSA 1JIYA 1L2CA 1WTMA 2LNHC 1L97A 4NWHA 3G3AB 4CISA 1V34A 3GULA 3WXUA 3HTGA 1HT2E 4JI0M 1LSCA 1TDZA 1P7SA 4NGVA 1G59A 4MR1A 4LFCM 1L30A 4NSRA 2GQFA 3T1HM 3GRUA 1L92A 1QUDA 4NRWA 261LA 1R7RA 2D91A 2Z19A 5EXPA 3M3UA 3QYBA 1C65A 2A7FA 5F3WA 1XEKA 2JY7A 3HT6A 4I4LA 3MK6A 3G3VA 3HUQA 1QUHA 2DWNA 3K3TA 1LZYA 1QSBA 1G8PA 3J7AS 4G6ZA 4L6V6 1OTRA 1LWGA 3SBJA 232LA 1YKXX 4Z46A 1L49A 2M60A 2K47A 7LZMA 1C7PA 1B7LA 2APLA 2OQ4A 2C5RA 1GB3A 4D9ZA 3GLIB 4M0WA 3HU9A 173LA 196LA 3VK8A 2H5ZA 2ZNWY 2XZFA 4R6CA 2C9OA 1HEMA 2XSZD 3GPPA 1YAQA 1I20A 1TEWA 3GUMA 2QENA 4TSBA 3TXGA 3I01M 2MGWA 5DM9A 1LZNA 3L27A 1L1ZA 1GB7A 4NY5A 3WMKA 3GLIE 2G4QA 1L44A 1I4WA 1FLQA 1QTBA 3JAMS 1GFVA 3T1YM 1SWZA 4DBGB 1V92A 1C62A 3C7YA 3HJSA 1JITA 4FWHA 4W58A 1L05A 4UWUA 2KNAA 2JA2A 1NJFA 1GBXA 2FYCA 2OE7X 1YL0X 3B72A 4JXJA 150LA 1E9SA 5FCPA 1UA6Y 1IX0A 3KDSE 2JUJA 3R9XB 4GKJM 1L63A 4GHLA 209LA 5DNYA 3U6LA 1IO5A 4OVZA 3WPLA 3SYKA 1DGFA 2R65A 1C66A 3L29A 1YSYA 2DWMA 1DYFA 1IR9A 1QS5A 5KXKA 1INUA 1L51A 1QSQA 1LYIA 4OW1A 2C9CA 2GNOA 5KO3A 1B5UA 1GL6A 1D9WA 2BQDA 2Z39A 1NNJA 3NBIA 1G06A 3DZDA 3U6CA 2ERCA 3RUNA 5E4PA 3AOEA 1G7HC 3VFDA 1KIPC 6LYZA 1C6NA 1L99A 4YM8A 2CE7A 3VDPA 4LF6M 1DYDA 174LA 4NIJA 1L09A 1OUBA 4Q7JA 4YXAC 3TPZA 1C6BA 1GFTA 3CDRA 3QE8A 1WJ7A 2LHMA 1YANA 6LZMA 1WXQA 1WQQA 2OPFA 1G7JC 1GB9A 1TH4A 1L28A 3K92A 1WTHA 3LCVB 4PPOA 1L57A 1I6SA 3U6EA 2QB0B 3TXEA 1L56A 4AZFA 1OUAA 3PDSA 4H9CA 3GRYA 4NGKA 3OE8A 1LYEA 4I7KA 4W51A 3GLFB 1V7SA 3C80A 1IC4Y 1QZMA 1OAOC 4DQ7A 2MH8A 3W0FA 4WW0A 1DV0A 1L32A 1QT5A 2RBNA 3HH6A 3HTBA 1L53A 5KXYA 5I14A 1G0QA 155LA 2CJLA 2D4KA 1DYEA 3A42A 4JI1M 1TH2A 2LBCA 5EP4A 1IWWA 1OFHA 3CT5A 3GRVA 1UICA 2B5ZA 5E6JA 1GF7A 2FNAA 1UFZA 1GWDA 4YEOA 5IHGA 2LZTA 1CJ9A 1MN3A 1SXJD 2ZBKB 1L98A 4TX7A 3ODUA 4IBIA 3T6UA 1BVKC 1G7IC 4AQYM 2F5OA 1OV5A 245LA 4PJ2C 2CHGA 2OU8A 4WOAA 1N78A 1RE2A 2UUCM 1HC0A 4LT1A 4I7MA 1OIZA 2EA0A 2ZILA 3ZQJA 5LA5A 2A5YB 2Y8PA 4XGIA 3A67Y 2RKOA 4NSHA 4DUYM 1D0LA 208LA 4R3DA 5DFLA 5C6IA 1CU5A 1PJTA 1T43A 2I25L 4CFOA 1GB2A 5L3IA 1L11A 2BPUA 3TXDA 1EQ5A 2BLYA 1L89A 1G1WA 2YR0A 4NSJA 1TF0B 1ZYTA 1A2YC 2CDSA 4LF7M 3FRHA 3H4JA 1JJ0A 3W6DA 4XJHA 5KKJA 1L60A 4IBDA 1OUGA 3W3EA 4EJ4A 4QY9A 4B3SM 1IXZA 3IG8A 113LA 5APEA 3FA0A 3HU3A 5II3A 2HULA 2K9DA 3HH5A 189LA 137LA 1GBYA 1L80A 4G4CA 1K3WA 1SSYA 2HECA 3HU1A 1LMOA 3A98B 4DD7A 1SXJE 250LA 4II8A 152LA 4OOOA 2RRUA 3C9PA 1GBOA 3HT9A 1GE1A 1W5TA 4IBBA 1HR0M 1JWRA 4PK0A 1W08A 1JTMA 3L26A 5B1GA 5LVKA 3SASA 3HGIA 5LVGA 3C7ZA 3OTOM 2Q9EA 4D82A 2VQFM 1ZMVA 1T3TA 3DMZA 5KXMA 4LFBM 4BLCA 2BQIA 3ZVQB 231LA 3DFZA 1LOZA 4KODA 1BB6A 1B5XA 2EO2A 3FD9A 1L96A 5LA8A 1PQIA 1CU2A 2DQFC 239LA 5FHWA 1LSMA 1DO2A 2V1CA 4GITA 4X3BA 1RCMA 2BAAA 3EO5A 4DR6M 4RKUF 2EKSC 3HY5A 2QNJA 9LYZA 5EQTA 1L62A 3IJVA 4EKRA 1GABA 2CP8A 3KFUG 104LA 3KW6A 1IY1A 4CJ6A 4OX9M 1N4FA 3GUPA 2I7NA 2DVWB 1KSFX 2RGOA 4FWGA 178LA 2FYDA 3FYDA 3E46A 1WQNA 3SFZA 1QTDA 3ZVQA 5K7OA 1BB3A 219LA 1HNWM 1HSXA 1L16A 3WU9A 3C3EA 1L40A 5ILFA 1JTOL 1D2NA 3FUXA 2HEAA 2BJWA 2JP7A 3EIEA 1XJUA 2F32A 2DBTA 4ETAA 218LA 2XBRA 1HEPA 217LA 3U5ZB 2L7IA 4K0KM 4LYOA 2JY5A 4MGKE 2EIZC 2L4EA 4H9IA 3LYZA 3HUAA 181LA 4MM3B 1FLWA 2R4EA 1QTEA 5T3FA 3N9CA 1LSYA 1L22A 3A93A 1KS3A 139LA 4BB9A 4JYAM 3SATA 1NBYC 3K2RA 3B6LA 4XJDA 2VDBB 1F6SA 1VDLA 2OU9A 3WUNA 146LA 2DHYA 3K1JA 2RBPA 2W1XA 1LGXA 1IN7A 5KQDA 1L42A 2OOBA 3TXFA 3V76A 5LYZA 1HEWA 3D3DA 4Z3MA 4MGZE 4LZJA 4GN4A 2Z18A 4AXTA 3GLHA 3HWLA 3WVXA 1IOQA 4YXCA 1VEDA 4LG2A 5LINA 1IWZA 2BJVA 5FEKA 5EXXA 3SB9A 3TXKA 2B6TA 3IHPA 1DYBA 2BQEA 3FUWA 3GPXA 1L08A 2DZLA 3ULRA 5I5QA 1XB2B 5KXZA 3C3DA 2ZIKA 5IREB 3ZH9B 1G0LA 1GB8A 3GO8A 3SBAA 1UACY 3DKEX 2QHOB 4W55A 1B6IA 4KT0F 1TCYA 1D6QA 1NJGA 3HFMY 1LZRA 2PC2A 3EXDA 242LA 1KXYA 3Q8XA 1XEPA 8CATA 1JKCA 3MGWA 1AT5A 1CUPA 243LA 1L0JA 1B7MA 2RB0X 4I81A 1YIKA 4KHPM 3VKGA 1P37A 163LA 1XSFA 2YNMD 4N1CC 1J1XY 1L79A 2KZSA 7CATA 1B7QA 1L2DA 4OWEA 1N34M 4HJZA 5LAGA 1L39A 5KQ8A 220LA 1B5VA 177LA 4WURA 4EIWA 111LA 1CKFA 1UC0A 1UIGA 131LA 2HAKA 1ZV5L 1DGGA 3J2PB 1CV5A 3HZJA 1D3JA 4CHTB 2UUBM 4R7GA 1CJ8A 1LHJA 1LMTA 2A7DA 4PHIA 4WM5A 5DN5A 1QAQA 4L4UA 4ITQA 190LA 230LA 1IORA 2DQDY 1B5YA 3DA1A 3CB7A 1T6OA 3HDFA 1LJIA 1R2ZA 2W1MA 2R46A 164LA 3BKHA 3CF0A 128LA 5FSWA 1PJSA 5ITXE 1DI3A 4NSIA 1L83A 3BBZA 4L41A 1GBSA 3GUKA 2KRKA 3PFIA 199LA 1FKVA 2DENA 2R44A 1IBKM 3KOWE 4ZFPA 2Y20A 4HL4A 1L46A 1D3MA 1GD6A 3KOYE 2UXCM 226LA 2Z2FA 4KO8A 4DDBA 1CUKA 3WU8A 4M4OA 4DV6M 1C10A 4B1AA 3QWLA 1IWTA 2FFJA 2H9KA 3FI7A 3ILKA 3HBHA 3GXKA 3BXWA 5C6LA 4W57A 2IGCA 3EMSA 5IZ7D 2DNAA 1G41A 221LA 4B0DA 1TGUA 2B6XA 3PVSA 2E5LM 1DKKA 1GF9A 4GCDA 1PGYA 4E3UA 3IJUA 1IWVA 2L09A 4IIWA 2V1UA 4RF1A 5I4WA 1G7MC 2WARA 2IHLA 4J7VA 2XBSA 3GP1A 4NGWA 1TBYA 4W56A 3B74A 1LI3A 1NBZC 2F47A 5ITQA 3AYQA 2W1LA 3A95A 3T15A 4II7A 3HTFA 3RU5A 1LZ6A 2W82A 4DV3M 2AUBA 1LZTA 2BQKA 3B9PA 2OTYX 2W1YA 4EKQA 1VDSA 201LA 1GJSA 3L2XA 3M0EA 2KNZA 1SQ2L 1IY3A 1VDPA 2HUBA 1D0KA 2XLJA 1DYAA 1UIDA 1QYRA 1LZ8A 1L47A 3BOSA 3LCUA 1IY2A 5E26A 1VQ1A 2D7HA 4IBCA 3AW6A 1GF4A 1JTTL 3OE9A 1K28A 1K3XA 1LZDA 2VF7A 3AFHA 4I7JA 1CKGA 2O01F 1VEKA 3H4MA 103LA 3ATNA 4JI2M 3HX3A 4B3MM 1PQJA 1N75A 1KFVA 5F16A 222LA 3GLHB 4IBGA 4WLYA 4R71A 2Z3XA 3HU2A 5KPTA 2L2DA 2O4WA 3A90A 4A7DA 3AOGA 4B7GA 1YAMA 2G4NA 4B49A 4LZZA 2ZYPA 3A45A 2YBHA 1CTWA 4LYMA 3T38A 2H9JA 1LYZA 1L82A 1P2LA 4NEBA 1IOTA 5LVHA 4NSGA 4TSCA 4UWNA 5A2QS 1L43A 1I1ZA 1LI2A 260LA 1LYGA 3CDTA 3GUJA 1LWKA 3LYTA 4RF0A 1HF4A 4YY3M 3P68A 3CTWB 3ZCBB 1L93A 3SMPA 1XXHB 2N35A 213LA 2RBQA 4NFVA 4ARMB 5IWAM 1NV8A 3P64A 3AGHA 4DQ5A 1E9RA 1JR3D 4GC9A 1V33A 255LA 3N9AA 4XBOA 4N1EI 4IBJA 1LPYA 4B4IA 2LZ2A 2XQOA 1E8LA 1C6JA 2Y0TA 1Q3CA 5ITXA 2MEBA 1T3PA 3W6CA 4NG1A 3WU7A 2Y21A 1IR8A 1IBMM 2CEAA 1XC8A 1CV1A 3DN3A 3W6AA 1IWYA 2BNKA 1B2KA 1HMLA 2B6YA 4H9HA 2BQGA 253LA 4WM4A 1G3IA 1F6RA 2KW0A 2DAGA 2FE8A 2QARC 2EUCA 3HHZA 4TWSA 4QOZC 4LGYA 1IR7A 1LSEA 2XH9A 1PQMA 4OWAA 2J7OA 2CUZA 3U60A 1RFPA 4N0JA 3G3WA 1LZCA 4FVMA 4HSFA 2B74A 5B1FA 4NXNM 2D7GA 2EQLA 2RSCA 1J5EM 1FLUA 1YKYX 4LDLA 4I8SA 4IJ4A 2R18A 1EFUB 1LHLA 4IBFA 2BQHA 4S0WA 1SWYA 1NMMA 165LA 5KXXA 3WL2A 1IN6A 3B0IA 1NWGA 1A5TA 3WYHA 3PNVA 1UIBA 2D4JA 1GXV2 1LJ4A 1REZA 2FBBA 2YSSC 4CGYB 3EMLA 4PRQA 4NSOB 2I7PA 4LT3A 2YVBA 4I0CA 4H92A 5A3ZA 2F4GA 1LHKA 3HUKA 3LZMA 3TXJA 3A8ZA 4LYZA 1GPQC 4WP2A 1H87A 207LA 4J0LA 2F5QA 3W6FA 4HPIA 5HNCA 1LSGA 1G0PA 2J5YA 151LA 1C6IA 2RGHA 3W0LB 2BQAA 3P65A 4Y28F 1TDYA 4DDCA 2Z2EA 5DYIA 2A4TA 1T8AA 5L8RF 4K5YA 4G3OA 4RLMA 2B70A 4B3RM 4HV2A 3WHLA 3E21A 3SMSA 1CV4A 1UUZC 3NBXX 1WR1B 1IEEA 2ZYCA 3AB6A 2B6ZA 1Q02A 1CNSA 4I7PA 1VDQA 3WHKA 5B05A 4XJIA 5ITRA 2YFQA 1CKCA 1CU0A 3NY8A 3AJIB 1REMA 1XMOM 1IP6A 4QNMA 3CT1A 4GN5C 1BVXA 2WSEF 2UXBM 1EIJA 1C6TA 1XNRM 3TWKA 4DV7M 127LA 3V2WA 3CDOA 4FCVA 159LA 241LA 4RNAA 1PQDA 1ZMWA 2Z37A 248LA 3SP3A 2Y0QA 4LFXA 4GMQA 3GQ4A 2CHQA 4PD2A 4DD3A 3HHWA 1NY5A 3SB5A 4FJRA 1PQOA 3M6AA 4AG6A 1C67A 175LA 1LHHA 1EL1A 1R4GA 214LA 1LSAA 1YAOA 4N5RA 122LA 2Q9DA 1LZBA 4ZPXA 4LF9M 1IXRC 2RBSA 4GLAA 3L2AA 3HBEX 4PRUA 4U3XB 3E9SA 4DV4M 184LA 3B7QA 1LLHA 2UXDM 4WM3A 1MU5A 1XGQC 4NGZA 2BWEA 1YAPA 1LJEA 1IVMA 3TMWA 5C1BA 5JI2E 1L13A 1SLYA 3DMVA 3K8ZA 3F6ZA 3J7BA 5LYMA 5EJCA 1BWJA 1XWIA 4DUZM 2HU3A 4FW9A 3WUAA 1QT6A 2G3QA 1VEJA 1D3NA 1JKAA 1MLCE 4PCZA 1J1PY 4NRVA 4MH0E 1UIAA 3AGIA 1L01A 4TTDA 5KXOA 1T97A 3SN6R 1VG5A 1L2BA 2B7XA 3M18B 5F9UA 3L64A 2NTHA 1FJGM 1A4VA 1OUCA 2ZIJA 2MR9A 1LJFA 114LA 193LA 8LYZA 1L36A 4XADA 1R5LA 3WUMA 1GB5A 1QTCA 115LA 1VAUA 3HTDA 1LYYA 1D6PA 2DKVA 4YENA 3A46A 1UBZA 1C08C 4G4OA 5L9JA 1IFYA 1LMNA 2YBJA 1PS5A 4HPEA 4MB7A 1B7SA 5F81A 5EP2A 3KAMA 1LAAA 198LA 1L17A 4QHSA 3SARA 4LF5M 4WG1A 4WM6A 5AMYA 108LA 1L10A 3B89A 5FTLA 3A92A 3D8BA 1QSAA 2ZWBA 180LA 1MJGM 2DI0A 3K2LA 102LA 5HNLA 5HQ1A 1GF3A 4H90A 3I51A 2Z8YM 112LA 1IWUA 4PDIA 2MROB 2KXEA 2ANVA 4GLVA 1GFRA 3I4VA 5DYGA 1L12A 1OFIA 1QUGA 1FDLY 1FBIX 3NWLA 1KW7A 170LA 4DD1A 2L7HA 4H8ZA 3JR4A 3QAKA 2HUKA 1KW5A 3AL0C 1ORYB 1ZURA 2HEBA 1FKQA 4G49A 1L45A 2LYMA 4I7NA 2HEEA 3AZ4A 1ZMUA 4YHHM 3KSXA 4J1AA 5KXTA 2YBMA 1XNQM 4DR2M 140LA 1XGTC 3SC3A 1IXSA 1DPXA 5C6JA 1C63A 1LSNA 3OJPA 5LAFA 5I4XA 4GN3A 3TWLA 1L04A 3BKVA 4OW0A 5BPVA 2I6ZA 3TMUA 2YBNA 2B3TA 4WLDA 3KS4A 4M9XA 1XMQM 2Z6BA 1NY6A 3JR5A 2ZTDA 1G7LC 224LA 3VWOA 235LA 187LA 1LPIA 3D8LA 4H93A 4DWXA 4LJAA 2XTHA 3C82A 5LIOA 1LYOA 1GE3A 4Z8XA 5APCA 4ML7A 2AHMA 4DR3M 1PJJA 3B7NA 1WQRA 1QQWA 3U61A 5LMNM 4LZMA 3AJNA 4WO9A 4NGLA 129LA 1JR3A 2YQZA 1PM5A 4J1BA 3DNAA 1RJCB 2JXNA 1G0MA 1L52A 4MSTA 2R6FA 3GLIA 1RU3A 1LZ9A 1CJ7A 1LHMA 4HJYA 2YBLA 5A3EA 2MJ5B 1GF8A 1P56A 1QS9A 2LXEA 1QUTA 1L34A 197LA 4AG5A 3J27B 2CV0A 1B7RA 5KPZA 4P2EA 4C3WA 4I7LA 4LF4M 1GLNA 1PJQA 1QTVA 1T6VL 4GIPA 4REZA 153LA 2F30A 4I7RA 110LA 3C83A 4NG8A 2NWDX 2V6ZM 5KJ9A 5KY1A 1NKHA 2C8PA 1QAMA 3U6SA 3TE6A 2X49A 1OP9B 4QOSA 1D2WA 259LA 1DGHA 3LHMA 3KP1E 2KRUA 4LRSA 2ZAMA 4ZEEA 1NDMC 4B4EA 1F4IA 4B7HA 2HEDA 1SX7A 3VLFB 262LA 3K9PA 2DHRA 1BWHA 3GLHE 1L68A 4HEOA 2XSZA 258LA 3WXTA 3LMMA 1CJ6A 1HQYE 249LA 4DDAA 157LA 4ANRA 1QDTA 2LVQD 1L73A 1Z5CA 2LVOC 4EXMA 4GRVA 134LA 2RBRA 1B7OA 3I4YA 4XENA 1WTNA 3THGA 1OUJA 3SB7A 3HBDA 1KYIA 4LFAM 2MEGA 1P3QQ 2CUUA 4NXMM 4EPFA 2CRUA 1JQUA 4CGEA 1Q3BA 1CV3A 1L31A 1LYDA 2XZUA 1ZWNA 2LYOA 4E97A 2MEFA 1B7PA 1OIPA 4GRIA 4ETBA 1AM7A 1L85A 2H5XA 1NQIA 5DLAA 215LA 3A91A 3A6CY 3LVWA 1JISA 4F1IA 3VDUA 5LVIA 1HFXA 3SHGB 1AKIA 1QQYA 1L8QA 1LYSA 1XJTA 1G4AE 2BQLA 4PGJB 4GBRB 3DMXA 5C18A 2JNHA 4Z41A 1BB5A 1JKDA 1W6ZA 3K9OA 4OWCA 1B5ZA 3SBBC 1DKJA 1L18A 4NOOB 1NDGC 1TH3A 2B75A 2MEAA 1KIRC 2UU9M 4NHTA 3GLGB 1XXHA 4LF8M 2QCUA 3P4ZA 1L41A 1WQMA 1QVRA 2R4JA 3RW8A 227LA 4R0FA 1LCNA 3SAUA 2DZNB 1N36M 5I53A 1NHBA 3F8VA 1F10A 1XGRC 2D4IA 4EPIA 4BADA 2F4AA 2D7EA 1VDTA 1L23A 1HNZM 3HT8A 3UZUA 1SXJC 1LJ3A 1OWZA 4G9SA 1C46A 1DYCA 3D4SA 4LCBA 2Q2EB 4NGYA 1L15A 4X65M 1GKIA 4LJ5A 1LZAA 1GEVA 1V7TA 1YILA 3LZ2A 2BQNA 3A94A 4DV2M 3FYCA 4FWDA 1LYHA 1OV7A 3WH1A 1L25A 2ZQ3A 3WPJA 4XYYA 3DN2A 3LW5F 5BR8M 1C61A 1JPOA 2LYZA 3C8QA 4QHTA 3CSRA 2CWIA 4NC6A 1GXXA 4W5WA 3CGWA 1S3SA 172LA 1C7YA 1DGHB 223LA 144LA 1LW9A 1IXSB 1GVNA 1P36A 1QDRA 4OU7A 1GEZA 4DV1M 1Z6TA 1AT6A 1L14A 1H6UA 1L74A 1LZ4A 1QAOA 5FTJA 2G8LA 1OVHA 5KXSA 1FLYA 1GJTA 1L87A 1JJ1A 2CFOA 1JTNA 1XEJA 1HSWA 1QT8A 3HH3A 2L6OA 1Y8GA 5ITTA 3F92A 3UONA 3LQRA 3HKPA 4LJ4A 3HHXA 3AZ5A 2R62A 3QAUA 4I8OA 1ZMYL 3W6EA 4HTNA 3U5ZA 4X64M 2VQEM 2OEAX 4AGAA 1HJPA 119LA 5ILCA 4W94A 2DZOB 3FTFA 2Z4SA 1BHZA 1C6CA 4X66M 5ITYA 1LZEA 1P5CA 4HV1A 3TXIA 3L28A 2RB2X 3FTDA 3I04M 3M7GA 2ANXA 1OYUA 3A96A 2B73A 4NHSA 5EBHA 2DQAA 5IT9S 4G4HA 1LZSA 1E32A 5APFA 4FD2A 3LQQA 1L86A 1PZYA 1L1TA 1L24A 1D9UA 1HENA 4LJ8A 2HTXA 4I7OA 1IP3A 2EJSA 1J1OY 5FTNA 2LHCA 2VIIA 1OWYA 3A6BY 2CWBA 246LA 4WLXA 5L3HA 1TDHA 2DQEY 3LZTA 5I4YA 1YROA 3F9LA 3KSJA 4JI8M 162LA 2HCBA 1QANA 4XK8F 2GV0A 4DV5M 1LMQA 5EP1A 4RW2A 3GLFA 2QBYA 192LA 4ZPUA 4AKHA 2Z38A 4JV5M 4CFPA 4TUWA 1LJNA 4N9RA 176LA 3RGSA 1P2CC 141LA 4CJ2A 2DXIA 1FN5A 4JN6A 3CDVA 4W52A 4RDSA 1LYJA 1K82A 1G07A 171LA 4LYTA 2WSCF 1LSBA 3U6QA 4PDGA 1IP7A 4XJGA 4N8ZA 183LA 1GB0A
chains in the Genus database with same CATH topology
228LA 2Q0MX 4ETCA 3A3RX 1L75A 4H9FA 1L03A 1LHIA 4GCFA 4ARMA 2O79A 4GCEA 1REYA 142LA 5LYTA 4O34A 1IP5A 1GBWA 210LA 1L48A 1L94A 160LA 1L95A 3JR6A 1YKZX 5APDA 126LA 1RI8B 1SSWA 2BQCA 158LA 3OE0A 4XN6A 4LDEA 2DQHY 1H6MA 1L55A 251LA 1NHEA 2L78A 1L65A 1PQKA 1UIFA 1VFBC 1GAZA 1OUDA 2DQJY 3HDEA 2RAYX 1LJKA 1JKBA 1LZ5A 1MELL 3AZ6A 1GE0A 1C45A 1QUOA 1UIHA 1LZ1A 4IATA 1G0GA 2RBOA 3C8RA 156LA 1UCOA 3C8SA 3DN0A 1HMKA 4IASA 4MCKA 1T8GA 130LA 4CHXA 1KXWA 1ZVHL 3A34A 1GF6A 1NF5A 1L38A 2B6WA 2YDGA 3ZEKA 1P2RA 1L20A 1B0DA 3IWRA 4H9AA 1L58A 1L54A 1EQEA 1TAYA 2LCBA 1L81A 3WVYA 143LA 4GCCA 5F14A 1VATA 1L33A 1GDXA 225LA 4OWBA 169LA 3GUOA 191LA 1QTHA 1IIZA 4PJZA 5KXWA 4H8YA 1GBZA 1OUHA 3AGGG 1GFAA 4DQJA 1OUEA 161LA 229LA 3J4GA 1JTPL 4WLTA 1CKHA 4QGZA 4KT3A 3WPKA 5HMVA 3CQLA 4M6DA 1OVJA 3WW6A 3DN6A 1OUFA 2X0AA 1GF0A 4ET8A 1B9OA 1C64A 1DPWA 4DD9A 1LSDA 4UWVA 1L88A 4HTKA 4LDOA 4WL6A 3LYOA 4LZTA 1YL1X 1IC5Y 2CGIA 1OUIA 1JJ3A 234LA 125LA 4ETEA 1L91A 4DT3A 1CX7A 1QT4A 233LA 5DN4A 2BLXA 1JSEA 1L19A 4EKPA 5J7CA 1GFGA 3SB6A 2MEHA 3RZEA 4RW1A 4B4JA 2C8OA 1XFPL 3AW7A 252LA 5FELA 1BWIA 1L02A 4OWHA 1C60A 1LSZA 3HU8A 1LTMA 4EMNA 147LA 1L67A 1L76A 2F2QA 5LVJA 1WQOA 1F0WA 1XGUC 2YBIA 4YEMA 5HMJA 1C6MA 4BAPA 2IFFY 2MEEA 3FI5A 2ZNXY 2LC9A 1D0MA 4H9BA 1HFZA 1ALCA 4LT0A 1LGUA 1G1VA 1GF5A 4DAJA 1G0JA 3LN2A 3D9AC 2F2NA 2MEIA 3W6BA 1C6EA 1UIEA 205LA 4ARJA 5F9XA 1BB4A 1IWXA 1CU6A 1I56A 3VW7A 1EQ4A 4ZIXA 1SX2A 107LA 1LMPA 1QUSA 5IDDA 1L00A 2OE4X 1CU3A 4DC4A 1G0KA 2O7AA 2RAZX 1BQLY 1KNIA 2RB1X 1TLAA 3CDQA 4NGOA 1C6LA 5FDJA 1GFUA 2I26L 4NGIA 1C68A 1CVKA 247LA 5JENB 4H91A 2OTZX 4ARQB 4TUNA 4XJFA 1L37A 1LKRA 4W96A 1OQMA 1L35A 1C43A 1L72A 1LMAA 1L26A 4Z98A 1C6HA 1LI6A 1HNLA 4G4BA 4ETDA 4YX7C 5FSTA 1L50A 4LYBA 5KXLA 1QT7A 4I7QA 138LA 1QTZA 148LE 1L59A 1ZVYB 3NY9A 3TMXA 1C6AA 1BGIA 2HU1A 4BS7A 1L07A 1XEIA 4OO9A 3QY4A 4IAPA 4WM1A 1GHLA 1C6PA 1IC7Y 7LYZA 4DJHA 1LKSA 4NHIA 1IP1A 3RT5X 5KXNA 1EPYA 4I7SA 1L71A 4KXIA 3QNGA 3AZ7A 3DN8A 166LA 123LA 3G3XA 1O23A 2FBDA 2NTGA 3LYMA 2B72A 195LA 4WL7A 256LA 5D5FA 118LA 4BAFA 5E9RA 1AZFA 1LYFA 3NYAA 5LZMA 1LZGA 3FADA 1GE2A 5M1YA 200LA 5IELA 1LJHA 1C6QA 1CX6A 1IP4A 1KIQC 5HLLA 1B7NA 3T36A 4I7TA 3WW5A 186LA 4DD2A 5B59A 4AQNA 1HEOA 4ARPA 1LSFA 2OE9X 244LA 1KXXA 1L27A 4ARLA 5I54A 1HFYA 4H8XA 1GFEA 1LJGA 1C6DA 3EBAB 5KXPA 2Z12A 1HEQA 3N9EA 2BQMA 1DI5A 168LA 6LYTA 3G3BB 1D2YA 1JEFA 1C6FA 1JSFA 4NHQA 1LJJA 1GAYA 1GB0A 2BQOA 3CSZA 3DN1A 1GFKA 1P3NA 3TXHA 188LA 1REXA 2BQFA 5B06A 132LA 4FDYA 237LA 3P66A 1GB6A 1OVKA 3GUIA 4H9EA 5B07A 1L90A 133LA 4WG7A 1GFHA 3OE6A 3OK0A 4RLNA 1IOCA 240LA 1L29A 1L21A 1L69A 206LA 3TXBA 1Z55A 1IP2A 4EOFA 2BQJA 1HHLA 1B5WA 1C6KA 1QIOA 4DYGA 1DI4A 4C5FA 1DZBX 2EPEA 4WMGA 1L66A 3A3QA 4LGKA 3RZ4A 1JHLA 1GDWA 4NHPA 2MEDA 257LA 1GFJA 182LA 3CSQA 4NWEA 216LA 3GUNA 1C6GA 4W59A 212LA 4WO6A 4W53A 1IOSA 1CKDA 3DN4A 1YQVY 4QEQA 3J6KA 2ZQ4A 1P6YA 4HJVA 1HERA 109LA 2D6BA 1WQPA 1WVUA 238LA 2OU0X 3HH4A 1DXJA 1GE4A 4LYCA 2DQCY 3GXRA 3C7WA 2VB1A 2MECA 4KL7A 1L64A 1L84A 1T6HA 2DQGY 5D5CA 194LA 2G4PA 1L77A 1QTKA 185LA 2HUMA 1CV0A 1LGWA 149LA 1P46A 4ARQA 3CT0A 5KKIA 3V2YA 2DQIY 1IY4A 4H1PA 4ET9A 3PBLA 5DL9A 3B0KA 4W54A 1CUQA 2XJWA 5LXWA 1L61A 3E3DA 1WVVA 2N5ZA 3HT7A 1D3FA 4DD0A 1CV6A 1L0KA 1XGPC 4LT2A 3WULA 3SB8A 4HTQA 3C81A 1QT3A 167LA 1T8FA 4EKSA 5KXRA 4WM2A 1C69A 254LA 120LA 4KPMA 4YOPA 4GCBA 145LA 4NGJA 236LA 1KY1A 4HP0A 3ATOA 4QDNA 4DKLA 1HELA 4H94A 1DQJC 4XJBA 2LZMA 1LMCA 154LA 1QSWA 1BB7A 1P64A 1L06A 4YF2A 3RNXA 3B0OA 2RH1A 4LFPA 135LA 3TMVA 2HEFA 1DYGA 211LA 4OOTA 1JUGA 1L70A 2BQBA 3FE0A 1LSPA 1JIYA 1WTMA 1L97A 4NWHA 3G3AB 3GULA 3WXUA 3HTGA 1LSCA 1P7SA 4NGVA 4MR1A 1L30A 1L92A 1QUDA 261LA 2D91A 2Z19A 3M3UA 1C65A 2A7FA 1XEKA 3HT6A 3G3VA 3HUQA 1QUHA 3K3TA 1LZYA 1QSBA 1LWGA 232LA 1YKXX 4Z46A 1L49A 7LZMA 1C7PA 1B7LA 1GB3A 4D9ZA 3HU9A 173LA 196LA 2H5ZA 2ZNWY 4R6CA 1HEMA 1YAQA 1I20A 1TEWA 3GUMA 4TSBA 3TXGA 5DM9A 1LZNA 1GB7A 4NY5A 3WMKA 2G4QA 1L44A 1FLQA 1QTBA 1GFVA 1SWZA 1C62A 3C7YA 1JITA 4W58A 1L05A 4UWUA 1GBXA 2FYCA 2OE7X 1YL0X 3B72A 150LA 5FCPA 1UA6Y 1IX0A 1L63A 209LA 1IO5A 3WPLA 1C66A 1DYFA 1IR9A 1QS5A 5KXKA 1INUA 1L51A 1QSQA 1LYIA 4OW1A 1B5UA 1D9WA 2BQDA 2Z39A 1G06A 3RUNA 5E4PA 1G7HC 1KIPC 6LYZA 1C6NA 1L99A 4YM8A 1DYDA 174LA 4NIJA 1L09A 1OUBA 4YXAC 1C6BA 1GFTA 3CDRA 3QE8A 2LHMA 1YANA 6LZMA 1WQQA 1G7JC 1GB9A 1L28A 1WTHA 4PPOA 1L57A 1I6SA 2QB0B 3TXEA 1L56A 4NGKA 1OUAA 3PDSA 4H9CA 4W51A 1LYEA 3OE8A 4I7KA 1V7SA 3C80A 1IC4Y 4DQ7A 1QT5A 1L32A 3HH6A 3HTBA 2RBNA 5KXYA 5I14A 1L53A 1G0QA 155LA 2CJLA 2D4KA 1DYEA 1IWWA 3CT5A 1UICA 2B5ZA 1GF7A 1GWDA 4YEOA 5IHGA 2LZTA 1CJ9A 1L98A 4TX7A 3ODUA 3T6UA 1BVKC 1G7IC 1OV5A 245LA 4PJ2C 2OU8A 4WOAA 1RE2A 1HC0A 4LT1A 4I7MA 2ZILA 5LA5A 2Y8PA 3A67Y 4NSHA 1D0LA 208LA 5C6IA 1CU5A 2I25L 4CFOA 1GB2A 5L3IA 1L11A 2BPUA 3TXDA 1EQ5A 2BLYA 1L89A 1G1WA 4NSJA 1ZYTA 1A2YC 2CDSA 1JJ0A 3W6DA 4XJHA 5KKJA 1L60A 1OUGA 3W3EA 4EJ4A 4QY9A 113LA 5APEA 3FA0A 5II3A 2HULA 3HH5A 189LA 137LA 1GBYA 1L80A 4G4CA 1SSYA 2HECA 1LMOA 4DD7A 250LA 4II8A 152LA 4OOOA 1GBOA 3HT9A 1GE1A 1JWRA 4PK0A 1W08A 1JTMA 5B1GA 5LVKA 5LVGA 3C7ZA 2Q9EA 3DMZA 5KXMA 2BQIA 3ZVQB 231LA 1LOZA 1BB6A 1B5XA 1L96A 5LA8A 1PQIA 1CU2A 2DQFC 239LA 5FHWA 1LSMA 4X3BA 1RCMA 2BAAA 3EO5A 2EKSC 9LYZA 1L62A 3IJVA 4EKRA 104LA 1N4FA 3GUPA 178LA 2FYDA 1WQNA 1QTDA 3ZVQA 5K7OA 1BB3A 219LA 1HSXA 1L16A 3WU9A 1L40A 5ILFA 1JTOL 2HEAA 2F32A 1XJUA 2DBTA 4ETAA 218LA 2XBRA 1HEPA 217LA 4LYOA 2EIZC 4H9IA 3LYZA 3HUAA 181LA 1FLWA 1QTEA 5T3FA 3N9CA 1LSYA 1L22A 3A93A 1KS3A 139LA 1NBYC 3K2RA 3B6LA 4XJDA 1F6SA 2OU9A 3WUNA 146LA 2RBPA 2W1XA 1LGXA 1L42A 3TXFA 5LYZA 1HEWA 3D3DA 4Z3MA 4GN4A 2Z18A 4AXTA 3HWLA 3WVXA 1IOQA 4YXCA 1VEDA 5LINA 1IWZA 5FEKA 3SB9A 3TXKA 2B6TA 2BQEA 1DYBA 1L08A 3ULRA 5I5QA 5KXZA 2ZIKA 1G0LA 1GB8A 3SBAA 1UACY 3DKEX 4W55A 1B6IA 1TCYA 1D6QA 3HFMY 1LZRA 2PC2A 3EXDA 242LA 1KXYA 1XEPA 1JKCA 3MGWA 1AT5A 1CUPA 243LA 1L0JA 1B7MA 2RB0X 1YIKA 1P37A 163LA 1XSFA 4N1CC 1J1XY 1L79A 4OWEA 1B7QA 4HJZA 5LAGA 1L39A 220LA 1B5VA 177LA 1UC0A 111LA 1CKFA 1UIGA 131LA 1ZV5L 1CV5A 1D3JA 2A7DA 1LHJA 1CJ8A 1LMTA 5DN5A 4PHIA 4WM5A 190LA 230LA 1IORA 2DQDY 1B5YA 3CB7A 3HDFA 1LJIA 2W1MA 164LA 3BKHA 128LA 1DI3A 4NSIA 1L83A 4L41A 1GBSA 3GUKA 199LA 1FKVA 4ZFPA 1L46A 1D3MA 1GD6A 226LA 2Z2FA 4DDBA 3WU8A 4M4OA 1C10A 4B1AA 1IWTA 2H9KA 3FI7A 3HBHA 3GXKA 5C6LA 4W57A 2IGCA 3EMSA 221LA 4B0DA 2B6XA 1DKKA 1GF9A 4GCDA 4E3UA 3IJUA 1IWVA 5I4WA 1G7MC 2WARA 2IHLA 4J7VA 2XBSA 4NGWA 1TBYA 4W56A 1LI3A 1NBZC 2F47A 3AYQA 2W1LA 3A95A 3HTFA 3RU5A 1LZ6A 2AUBA 1LZTA 2BQKA 2OTYX 2W1YA 4EKQA 1VDSA 201LA 3L2XA 1SQ2L 1IY3A 1VDPA 2HUBA 1D0KA 1UIDA 1DYAA 1LZ8A 1L47A 3AW6A 1GF4A 1JTTL 3OE9A 1K28A 1LZDA 4I7JA 1CKGA 103LA 3ATNA 1PQJA 5F16A 222LA 4WLYA 2O4WA 3A90A 4A7DA 1YAMA 2G4NA 4B49A 2ZYPA 2YBHA 1CTWA 4LYMA 2H9JA 1LYZA 1L82A 1P2LA 4NEBA 1IOTA 5LVHA 4NSGA 4TSCA 4UWNA 1L43A 1I1ZA 1LI2A 260LA 1LYGA 3CDTA 3GUJA 1LWKA 3LYTA 1HF4A 3P68A 1L93A 213LA 2RBQA 4NFVA 4ARMB 3P64A 3AGHA 4DQ5A 255LA 3N9AA 4N1EI 1LPYA 4B4IA 2LZ2A 2XQOA 1E8LA 1C6JA 2MEBA 1T3PA 3W6CA 4NG1A 3WU7A 1IR8A 1CV1A 3DN3A 3W6AA 1IWYA 1B2KA 1HMLA 2B6YA 4H9HA 2BQGA 253LA 4WM4A 1F6RA 2QARC 4TWSA 1IR7A 1LSEA 1PQMA 4OWAA 1RFPA 4N0JA 3G3WA 1LZCA 4HSFA 2B74A 5B1FA 2EQLA 2RSCA 1FLUA 1YKYX 4LDLA 4I8SA 4IJ4A 1LHLA 4S0WA 2BQHA 1SWYA 1NMMA 165LA 5KXXA 3WL2A 3B0IA 1NWGA 3WYHA 1UIBA 2D4JA 1GXV2 1LJ4A 1REZA 2FBBA 2YSSC 3EMLA 4PRQA 4LT3A 2YVBA 4I0CA 4H92A 5A3ZA 2F4GA 1LHKA 3HUKA 3LZMA 3TXJA 4LYZA 3A8ZA 1GPQC 1H87A 207LA 4J0LA 3W6FA 4HPIA 5HNCA 1LSGA 1G0PA 151LA 1C6IA 2BQAA 3P65A 1TDYA 4DDCA 2Z2EA 2A4TA 1T8AA 4K5YA 4RLMA 2B70A 4HV2A 1CV4A 1UUZC 3AB6A 1IEEA 2ZYCA 2B6ZA 4I7PA 1CNSA 1VDQA 5B05A 4XJIA 1CKCA 1CU0A 3NY8A 1REMA 1IP6A 3CT1A 4GN5C 1BVXA 1C6TA 127LA 3V2WA 3CDOA 159LA 241LA 1PQDA 2Z37A 3SP3A 248LA 4LFXA 4DD3A 3SB5A 4FJRA 1PQOA 1C67A 175LA 1LHHA 1EL1A 214LA 1LSAA 1YAOA 4N5RA 122LA 2Q9DA 1LZBA 2RBSA 4GLAA 4PRUA 3HBEX 4U3XB 184LA 1LLHA 4WM3A 1XGQC 4NGZA 1YAPA 1LJEA 1IVMA 3TMWA 1L13A 1SLYA 3DMVA 3F6ZA 5LYMA 1BWJA 2HU3A 3WUAA 1QT6A 1D3NA 1JKAA 1MLCE 1J1PY 1UIAA 3AGIA 1L01A 4TTDA 5KXOA 1T97A 3SN6R 2B7XA 3M18B 5F9UA 3L64A 2NTHA 1A4VA 1OUCA 2ZIJA 1LJFA 114LA 193LA 8LYZA 1L36A 4XADA 3WUMA 1GB5A 1QTCA 115LA 1VAUA 3HTDA 1LYYA 1D6PA 2DKVA 4YENA 1UBZA 1C08C 5L9JA 1LMNA 2YBJA 1PS5A 4HPEA 1B7SA 5F81A 3KAMA 1LAAA 198LA 1L17A 4WG1A 4WM6A 5AMYA 108LA 1L10A 3A92A 1QSAA 2ZWBA 180LA 102LA 5HNLA 5HQ1A 1GF3A 4H90A 112LA 1IWUA 2ANVA 4GLVA 1GFRA 1QUGA 1L12A 1FDLY 1FBIX 1KW7A 170LA 4DD1A 4H8ZA 3QAKA 2HUKA 1KW5A 1ZURA 2HEBA 1FKQA 4G49A 1L45A 2LYMA 4I7NA 2HEEA 3AZ4A 4J1AA 5KXTA 2YBMA 140LA 1XGTC 1DPXA 5C6JA 1C63A 1LSNA 3OJPA 5LAFA 5I4XA 4GN3A 1L04A 3BKVA 2I6ZA 3TMUA 2YBNA 4WLDA 2Z6BA 224LA 1G7LC 3VWOA 235LA 187LA 1LPIA 4DWXA 4H93A 2XTHA 3C82A 5LIOA 1LYOA 1GE3A 5APCA 4ML7A 1WQRA 4LZMA 3AJNA 4WO9A 4NGLA 129LA 4J1BA 3DNAA 1RJCB 4MSTA 1G0MA 1L52A 1LZ9A 1CJ7A 1LHMA 4HJYA 2YBLA 5A3EA 1P56A 1GF8A 1QS9A 1L34A 1QUTA 197LA 1B7RA 4P2EA 4C3WA 4I7LA 1QTVA 1T6VL 153LA 2F30A 4I7RA 110LA 3C83A 4NG8A 2NWDX 5KJ9A 5KY1A 1NKHA 2C8PA 1OP9B 259LA 1D2WA 3LHMA 4ZEEA 1NDMC 4B4EA 2HEDA 1SX7A 262LA 1BWHA 1L68A 3WXTA 258LA 1CJ6A 249LA 4DDAA 157LA 4ANRA 1QDTA 1L73A 4EXMA 4GRVA 134LA 2RBRA 1B7OA 4XENA 1WTNA 3SB7A 1OUJA 3HBDA 2MEGA 2CUUA 4EPFA 1JQUA 4CGEA 1CV3A 1L31A 1LYDA 1ZWNA 2LYOA 4E97A 2MEFA 1B7PA 4ETBA 1AM7A 1L85A 1NQIA 5DLAA 215LA 3A91A 3A6CY 1JISA 5LVIA 1HFXA 1AKIA 1QQYA 1XJTA 1LYSA 4PGJB 2BQLA 4GBRB 3DMXA 4Z41A 1BB5A 1JKDA 1W6ZA 4OWCA 1B5ZA 3SBBC 1DKJA 1L18A 1NDGC 2B75A 2MEAA 1KIRC 4NHTA 3P4ZA 1L41A 1WQMA 3RW8A 227LA 4R0FA 1LCNA 5I53A 1NHBA 3F8VA 1F10A 1XGRC 2D4IA 4EPIA 4BADA 2F4AA 1VDTA 1L23A 3HT8A 1LJ3A 1OWZA 4G9SA 1C46A 1DYCA 3D4SA 4NGYA 1L15A 1LZAA 1V7TA 1YILA 1GEVA 3LZ2A 2BQNA 3A94A 1LYHA 1OV7A 3WH1A 1L25A 2ZQ3A 3WPJA 4XYYA 3DN2A 1JPOA 1C61A 2LYZA 3C8QA 3CSRA 2CWIA 1GXXA 172LA 223LA 144LA 1LW9A 1P36A 1QDRA 1GEZA 1AT6A 1L14A 1L74A 1LZ4A 1OVHA 5KXSA 1FLYA 1L87A 1JJ1A 1JTNA 1XEJA 1HSWA 1QT8A 3HH3A 3UONA 3AZ5A 1ZMYL 3W6EA 4HTNA 2OEAX 4AGAA 119LA 5ILCA 4W94A 1BHZA 1C6CA 1LZEA 4HV1A 1P5CA 3TXIA 2RB2X 2ANXA 1OYUA 3A96A 2B73A 4NHSA 5EBHA 2DQAA 4G4HA 1LZSA 5APFA 1L86A 1PZYA 1L24A 1D9UA 1HENA 2HTXA 4I7OA 1IP3A 1J1OY 1OWYA 3A6BY 246LA 4WLXA 5L3HA 2DQEY 3LZTA 5I4YA 1YROA 3F9LA 162LA 2GV0A 1LMQA 4RW2A 192LA 4ZPUA 2Z38A 4CFPA 1LJNA 4N9RA 176LA 1P2CC 141LA 4CJ2A 1FN5A 3CDVA 4W52A 4RDSA 1LYJA 1G07A 171LA 4LYTA 1LSBA 1IP7A 4XJGA 4N8ZA 183LA 1KY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DI4 A;  2Q0M X;  1LHH A;  4C5F A;  4ETC A;  3IJV A;  1EL1 A;  1DZB X;  2EPE A;  3A3R X;  4H9F A;  1LHI A;  1N4F A;  4GCF A;  4WMG A;  1LSA A;  1YAO A;  4N5R A;  2FYD A;  1LZB A;  4GCE A;  1REY A;  1WQN A;  4GLA A;  4PRU A;  3HBE X;  4U3X B;  5LYT A;  4O34 A;  3A3Q A;  3ZVQ A;  4LGK A;  1IP5 A;  1GBW A;  5K7O A;  3RZ4 A;  1BB3 A;  4ET9 A;  1JHL A;  1HSX A;  4WM3 A;  1GDW A;  4NHP A;  1YKZ X;  5APD A;  1RI8 B;  3WU9 A;  2MED A;  1XGQ C;  5ILF A;  2BQC A;  1GFJ A;  4NGZ A;  3CSQ A;  1YAP A;  1JTO L;  4NWE A;  1LJE A;  1IVM A;  2HEA A;  4XN6 A;  4WO6 A;  2DQH Y;  1H6M A;  2DBT A;  3TMW A;  4ETA A;  1IOS A;  1CKD A;  1SLY A;  1NHE A;  3F6Z A;  2XBR A;  5LYM A;  1YQV Y;  1UIF A;  1BWJ A;  1GAZ A;  1HEP A;  1VFB C;  1OUD A;  2DQJ Y;  2HU3 A;  3J6K A;  2ZQ4 A;  4HJV A;  4QEQ A;  4LYO A;  3WUA A;  1LJK A;  1JKB A;  1LZ5 A;  1MEL L;  1JKA A;  2EIZ C;  1MLC E;  3AZ6 A;  1J1P Y;  4H9I A;  1HER A;  3LYZ A;  1UIA A;  2D6B A;  1WQP A;  3AGI A;  1GE0 A;  1FLW A;  4TTD A;  5KXO A;  1QTE A;  1C45 A;  1WVU A;  5T3F A;  3N9C A;  1LSY A;  1UIH A;  3A93 A;  1DXJ A;  1LZ1 A;  3M18 B;  4IAT A;  5F9U A;  1GE4 A;  1NBY C;  3B6L A;  4LYC A;  4XJD A;  1A4V A;  1OUC A;  2ZIJ A;  2DQC Y;  3GXR A;  1F6S A;  1LJF A;  193L A;  8LYZ A;  3WUN A;  1UCO A;  2VB1 A;  4XAD A;  2MEC A;  4KL7 A;  3WUM A;  1GB5 A;  2W1X A;  5LVJ A;  1HMK A;  4IAS A;  2DQG Y;  3TXF A;  4MCK A;  5LYZ A;  1HEW A;  1VAU A;  5D5C A;  4CHX A;  3D3D A;  1KXW A;  4Z3M A;  194L A;  1ZVH L;  3A34 A;  1LYY A;  4GN4 A;  1D6P A;  1GF6 A;  2DKV A;  2G4P A;  1NF5 A;  1QTK A;  1UBZ A;  2YDG A;  2Z18 A;  4YEN A;  3WVX A;  3ZEK A;  1IOQ A;  1C08 C;  1B0D A;  5L9J A;  1LMN A;  1VED A;  3IWR A;  2YBJ A;  1PS5 A;  4HPE A;  1B7S A;  5F81 A;  4H9A A;  5LIN A;  1EQE A;  1IWZ A;  3CT0 A;  3KAM A;  5FEK A;  1TAY A;  1LAA A;  3TXK A;  5KKI A;  3WVY A;  2BQE A;  4WG1 A;  4WM6 A;  5AMY A;  2DQI Y;  3ULR A;  1IY4 A;  4H1P A;  5I5Q A;  5KXZ A;  3A92 A;  1QSA A;  2ZIK A;  2ZWB A;  3B0K A;  4GCC A;  5DL9 A;  5F14 A;  1VAT A;  1GB8 A;  5HNL A;  5HQ1 A;  1GF3 A;  4H90 A;  2XJW A;  1UAC Y;  1GDX A;  5LXW A;  3E3D A;  1IWU A;  4OWB A;  1WVV A;  4GLV A;  2N5Z A;  1TCY A;  1D6Q A;  4DD0 A;  3HFM Y;  1GFR A;  1IIZ A;  1LZR A;  2PC2 A;  1FDL Y;  3EXD A;  5KXW A;  1FBI X;  1KXY A;  4H8Y A;  1GBZ A;  1OUH A;  1XGP C;  4H8Z A;  4LT2 A;  3AGG G;  1GFA A;  1JKC A;  4HTQ A;  3MGW A;  3WUL A;  1AT5 A;  1OUE A;  5KXR A;  5DN5 A;  1B7M A;  3J4G A;  1YIK A;  4WM2 A;  1JTP L;  4WLT A;  1CKH A;  4KPM A;  1XSF A;  4QGZ A;  4GCB A;  4YOP A;  4NGJ A;  4KT3 A;  3WPK A;  2HEB A;  3CQL A;  5HMV A;  4N1C C;  1J1X Y;  3ATO A;  4HP0 A;  4M6D A;  4OWE A;  1B7Q A;  1FKQ A;  4QDN A;  4HJZ A;  5LAG A;  1HEL A;  4H94 A;  1DQJ C;  4G49 A;  2LYM A;  1B5V A;  4XJB A;  1UC0 A;  1CKF A;  1OUF A;  2HEE A;  1UIG A;  2X0A A;  1LMC A;  3AZ4 A;  1GF0 A;  3WW6 A;  154L A;  1QSW A;  1BB7 A;  4J1A A;  4ET8 A;  1B9O A;  4YF2 A;  1DPW A;  3RNX A;  2YBM A;  5KXT A;  1ZV5 L;  4DD9 A;  1LSD A;  1XGT C;  1DPX A;  4UWV A;  3B0O A;  2A7D A;  1LHJ A;  1CJ8 A;  1LSN A;  1LMT A;  3OJP A;  3LYO A;  4HTK A;  4LFP A;  4LZT A;  4PHI A;  4WL6 A;  4GN3 A;  4WM5 A;  1YL1 X;  5I4X A;  1IOR A;  1IC5 Y;  3BKV A;  135L A;  2I6Z A;  2CGI A;  1B5Y A;  1OUI A;  2DQD Y;  2YBN A;  3CB7 A;  4WLD A;  3TMU A;  1LJI A;  3TMV A;  1JJ3 A;  2HEF A;  4OOT A;  4ETE A;  1JUG A;  2W1M A;  1G7L C;  3VWO A;  3BKH A;  4DT3 A;  5DN4 A;  1LPI A;  2BQB A;  4DWX A;  4H93 A;  3FE0 A;  2BLX A;  1DI3 A;  1LSP A;  1JSE A;  4NSI A;  2XTH A;  1JIY A;  1WTM A;  5J7C A;  4L41 A;  1GFG A;  1GBS A;  1GE3 A;  1LYO A;  5LIO A;  2MEH A;  5APC A;  4NWH A;  4ML7 A;  3G3A B;  4RW1 A;  1FKV A;  4B4J A;  3WXU A;  2C8O A;  1LSC A;  1WQR A;  1XFP L;  3AW7 A;  4ZFP A;  5FEL A;  1BWI A;  4NGV A;  4OWH A;  3AJN A;  4MR1 A;  4WO9 A;  1GD6 A;  1LSZ A;  4NGL A;  1LTM A;  4EMN A;  2Z2F A;  4J1B A;  2D91 A;  1RJC B;  2Z19 A;  4MST A;  1LZ9 A;  1CJ7 A;  3M3U A;  1LHM A;  2A7F A;  4HJY A;  2YBL A;  4DDB A;  5A3E A;  1GF8 A;  1WQO A;  1F0W A;  1XGU C;  1QUT A;  2YBI A;  3WU8 A;  1XEK A;  4YEM A;  4M4O A;  5HMJ A;  1C10 A;  4B1A A;  1IWT A;  4BAP A;  2IFF Y;  1B7R A;  2MEE A;  2H9K A;  2ZNX Y;  3FI7 A;  3HBH A;  4P2E A;  4C3W A;  3K3T A;  3GXK A;  1D0M A;  1LZY A;  1T6V L;  1HFZ A;  1ALC A;  4H9B A;  5C6L A;  153L A;  1YKX X;  4LT0 A;  3EMS A;  2F30 A;  4Z46 A;  4NG8 A;  4B0D A;  1C7P A;  1B7L A;  2NWD X;  5KJ9 A;  5KY1 A;  1GF5 A;  1DKK A;  1GB3 A;  1GF9 A;  4D9Z A;  4GCD A;  1NKH A;  3LN2 A;  4E3U A;  3D9A C;  3IJU A;  2F2N A;  2C8P A;  1IWV A;  2MEI A;  5I4W A;  1G7M C;  2H5Z A;  2WAR A;  1OP9 B;  2ZNW Y;  2IHL A;  4J7V A;  3W6B A;  4R6C A;  2XBS A;  4NGW A;  1UIE A;  1TBY A;  3LHM A;  1HEM A;  5F9X A;  1NBZ C;  1BB4 A;  4ZEE A;  1NDM C;  1IWX A;  4B4E A;  1YAQ A;  1I56 A;  1I20 A;  3AYQ A;  1TEW A;  2W1L A;  3A95 A;  4TSB A;  2HED A;  1EQ4 A;  3TXG A;  5DM9 A;  4ZIX A;  3RU5 A;  1LZN A;  1LZ6 A;  1BWH A;  3WXT A;  2AUB A;  1LZT A;  1GB7 A;  1CJ6 A;  1LMP A;  2BQK A;  1QUS A;  4NY5 A;  3WMK A;  2W1Y A;  2G4Q A;  5IDD A;  1VDS A;  4DDA A;  4DC4 A;  1FLQ A;  4ANR A;  1QDT A;  1GFV A;  1SQ2 L;  1IY3 A;  1JIT A;  134L A;  1B7O A;  1BQL Y;  1VDP A;  2HUB A;  4XEN A;  1WTN A;  1D0K A;  1OUJ A;  1UID A;  3HBD A;  2MEG A;  4UWU A;  1GBX A;  1LZ8 A;  4NGO A;  2FYC A;  1YL0 X;  3B72 A;  5FCP A;  4CGE A;  3AW6 A;  5FDJ A;  1UA6 Y;  1IX0 A;  1GF4 A;  1GFU A;  1JTT L;  2I26 L;  4NGI A;  1LZD A;  2LYO A;  2MEF A;  1B7P A;  5JEN B;  4H91 A;  1CKG A;  1IO5 A;  4TUN A;  4ETB A;  1AM7 A;  1NQI A;  3ATN A;  5DLA A;  3WPL A;  3A91 A;  3A6C Y;  4XJF A;  5F16 A;  1JIS A;  1LKR A;  4W96 A;  1OQM A;  4WLY A;  5LVI A;  1C43 A;  1LMA A;  1HFX A;  3A90 A;  4A7D A;  1AKI A;  1QQY A;  1IR9 A;  5KXK A;  1LYS A;  4Z98 A;  1INU A;  1YAM A;  2BQL A;  4PGJ B;  2G4N A;  4OW1 A;  1HNL A;  4G4B A;  4ETD A;  4B49 A;  2ZYP A;  1B5U A;  5FST A;  2YBH A;  4AXT A;  4Z41 A;  1BB5 A;  2BQD A;  2Z39 A;  1JKD A;  1W6Z A;  4LYM A;  2H9J A;  1LYZ A;  1B5Z A;  4OWC A;  4NEB A;  1IOT A;  4LYB A;  5LVH A;  1DKJ A;  4NSG A;  4TSC A;  1NDG C;  5KXL A;  4UWN A;  1I1Z A;  2MEA A;  1KIR C;  4NHT A;  1ZVY B;  3TMX A;  5E4P A;  1G7H C;  1BGI A;  3P4Z A;  2HU1 A;  4BS7 A;  1KIP C;  1WQM A;  4YM8 A;  6LYZ A;  1XEI A;  3RW8 A;  4NIJ A;  4R0F A;  3LYT A;  1HF4 A;  1OUB A;  1LCN A;  3P68 A;  3QY4 A;  4WM1 A;  1GHL A;  5I53 A;  1GFT A;  1F10 A;  1IC7 Y;  1XGR C;  2D4I A;  3QE8 A;  2F4A A;  5LAF A;  2LHM A;  1YAN A;  4BAD A;  1WQQ A;  1VDT A;  1LKS A;  1G7J C;  1IP1 A;  1GB9 A;  4NHI A;  4NFV A;  1LJ3 A;  3RT5 X;  4G9S A;  1C46 A;  3P64 A;  3AGH A;  5KXN A;  4NGY A;  4PPO A;  1LZA A;  1V7T A;  1YIL A;  1GEV A;  3LZ2 A;  2BQN A;  3A94 A;  3N9A A;  4N1E I;  3WH1 A;  2ZQ3 A;  3TXE A;  4KXI A;  3WPJ A;  1OUA A;  4NGK A;  4H9C A;  2LZ2 A;  4XYY A;  3AZ7 A;  3QNG A;  4B4I A;  1E8L A;  1JPO A;  1V7S A;  2LYZ A;  1IC4 Y;  2MEB A;  1O23 A;  2FBD A;  3CSR A;  2CWI A;  3LYM A;  5KXY A;  1T3P A;  3W6C A;  4NG1 A;  3WU7 A;  1IR8 A;  1GXX A;  3W6A A;  1IWY A;  2CJL A;  2D4K A;  4WL7 A;  1B2K A;  1QDR A;  1HML A;  4H9H A;  2BQG A;  1IWW A;  3CT5 A;  1GEZ A;  4WM4 A;  5D5F A;  1UIC A;  2B5Z A;  1F6R A;  4BAF A;  5E9R A;  1GF7 A;  1AZF A;  1GWD A;  4YEO A;  5IHG A;  1AT6 A;  1LZG A;  2LZT A;  1CJ9 A;  1LZ4 A;  4TWS A;  1IR7 A;  1LSE A;  1GE2 A;  5KXS A;  1FLY A;  5M1Y A;  4TX7 A;  3T6U A;  4OWA A;  1BVK C;  1G7I C;  5IEL A;  1JJ1 A;  1RFP A;  4N0J A;  4PJ2 C;  1LZC A;  1XEJ A;  4HSF A;  1LJH A;  4WOA A;  1HSW A;  5B1F A;  1RE2 A;  2EQL A;  2RSC A;  1HC0 A;  1FLU A;  1YKY X;  4LT1 A;  1IP4 A;  1KIQ C;  4I8S A;  5HLL A;  4IJ4 A;  1B7N A;  2ZIL A;  1LHL A;  3AZ5 A;  2BQH A;  3T36 A;  3WW5 A;  1NMM A;  5LA5 A;  2Y8P A;  5KXX A;  3A67 Y;  3WL2 A;  3B0I A;  1NWG A;  4NSH A;  7LYZ A;  1ZMY L;  3W6E A;  3WYH A;  4DD2 A;  4HTN A;  1D0L A;  208L A;  5B59 A;  1HEO A;  1UIB A;  1GXV 2;  2D4J A;  1LJ4 A;  5C6I A;  1LSF A;  1REZ A;  4AGA A;  2FBB A;  2YSS C;  4DD1 A;  1KXX A;  2I25 L;  4CFO A;  1GB2 A;  4PRQ A;  4W94 A;  1HFY A;  5I54 A;  5L3I A;  4LT3 A;  5ILC A;  2YVB A;  2BPU A;  3TXD A;  4I0C A;  1EQ5 A;  1BHZ A;  2BLY A;  1GFE A;  1LJG A;  4H92 A;  3EBA B;  4H8X A;  5KXP A;  5A3Z A;  2F4G A;  2Z12 A;  1HEQ A;  1LHK A;  1LZE A;  3N9E A;  4HV1 A;  3TXJ A;  2BQM A;  3A8Z A;  4LYZ A;  1DI5 A;  1GPQ C;  4NSJ A;  3TXI A;  1H87 A;  1A2Y C;  207L A;  2CDS A;  3G3B B;  4J0L A;  6LYT A;  1JEF A;  4HPI A;  1JJ0 A;  3W6F A;  5HNC A;  1LSG A;  4XJG A;  1JSF A;  4NHQ A;  3W6D A;  1LJJ A;  1GAY A;  3A96 A;  4NHS A;  4XJH A;  2DQA A;  5EBH A;  5KKJ A;  1OUG A;  3W3E A;  2BQA A;  4QY9 A;  3P65 A;  4G4H A;  1LZS A;  5APF A;  1TDY A;  1PZY A;  4DDC A;  1D9U A;  2Z2E A;  2BQO A;  3CSZ A;  5APE A;  5II3 A;  1GFK A;  1HEN A;  2HTX A;  3TXH A;  4RLM A;  1REX A;  2BQF A;  1GBY A;  1IP3 A;  4G4C A;  5B06 A;  4HV2 A;  1J1O Y;  132L A;  2HEC A;  4FDY A;  1LMO A;  3A6B Y;  5C6J A;  4DD7 A;  4WLX A;  4II8 A;  1UUZ C;  2DQE Y;  3P66 A;  5L3H A;  3LZT A;  3AB6 A;  1IEE A;  1YRO A;  2ZYC A;  4OOO A;  5I4Y A;  1CNS A;  1GB6 A;  1GBO A;  1GE1 A;  1VDQ A;  5B05 A;  4XJI A;  1CKC A;  1JWR A;  4H9E A;  5B07 A;  1W08 A;  2GV0 A;  5B1G A;  1REM A;  5LVK A;  1LMQ A;  1IP6 A;  133L A;  3CT1 A;  4GN5 C;  1BVX A;  4RW2 A;  4WG7 A;  5LVG A;  1GFH A;  2Z38 A;  5KXM A;  3OK0 A;  4CFP A;  1LJN A;  2BQI A;  4N9R A;  3ZVQ B;  4RLN A;  1IOC A;  1LOZ A;  1P2C C;  2Z37 A;  3SP3 A;  1BB6 A;  1B5X A;  4CJ2 A;  4LFX A;  1FN5 A;  5LA8 A;  3TXB A;  1Z55 A;  4DD3 A;  4RDS A;  2DQF C;  5FHW A;  1IP2 A;  1LSM A;  4EOF A;  2BQJ A;  4FJR A;  4X3B A;  1HHL A;  1RCM A;  2BAA A;  4LYT A;  1LSB A;  3EO5 A;  1B5W A;  1QIO A;  1IP7 A;  2EKS C;  4N8Z A;  4DYG A;  1GB0 A;  9LYZ A; 
#chains in the Genus database with same CATH topology
 228L A;  2Q0M X;  2X4A A;  3SAV A;  4ETC A;  3A3R X;  1L75 A;  4H9F A;  1NHW C;  1L03 A;  1LHI A;  4GCF A;  4GKK M;  4ARM A;  3SHF A;  2O79 A;  3HJQ A;  4GCE A;  1AUA A;  1REY A;  142L A;  5LYT A;  4O34 A;  2HL7 A;  1IP5 A;  1GBW A;  210L A;  1L48 A;  2OO9 A;  1L94 A;  2BWB A;  2HHH M;  160L A;  1L95 A;  3JR6 A;  1YKZ X;  5APD A;  126L A;  1RI8 B;  1SSW A;  2BQC A;  1WIV A;  158L A;  3OE0 A;  4XN6 A;  4LDE A;  2DQH Y;  1H6M A;  1YE9 A;  1L55 A;  251L A;  1EE8 A;  3FKE A;  1NHE A;  1NV9 A;  2L78 A;  1VEG A;  1L65 A;  1PQK A;  1UIF A;  1VFB C;  1GAZ A;  1OUD A;  1TR8 A;  3AKZ A;  2DQJ Y;  3HDE A;  2RAY X;  1LJK A;  1JKB A;  1LZ5 A;  1MEL L;  3AZ6 A;  5ITU A;  4G4R A;  1GE0 A;  1C45 A;  3W67 A;  1QUO A;  1UIH A;  2QBY B;  2KEB A;  1LZ1 A;  4IAT A;  1G0G A;  3U6O A;  3KS8 A;  4GH9 A;  4I5S A;  2RBO A;  3C8R A;  156L A;  1UCO A;  3C8S A;  1OJL A;  2XGN A;  3DN0 A;  3MHV C;  1HMK A;  2Z4R A;  4IAS A;  1IN4 A;  4MCK A;  1T8G A;  130L A;  1NHG C;  4CHX A;  3FE3 A;  1KXW A;  3EIH A;  1ZVH L;  3A34 A;  1N33 M;  1GF6 A;  1NF5 A;  1L38 A;  2B6W A;  2YDG A;  3ZEK A;  4AW4 A;  4IJE A;  1P2R A;  1L20 A;  1B0D A;  3IWR A;  4GEW A;  4LJ6 A;  4H9A A;  1L58 A;  1L54 A;  1R6B X;  1EQE A;  1HQC A;  2LH0 A;  2Z7J A;  1GO5 A;  2JY8 A;  1TAY A;  2LCB A;  1L81 A;  3WVY A;  143L A;  4S12 A;  4GCC A;  5F14 A;  1VAT A;  1L33 A;  1GDX A;  225L A;  4OWB A;  169L A;  3GLG E;  191L A;  3GUO A;  1UM8 A;  1QTH A;  2QP9 X;  1IIZ A;  3GRR A;  2DKL A;  4PJZ A;  5KXW A;  4F2L A;  4H8Y A;  1KY0 A;  1GBZ A;  2LVN C;  1OUH A;  3AGG G;  1GFA A;  4DQJ A;  1VDD A;  1OUE A;  161L A;  229L A;  2UUA M;  4AKI A;  3J4G A;  3U6M A;  4AI6 A;  3IG5 A;  1FNN A;  3FUV A;  1CKH A;  1JTP L;  4WLT A;  4A3V B;  4QGZ A;  1R2Y A;  4KT3 A;  3WPK A;  5HMV A;  3CQL A;  4M6D A;  1N32 M;  2ZAO A;  1OVJ A;  3TL4 X;  3WW6 A;  1OUF A;  2X0A A;  3DN6 A;  1GF0 A;  4ET8 A;  1N77 A;  2DAM A;  1B9O A;  2EKK A;  1DO0 A;  1C64 A;  1DPW A;  4DD9 A;  1SXJ B;  1LSD A;  4UWV A;  1L88 A;  4HTK A;  4LDO A;  4WL6 A;  3LYO A;  4LZT A;  1IY0 A;  1YL1 X;  1IC5 Y;  2CGI A;  1OUI A;  1JJ3 A;  234L A;  4HLQ A;  125L A;  4ETE A;  1L91 A;  4BBA A;  4DT3 A;  1CX7 A;  3UGJ A;  1QT4 A;  233L A;  5DN4 A;  2BLX A;  1JSE A;  3KP0 E;  3DOA A;  1L19 A;  4EKP A;  5J7C A;  1ZQ9 A;  1GFG A;  3SB6 A;  2DAI A;  2MEH A;  3RZE A;  4RW1 A;  4B4J A;  3PXG A;  1ZV1 A;  2C8O A;  4DR1 M;  1X37 A;  1XFP L;  3AW7 A;  1W5S A;  252L A;  5FEL A;  1BWI A;  1L02 A;  4OWH A;  1C60 A;  1LSZ A;  3HU8 A;  1NNU C;  1LTM A;  4UN2 B;  2JZ1 A;  2ZM6 M;  4EMN A;  147L A;  1L67 A;  1L76 A;  2F2Q A;  5LVJ A;  1WQO A;  1F0W A;  1XGU C;  2YBI A;  4YEM A;  2F5P A;  5HMJ A;  1C6M A;  4BAP A;  2IFF Y;  4MGI E;  2MEE A;  3FI5 A;  2ZNX Y;  3U60 B;  2LC9 A;  1D0M A;  4H9B A;  1HFZ A;  1ALC A;  3SYL A;  4IBK A;  4LT0 A;  3GQ3 A;  2HKJ A;  1LGU A;  1ZAE A;  1G1V A;  3MMP A;  1GF5 A;  4DAJ A;  2O5R A;  1G0J A;  3LN2 A;  3D9A C;  2F2N A;  2MEI A;  1PRB A;  3U6D A;  3W6B A;  3W68 A;  1C6E A;  1UIE A;  1C1K A;  205L A;  4ARJ A;  5F9X A;  2C96 A;  1BB4 A;  3FUU A;  1IWX A;  1CU6 A;  1I56 A;  3CF2 A;  3VW7 A;  1EQ4 A;  4NL4 H;  4ZIX A;  1SX2 A;  2C98 A;  4JI3 M;  107L A;  2XFS A;  1LMP A;  1QUS A;  3GLF E;  5IDD A;  3KOZ E;  1L00 A;  2OE4 X;  1CU3 A;  4DC4 A;  1G0K A;  2K6B A;  3MJ5 A;  2HWJ A;  3FUT A;  4GHA A;  4Z6Y A;  4PT5 A;  2O7A A;  2RAZ X;  1BQL Y;  1KNI A;  5KPR A;  5JI3 E;  2RB1 X;  1TLA A;  3CDQ A;  3TQS A;  4NGO A;  1IM2 A;  1C6L A;  5FDJ A;  3KVW A;  1GFU A;  2I26 L;  4NGI A;  2P5T A;  1C68 A;  1Z5B A;  1CVK A;  3FRI A;  247L A;  4LJ7 A;  2LVA A;  5JEN B;  4H91 A;  2OTZ X;  4ARQ B;  4TUN A;  4FCW A;  4XJF A;  1L37 A;  2VF8 A;  1LKR A;  4W96 A;  1OQM A;  1L35 A;  1C43 A;  1L72 A;  1LMA A;  1L26 A;  4P17 A;  5LMU M;  4Z98 A;  1C6H A;  1LI6 A;  2NQ8 C;  1Z5A A;  1HNL A;  4G4B A;  4ETD A;  4YX7 C;  3UMM A;  1L50 A;  5FST A;  4LJ9 A;  3AOE C;  5FTK A;  3J80 S;  2WZJ A;  2X8A A;  4LYB A;  4QNR A;  5KXL A;  3TWM A;  1QT7 A;  1YUB A;  138L A;  1QTZ A;  4I7Q A;  148L E;  2DWL A;  1L59 A;  1ZVY B;  3NY9 A;  1C6A A;  3TMX A;  4D81 A;  2M5Z A;  1J09 A;  1BGI A;  2HU1 A;  3VK7 A;  4BS7 A;  5H37 D;  1NO1 A;  1L07 A;  3UJN A;  3GPY A;  1XEI A;  4OO9 A;  3PNY A;  1NVM A;  1SXJ A;  2EKF A;  3QY4 A;  1XXH E;  4IAP A;  4WM1 A;  1GHL A;  4DR7 M;  1WGL A;  1C6P A;  1IC7 Y;  7LYZ A;  4DJH A;  1WGN A;  2QQ8 A;  1LKS A;  4NHI A;  1IP1 A;  3FTC A;  3RT5 X;  5KXN A;  1TTE A;  1EPY A;  4I7S A;  4AKG A;  1IBL M;  4L8R C;  1L71 A;  4KXI A;  4LY6 A;  3QNG A;  3AZ7 A;  3DN8 A;  5EP3 A;  166L A;  123L A;  3G3X A;  2JZ0 A;  4DR4 M;  1O23 A;  2FBD A;  2NTG A;  3LYM A;  2ZTC A;  4OVZ B;  3QYE A;  4MGH A;  2B72 A;  195L A;  4WL7 A;  256L A;  5D5F A;  1QZE A;  118L A;  4BAF A;  5E9R A;  1AZF A;  1LYF A;  3NYA A;  5LZM A;  1LZG A;  2CV2 A;  3FAD A;  1GE2 A;  1NSF A;  5M1Y A;  200L A;  2F5S A;  5IEL A;  3R8F A;  4KLN A;  2G5G X;  2O25 A;  1LJH A;  2ZAN A;  4MGY E;  1C6Q A;  1CX6 A;  3RE8 A;  1IP4 A;  1KIQ C;  1IQP A;  5HLL A;  4L16 A;  1B7N A;  3T36 A;  2FH0 A;  4I7T A;  3WW5 A;  2DWZ B;  4JI7 M;  186L A;  4DD2 A;  1OKS A;  5B59 A;  4AQN A;  1HEO A;  4ARP A;  1LSF A;  2OE9 X;  244L A;  1KXX A;  1L27 A;  2R0I A;  4ARL A;  5I54 A;  1Z59 A;  3J81 S;  1HFY A;  4JI5 M;  2KNV A;  2JY6 B;  4H8X A;  1GFE A;  1LJG A;  1C6D A;  3EBA B;  5KXP A;  2Z12 A;  1HEQ A;  3L25 A;  3N9E A;  2BQM A;  1DI5 A;  168L A;  6LYT A;  3G3B B;  1D2Y A;  1JEF A;  1C6F A;  5FTM A;  4JI6 M;  1JSF A;  4M9Z A;  2JWS A;  4NHQ A;  1LJJ A;  1GAY A;  1XHB A;  4JI4 M;  4DV0 M;  1I94 M;  4M0D A;  3GPU A;  2BQO A;  3CSZ A;  3DN1 A;  2CHV A;  1GFK A;  1P3N A;  3U6P A;  3TXH A;  188L A;  1REX A;  2BQF A;  5B06 A;  132L A;  3LVV A;  4FDY A;  3RGP A;  2L4F A;  4LRT A;  237L A;  1PJI A;  3P66 A;  1E94 E;  1GB6 A;  1DGB A;  1OVK A;  3GUI A;  4H9E A;  5B07 A;  2DAK A;  1L90 A;  3ZC7 B;  2DAE A;  4G4Q A;  1Q39 A;  133L A;  3KOX E;  4WG7 A;  1GFH A;  1HNX M;  3OE6 A;  3OK0 A;  5GKN A;  4B3T M;  4RLN A;  1IOC A;  1AIP C;  240L A;  1L29 A;  3GLG A;  1L21 A;  1L69 A;  206L A;  3TXB A;  1IN5 A;  2J7N A;  3HHY A;  1Z55 A;  2C99 A;  1IP2 A;  4EOF A;  2BQJ A;  1HHL A;  2F4V M;  3CF6 E;  1JQJ C;  1C6K A;  2LTU A;  1OQY A;  1B5W A;  1QIO A;  2XFT A;  4DYG A;  3VKH A;  1DI4 A;  4C5F A;  4GC5 A;  1DZB X;  2EPE A;  4WMG A;  3B7Z A;  3FTE A;  2OOA A;  3C58 A;  1L66 A;  2XF3 A;  2KZU A;  3A3Q A;  4LGK A;  1YLA A;  3RZ4 A;  4FCT A;  1JHL A;  3AV0 A;  1GDW A;  4NHP A;  2MED A;  2LWX A;  257L A;  1JR3 E;  2KA6 B;  1GFJ A;  182L A;  3CSQ A;  4NWE A;  216L A;  3GUN A;  1C6G A;  4W59 A;  212L A;  4WO6 A;  4W53 A;  4IBE A;  1IOS A;  1CKD A;  3DN4 A;  3E4R A;  1YQV Y;  2F5N A;  4QEQ A;  3J6K A;  2ZQ4 A;  3RFW A;  1P6Y A;  4HJV A;  1HER A;  109L A;  4LGM A;  2D6B A;  1WQP A;  1WVU A;  2K0B X;  238L A;  2OU0 X;  3T6P A;  3HH4 A;  1DXJ A;  1GE4 A;  2KDL A;  4LYC A;  2DQC Y;  3GXR A;  3C7W A;  2VB1 A;  4IJF A;  2MEC A;  4KL7 A;  1IN8 A;  1J7K A;  5EXT A;  1L64 A;  1L84 A;  2QZ4 A;  1T6H A;  2DQG Y;  5D5C A;  194L A;  3GQ5 A;  2G4P A;  2XEP A;  1L77 A;  1QTK A;  185L A;  2HUM A;  2QSF X;  1CV0 A;  1LGW A;  149L A;  2LVP C;  4L78 A;  1P46 A;  4ARQ A;  3CT0 A;  2H1R A;  1WHC A;  1MX0 A;  5KKI A;  1OAI A;  3V2Y A;  2DQI Y;  2FS1 A;  2LHG A;  1IY4 A;  4H1P A;  4ET9 A;  3PBL A;  5DL9 A;  4CIZ A;  3B0K A;  4L15 A;  1JB0 F;  1LV7 A;  4W54 A;  1CUQ A;  1BVS A;  3UK6 A;  3U61 B;  2XJW A;  1G71 A;  5LXW A;  1L61 A;  3E3D A;  4DR5 M;  1WVV A;  3SAW A;  2N5Z A;  3HT7 A;  1D3F A;  4DD0 A;  1CV6 A;  3Q8G A;  4P16 A;  2CV1 A;  1L0K A;  4M9S A;  1XGP C;  4LT2 A;  3WUL A;  3IEC A;  2R45 A;  4HTQ A;  3SB8 A;  3C81 A;  2QPA A;  1QT3 A;  167L A;  1T8F A;  4EKS A;  5KXR A;  4WM2 A;  4B08 A;  1C69 A;  3HJ8 A;  5FLX S;  254L A;  120L A;  4KPM A;  4YOP A;  4GCB A;  145L A;  4NGJ A;  4G4N A;  236L A;  1KY1 A;  4HP0 A;  3ATO A;  4QDN A;  4DKL A;  1HEL A;  4H94 A;  1DQJ C;  1SG9 A;  2FOI C;  5EXS A;  4XJB A;  1GL7 A;  2LZM A;  4D80 A;  1LMC A;  154L A;  4X62 M;  2KHH A;  1BB7 A;  1P64 A;  1QSW A;  1L06 A;  4YF2 A;  3RNX A;  2WSF F;  3B0O A;  2RH1 A;  4LFP A;  3KXE C;  135L A;  3TMV A;  2HEF A;  1DYG A;  211L A;  4OOT A;  1JUG A;  1L70 A;  1HT1 E;  4B7F A;  2BQB A;  3FE0 A;  1LSP A;  3HWS A;  1JIY A;  1L2C A;  1WTM A;  2LNH C;  1L97 A;  4NWH A;  3G3A B;  4CIS A;  1V34 A;  3GUL A;  3WXU A;  3HTG A;  1HT2 E;  4JI0 M;  1LSC A;  1TDZ A;  1P7S A;  4NGV A;  1G59 A;  4MR1 A;  4LFC M;  1L30 A;  4NSR A;  2GQF A;  3T1H M;  3GRU A;  1L92 A;  1QUD A;  4NRW A;  261L A;  1R7R A;  2D91 A;  2Z19 A;  5EXP A;  3M3U A;  3QYB A;  1C65 A;  2A7F A;  5F3W A;  1XEK A;  2JY7 A;  3HT6 A;  4I4L A;  3MK6 A;  3G3V A;  3HUQ A;  1QUH A;  2DWN A;  3K3T A;  1LZY A;  1QSB A;  1G8P A;  3J7A S;  4G6Z A;  4L6V 6;  1OTR A;  1LWG A;  3SBJ A;  232L A;  1YKX X;  4Z46 A;  1L49 A;  2M60 A;  2K47 A;  7LZM A;  1C7P A;  1B7L A;  2APL A;  2OQ4 A;  2C5R A;  1GB3 A;  4D9Z A;  3GLI B;  4M0W A;  3HU9 A;  173L A;  196L A;  3VK8 A;  2H5Z A;  2ZNW Y;  2XZF A;  4R6C A;  2C9O A;  1HEM A;  2XSZ D;  3GPP A;  1YAQ A;  1I20 A;  1TEW A;  3GUM A;  2QEN A;  4TSB A;  3TXG A;  3I01 M;  2MGW A;  5DM9 A;  1LZN A;  3L27 A;  1L1Z A;  1GB7 A;  4NY5 A;  3WMK A;  3GLI E;  2G4Q A;  1L44 A;  1I4W A;  1FLQ A;  1QTB A;  3JAM S;  1GFV A;  3T1Y M;  1SWZ A;  4DBG B;  1V92 A;  1C62 A;  3C7Y A;  3HJS A;  1JIT A;  4FWH A;  4W58 A;  1L05 A;  4UWU A;  2KNA A;  2JA2 A;  1NJF A;  1GBX A;  2FYC A;  2OE7 X;  1YL0 X;  3B72 A;  4JXJ A;  150L A;  1E9S A;  5FCP A;  1UA6 Y;  1IX0 A;  3KDS E;  2JUJ A;  3R9X B;  4GKJ M;  1L63 A;  4GHL A;  209L A;  5DNY A;  3U6L A;  1IO5 A;  4OVZ A;  3WPL A;  3SYK A;  1DGF A;  2R65 A;  1C66 A;  3L29 A;  1YSY A;  2DWM A;  1DYF A;  1IR9 A;  1QS5 A;  5KXK A;  1INU A;  1L51 A;  1QSQ A;  1LYI A;  4OW1 A;  2C9C A;  2GNO A;  5KO3 A;  1B5U A;  1GL6 A;  1D9W A;  2BQD A;  2Z39 A;  1NNJ A;  3NBI A;  1G06 A;  3DZD A;  3U6C A;  2ERC A;  3RUN A;  5E4P A;  3AOE A;  1G7H C;  3VFD A;  1KIP C;  6LYZ A;  1C6N A;  1L99 A;  4YM8 A;  2CE7 A;  3VDP A;  4LF6 M;  1DYD A;  174L A;  4NIJ A;  1L09 A;  1OUB A;  4Q7J A;  4YXA C;  3TPZ A;  1C6B A;  1GFT A;  3CDR A;  3QE8 A;  1WJ7 A;  2LHM A;  1YAN A;  6LZM A;  1WXQ A;  1WQQ A;  2OPF A;  1G7J C;  1GB9 A;  1TH4 A;  1L28 A;  3K92 A;  1WTH A;  3LCV B;  4PPO A;  1L57 A;  1I6S A;  3U6E A;  2QB0 B;  3TXE A;  1L56 A;  4AZF A;  1OUA A;  3PDS A;  4H9C A;  3GRY A;  4NGK A;  3OE8 A;  1LYE A;  4I7K A;  4W51 A;  3GLF B;  1V7S A;  3C80 A;  1IC4 Y;  1QZM A;  1OAO C;  4DQ7 A;  2MH8 A;  3W0F A;  4WW0 A;  1DV0 A;  1L32 A;  1QT5 A;  2RBN A;  3HH6 A;  3HTB A;  1L53 A;  5KXY A;  5I14 A;  1G0Q A;  155L A;  2CJL A;  2D4K A;  1DYE A;  3A42 A;  4JI1 M;  1TH2 A;  2LBC A;  5EP4 A;  1IWW A;  1OFH A;  3CT5 A;  3GRV A;  1UIC A;  2B5Z A;  5E6J A;  1GF7 A;  2FNA A;  1UFZ A;  1GWD A;  4YEO A;  5IHG A;  2LZT A;  1CJ9 A;  1MN3 A;  1SXJ D;  2ZBK B;  1L98 A;  4TX7 A;  3ODU A;  4IBI A;  3T6U A;  1BVK C;  1G7I C;  4AQY M;  2F5O A;  1OV5 A;  245L A;  4PJ2 C;  2CHG A;  2OU8 A;  4WOA A;  1N78 A;  1RE2 A;  2UUC M;  1HC0 A;  4LT1 A;  4I7M A;  1OIZ A;  2EA0 A;  2ZIL A;  3ZQJ A;  5LA5 A;  2A5Y B;  2Y8P A;  4XGI A;  3A67 Y;  2RKO A;  4NSH A;  4DUY M;  1D0L A;  208L A;  4R3D A;  5DFL A;  5C6I A;  1CU5 A;  1PJT A;  1T43 A;  2I25 L;  4CFO A;  1GB2 A;  5L3I A;  1L11 A;  2BPU A;  3TXD A;  1EQ5 A;  2BLY A;  1L89 A;  1G1W A;  2YR0 A;  4NSJ A;  1TF0 B;  1ZYT A;  1A2Y C;  2CDS A;  4LF7 M;  3FRH A;  3H4J A;  1JJ0 A;  3W6D A;  4XJH A;  5KKJ A;  1L60 A;  4IBD A;  1OUG A;  3W3E A;  4EJ4 A;  4QY9 A;  4B3S M;  1IXZ A;  3IG8 A;  113L A;  5APE A;  3FA0 A;  3HU3 A;  5II3 A;  2HUL A;  2K9D A;  3HH5 A;  189L A;  137L A;  1GBY A;  1L80 A;  4G4C A;  1K3W A;  1SSY A;  2HEC A;  3HU1 A;  1LMO A;  3A98 B;  4DD7 A;  1SXJ E;  250L A;  4II8 A;  152L A;  4OOO A;  2RRU A;  3C9P A;  1GBO A;  3HT9 A;  1GE1 A;  1W5T A;  4IBB A;  1HR0 M;  1JWR A;  4PK0 A;  1W08 A;  1JTM A;  3L26 A;  5B1G A;  5LVK A;  3SAS A;  3HGI A;  5LVG A;  3C7Z A;  3OTO M;  2Q9E A;  4D82 A;  2VQF M;  1ZMV A;  1T3T A;  3DMZ A;  5KXM A;  4LFB M;  4BLC A;  2BQI A;  3ZVQ B;  231L A;  3DFZ A;  1LOZ A;  4KOD A;  1BB6 A;  1B5X A;  2EO2 A;  3FD9 A;  1L96 A;  5LA8 A;  1PQI A;  1CU2 A;  2DQF C;  239L A;  5FHW A;  1LSM A;  1DO2 A;  2V1C A;  4GIT A;  4X3B A;  1RCM A;  2BAA A;  3EO5 A;  4DR6 M;  4RKU F;  2EKS C;  3HY5 A;  2QNJ A;  9LYZ A;  5EQT A;  1L62 A;  3IJV A;  4EKR A;  1GAB A;  2CP8 A;  3KFU G;  104L A;  3KW6 A;  1IY1 A;  4CJ6 A;  4OX9 M;  1N4F A;  3GUP A;  2I7N A;  2DVW B;  1KSF X;  2RGO A;  4FWG A;  178L A;  2FYD A;  3FYD A;  3E46 A;  1WQN A;  3SFZ A;  1QTD A;  3ZVQ A;  5K7O A;  1BB3 A;  219L A;  1HNW M;  1HSX A;  1L16 A;  3WU9 A;  3C3E A;  1L40 A;  5ILF A;  1JTO L;  1D2N A;  3FUX A;  2HEA A;  2BJW A;  2JP7 A;  3EIE A;  1XJU A;  2F32 A;  2DBT A;  4ETA A;  218L A;  2XBR A;  1HEP A;  217L A;  3U5Z B;  2L7I A;  4K0K M;  4LYO A;  2JY5 A;  4MGK E;  2EIZ C;  2L4E A;  4H9I A;  3LYZ A;  3HUA A;  181L A;  4MM3 B;  1FLW A;  2R4E A;  1QTE A;  5T3F A;  3N9C A;  1LSY A;  1L22 A;  3A93 A;  1KS3 A;  139L A;  4BB9 A;  4JYA M;  3SAT A;  1NBY C;  3K2R A;  3B6L A;  4XJD A;  2VDB B;  1F6S A;  1VDL A;  2OU9 A;  3WUN A;  146L A;  2DHY A;  3K1J A;  2RBP A;  2W1X A;  1LGX A;  1IN7 A;  5KQD A;  1L42 A;  2OOB A;  3TXF A;  3V76 A;  5LYZ A;  1HEW A;  3D3D A;  4Z3M A;  4MGZ E;  4LZJ A;  4GN4 A;  2Z18 A;  4AXT A;  3GLH A;  3HWL A;  3WVX A;  1IOQ A;  4YXC A;  1VED A;  4LG2 A;  5LIN A;  1IWZ A;  2BJV A;  5FEK A;  5EXX A;  3SB9 A;  3TXK A;  2B6T A;  3IHP A;  1DYB A;  2BQE A;  3FUW A;  3GPX A;  1L08 A;  2DZL A;  3ULR A;  5I5Q A;  1XB2 B;  5KXZ A;  3C3D A;  2ZIK A;  5IRE B;  3ZH9 B;  1G0L A;  1GB8 A;  3GO8 A;  3SBA A;  1UAC Y;  3DKE X;  2QHO B;  4W55 A;  1B6I A;  4KT0 F;  1TCY A;  1D6Q A;  1NJG A;  3HFM Y;  1LZR A;  2PC2 A;  3EXD A;  242L A;  1KXY A;  3Q8X A;  1XEP A;  8CAT A;  1JKC A;  3MGW A;  1AT5 A;  1CUP A;  243L A;  1L0J A;  1B7M A;  2RB0 X;  4I81 A;  1YIK A;  4KHP M;  3VKG A;  1P37 A;  163L A;  1XSF A;  2YNM D;  4N1C C;  1J1X Y;  1L79 A;  2KZS A;  7CAT A;  1B7Q A;  1L2D A;  4OWE A;  1N34 M;  4HJZ A;  5LAG A;  1L39 A;  5KQ8 A;  220L A;  1B5V A;  177L A;  4WUR A;  4EIW A;  111L A;  1CKF A;  1UC0 A;  1UIG A;  131L A;  2HAK A;  1ZV5 L;  1DGG A;  3J2P B;  1CV5 A;  3HZJ A;  1D3J A;  4CHT B;  2UUB M;  4R7G A;  1CJ8 A;  1LHJ A;  1LMT A;  2A7D A;  4PHI A;  4WM5 A;  5DN5 A;  1QAQ A;  4L4U A;  4ITQ A;  190L A;  230L A;  1IOR A;  2DQD Y;  1B5Y A;  3DA1 A;  3CB7 A;  1T6O A;  3HDF A;  1LJI A;  1R2Z A;  2W1M A;  2R46 A;  164L A;  3BKH A;  3CF0 A;  128L A;  5FSW A;  1PJS A;  5ITX E;  1DI3 A;  4NSI A;  1L83 A;  3BBZ A;  4L41 A;  1GBS A;  3GUK A;  2KRK A;  3PFI A;  199L A;  1FKV A;  2DEN A;  2R44 A;  1IBK M;  3KOW E;  4ZFP A;  2Y20 A;  4HL4 A;  1L46 A;  1D3M A;  1GD6 A;  3KOY E;  2UXC M;  226L A;  2Z2F A;  4KO8 A;  4DDB A;  1CUK A;  3WU8 A;  4M4O A;  4DV6 M;  1C10 A;  4B1A A;  3QWL A;  1IWT A;  2FFJ A;  2H9K A;  3FI7 A;  3ILK A;  3HBH A;  3GXK A;  3BXW A;  5C6L A;  4W57 A;  2IGC A;  3EMS A;  5IZ7 D;  2DNA A;  1G41 A;  221L A;  4B0D A;  1TGU A;  2B6X A;  3PVS A;  2E5L M;  1DKK A;  1GF9 A;  4GCD A;  1PGY A;  4E3U A;  3IJU A;  1IWV A;  2L09 A;  4IIW A;  2V1U A;  4RF1 A;  5I4W A;  1G7M C;  2WAR A;  2IHL A;  4J7V A;  2XBS A;  3GP1 A;  4NGW A;  1TBY A;  4W56 A;  3B74 A;  1LI3 A;  1NBZ C;  2F47 A;  5ITQ A;  3AYQ A;  2W1L A;  3A95 A;  3T15 A;  4II7 A;  3HTF A;  3RU5 A;  1LZ6 A;  2W82 A;  4DV3 M;  2AUB A;  1LZT A;  2BQK A;  3B9P A;  2OTY X;  2W1Y A;  4EKQ A;  1VDS A;  201L A;  1GJS A;  3L2X A;  3M0E A;  2KNZ A;  1SQ2 L;  1IY3 A;  1VDP A;  2HUB A;  1D0K A;  2XLJ A;  1DYA A;  1UID A;  1QYR A;  1LZ8 A;  1L47 A;  3BOS A;  3LCU A;  1IY2 A;  5E26 A;  1VQ1 A;  2D7H A;  4IBC A;  3AW6 A;  1GF4 A;  1JTT L;  3OE9 A;  1K28 A;  1K3X A;  1LZD A;  2VF7 A;  3AFH A;  4I7J A;  1CKG A;  2O01 F;  1VEK A;  3H4M A;  103L A;  3ATN A;  4JI2 M;  3HX3 A;  4B3M M;  1PQJ A;  1N75 A;  1KFV A;  5F16 A;  222L A;  3GLH B;  4IBG A;  4WLY A;  4R71 A;  2Z3X A;  3HU2 A;  5KPT A;  2L2D A;  2O4W A;  3A90 A;  4A7D A;  3AOG A;  4B7G A;  1YAM A;  2G4N A;  4B49 A;  4LZZ A;  2ZYP A;  3A45 A;  2YBH A;  1CTW A;  4LYM A;  3T38 A;  2H9J A;  1LYZ A;  1L82 A;  1P2L A;  4NEB A;  1IOT A;  5LVH A;  4NSG A;  4TSC A;  4UWN A;  5A2Q S;  1L43 A;  1I1Z A;  1LI2 A;  260L A;  1LYG A;  3CDT A;  3GUJ A;  1LWK A;  3LYT A;  4RF0 A;  1HF4 A;  4YY3 M;  3P68 A;  3CTW B;  3ZCB B;  1L93 A;  3SMP A;  1XXH B;  2N35 A;  213L A;  2RBQ A;  4NFV A;  4ARM B;  5IWA M;  1NV8 A;  3P64 A;  3AGH A;  4DQ5 A;  1E9R A;  1JR3 D;  4GC9 A;  1V33 A;  255L A;  3N9A A;  4XBO A;  4N1E I;  4IBJ A;  1LPY A;  4B4I A;  2LZ2 A;  2XQO A;  1E8L A;  1C6J A;  2Y0T A;  1Q3C A;  5ITX A;  2MEB A;  1T3P A;  3W6C A;  4NG1 A;  3WU7 A;  2Y21 A;  1IR8 A;  1IBM M;  2CEA A;  1XC8 A;  1CV1 A;  3DN3 A;  3W6A A;  1IWY A;  2BNK A;  1B2K A;  1HML A;  2B6Y A;  4H9H A;  2BQG A;  253L A;  4WM4 A;  1G3I A;  1F6R A;  2KW0 A;  2DAG A;  2FE8 A;  2QAR C;  2EUC A;  3HHZ A;  4TWS A;  4QOZ C;  4LGY A;  1IR7 A;  1LSE A;  2XH9 A;  1PQM A;  4OWA A;  2J7O A;  2CUZ A;  3U60 A;  1RFP A;  4N0J A;  3G3W A;  1LZC A;  4FVM A;  4HSF A;  2B74 A;  5B1F A;  4NXN M;  2D7G A;  2EQL A;  2RSC A;  1J5E M;  1FLU A;  1YKY X;  4LDL A;  4I8S A;  4IJ4 A;  2R18 A;  1EFU B;  1LHL A;  4IBF A;  2BQH A;  4S0W A;  1SWY A;  1NMM A;  165L A;  5KXX A;  3WL2 A;  1IN6 A;  3B0I A;  1NWG A;  1A5T A;  3WYH A;  3PNV A;  1UIB A;  2D4J A;  1GXV 2;  1LJ4 A;  1REZ A;  2FBB A;  2YSS C;  4CGY B;  3EML A;  4PRQ A;  4NSO B;  2I7P A;  4LT3 A;  2YVB A;  4I0C A;  4H92 A;  5A3Z A;  2F4G A;  1LHK A;  3HUK A;  3LZM A;  3TXJ A;  3A8Z A;  4LYZ A;  1GPQ C;  4WP2 A;  1H87 A;  207L A;  4J0L A;  2F5Q A;  3W6F A;  4HPI A;  5HNC A;  1LSG A;  1G0P A;  2J5Y A;  151L A;  1C6I A;  2RGH A;  3W0L B;  2BQA A;  3P65 A;  4Y28 F;  1TDY A;  4DDC A;  2Z2E A;  5DYI A;  2A4T A;  1T8A A;  5L8R F;  4K5Y A;  4G3O A;  4RLM A;  2B70 A;  4B3R M;  4HV2 A;  3WHL A;  3E21 A;  3SMS A;  1CV4 A;  1UUZ C;  3NBX X;  1WR1 B;  1IEE A;  2ZYC A;  3AB6 A;  2B6Z A;  1Q02 A;  1CNS A;  4I7P A;  1VDQ A;  3WHK A;  5B05 A;  4XJI A;  5ITR A;  2YFQ A;  1CKC A;  1CU0 A;  3NY8 A;  3AJI B;  1REM A;  1XMO M;  1IP6 A;  4QNM A;  3CT1 A;  4GN5 C;  1BVX A;  2WSE F;  2UXB M;  1EIJ A;  1C6T A;  1XNR M;  3TWK A;  4DV7 M;  127L A;  3V2W A;  3CDO A;  4FCV A;  159L A;  241L A;  4RNA A;  1PQD A;  1ZMW A;  2Z37 A;  248L A;  3SP3 A;  2Y0Q A;  4LFX A;  4GMQ A;  3GQ4 A;  2CHQ A;  4PD2 A;  4DD3 A;  3HHW A;  1NY5 A;  3SB5 A;  4FJR A;  1PQO A;  3M6A A;  4AG6 A;  1C67 A;  175L A;  1LHH A;  1EL1 A;  1R4G A;  214L A;  1LSA A;  1YAO A;  4N5R A;  122L A;  2Q9D A;  1LZB A;  4ZPX A;  4LF9 M;  1IXR C;  2RBS A;  4GLA A;  3L2A A;  3HBE X;  4PRU A;  4U3X B;  3E9S A;  4DV4 M;  184L A;  3B7Q A;  1LLH A;  2UXD M;  4WM3 A;  1MU5 A;  1XGQ C;  4NGZ A;  2BWE A;  1YAP A;  1LJE A;  1IVM A;  3TMW A;  5C1B A;  5JI2 E;  1L13 A;  1SLY A;  3DMV A;  3K8Z A;  3F6Z A;  3J7B A;  5LYM A;  5EJC A;  1BWJ A;  1XWI A;  4DUZ M;  2HU3 A;  4FW9 A;  3WUA A;  1QT6 A;  2G3Q A;  1VEJ A;  1D3N A;  1JKA A;  1MLC E;  4PCZ A;  1J1P Y;  4NRV A;  4MH0 E;  1UIA A;  3AGI A;  1L01 A;  4TTD A;  5KXO A;  1T97 A;  3SN6 R;  1VG5 A;  1L2B A;  2B7X A;  3M18 B;  5F9U A;  3L64 A;  2NTH A;  1FJG M;  1A4V A;  1OUC A;  2ZIJ A;  2MR9 A;  1LJF A;  114L A;  193L A;  8LYZ A;  1L36 A;  4XAD A;  1R5L A;  3WUM A;  1GB5 A;  1QTC A;  115L A;  1VAU A;  3HTD A;  1LYY A;  1D6P A;  2DKV A;  4YEN A;  3A46 A;  1UBZ A;  1C08 C;  4G4O A;  5L9J A;  1IFY A;  1LMN A;  2YBJ A;  1PS5 A;  4HPE A;  4MB7 A;  1B7S A;  5F81 A;  5EP2 A;  3KAM A;  1LAA A;  198L A;  1L17 A;  4QHS A;  3SAR A;  4LF5 M;  4WG1 A;  4WM6 A;  5AMY A;  108L A;  1L10 A;  3B89 A;  5FTL A;  3A92 A;  3D8B A;  1QSA A;  2ZWB A;  180L A;  1MJG M;  2DI0 A;  3K2L A;  102L A;  5HNL A;  5HQ1 A;  1GF3 A;  4H90 A;  3I51 A;  2Z8Y M;  112L A;  1IWU A;  4PDI A;  2MRO B;  2KXE A;  2ANV A;  4GLV A;  1GFR A;  3I4V A;  5DYG A;  1L12 A;  1OFI A;  1QUG A;  1FDL Y;  1FBI X;  3NWL A;  1KW7 A;  170L A;  4DD1 A;  2L7H A;  4H8Z A;  3JR4 A;  3QAK A;  2HUK A;  1KW5 A;  3AL0 C;  1ORY B;  1ZUR A;  2HEB A;  1FKQ A;  4G49 A;  1L45 A;  2LYM A;  4I7N A;  2HEE A;  3AZ4 A;  1ZMU A;  4YHH M;  3KSX A;  4J1A A;  5KXT A;  2YBM A;  1XNQ M;  4DR2 M;  140L A;  1XGT C;  3SC3 A;  1IXS A;  1DPX A;  5C6J A;  1C63 A;  1LSN A;  3OJP A;  5LAF A;  5I4X A;  4GN3 A;  3TWL A;  1L04 A;  3BKV A;  4OW0 A;  5BPV A;  2I6Z A;  3TMU A;  2YBN A;  2B3T A;  4WLD A;  3KS4 A;  4M9X A;  1XMQ M;  2Z6B A;  1NY6 A;  3JR5 A;  2ZTD A;  1G7L C;  224L A;  3VWO A;  235L A;  187L A;  1LPI A;  3D8L A;  4H93 A;  4DWX A;  4LJA A;  2XTH A;  3C82 A;  5LIO A;  1LYO A;  1GE3 A;  4Z8X A;  5APC A;  4ML7 A;  2AHM A;  4DR3 M;  1PJJ A;  3B7N A;  1WQR A;  1QQW A;  3U61 A;  5LMN M;  4LZM A;  3AJN A;  4WO9 A;  4NGL A;  129L A;  1JR3 A;  2YQZ A;  1PM5 A;  4J1B A;  3DNA A;  1RJC B;  2JXN A;  1G0M A;  1L52 A;  4MST A;  2R6F A;  3GLI A;  1RU3 A;  1LZ9 A;  1CJ7 A;  1LHM A;  4HJY A;  2YBL A;  5A3E A;  2MJ5 B;  1GF8 A;  1P56 A;  1QS9 A;  2LXE A;  1QUT A;  1L34 A;  197L A;  4AG5 A;  3J27 B;  2CV0 A;  1B7R A;  5KPZ A;  4P2E A;  4C3W A;  4I7L A;  4LF4 M;  1GLN A;  1PJQ A;  1QTV A;  1T6V L;  4GIP A;  4REZ A;  153L A;  2F30 A;  4I7R A;  110L A;  3C83 A;  4NG8 A;  2NWD X;  2V6Z M;  5KJ9 A;  5KY1 A;  1NKH A;  2C8P A;  1QAM A;  3U6S A;  3TE6 A;  2X49 A;  1OP9 B;  4QOS A;  1D2W A;  259L A;  1DGH A;  3LHM A;  3KP1 E;  2KRU A;  4LRS A;  2ZAM A;  4ZEE A;  1NDM C;  4B4E A;  1F4I A;  4B7H A;  2HED A;  1SX7 A;  3VLF B;  262L A;  3K9P A;  2DHR A;  1BWH A;  3GLH E;  1L68 A;  4HEO A;  2XSZ A;  258L A;  3WXT A;  3LMM A;  1CJ6 A;  1HQY E;  249L A;  4DDA A;  157L A;  4ANR A;  1QDT A;  2LVQ D;  1L73 A;  1Z5C A;  2LVO C;  4EXM A;  4GRV A;  134L A;  2RBR A;  1B7O A;  3I4Y A;  4XEN A;  1WTN A;  3THG A;  1OUJ A;  3SB7 A;  3HBD A;  1KYI A;  4LFA M;  2MEG A;  1P3Q Q;  2CUU A;  4NXM M;  4EPF A;  2CRU A;  1JQU A;  4CGE A;  1Q3B A;  1CV3 A;  1L31 A;  1LYD A;  2XZU A;  1ZWN A;  2LYO A;  4E97 A;  2MEF A;  1B7P A;  1OIP A;  4GRI A;  4ETB A;  1AM7 A;  1L85 A;  2H5X A;  1NQI A;  5DLA A;  215L A;  3A91 A;  3A6C Y;  3LVW A;  1JIS A;  4F1I A;  3VDU A;  5LVI A;  1HFX A;  3SHG B;  1AKI A;  1QQY A;  1L8Q A;  1LYS A;  1XJT A;  1G4A E;  2BQL A;  4PGJ B;  4GBR B;  3DMX A;  5C18 A;  2JNH A;  4Z41 A;  1BB5 A;  1JKD A;  1W6Z A;  3K9O A;  4OWC A;  1B5Z A;  3SBB C;  1DKJ A;  1L18 A;  4NOO B;  1NDG C;  1TH3 A;  2B75 A;  2MEA A;  1KIR C;  2UU9 M;  4NHT A;  3GLG B;  1XXH A;  4LF8 M;  2QCU A;  3P4Z A;  1L41 A;  1WQM A;  1QVR A;  2R4J A;  3RW8 A;  227L A;  4R0F A;  1LCN A;  3SAU A;  2DZN B;  1N36 M;  5I53 A;  1NHB A;  3F8V A;  1F10 A;  1XGR C;  2D4I A;  4EPI A;  4BAD A;  2F4A A;  2D7E A;  1VDT A;  1L23 A;  1HNZ M;  3HT8 A;  3UZU A;  1SXJ C;  1LJ3 A;  1OWZ A;  4G9S A;  1C46 A;  1DYC A;  3D4S A;  4LCB A;  2Q2E B;  4NGY A;  1L15 A;  4X65 M;  1GKI A;  4LJ5 A;  1LZA A;  1GEV A;  1V7T A;  1YIL A;  3LZ2 A;  2BQN A;  3A94 A;  4DV2 M;  3FYC A;  4FWD A;  1LYH A;  1OV7 A;  3WH1 A;  1L25 A;  2ZQ3 A;  3WPJ A;  4XYY A;  3DN2 A;  3LW5 F;  5BR8 M;  1C61 A;  1JPO A;  2LYZ A;  3C8Q A;  4QHT A;  3CSR A;  2CWI A;  4NC6 A;  1GXX A;  4W5W A;  3CGW A;  1S3S A;  172L A;  1C7Y A;  1DGH B;  223L A;  144L A;  1LW9 A;  1IXS B;  1GVN A;  1P36 A;  1QDR A;  4OU7 A;  1GEZ A;  4DV1 M;  1Z6T A;  1AT6 A;  1L14 A;  1H6U A;  1L74 A;  1LZ4 A;  1QAO A;  5FTJ A;  2G8L A;  1OVH A;  5KXS A;  1FLY A;  1GJT A;  1L87 A;  1JJ1 A;  2CFO A;  1JTN A;  1XEJ A;  1HSW A;  1QT8 A;  3HH3 A;  2L6O A;  1Y8G A;  5ITT A;  3F92 A;  3UON A;  3LQR A;  3HKP A;  4LJ4 A;  3HHX A;  3AZ5 A;  2R62 A;  3QAU A;  4I8O A;  1ZMY L;  3W6E A;  4HTN A;  3U5Z A;  4X64 M;  2VQE M;  2OEA X;  4AGA A;  1HJP A;  119L A;  5ILC A;  4W94 A;  2DZO B;  3FTF A;  2Z4S A;  1BHZ A;  1C6C A;  4X66 M;  5ITY A;  1LZE A;  1P5C A;  4HV1 A;  3TXI A;  3L28 A;  2RB2 X;  3FTD A;  3I04 M;  3M7G A;  2ANX A;  1OYU A;  3A96 A;  2B73 A;  4NHS A;  5EBH A;  2DQA A;  5IT9 S;  4G4H A;  1LZS A;  1E32 A;  5APF A;  4FD2 A;  3LQQ A;  1L86 A;  1PZY A;  1L1T A;  1L24 A;  1D9U A;  1HEN A;  4LJ8 A;  2HTX A;  4I7O A;  1IP3 A;  2EJS A;  1J1O Y;  5FTN A;  2LHC A;  2VII A;  1OWY A;  3A6B Y;  2CWB A;  246L A;  4WLX A;  5L3H A;  1TDH A;  2DQE Y;  3LZT A;  5I4Y A;  1YRO A;  3F9L A;  3KSJ A;  4JI8 M;  162L A;  2HCB A;  1QAN A;  4XK8 F;  2GV0 A;  4DV5 M;  1LMQ A;  5EP1 A;  4RW2 A;  3GLF A;  2QBY A;  192L A;  4ZPU A;  4AKH A;  2Z38 A;  4JV5 M;  4CFP A;  4TUW A;  1LJN A;  4N9R A;  176L A;  3RGS A;  1P2C C;  141L A;  4CJ2 A;  2DXI A;  1FN5 A;  4JN6 A;  3CDV A;  4W52 A;  4RDS A;  1LYJ A;  1K82 A;  1G07 A;  171L A;  4LYT A;  2WSC F;  1LSB A;  3U6Q A;  4PDG A;  1IP7 A;  4XJG A;  4N8Z A;  183L A;  1GB0 A; 
#chains in the Genus database with same CATH homology
 228L A;  2Q0M X;  4ETC A;  3A3R X;  1L75 A;  4H9F A;  1L03 A;  1LHI A;  4GCF A;  4ARM A;  2O79 A;  4GCE A;  1REY A;  142L A;  5LYT A;  4O34 A;  1IP5 A;  1GBW A;  210L A;  1L48 A;  1L94 A;  160L A;  1L95 A;  3JR6 A;  1YKZ X;  5APD A;  126L A;  1RI8 B;  1SSW A;  2BQC A;  158L A;  3OE0 A;  4XN6 A;  4LDE A;  2DQH Y;  1H6M A;  1L55 A;  251L A;  1NHE A;  2L78 A;  1L65 A;  1PQK A;  1UIF A;  1VFB C;  1GAZ A;  1OUD A;  2DQJ Y;  3HDE A;  2RAY X;  1LJK A;  1JKB A;  1LZ5 A;  1MEL L;  3AZ6 A;  1GE0 A;  1C45 A;  1QUO A;  1UIH A;  1LZ1 A;  4IAT A;  1G0G A;  2RBO A;  3C8R A;  156L A;  1UCO A;  3C8S A;  3DN0 A;  1HMK A;  4IAS A;  4MCK A;  1T8G A;  130L A;  4CHX A;  1KXW A;  1ZVH L;  3A34 A;  1GF6 A;  1NF5 A;  1L38 A;  2B6W A;  2YDG A;  3ZEK A;  1P2R A;  1L20 A;  1B0D A;  3IWR A;  4H9A A;  1L58 A;  1L54 A;  1EQE A;  1TAY A;  2LCB A;  1L81 A;  3WVY A;  143L A;  4GCC A;  5F14 A;  1VAT A;  1L33 A;  1GDX A;  225L A;  4OWB A;  169L A;  3GUO A;  191L A;  1QTH A;  1IIZ A;  4PJZ A;  5KXW A;  4H8Y A;  1GBZ A;  1OUH A;  3AGG G;  1GFA A;  4DQJ A;  1OUE A;  161L A;  229L A;  3J4G A;  1JTP L;  4WLT A;  1CKH A;  4QGZ A;  4KT3 A;  3WPK A;  5HMV A;  3CQL A;  4M6D A;  1OVJ A;  3WW6 A;  3DN6 A;  1OUF A;  2X0A A;  1GF0 A;  4ET8 A;  1B9O A;  1C64 A;  1DPW A;  4DD9 A;  1LSD A;  4UWV A;  1L88 A;  4HTK A;  4LDO A;  4WL6 A;  3LYO A;  4LZT A;  1YL1 X;  1IC5 Y;  2CGI A;  1OUI A;  1JJ3 A;  234L A;  125L A;  4ETE A;  1L91 A;  4DT3 A;  1CX7 A;  1QT4 A;  233L A;  5DN4 A;  2BLX A;  1JSE A;  1L19 A;  4EKP A;  5J7C A;  1GFG A;  3SB6 A;  2MEH A;  3RZE A;  4RW1 A;  4B4J A;  2C8O A;  1XFP L;  3AW7 A;  252L A;  5FEL A;  1BWI A;  1L02 A;  4OWH A;  1C60 A;  1LSZ A;  3HU8 A;  1LTM A;  4EMN A;  147L A;  1L67 A;  1L76 A;  2F2Q A;  5LVJ A;  1WQO A;  1F0W A;  1XGU C;  2YBI A;  4YEM A;  5HMJ A;  1C6M A;  4BAP A;  2IFF Y;  2MEE A;  3FI5 A;  2ZNX Y;  2LC9 A;  1D0M A;  4H9B A;  1HFZ A;  1ALC A;  4LT0 A;  1LGU A;  1G1V A;  1GF5 A;  4DAJ A;  1G0J A;  3LN2 A;  3D9A C;  2F2N A;  2MEI A;  3W6B A;  1C6E A;  1UIE A;  205L A;  4ARJ A;  5F9X A;  1BB4 A;  1IWX A;  1CU6 A;  1I56 A;  3VW7 A;  1EQ4 A;  4ZIX A;  1SX2 A;  107L A;  1LMP A;  1QUS A;  5IDD A;  1L00 A;  2OE4 X;  1CU3 A;  4DC4 A;  1G0K A;  2O7A A;  2RAZ X;  1BQL Y;  1KNI A;  2RB1 X;  1TLA A;  3CDQ A;  4NGO A;  1C6L A;  5FDJ A;  1GFU A;  2I26 L;  4NGI A;  1C68 A;  1CVK A;  247L A;  5JEN B;  4H91 A;  2OTZ X;  4ARQ B;  4TUN A;  4XJF A;  1L37 A;  1LKR A;  4W96 A;  1OQM A;  1L35 A;  1C43 A;  1L72 A;  1LMA A;  1L26 A;  4Z98 A;  1C6H A;  1LI6 A;  1HNL A;  4G4B A;  4ETD A;  4YX7 C;  5FST A;  1L50 A;  4LYB A;  5KXL A;  1QT7 A;  4I7Q A;  138L A;  1QTZ A;  148L E;  1L59 A;  1ZVY B;  3NY9 A;  3TMX A;  1C6A A;  1BGI A;  2HU1 A;  4BS7 A;  1L07 A;  1XEI A;  4OO9 A;  3QY4 A;  4IAP A;  4WM1 A;  1GHL A;  1C6P A;  1IC7 Y;  7LYZ A;  4DJH A;  1LKS A;  4NHI A;  1IP1 A;  3RT5 X;  5KXN A;  1EPY A;  4I7S A;  1L71 A;  4KXI A;  3QNG A;  3AZ7 A;  3DN8 A;  166L A;  123L A;  3G3X A;  1O23 A;  2FBD A;  2NTG A;  3LYM A;  2B72 A;  195L A;  4WL7 A;  256L A;  5D5F A;  118L A;  4BAF A;  5E9R A;  1AZF A;  1LYF A;  3NYA A;  5LZM A;  1LZG A;  3FAD A;  1GE2 A;  5M1Y A;  200L A;  5IEL A;  1LJH A;  1C6Q A;  1CX6 A;  1IP4 A;  1KIQ C;  5HLL A;  1B7N A;  3T36 A;  4I7T A;  3WW5 A;  186L A;  4DD2 A;  5B59 A;  4AQN A;  1HEO A;  4ARP A;  1LSF A;  2OE9 X;  244L A;  1KXX A;  1L27 A;  4ARL A;  5I54 A;  1HFY A;  4H8X A;  1GFE A;  1LJG A;  1C6D A;  3EBA B;  5KXP A;  2Z12 A;  1HEQ A;  3N9E A;  2BQM A;  1DI5 A;  168L A;  6LYT A;  3G3B B;  1D2Y A;  1JEF A;  1C6F A;  1JSF A;  4NHQ A;  1LJJ A;  1GAY A;  1GB0 A;  2BQO A;  3CSZ A;  3DN1 A;  1GFK A;  1P3N A;  3TXH A;  188L A;  1REX A;  2BQF A;  5B06 A;  132L A;  4FDY A;  237L A;  3P66 A;  1GB6 A;  1OVK A;  3GUI A;  4H9E A;  5B07 A;  1L90 A;  133L A;  4WG7 A;  1GFH A;  3OE6 A;  3OK0 A;  4RLN A;  1IOC A;  240L A;  1L29 A;  1L21 A;  1L69 A;  206L A;  3TXB A;  1Z55 A;  1IP2 A;  4EOF A;  2BQJ A;  1HHL A;  1B5W A;  1C6K A;  1QIO A;  4DYG A;  1DI4 A;  4C5F A;  1DZB X;  2EPE A;  4WMG A;  1L66 A;  3A3Q A;  4LGK A;  3RZ4 A;  1JHL A;  1GDW A;  4NHP A;  2MED A;  257L A;  1GFJ A;  182L A;  3CSQ A;  4NWE A;  216L A;  3GUN A;  1C6G A;  4W59 A;  212L A;  4WO6 A;  4W53 A;  1IOS A;  1CKD A;  3DN4 A;  1YQV Y;  4QEQ A;  3J6K A;  2ZQ4 A;  1P6Y A;  4HJV A;  1HER A;  109L A;  2D6B A;  1WQP A;  1WVU A;  238L A;  2OU0 X;  3HH4 A;  1DXJ A;  1GE4 A;  4LYC A;  2DQC Y;  3GXR A;  3C7W A;  2VB1 A;  2MEC A;  4KL7 A;  1L64 A;  1L84 A;  1T6H A;  2DQG Y;  5D5C A;  194L A;  2G4P A;  1L77 A;  1QTK A;  185L A;  2HUM A;  1CV0 A;  1LGW A;  149L A;  1P46 A;  4ARQ A;  3CT0 A;  5KKI A;  3V2Y A;  2DQI Y;  1IY4 A;  4H1P A;  4ET9 A;  3PBL A;  5DL9 A;  3B0K A;  4W54 A;  1CUQ A;  2XJW A;  5LXW A;  1L61 A;  3E3D A;  1WVV A;  2N5Z A;  3HT7 A;  1D3F A;  4DD0 A;  1CV6 A;  1L0K A;  1XGP C;  4LT2 A;  3WUL A;  3SB8 A;  4HTQ A;  3C81 A;  1QT3 A;  167L A;  1T8F A;  4EKS A;  5KXR A;  4WM2 A;  1C69 A;  254L A;  120L A;  4KPM A;  4YOP A;  4GCB A;  145L A;  4NGJ A;  236L A;  1KY1 A;  4HP0 A;  3ATO A;  4QDN A;  4DKL A;  1HEL A;  4H94 A;  1DQJ C;  4XJB A;  2LZM A;  1LMC A;  154L A;  1QSW A;  1BB7 A;  1P64 A;  1L06 A;  4YF2 A;  3RNX A;  3B0O A;  2RH1 A;  4LFP A;  135L A;  3TMV A;  2HEF A;  1DYG A;  211L A;  4OOT A;  1JUG A;  1L70 A;  2BQB A;  3FE0 A;  1LSP A;  1JIY A;  1WTM A;  1L97 A;  4NWH A;  3G3A B;  3GUL A;  3WXU A;  3HTG A;  1LSC A;  1P7S A;  4NGV A;  4MR1 A;  1L30 A;  1L92 A;  1QUD A;  261L A;  2D91 A;  2Z19 A;  3M3U A;  1C65 A;  2A7F A;  1XEK A;  3HT6 A;  3G3V A;  3HUQ A;  1QUH A;  3K3T A;  1LZY A;  1QSB A;  1LWG A;  232L A;  1YKX X;  4Z46 A;  1L49 A;  7LZM A;  1C7P A;  1B7L A;  1GB3 A;  4D9Z A;  3HU9 A;  173L A;  196L A;  2H5Z A;  2ZNW Y;  4R6C A;  1HEM A;  1YAQ A;  1I20 A;  1TEW A;  3GUM A;  4TSB A;  3TXG A;  5DM9 A;  1LZN A;  1GB7 A;  4NY5 A;  3WMK A;  2G4Q A;  1L44 A;  1FLQ A;  1QTB A;  1GFV A;  1SWZ A;  1C62 A;  3C7Y A;  1JIT A;  4W58 A;  1L05 A;  4UWU A;  1GBX A;  2FYC A;  2OE7 X;  1YL0 X;  3B72 A;  150L A;  5FCP A;  1UA6 Y;  1IX0 A;  1L63 A;  209L A;  1IO5 A;  3WPL A;  1C66 A;  1DYF A;  1IR9 A;  1QS5 A;  5KXK A;  1INU A;  1L51 A;  1QSQ A;  1LYI A;  4OW1 A;  1B5U A;  1D9W A;  2BQD A;  2Z39 A;  1G06 A;  3RUN A;  5E4P A;  1G7H C;  1KIP C;  6LYZ A;  1C6N A;  1L99 A;  4YM8 A;  1DYD A;  174L A;  4NIJ A;  1L09 A;  1OUB A;  4YXA C;  1C6B A;  1GFT A;  3CDR A;  3QE8 A;  2LHM A;  1YAN A;  6LZM A;  1WQQ A;  1G7J C;  1GB9 A;  1L28 A;  1WTH A;  4PPO A;  1L57 A;  1I6S A;  2QB0 B;  3TXE A;  1L56 A;  4NGK A;  1OUA A;  3PDS A;  4H9C A;  4W51 A;  1LYE A;  3OE8 A;  4I7K A;  1V7S A;  3C80 A;  1IC4 Y;  4DQ7 A;  1QT5 A;  1L32 A;  3HH6 A;  3HTB A;  2RBN A;  5KXY A;  5I14 A;  1L53 A;  1G0Q A;  155L A;  2CJL A;  2D4K A;  1DYE A;  1IWW A;  3CT5 A;  1UIC A;  2B5Z A;  1GF7 A;  1GWD A;  4YEO A;  5IHG A;  2LZT A;  1CJ9 A;  1L98 A;  4TX7 A;  3ODU A;  3T6U A;  1BVK C;  1G7I C;  1OV5 A;  245L A;  4PJ2 C;  2OU8 A;  4WOA A;  1RE2 A;  1HC0 A;  4LT1 A;  4I7M A;  2ZIL A;  5LA5 A;  2Y8P A;  3A67 Y;  4NSH A;  1D0L A;  208L A;  5C6I A;  1CU5 A;  2I25 L;  4CFO A;  1GB2 A;  5L3I A;  1L11 A;  2BPU A;  3TXD A;  1EQ5 A;  2BLY A;  1L89 A;  1G1W A;  4NSJ A;  1ZYT A;  1A2Y C;  2CDS A;  1JJ0 A;  3W6D A;  4XJH A;  5KKJ A;  1L60 A;  1OUG A;  3W3E A;  4EJ4 A;  4QY9 A;  113L A;  5APE A;  3FA0 A;  5II3 A;  2HUL A;  3HH5 A;  189L A;  137L A;  1GBY A;  1L80 A;  4G4C A;  1SSY A;  2HEC A;  1LMO A;  4DD7 A;  250L A;  4II8 A;  152L A;  4OOO A;  1GBO A;  3HT9 A;  1GE1 A;  1JWR A;  4PK0 A;  1W08 A;  1JTM A;  5B1G A;  5LVK A;  5LVG A;  3C7Z A;  2Q9E A;  3DMZ A;  5KXM A;  2BQI A;  3ZVQ B;  231L A;  1LOZ A;  1BB6 A;  1B5X A;  1L96 A;  5LA8 A;  1PQI A;  1CU2 A;  2DQF C;  239L A;  5FHW A;  1LSM A;  4X3B A;  1RCM A;  2BAA A;  3EO5 A;  2EKS C;  9LYZ A;  1L62 A;  3IJV A;  4EKR A;  104L A;  1N4F A;  3GUP A;  178L A;  2FYD A;  1WQN A;  1QTD A;  3ZVQ A;  5K7O A;  1BB3 A;  219L A;  1HSX A;  1L16 A;  3WU9 A;  1L40 A;  5ILF A;  1JTO L;  2HEA A;  2F32 A;  1XJU A;  2DBT A;  4ETA A;  218L A;  2XBR A;  1HEP A;  217L A;  4LYO A;  2EIZ C;  4H9I A;  3LYZ A;  3HUA A;  181L A;  1FLW A;  1QTE A;  5T3F A;  3N9C A;  1LSY A;  1L22 A;  3A93 A;  1KS3 A;  139L A;  1NBY C;  3K2R A;  3B6L A;  4XJD A;  1F6S A;  2OU9 A;  3WUN A;  146L A;  2RBP A;  2W1X A;  1LGX A;  1L42 A;  3TXF A;  5LYZ A;  1HEW A;  3D3D A;  4Z3M A;  4GN4 A;  2Z18 A;  4AXT A;  3HWL A;  3WVX A;  1IOQ A;  4YXC A;  1VED A;  5LIN A;  1IWZ A;  5FEK A;  3SB9 A;  3TXK A;  2B6T A;  2BQE A;  1DYB A;  1L08 A;  3ULR A;  5I5Q A;  5KXZ A;  2ZIK A;  1G0L A;  1GB8 A;  3SBA A;  1UAC Y;  3DKE X;  4W55 A;  1B6I A;  1TCY A;  1D6Q A;  3HFM Y;  1LZR A;  2PC2 A;  3EXD A;  242L A;  1KXY A;  1XEP A;  1JKC A;  3MGW A;  1AT5 A;  1CUP A;  243L A;  1L0J A;  1B7M A;  2RB0 X;  1YIK A;  1P37 A;  163L A;  1XSF A;  4N1C C;  1J1X Y;  1L79 A;  4OWE A;  1B7Q A;  4HJZ A;  5LAG A;  1L39 A;  220L A;  1B5V A;  177L A;  1UC0 A;  111L A;  1CKF A;  1UIG A;  131L A;  1ZV5 L;  1CV5 A;  1D3J A;  2A7D A;  1LHJ A;  1CJ8 A;  1LMT A;  5DN5 A;  4PHI A;  4WM5 A;  190L A;  230L A;  1IOR A;  2DQD Y;  1B5Y A;  3CB7 A;  3HDF A;  1LJI A;  2W1M A;  164L A;  3BKH A;  128L A;  1DI3 A;  4NSI A;  1L83 A;  4L41 A;  1GBS A;  3GUK A;  199L A;  1FKV A;  4ZFP A;  1L46 A;  1D3M A;  1GD6 A;  226L A;  2Z2F A;  4DDB A;  3WU8 A;  4M4O A;  1C10 A;  4B1A A;  1IWT A;  2H9K A;  3FI7 A;  3HBH A;  3GXK A;  5C6L A;  4W57 A;  2IGC A;  3EMS A;  221L A;  4B0D A;  2B6X A;  1DKK A;  1GF9 A;  4GCD A;  4E3U A;  3IJU A;  1IWV A;  5I4W A;  1G7M C;  2WAR A;  2IHL A;  4J7V A;  2XBS A;  4NGW A;  1TBY A;  4W56 A;  1LI3 A;  1NBZ C;  2F47 A;  3AYQ A;  2W1L A;  3A95 A;  3HTF A;  3RU5 A;  1LZ6 A;  2AUB A;  1LZT A;  2BQK A;  2OTY X;  2W1Y A;  4EKQ A;  1VDS A;  201L A;  3L2X A;  1SQ2 L;  1IY3 A;  1VDP A;  2HUB A;  1D0K A;  1UID A;  1DYA A;  1LZ8 A;  1L47 A;  3AW6 A;  1GF4 A;  1JTT L;  3OE9 A;  1K28 A;  1LZD A;  4I7J A;  1CKG A;  103L A;  3ATN A;  1PQJ A;  5F16 A;  222L A;  4WLY A;  2O4W A;  3A90 A;  4A7D A;  1YAM A;  2G4N A;  4B49 A;  2ZYP A;  2YBH A;  1CTW A;  4LYM A;  2H9J A;  1LYZ A;  1L82 A;  1P2L A;  4NEB A;  1IOT A;  5LVH A;  4NSG A;  4TSC A;  4UWN A;  1L43 A;  1I1Z A;  1LI2 A;  260L A;  1LYG A;  3CDT A;  3GUJ A;  1LWK A;  3LYT A;  1HF4 A;  3P68 A;  1L93 A;  213L A;  2RBQ A;  4NFV A;  4ARM B;  3P64 A;  3AGH A;  4DQ5 A;  255L A;  3N9A A;  4N1E I;  1LPY A;  4B4I A;  2LZ2 A;  2XQO A;  1E8L A;  1C6J A;  2MEB A;  1T3P A;  3W6C A;  4NG1 A;  3WU7 A;  1IR8 A;  1CV1 A;  3DN3 A;  3W6A A;  1IWY A;  1B2K A;  1HML A;  2B6Y A;  4H9H A;  2BQG A;  253L A;  4WM4 A;  1F6R A;  2QAR C;  4TWS A;  1IR7 A;  1LSE A;  1PQM A;  4OWA A;  1RFP A;  4N0J A;  3G3W A;  1LZC A;  4HSF A;  2B74 A;  5B1F A;  2EQL A;  2RSC A;  1FLU A;  1YKY X;  4LDL A;  4I8S A;  4IJ4 A;  1LHL A;  4S0W A;  2BQH A;  1SWY A;  1NMM A;  165L A;  5KXX A;  3WL2 A;  3B0I A;  1NWG A;  3WYH A;  1UIB A;  2D4J A;  1GXV 2;  1LJ4 A;  1REZ A;  2FBB A;  2YSS C;  3EML A;  4PRQ A;  4LT3 A;  2YVB A;  4I0C A;  4H92 A;  5A3Z A;  2F4G A;  1LHK A;  3HUK A;  3LZM A;  3TXJ A;  4LYZ A;  3A8Z A;  1GPQ C;  1H87 A;  207L A;  4J0L A;  3W6F A;  4HPI A;  5HNC A;  1LSG A;  1G0P A;  151L A;  1C6I A;  2BQA A;  3P65 A;  1TDY A;  4DDC A;  2Z2E A;  2A4T A;  1T8A A;  4K5Y A;  4RLM A;  2B70 A;  4HV2 A;  1CV4 A;  1UUZ C;  3AB6 A;  1IEE A;  2ZYC A;  2B6Z A;  4I7P A;  1CNS A;  1VDQ A;  5B05 A;  4XJI A;  1CKC A;  1CU0 A;  3NY8 A;  1REM A;  1IP6 A;  3CT1 A;  4GN5 C;  1BVX A;  1C6T A;  127L A;  3V2W A;  3CDO A;  159L A;  241L A;  1PQD A;  2Z37 A;  3SP3 A;  248L A;  4LFX A;  4DD3 A;  3SB5 A;  4FJR A;  1PQO A;  1C67 A;  175L A;  1LHH A;  1EL1 A;  214L A;  1LSA A;  1YAO A;  4N5R A;  122L A;  2Q9D A;  1LZB A;  2RBS A;  4GLA A;  4PRU A;  3HBE X;  4U3X B;  184L A;  1LLH A;  4WM3 A;  1XGQ C;  4NGZ A;  1YAP A;  1LJE A;  1IVM A;  3TMW A;  1L13 A;  1SLY A;  3DMV A;  3F6Z A;  5LYM A;  1BWJ A;  2HU3 A;  3WUA A;  1QT6 A;  1D3N A;  1JKA A;  1MLC E;  1J1P Y;  1UIA A;  3AGI A;  1L01 A;  4TTD A;  5KXO A;  1T97 A;  3SN6 R;  2B7X A;  3M18 B;  5F9U A;  3L64 A;  2NTH A;  1A4V A;  1OUC A;  2ZIJ A;  1LJF A;  114L A;  193L A;  8LYZ A;  1L36 A;  4XAD A;  3WUM A;  1GB5 A;  1QTC A;  115L A;  1VAU A;  3HTD A;  1LYY A;  1D6P A;  2DKV A;  4YEN A;  1UBZ A;  1C08 C;  5L9J A;  1LMN A;  2YBJ A;  1PS5 A;  4HPE A;  1B7S A;  5F81 A;  3KAM A;  1LAA A;  198L A;  1L17 A;  4WG1 A;  4WM6 A;  5AMY A;  108L A;  1L10 A;  3A92 A;  1QSA A;  2ZWB A;  180L A;  102L A;  5HNL A;  5HQ1 A;  1GF3 A;  4H90 A;  112L A;  1IWU A;  2ANV A;  4GLV A;  1GFR A;  1QUG A;  1L12 A;  1FDL Y;  1FBI X;  1KW7 A;  170L A;  4DD1 A;  4H8Z A;  3QAK A;  2HUK A;  1KW5 A;  1ZUR A;  2HEB A;  1FKQ A;  4G49 A;  1L45 A;  2LYM A;  4I7N A;  2HEE A;  3AZ4 A;  4J1A A;  5KXT A;  2YBM A;  140L A;  1XGT C;  1DPX A;  5C6J A;  1C63 A;  1LSN A;  3OJP A;  5LAF A;  5I4X A;  4GN3 A;  1L04 A;  3BKV A;  2I6Z A;  3TMU A;  2YBN A;  4WLD A;  2Z6B A;  224L A;  1G7L C;  3VWO A;  235L A;  187L A;  1LPI A;  4DWX A;  4H93 A;  2XTH A;  3C82 A;  5LIO A;  1LYO A;  1GE3 A;  5APC A;  4ML7 A;  1WQR A;  4LZM A;  3AJN A;  4WO9 A;  4NGL A;  129L A;  4J1B A;  3DNA A;  1RJC B;  4MST A;  1G0M A;  1L52 A;  1LZ9 A;  1CJ7 A;  1LHM A;  4HJY A;  2YBL A;  5A3E A;  1P56 A;  1GF8 A;  1QS9 A;  1L34 A;  1QUT A;  197L A;  1B7R A;  4P2E A;  4C3W A;  4I7L A;  1QTV A;  1T6V L;  153L A;  2F30 A;  4I7R A;  110L A;  3C83 A;  4NG8 A;  2NWD X;  5KJ9 A;  5KY1 A;  1NKH A;  2C8P A;  1OP9 B;  259L A;  1D2W A;  3LHM A;  4ZEE A;  1NDM C;  4B4E A;  2HED A;  1SX7 A;  262L A;  1BWH A;  1L68 A;  3WXT A;  258L A;  1CJ6 A;  249L A;  4DDA A;  157L A;  4ANR A;  1QDT A;  1L73 A;  4EXM A;  4GRV A;  134L A;  2RBR A;  1B7O A;  4XEN A;  1WTN A;  3SB7 A;  1OUJ A;  3HBD A;  2MEG A;  2CUU A;  4EPF A;  1JQU A;  4CGE A;  1CV3 A;  1L31 A;  1LYD A;  1ZWN A;  2LYO A;  4E97 A;  2MEF A;  1B7P A;  4ETB A;  1AM7 A;  1L85 A;  1NQI A;  5DLA A;  215L A;  3A91 A;  3A6C Y;  1JIS A;  5LVI A;  1HFX A;  1AKI A;  1QQY A;  1XJT A;  1LYS A;  4PGJ B;  2BQL A;  4GBR B;  3DMX A;  4Z41 A;  1BB5 A;  1JKD A;  1W6Z A;  4OWC A;  1B5Z A;  3SBB C;  1DKJ A;  1L18 A;  1NDG C;  2B75 A;  2MEA A;  1KIR C;  4NHT A;  3P4Z A;  1L41 A;  1WQM A;  3RW8 A;  227L A;  4R0F A;  1LCN A;  5I53 A;  1NHB A;  3F8V A;  1F10 A;  1XGR C;  2D4I A;  4EPI A;  4BAD A;  2F4A A;  1VDT A;  1L23 A;  3HT8 A;  1LJ3 A;  1OWZ A;  4G9S A;  1C46 A;  1DYC A;  3D4S A;  4NGY A;  1L15 A;  1LZA A;  1V7T A;  1YIL A;  1GEV A;  3LZ2 A;  2BQN A;  3A94 A;  1LYH A;  1OV7 A;  3WH1 A;  1L25 A;  2ZQ3 A;  3WPJ A;  4XYY A;  3DN2 A;  1JPO A;  1C61 A;  2LYZ A;  3C8Q A;  3CSR A;  2CWI A;  1GXX A;  172L A;  223L A;  144L A;  1LW9 A;  1P36 A;  1QDR A;  1GEZ A;  1AT6 A;  1L14 A;  1L74 A;  1LZ4 A;  1OVH A;  5KXS A;  1FLY A;  1L87 A;  1JJ1 A;  1JTN A;  1XEJ A;  1HSW A;  1QT8 A;  3HH3 A;  3UON A;  3AZ5 A;  1ZMY L;  3W6E A;  4HTN A;  2OEA X;  4AGA A;  119L A;  5ILC A;  4W94 A;  1BHZ A;  1C6C A;  1LZE A;  4HV1 A;  1P5C A;  3TXI A;  2RB2 X;  2ANX A;  1OYU A;  3A96 A;  2B73 A;  4NHS A;  5EBH A;  2DQA A;  4G4H A;  1LZS A;  5APF A;  1L86 A;  1PZY A;  1L24 A;  1D9U A;  1HEN A;  2HTX A;  4I7O A;  1IP3 A;  1J1O Y;  1OWY A;  3A6B Y;  246L A;  4WLX A;  5L3H A;  2DQE Y;  3LZT A;  5I4Y A;  1YRO A;  3F9L A;  162L A;  2GV0 A;  1LMQ A;  4RW2 A;  192L A;  4ZPU A;  2Z38 A;  4CFP A;  1LJN A;  4N9R A;  176L A;  1P2C C;  141L A;  4CJ2 A;  1FN5 A;  3CDV A;  4W52 A;  4RDS A;  1LYJ A;  1G07 A;  171L A;  4LYT A;  1LSB A;  1IP7 A;  4XJG A;  4N8Z A;  183L A;  1KY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...