1D0LA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
322
structure length
314
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
total genus 112
structure length 314
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0lA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0lA02
1KXYA 4MR1A 1GE3A 1LJIA 2DQFC 2ZYCA 2DQEY 5APFA 3WL2A 4ETAA 1T3PA 3LZTA 1JHLA 4RLNA 4B4JA 3RNXA 1JTOL 4KT3A 5KXOA 2DQIY 193LA 1LCNA 1OUGA 4ML7A 1LSAA 3AZ7A 5FSTA 4UWVA 1PS5A 1GBWA 2LYZA 3P66A 4GCDA 4PHIA 9LYZA 1XGUC 4CFOA 4PGJB 5E4PA 4B49A 2ZILA 1C43A 1IORA 1CJ8A 4XENA 4XJBA 1JKCA 5F16A 2W1XA 2D4KA 1XSFA 1B0DA 3A90A 3B0KA 1ZVYB 3AZ4A 4TUNA 1QDRA 4WMGA 4WM5A 2GV0A 3W6BA 1ZMYL 1XGQC 4GN3A 4TWSA 4TX7A 1B5XA 1LZ6A 1RE2A 4N0JA 1BQLY 1C45A 3WMKA 3ATOA 4OWHA 4XN6A 3A6CY 1HF4A 4W96A 1GD6A 1JIYA 2Z37A 1IWWA 1OP9B 3K3TA 5KXNA 2MEAA 1WQPA 5B1GA 4PRQA 1ALCA 2MEFA 1LZTA 1WTNA 1BVXA 1BGIA 1EL1A 5KXPA 1LSFA 4ETDA 5I53A 1TCYA 2BQFA 1F6SA 4PPOA 4OW1A 1OUCA 4R6CA 4NHIA 3A67Y 3B6LA 1FLWA 1JJ3A 5KXTA 1DI3A 3WUAA 4B0DA 4OWAA 1FKQA 1YKZX 4NG8A 4BAPA 1GBSA 1GF0A 1UIEA 1UIAA 1GE0A 4HPEA 1LZBA 4N1EI 3AZ5A 3W6AA 4H9FA 3AW7A 4WOAA 1GFGA 1TDYA 1I56A 4NGZA 5I4WA 1B9OA 4NHPA 3G3BB 2EKSC 3LYZA 5HMJA 5I54A 3TXFA 4DDAA 1GF6A 5KXMA 2D4IA 4DDBA 4DYGA 2FBDA 4L41A 1UIFA 4H8XA 1NDMC 3CT0A 5KKJA 2ZNXY 4YEOA 4KPMA 2HTXA 4H8YA 4ZIXA 2ZIJA 1D6PA 2G4NA 1GFKA 4BS7A 2DQDY 4YEMA 5LYTA 1LZ5A 1GDWA 1REXA 3W6FA 2YBIA 1C10A 3HFMY 1WQMA 1XGRC 3W6DA 2I25L 2MEIA 4NGYA 4EOFA 1B7SA 3GXKA 5F14A 1YKXX 3J6KA 3P65A 4M4OA 3P4ZA 1LMCA 4MSTA 4WM2A 4GCEA 1JJ1A 1YROA 1LSCA 1BWHA 3N9CA 4AGAA 2A7DA 4H9CA 3WPLA 5LAFA 1LJEA 4OOOA 1IO5A 5APDA 4LFXA 5KXRA 1IY4A 3LZ2A 4MCKA 1LHJA 3AYQA 3WPKA 134LA 4HTNA 1GF5A 2D6BA 1GF9A 1HEMA 1JWRA 1IWZA 1QIOA 1YAQA 1H87A 2BQEA 3B72A 4CJ2A 4N5RA 1YANA 5LVKA 2DQJY 3WU9A 1REZA 1UACY 4Z41A 4G4CA 3CSQA 1GXV2 4LYMA 3WW6A 1W08A 4A7DA 4DC4A 4FDYA 1YAMA 1EQ5A 1UA6Y 5I4XA 1D0MA 1IP2A 4WM1A 1B5ZA 1OQMA 4G4BA 1EQ4A 2MEDA 5LXWA 1LZAA 3WULA 1LJ3A 3LYTA 3N9EA 1CJ7A 1LKSA 1IOCA 4NGWA 5IHGA 1OUFA 4NSHA 1GB2A 3AZ6A 2CWIA 3TMVA 1HEWA 1SQ2L 2BQLA 4ETCA 4RW2A 5DM9A 1BB5A 1DPWA 1CJ6A 1GFHA 1YQVY 2BLXA 2HU3A 4B4IA 5F9XA 4QGZA 3ZVQA 1FBIX 5FHWA 5B05A 1KIPC 1I20A 4TTDA 4KXIA 1XFPL 1IX0A 5KXLA 4HV2A 1C7PA 2F30A 1HERA 1BB4A 153LA 1LJKA 5E9RA 194LA 4U3XB 1G7IC 5LA8A 1LHIA 3AB6A 5DL9A 1YILA 3WH1A 4ET9A 4NSIA 1F6RA 1LSPA 1N4FA 1FN5A 1IWTA 4OWCA 2MEGA 1VAUA 1ZVHL 2BQJA 2C8OA 1LTMA 1GAZA 4GLVA 1LZ9A 1EQEA 4B1AA 1IP7A 1LHKA 1JKDA 4M6DA 1JTPL 1XGTC 3RU5A 2D91A 2W1LA 1KIRC 1GFRA 4J1AA 5KXKA 1OUEA 1GE4A 1LYZA 4HV1A 4LYTA 1GDXA 1UIDA 5J7CA 4HP0A 4C3WA 2ZQ3A 4HSFA 4H92A 5B1FA 5D5FA 4D9ZA 1OUAA 4OOTA 2LZ2A 3A6BY 4WO9A 4HTKA 4IJ4A 1RI8B 1RCMA 1VATA 1GB0A 1DI5A 4LGKA 4KL7A 1PZYA 2X0AA 4LZTA 3TXDA 4YF2A 1LPIA 1B7LA 1GPQC 2BAAA 2EIZC 3G3AB 3P68A 4GCBA 4XJIA 5B07A 4DD3A 1GFUA 2G4QA 4DD9A 2H9KA 5KJ9A 3EO5A 3ZVQB 1LSGA 4WG7A 3TXGA 2CJLA 2MEHA 1UICA 1WTMA 4N8ZA 4XYYA 3RZ4A 1GF3A 1IWYA 3TXKA 5DN5A 1BB6A 4NHQA 5KXYA 4DT3A 2W1MA 2YBHA 4H1PA 4IATA 1VEDA 3TXBA 1LZYA 1LMAA 4CGEA 5DN4A 4DWXA 4G9SA 1IP1A 1LMQA 1UUZC 1GAYA 4OWEA 4XADA 1NWGA 1W6ZA 1KXWA 2BQAA 3AW6A 1IY3A 1GFVA 3T36A 5I4YA 1E8LA 1B5YA 4CHXA 5L3HA 5B59A 2BQHA 1HSWA 1LZ8A 1INUA 1GB5A 1LMTA 2RSCA 3TXEA 5LVHA 1QUTA 1LJHA 2FYCA 1GFTA 1WVVA 1OUBA 1HFYA 1UCOA 1JISA 3J4GA 1G7HC 4HJYA 4RDSA 1Z55A 5KKIA 1H6MA 1UBZA 1JTTL 3QNGA 1IOTA 3TMWA 5KXWA 3IJUA 1BHZA 4TSCA 5HNLA 4DD1A 5C6IA 3LYOA 1QTEA 4LFPA 3IJVA 4ZEEA 4WL7A 2MEEA 1GF7A 2BQNA 3ATNA 4WLXA 4G4HA 1BB3A 1VDPA 4LT2A 4H9HA 5D5CA 5T3FA 1IVMA 1CKCA 2Z2EA 2Z19A 1MLCE 1JPOA 1HFZA 3N9AA 3TXIA 4LYZA 1GEZA 4WLYA 5IDDA 2WARA 3A95A 4NIJA 1HEOA 1TAYA 4DDCA 1GFAA 2XTHA 4LT0A 1LSEA 3A94A 1FLYA 2HEBA 5LYMA 2A7FA 4NWHA 4LYOA 3QE8A 4XJFA 5B06A 1LSNA 2F2NA 1OUIA 1YKYX 3D3DA 1GB8A 1LJFA 1XGPC 1HELA 4PRUA 1TEWA 3P64A 4NGOA 1G7LC 1AT5A 1F0WA 3VWOA 2LYOA 2Q0MX 4XJDA 5LAGA 3RW8A 4ETBA 2DBTA 3W6CA 5LIOA 1OUJA 2DKVA 3GXRA 3TXJA 3HBHA 1QUSA 2BQMA 1IP4A 5KXSA 2HEFA 1IOSA 2YBLA 4YENA 4XJHA 5AMYA 5KXZA 5I5QA 4WO6A 5IELA 5K7OA 207LA 4EMNA 2MEBA 2N5ZA 3OK0A 4PJ2C 4NHSA 1IWUA 1HENA 4NGJA 3ULRA 1IP6A 1B7RA 2I6ZA 2HU1A 1HMLA 1UC0A 1DKKA 4X3BA 1J1OY 3W3EA 154LA 1HEQA 2HEDA 4UWNA 5LYZA 1D0KA 4HPIA 4HTQA 4IASA 1LZRA 4AXTA 1LZDA 3CB7A 5F81A 2DQGY 1VFBC 2H9JA 1QTKA 1IOQA 1B7NA 1NMMA 1I1ZA 3FE0A 5LVGA 1GBOA 1BWIA 3WYHA 1LJ4A 1LMNA 1ZV5L 2I26L 1BWJA 2DQHY 1YAPA 1CKFA 2BLYA 1LJGA 2BQDA 5F9UA 5KXXA 1IC7Y 2HEAA 4NEBA 3WVXA 3TMUA 1F10A 3LHMA 2Y8PA 1BVKC 1NDGC 1VDSA 4Z46A 5LINA 1LJJA 4NFVA 1IR8A 1LZGA 4DD2A 2EQLA 4Z98A 1CKGA 1GB6A 1OUHA 1LSDA 2ZWBA 1BB7A 2D4JA 1CNSA 3WVYA 3FI7A 1IWVA 1DPXA 4NSJA 2H5ZA 1T6VL 1B7OA 2HUBA 4LYBA 4I8SA 1DQJC 1QDTA 3TMXA 1MELL 4XJGA 4LYCA 1GF4A 1IR7A 1P2CC 1D6QA 1AM7A 1GWDA 2IFFY 3QY4A 1LZCA 4HJVA 4N9RA 2VB1A 2LYMA 3AJNA 2HEEA 1LZSA 3BKHA 1XEIA 1VDQA 208LA 3A93A 1JUGA 4NG1A 5JENB 4ETEA 3MGWA 3D9AC 4TSBA 5KY1A 4N1CC 4E3UA 4H9IA 5M1YA 5HMVA 2Z39A 1GB7A 3EMSA 3ZEKA 1GB9A 135LA 1LJNA 2MECA 2CGIA 1LZ1A 4NSGA 1GEVA 1LSBA 2YDGA 5DLAA 1LYYA 1NF5A 3CSRA 1FLQA 4H91A 5LVJA 2Z18A 132LA 3EXDA 3RT5X 4NHTA 1LZEA 2YVBA 1HSXA 1RJCB 1JKBA 4NGLA 1WQRA 1LSYA 1UIGA 2YSSC 3A3RX 4WL6A 2F4GA 1GFJA 6LYZA 1J1XY 1VDTA 3CT5A 1FLUA 2DQAA 4GLAA 1B5WA 2YBJA 3WPJA 5C6JA 1IR9A 1YAOA 3A96A 5LVIA 1NKHA 2HECA 1HC0A 1CJ9A 2BQBA 4O34A 1FDLY 1NHEA 1LYOA 1UIHA 1KIQC 1WQQA 5HLLA 1B7PA 4H9EA 1JJ0A 1V7TA 4DD7A 4QEQA 3M3UA 4UWUA 4WM4A 1OUDA 1G7MC 4GN5C 1GFEA 1UIBA 133LA 1C08C 1G7JC 1HMKA 1LOZA 1JEFA 2F4AA 2Z12A 4H8ZA 2DQCY 4NY5A 1NBZC 2XJWA 3HBDA 4R0FA 4ZFPA 3A92A 2ZQ4A 4Z3MA 4RW1A 1HFXA 4NGVA 3LYMA 1FKVA 4WLDA 1DI4A 4H94A 3WXTA 1QSAA 5A3ZA 3WXUA 1XEKA 4ANRA 1DZBX 1GBXA 1D9UA 2G4PA 2ZIKA 1NBYC 3F6ZA 4J0LA 4J1BA 1IP5A 3B0OA 5APEA 4H9BA 1HHLA 1JITA 4NWEA 2W1YA 1LHMA 3HBEX 2XBSA 1DKJA 1CKDA 4B4EA 3A34A 1A2YC 4W94A 1LHLA 3IWRA 1AZFA 4BAFA 1B5VA 2BQKA 2ZNWY 3M18B 1DXJA 1JSFA 1IIZA 3EBAB 3CT1A 5FCPA 3OJPA 2FBBA 5ILCA 1QSWA 1YIKA 1J1PY 4LT3A 3TXHA 1LZ4A 3WU7A 4C5FA 1B2KA 1B5UA 4WM3A 4I0CA 5FDJA 2XBRA 7LYZA 1IC4Y 3AGIA 2NWDX 3AGGG 3CSZA 1LSZA 4RLMA 6LYTA 2ZYPA 1AKIA 1GHLA 1B7MA 1KXXA 2BQCA 4GCFA 1LKRA 1GE2A 1YL0X 4GN4A 1GB3A 1V7SA 2CDSA 4BADA 2Z38A 5HNCA 2B5ZA 4G49A 2BQGA 2BPUA 5APCA 2EPEA 1QQYA 3CQLA 2Z2FA 3B0IA 1WVUA 1GBZA 2YBMA 3WUMA 3A3QA 1LAAA 4NGIA 1NQIA 1LMPA 4NGKA 1LZNA 4II8A 3AGHA 8LYZA 2BQOA 3KAMA 5ILFA 1B7QA 1JSEA 4WM6A 1IWXA 4FJRA 3SP3A 5L9JA 2BQIA 4H93A 1C46A 4H9AA 1O23A 1LSMA 5FELA 3WU8A 1IP3A 3WUNA 5II3A 2IHLA 4LT1A 2C8PA 5C6LA 4OWBA 4P2EA 4DD0A 5L3IA 3E3DA 1AT6A 1REMA 3A91A 1REYA 1WQNA 4GCCA 1GXXA 1XEJA 2LHMA 1GE1A 3BKVA 4WLTA 1HEPA 4QDNA 4YM8A 4ET8A 1HNLA 4CFPA 1TBYA 1GBYA 3T6UA 2AUBA 2LZTA 3W6EA 5HQ1A 4J7VA 5FEKA 4HJZA 1IC5Y 1WQOA 3LN2A 1LYSA 2FYDA 1A4VA 1RFPA 1LMOA 1SLYA 2YBNA 2PC2A 4H90A 4YOPA 1IEEA 3A8ZA 4QY9A 5A3EA 1YL1X 5EBHA 1GF8A 1CKHA 5LA5A 1LHHA 1D0LA 1JKAA 3WW5A 4WG1A
chains in the Genus database with same CATH superfamily
1L06A 3T1HM 2DQFC 4ETAA 3AJIB 3WL2A 1L70A 3RNXA 2HHHM 4KT3A 3HDEA 3DN3A 4P17A 4ML7A 1QTBA 5FSTA 102LA 1GVNA 1GBWA 1C1KA 3U6PA 3P66A 4PHIA 2UUCM 1L95A 1XGUC 4PK0A 4XENA 1C43A 1IORA 4Z6YA 1VEGA 1B0DA 3W6BA 4WMGA 243LA 241LA 4PDGA 1ZMYL 1XGQC 4DR2M 4N0JA 1DO2A 3T15A 1CU6A 4LJ6A 1L2CA 3WMKA 3IHPA 1C6CA 3SC3A 1JIYA 1IWWA 1OP9B 3HTFA 4EPFA 4YX7C 4M0DA 1XEPA 4JXJA 7LZMA 3HHWA 2KRUA 2JZ1A 1LSFA 5I53A 4D81A 1SWZA 4OW1A 1DGBA 4EPIA 1OUCA 3A67Y 1FLWA 1IQPA 1DI3A 3J27B 1OIPA 4DUZM 2O4WA 4W56A 1L75A 4B08A 4N1EI 1JB0F 4EIWA 2B6TA 3M6AA 1N77A 2KNAA 1B9OA 2Q9EA 5I54A 4DDAA 1KY1A 5KXMA 1L72A 2FBDA 3M7GA 2ZNXY 3HH5A 4KPMA 3SAVA 2O01F 3RE8A 1D6PA 3GLIE 5C18A 1WTHA 1DO0A 3IG5A 1YE9A 1L86A 1XWIA 1LZ5A 1REXA 1QUGA 3HFMY 1XGRC 4QHSA 3OE8A 5F14A 1KYIA 1NO1A 1KY0A 4M4OA 2JA2A 242LA 3HHZA 1TR8A 1JJ1A 1L43A 259LA 257LA 3PDSA 1L33A 2A7DA 4H9CA 1L8QA 4OX9M 5LAFA 1LJEA 4LF4M 4AI6A 134LA 1OVKA 4HTNA 2D6BA 4QOZC 150LA 1L81A 4CJ2A 6LZMA 2DQJY 3OE9A 4AZFA 1L90A 2Z8YM 4G4CA 2CHQA 3CSQA 1GXV2 3QWLA 261LA 3U6QA 1CV5A 4G4BA 2MEDA 5LXWA 4I7TA 1LZAA 2BWEA 2HL7A 5EP1A 1LJ3A 3N9EA 4I81A 2R62A 5KQ8A 4NGWA 5IHGA 3KSJA 1OUFA 4DR6M 1HEWA 3MJ5A 2BQLA 3KSXA 4L6V6 4RW2A 2XFTA 2KXEA 2BLXA 4X62M 1ZWNA 2HU3A 1G0KA 5FHWA 2LHGA 151LA 2APLA 4LRSA 3SBJA 4HV2A 1L68A 1HERA 1CUPA 5IT9S 1BB4A 5E9RA 1L15A 5DL9A 3WH1A 3RGPA 2RGHA 4NSIA 4W54A 1F6RA 1L59A 1L20A 1W5SA 3I51A 1G0MA 1C6IA 3J7AS 1GAZA 4GLVA 192LA 5ITRA 2D91A 3L64A 3HU2A 2QHOB 2J7OA 3BXWA 3L28A 2EKFA 5D5FA 1ZMUA 1WGLA 3V2YA 3MHVC 1JQJC 4LY6A 3A6BY 5E26A 3GLHE 2DXIA 4IJFA 4LG2A 2QBYA 1VATA 165LA 4YF2A 1LPIA 2EIZC 2KW0A 5B07A 1L47A 1D3NA 2JY7A 4M9ZA 3TXGA 2MEHA 4XYYA 1L48A 1C6TA 1WTMA 1X37A 130LA 2L09A 1C61A 3KVWA 4OO9A 1NSFA 1LMAA 1L67A 2BJVA 3OTOM 2B74A 4L4UA 1L27A 5I4YA 1IY3A 3J80S 2DZOB 1G0QA 3VK7A 4CHXA 2BQHA 1INUA 4M9SA 4PDIA 2CP8A 4L16A 1P3NA 2GNOA 1HFYA 4HJYA 1JISA 111LA 247LA 3SAWA 4CGYB 191LA 2YQZA 2FS1A 252LA 2G3QA 3IJVA 197LA 1GF7A 3T6UA 3W6EA 4WLXA 4LT2A 2OPFA 1QTDA 2XSZD 2Z2EA 1MLCE 1JPOA 1HFZA 3N9AA 4IBGA 1L80A 3TXIA 4DQ5A 1GEZA 5IDDA 4NIJA 1TAYA 1GFAA 3LW5F 5LYMA 3QE8A 4XJFA 3FUVA 4PRUA 3AOEC 3P64A 110LA 4AQNA 3RW8A 5LAGA 1L51A 2DBTA 1L44A 1T8GA 3GXRA 5KXSA 2M5ZA 145LA 1CV4A 5I5QA 2F5NA 3K1JA 2N5ZA 3OK0A 4PJ2C 1IWUA 196LA 1L99A 1L04A 2HU1A 1WXQA 4G4NA 2HULA 183LA 2DHRA 1HEQA 3A98B 4LDLA 1T3TA 4QNRA 1D0KA 2Y0QA 4HPIA 5C6LA 1L1TA 2CV2A 4FWGA 1NMMA 3RGSA 3FE0A 1P7SA 1IY0A 3HU9A 3WYHA 2I26L 1BWJA 1CKFA 2BLYA 1FNNA 3KW6A 4NEBA 3WVXA 4GH9A 2UUBM 5EJCA 5LINA 4DD2A 1IR8A 195LA 1E9RA 148LE 3LMMA 2DAEA 137LA 4RF1A 4Z98A 3VW7A 3CTWB 232LA 1CNSA 1KW7A 3NBXX 1WHCA 1VG5A 1IWVA 4DV5M 1L41A 1L24A 1L54A 1B7OA 2H5ZA 4LYBA 4I8SA 3TMXA 1MELL 1GF4A 1XHBA 2LWXA 1Q3CA 1AM7A 3GQ5A 1IBLM 1GWDA 224LA 2IFFY 4HJVA 2LYMA 3AJNA 1LZSA 1JUGA 2UU9M 5JENB 3MGWA 3SARA 1L08A 4MH0E 4N1CC 4H9IA 5M1YA 4B3RM 1GB9A 2CGIA 4NSGA 3FUTA 5DLAA 1NF5A 3EXDA 1XXHB 1IN4A 3LVWA 1LZEA 4NHTA 1WR1B 1WQRA 1LSYA 1UIGA 2A4TA 1C6AA 1B5WA 2C9OA 5LVIA 1D3JA 1HC0A 5KPTA 2EO2A 2BQBA 1FDLY 144LA 2C9CA 1V7TA 3M3UA 4WM4A 3EMLA 1GFEA 1C08C 1G7JC 1HMKA 1LOZA 4JV5M 2VF8A 3A92A 168LA 1Y8GA 2OEAX 4RW1A 1K28A 4XGIA 1OVHA 4L78A 4H94A 2N35A 231LA 1HT1E 5A3ZA 1DZBX 1GBXA 5HQ1A 3FRHA 1NBYC 3B0OA 4LFBM 3EIEA 2L4FA 4GKJM 1DKJA 2DWNA 235LA 3HH4A 3C81A 2KRKA 1J5EM 1LHLA 3I04M 1AZFA 3IWRA 164LA 4BAFA 2BQKA 4FWHA 1DYBA 1RU3A 4I4LA 1DXJA 1C6QA 3U60A 1L34A 3EBAB 4MM3B 3OJPA 4G3OA 131LA 4LT3A 3WU7A 1LZ4A 1J7KA 4I0CA 3L27A 234LA 3SB8A 3AGGG 230LA 6LYTA 1AKIA 1GHLA 3HU8A 4GCFA 4LDOA 4GN4A 3UMMA 1IN5A 4W57A 1L74A 3FD9A 1MN3A 1L37A 5ITYA 1PQDA 2L7HA 2BPUA 3JR6A 3U6CA 3C58A 3B0IA 1K82A 1WVUA 1G0PA 2HAKA 1DYAA 1C69A 4I7OA 1A5TA 1LAAA 4QOSA 1D2WA 4NXNM 3K8ZA 1LMPA 4YXCA 1L30A 3TWMA 4NGKA 2L4EA 2B7XA 2VF7A 2LCBA 2LC9A 1QT8A 1PQMA 1NJFA 1JSEA 2XH9A 1L11A 262LA 1L88A 4CHTB 258LA 1VDDA 3PNVA 3U5ZB 1LSMA 3GLIA 5FELA 2C8PA 2YNMD 3VDUA 2LVPC 4DD0A 1AT6A 1LI6A 3A91A 3L25A 2CE7A 1XEJA 4WLTA 3BKVA 4CFPA 4MGHA 2EJSA 4LF5M 2R4JA 1PQOA 3K92A 4YOPA 1B6IA 1DYEA 1L26A 4QY9A 1C65A 1GF8A 1LHHA 1JKAA 1L56A 4WG1A 4S0WA 2ZYCA 3SBBC 174LA 2XEPA 4B4JA 5FTLA 3HWLA 4GC9A 1EFUB 193LA 3CF0A 1I4WA 4R71A 3DOAA 9LYZA 161LA 4GCDA 1XMQM 2Z6BA 1QVRA 3GUPA 5F16A 4TUNA 3B0KA 1L01A 4WM5A 2GV0A 3FE3A 2HUMA 4GN3A 4TWSA 1B5XA 2CUZA 1LZ6A 4W59A 2KA6B 1ZMWA 1RE2A 3FKEA 1C45A 2LVQD 4LGMA 1GJSA 2LTUA 1JTNA 1HF4A 1NY6A 1GD6A 4W96A 1PGYA 1DYDA 1QT3A 4JI2M 1C64A 1KNIA 1WQPA 4GRIA 2E5LM 1LZTA 1KS3A 1YUBA 1BGIA 220LA 1NHGC 5KXPA 1XMOM 1F6SA 1XNRM 1IXSB 3DN0A 1XJTA 4NHIA 2HUKA 2XLJA 186LA 1C6EA 5KXTA 2LH0A 1C6NA 4OWAA 3E4RA 1GBSA 1UIAA 1GE0A 3UK6A 4HPEA 1L32A 3B74A 3AW7A 1C68A 3L2AA 1GFGA 1EE8A 1I56A 3G3BB 3TE6A 214LA 4OW0A 5HMJA 1P2RA 126LA 5DYIA 1OWZA 1UIFA 2BNKA 4YEOA 5KKJA 3GRYA 147LA 2ZIJA 2G4NA 2JP7A 3F9LA 248LA 1L73A 3CGWA 2YBIA 5KQDA 4R7GA 3W6DA 4NGYA 4EOFA 3U61A 3J6KA 1IXRC 4K5YA 4XK8F 3P4ZA 3SMPA 1LMCA 1LSCA 4NXMM 3WPLA 1C6FA 4LFXA 1D9WA 104LA 3CF2A 3AYQA 3VK8A 3C9PA 1L40A 1L10A 1HEMA 1JWRA 3FUWA 1QIOA 2XZUA 123LA 2VQFM 1I94M 2V1CA 1REZA 1UACY 2BJWA 3GPYA 1C6DA 3I01M 4LYMA 2Z7JA 3WW6A 4A7DA 4DC4A 4FDYA 4I7SA 3SMSA 5I4XA 181LA 1W5TA 1IP2A 3WHKA 3FUXA 1EQ4A 1PJJA 2R45A 3WULA 1XC8A 3HTGA 219LA 3U6EA 237LA 3LYTA 3B9PA 1IOCA 228LA 1SQ2L 1GFHA 1KIPC 1I20A 1L62A 1XFPL 4DAJA 5GKNA 4B3MM 4ET9A 4D82A 2B70A 1L16A 1L93A 3HUQA 1QT5A 1N4FA 4LFAM 3Q8XA 182LA 4I7QA 3TQSA 1LZ9A 4ARPA 3PBLA 1IP7A 1VEKA 1JKDA 1LHKA 1JTPL 4B1AA 2DWZB 1KIRC 5KXKA 2KNZA 1IXZA 4OVZA 3TWKA 2W82A 184LA 1LYZA 109LA 1GDXA 1UIDA 5J7CA 4HP0A 120LA 3SFZA 2ZQ3A 166LA 5B1FA 1OUAA 5JI2E 2LZ2A 4OOTA 4WO9A 213LA 3NY8A 3QAKA 2OE4X 2QB0B 140LA 1RCMA 1DI5A 5FTMA 3C82A 1PZYA 4LZTA 4JI7M 4GCBA 3G3AB 141LA 3SB7A 3LCUA 223LA 4DD3A 5KJ9A 3JR5A 3L29A 4JI8M 4PD2A 4GEWA 2QCUA 1LI2A 1GF3A 4NRVA 4P16A 3HZJA 4EXMA 2YBHA 3TXBA 2UXCM 4CGEA 3LVVA 2YFQA 3SAUA 4KO8A 3HGIA 3A45A 1IP1A 1LMQA 2K9DA 1WIVA 4XADA 1NWGA 3AW6A 4I7LA 1B5YA 4JI4M 3EIHA 129LA 1QT6A 2RSCA 4LJ9A 3HTDA 2JXNA 1IFYA 2M60A 1OJLA 3TXEA 2IGCA 4OVZB 3DKEX 2FYCA 1WVVA 3J4GA 1H6MA 1K3WA 3QNGA 225LA 4RF0A 1OV7A 4TSCA 158LA 3CDTA 143LA 4EKPA 4LFPA 4JI3M 4ZEEA 4WL7A 2BQNA 3ATNA 5T3FA 4H9HA 1IVMA 1OWYA 1L12A 4LYZA 3HKPA 4WLYA 2WARA 3W0LB 1LGWA 3A95A 3T38A 2XTHA 3L2XA 3HJQA 1CU0A 1QAOA 4NWHA 4LYOA 1OAOC 3CF6E 1OUIA 1V92A 1C63A 1L52A 1L69A 1SSWA 1LJFA 3DN4A 1HELA 1TEWA 4NGOA 1G7LC 1F0WA 4REZA 2VQEM 3VWOA 4XJDA 1R2YA 1SSYA 3G3XA 2RBQA 5LIOA 2HCBA 4EKRA 1QUSA 1XNQM 2BQMA 250LA 2HEFA 1MJGM 4FVMA 4YENA 5AMYA 3K9OA 5KXZA 4ARQA 3GLHB 4MGZE 5IELA 4EMNA 1UM8A 3WHLA 169LA 1QSQA 1B7RA 1PRBA 1UC0A 1NVMA 5EP2A 1GL6A 4EKQA 1L64A 4IASA 4HTQA 1LZRA 2K0BX 2DQGY 2QNJA 5EXTA 2EA0A 1VFBC 5LVGA 1LMNA 5FTJA 4DKLA 1JQUA 1QZEA 1R6BX 2WSEF 2D7EA 4JI0M 1VDSA 172LA 1H6UA 1LJJA 4NFVA 3HDFA 3DA1A 1GB6A 4NL4H 1OUHA 1T97A 2D4JA 2XGNA 2RGOA 4FCWA 3GQ3A 3FI5A 2LHCA 3GLFB 4I8OA 4NSJA 1L91A 1P64A 2HUBA 4GIPA 4LYCA 3B7NA 4CIZA 1IR7A 1P2CC 1LZCA 229LA 2C98A 3U6OA 2HEEA 3BKHA 3DN2A 4NG1A 1C67A 5KY1A 2C5RA 2KEBA 2Z39A 3ZEKA 226LA 1LJNA 1P36A 1C6JA 1C6KA 1HR0M 127LA 1L19A 2YDGA 1L66A 1FLQA 132LA 2YVBA 1JKBA 4NGLA 3A3RX 4W53A 1L82A 4WL6A 2F4GA 3HHYA 6LYZA 1VDTA 1OQYA 4A3VB 5ITUA 4GLAA 1V34A 3AKZA 189LA 3UJNA 1NKHA 4GC5A 1L77A 1CJ9A 1IXSA 2DAKA 5KPRA 4DR4M 3RZEA 1WQQA 3U6SA 1JJ0A 4DV1M 2B73A 3DN8A 1E94E 162LA 1UIBA 2F4AA 4J1AA 1C66A 4NY5A 1QTHA 2JY5A 2ZQ4A 1N34M 3W0FA 119LA 1ORYB 3WXTA 1E32A 4FD2A 4NOOB 1QSAA 1L58A 3WXUA 190LA 4J1BA 1D9UA 2G4PA 1TTEA 2DAIA 5APEA 1IP5A 3UZUA 1NHWC 2LNHC 260LA 1JITA 2I7NA 1SXJC 3GPPA 2JY6B 1LHMA 3NY9A 1V33A 1DGFA 160LA 4B4EA 4I7JA 1L21A 3M18B 1HNWM 1T8AA 1DV0A 3QAUA 1IM2A 5FCPA 2J7NA 1L13A 5ILCA 1J1PY 4C5FA 1LPYA 2NTGA 4JI6M 5FDJA 1L29A 7LYZA 1IC4Y 2X4AA 4RLMA 1SXJA 2QZ4A 4F2LA 2ZYPA 4IIWA 2BQCA 1LKRA 3R8FA 1L57A 1V7SA 5LZMA 2Y20A 4G4OA 1DYGA 4G49A 2BQGA 1GKIA 4B3TM 5APCA 1QQYA 3CQLA 2MJ5B 1GBZA 187LA 1NQIA 1G8PA 3RFWA 1LZNA 255LA 2OTZX 4II8A 1G1WA 3HH3A 5I14A 2BQOA 2XZFA 3KAMA 5ILFA 1B7QA 4NC6A 5ITXA 4GRVA 3JAMS 114LA 5L9JA 3SHFA 4LFCM 5II3A 1O23A 2F5SA 4LF9M 1Z59A 2IHLA 1R7RA 2L2DA 4GMQA 3GRUA 1CV1A 1P5CA 1OIZA 2RBRA 3SB5A 3TPZA 4QDNA 4ET8A 2LZTA 2XFSA 4PCZA 2D7HA 1IC5Y 1L35A 1WQOA 1LYSA 3LN2A 2Z4SA 1LMOA 1RFPA 1SLYA 3V2WA 1Z5CA 5A3EA 1YL1X 3J7BA 1C62A 244LA 1HQYE 1R5LA 4MR1A 1GE3A 157LA 4LJ5A 1T3PA 4LZMA 3LZTA 4RLNA 5KO3A 1L2DA 2B72A 4ARMB 1JTOL 5KXOA 2H5XA 2DQIY 1LCNA 1LSAA 1G1VA 3DMXA 3AZ7A 3TL4X 1LGUA 3OE0A 211LA 2OU0X 1CUKA 1JR3E 4PGJB 4PT5A 1L65A 4B49A 2ZILA 1CJ8A 4XJBA 1JKCA 2D4KA 1XSFA 1L42A 142LA 2DAMA 1ZVYB 1QDRA 1CX7A 1OTRA 4W58A 4TX7A 1HNXM 1HQCA 1MX0A 1BQLY 4NRWA 4OWHA 3GLGB 1FJGM 4CJ6A 5KXNA 2Z3XA 1ALCA 1WTNA 1BVXA 1L61A 4ETDA 3MMPA 1TCYA 5EP3A 2L7IA 3DN6A 1P56A 3B6LA 112LA 4LDEA 2RRUA 1JJ3A 1QT7A 4B0DA 4BAPA 4E97A 1CVKA 1G0LA 4I5SA 1UIEA 3KS8A 4IBCA 1LZBA 3AZ5A 3KDSE 4DR3M 4QNMA 4RNAA 1QAQA 4UN2B 1L05A 1QQWA 4H9FA 4DR7M 1TDYA 4NGZA 206LA 2FNAA 1ZMVA 4G4QA 2EKSC 1P46A 1L22A 1GL7A 215LA 3TXFA 1GF6A 2D4IA 4ARQB 1Q02A 2LVAA 4DDBA 4DYGA 4L41A 5FLXS 3FTEA 1LYDA 4L15A 1LGXA 1JR3A 1YLAA 2C99A 1NDMC 3CT0A 1Z5AA 3ZCBB 4R3DA 3ILKA 3KOZE 4LJAA 3HHXA 1L17A 4ZIXA 2ZAMA 2JWSA 205LA 4BS7A 2DQDY 4YEMA 4LRTA 5BR8M 4JI5M 1UFZA 1SX7A 2OE9X 3W6FA 4LJ7A 1C10A 2FOIC 1WQMA 4DV6M 1JTMA 2MEIA 1B7SA 1YKXX 4GCEA 1YROA 1SX2A 4OOOA 4WW0A 5KXRA 1IY4A 3LZ2A 2L78A 1KFVA 3WPKA 3KP0E 3C3EA 3LQQA 4C3WA 1GF9A 4YHHM 1IWZA 3B72A 2BQEA 2JUJA 163LA 4N5RA 2OO9A 2DNAA 1YANA 5EQTA 5LVKA 2F47A 4Z41A 1W08A 2O79A 177LA 1YAMA 113LA 1UA6Y 233LA 2RBPA 1L2BA 2QPAA 4DV0M 1OQMA 1IN6A 2JZ0A 2LVNC 2UUAM 1L98A 4LJ8A 1QTZA 180LA 1CUQA 1GB2A 3TMVA 2B6XA 4ETCA 5DM9A 1L23A 1CJ6A 1YQVY 4QGZA 3ZVQA 1FBIX 4S12A 4LCBA 4LF8M 1IX0A 5KXLA 256LA 1PJQA 1G3IA 1LJKA 194LA 125LA 1Z6TA 1YILA 2O7AA 5F3WA 3CDOA 2R18A 199LA 1LSPA 3GQ4A 2RAZX 1L03A 1ZVHL 2BQJA 5IWAM 4X66M 3W68A 1CV0A 2KZUA 2AHMA 4NSRA 4DV2M 1P2LA 4DV3M 2B75A 1OUEA 3J81S 3GLFE 1GE4A 7CATA 4CISA 2OOBA 4GHLA 4D9ZA 4MB7A 1HT2E 3CDQA 2XSZA 1GB0A 4LGKA 3TXDA 2X0AA 2G8LA 2OOAA 1B7LA 1GPQC 2CRUA 3FA0A 1PJSA 4XJIA 2G4QA 1QSBA 3EO5A 3I4VA 4WG7A 1UICA 1DGHA 4FCVA 1L38A 1L97A 3RZ4A 118LA 1AIPC 3TXKA 1L46A 1R4GA 1BB6A 3GUMA 4NHQA 5KXYA 1PQJA 3K9PA 1HNZM 4H1PA 5LMNM 1LZYA 5DN4A 3IG8A 1KSFX 4G9SA 1ZQ9A 3C8RA 1GAYA 4OWEA 1SXJD 3DNAA 1W6ZA 1T6HA 1GFVA 1NJGA 1L45A 1DYFA 2VIIA 5L3HA 217LA 5B59A 1LZ8A 1LMTA 3VDPA 1HJPA 2CV0A 5LVHA 1NV9A 1LJHA 1NNUC 4ARMA 3NWLA 1UCOA 1L0KA 4RDSA 2R4EA 5KKIA 1IBMM 2NTHA 3TMWA 1IOTA 2MH8A 5HNLA 2WZJA 4DUYM 4LZZA 2B3TA 1G41A 3LYOA 222LA 2MEEA 4G4HA 1VDPA 4F1IA 5D5CA 1CKCA 2Z19A 3B7QA 5LMUM 1HEOA 2UXDM 3FUUA 4ZPXA 1LSEA 4LT0A 1FLYA 3H4JA 2HEBA 2DVWB 5EXSA 1L84A 155LA 3V76A 2LYOA 2Q0MX 4L8RC 1L60A 2VDBB 3W6CA 2KHHA 4W55A 3HBHA 1T43A 1IOSA 1PJTA 1P6YA 4WO6A 3BOSA 2MEBA 2HKJA 1QUOA 3SB6A 4FW9A 3PVSA 1HENA 4EJ4A 1IP6A 1L14A 4X3BA 1DKKA 1C6LA 1KW5A 3GUJA 154LA 1TDHA 1N36M 1L89A 4UWNA 2OTYX 1QS5A 1TH4A 4AXTA 1IOQA 1B7NA 3SYLA 3UGJA 1I1ZA 1QTKA 1GBOA 1LJ4A 1ZV5L 1CV6A 1LJGA 2BQDA 5F9UA 1IC7Y 1TLAA 2HEAA 3SASA 3TMUA 3LHMA 1NDGC 1R2ZA 1IY1A 2F5PA 1CKGA 2A5YB 1L85A 2ZWBA 3L26A 2Y21A 2RB2X 2MGWA 3GUKA 3WVYA 1MU5A 3VKGA 1DPXA 1L83A 2XQOA 1T6VL 4XJGA 1CU3A 1N33M 4I7RA 1D6QA 200LA 5C1BA 2RH1A 4N9RA 208LA 1XXHE 4ETEA 3D9AC 4TSBA 2K47A 173LA 2Q2EB 5HMVA 1GB7A 135LA 1C6BA 1LYHA 1LSBA 1LYYA 3CSRA 5LVJA 2R44A 3OE6A 2Z18A 2DENA 2YSSC 245LA 2G5GX 3CT5A 2B6ZA 1FLUA 3DMVA 2YBJA 3WPJA 4OU7A 1IR9A 1YAOA 1L1ZA 5C6JA 2HECA 1L02A 1D3FA 3GUOA 3HUAA 3U60B 5ITTA 1LYOA 3U6MA 1KIQC 5HLLA 1B7PA 4H9EA 2WSCF 4UWUA 1G7MC 1IN8A 1GJTA 1OUDA 3QYEA 133LA 3HT7A 4GN5C 1JEFA 4IBIA 4B7FA 1NBZC 3U5ZA 4ZFPA 4JYAM 4Z3MA 4NGVA 4WLDA 1FKVA 4BBAA 2DHYA 3AL0C 1OFHA 4X64M 3GLGA 4ANRA 1GABA 2ZIKA 3FYDA 3HWSA 188LA 1NY5A 4Q7JA 4X65M 103LA 3HBEX 2JY8A 4FWDA 3W67A 2XBSA 1CKDA 4DV7M 2DAGA 3A46A 1B5VA 1PQKA 1IIZA 1J09A 3CT1A 2D7GA 3GLHA 2FBBA 2Z4RA 2C96A 2DZNB 178LA 3C7WA 3GUNA 2XBRA 4II7A 3AGIA 2NWDX 3CSZA 1L53A 4AG6A 2DKLA 4AG5A 1B7MA 4IBJA 1KXXA 3SBAA 2X8AA 1GE2A 3DFZA 3GRVA 2CDSA 1TDZA 2Z38A 5HNCA 2B5ZA 1G07A 2KDLA 2ERCA 2XF3A 254LA 2V1UA 3A42A 1CTWA 4KT0F 1LYIA 4LJ4A 2DI0A 4DJHA 2J5YA 2YBMA 3WUMA 3A3QA 4NGIA 3PFIA 8LYZA 2L6OA 5IREB 5JI3E 1L07A 3JR4A 4IBBA 251LA 3LZMA 2KZSA 3HTBA 4DQJA 1IWXA 1SXJE 146LA 4IAPA 1GO5A 2BQIA 4H93A 1C46A 3WU8A 1IP3A 4M0WA 4W5WA 2P5TA 4Z8XA 1C6HA 4OWBA 4P2EA 1IY2A 3E3DA 3AOGA 1REMA 2ZANA 1D2YA 1TF0B 1L92A 2QBYB 1HNLA 1TBYA 1GBYA 5L3IA 4AQYM 4J7VA 2Q9DA 4HJZA 3FADA 1OFIA 2QENA 3I4YA 3U6DA 236LA 1A4VA 3U6LA 4H90A 2PC2A 4ZPUA 238LA 3AFHA 5EBHA 4AKIA 1C60A 1D0LA 1BVSA 3P65A 3WW5A 1KXYA 1XB2B 1LJIA 5APFA 2DQEY 1L36A 1L79A 1JHLA 3THGA 4EKSA 1OUGA 3G3WA 176LA 4UWVA 1PM5A 1PS5A 3DN1A 2LYZA 1IN7A 185LA 4CFOA 5E4PA 2F5OA 3KFUG 1Z5BA 2W1XA 3C3DA 1PJIA 3A90A 3D4SA 3AZ4A 3AV0A 1LYJA 5A2QS 2LBCA 3TWLA 128LA 4D80A 1CV3A 3ATOA 4GKKM 3SB9A 3KOYE 4XN6A 3A6CY 4GBRB 3B89A 2Z37A 1TGUA 3K3TA 2MEAA 2CWBA 5B1GA 4PRQA 3ZH9B 2MEFA 1SXJB 1G06A 1EL1A 2FH0A 1L63A 2K6BA 1ZYTA 1QYRA 3AOEA 2BQFA 5E6JA 4PPOA 1N32M 4R6CA 2RKOA 4BLCA 3WUAA 1FKQA 1YKZX 4NG8A 1GF0A 1G4AE 4I7MA 4WP2A 3KOXE 1AUAA 3GLFA 3W6AA 4WOAA 2X49A 1PQIA 5I4WA 4NHPA 3KOWE 152LA 3LYZA 2RB1X 5DFLA 1QTVA 1G71A 2QP9X 1C6MA 3U61B 107LA 4H8XA 1G0GA 4IJEA 2HTXA 5FSWA 4H8YA 1WGNA 1QANA 1OKSA 2DWMA 1GFKA 5LYTA 1GDWA 2GQFA 3FYCA 3GPUA 1L31A 4Y28F 3H4MA 1L94A 2I25L 3GXKA 3T1YM 4MSTA 3F92A 4WM2A 1LI3A 3HJSA 5FTKA 1BWHA 3N9CA 4AGAA 3CDVA 2LZMA 3FRIA 2QQ8A 3K2RA 4HEOA 4MGKE 1IO5A 2ANXA 5APDA 212LA 4MCKA 1LHJA 3C7YA 3CDRA 4W52A 1Q3BA 3Q8GA 1GF5A 4WURA 122LA 1YAQA 1H87A 3WU9A 4ARLA 4DQ7A 3SATA 1EQ5A 4YXAC 1D0MA 1SWYA 4WM1A 138LA 1B5ZA 3T6PA 1L87A 1CJ7A 3DZDA 1LKSA 1C6PA 4GITA 2F2QA 1L0JA 4NSHA 108LA 3AZ6A 2CWIA 3QYBA 3HT8A 3LQRA 210LA 4MGYE 1BB5A 1DPWA 1S3SA 1T6OA 3E46A 2OU9A 5F9XA 4B4IA 4KLNA 5B05A 1N78A 4TTDA 3HT6A 4KXIA 3C8QA 1L76A 1C7PA 2F30A 3VFDA 1G59A 153LA 3FTCA 4U3XB 5LA8A 1G7IC 4BB9A 1LHIA 3AB6A 115LA 4IBEA 1I6SA 1FN5A 1IWTA 4OWCA 2MEGA 1VAUA 2C8OA 3D8LA 1LTMA 1L28A 1EQEA 3HU1A 3PXGA 4M6DA 1XGTC 2H1RA 3RU5A 5EP4A 2W1LA 1GFRA 3BBZA 1VQ1A 3IECA 4HV1A 4LYTA 3HUKA 4AKGA 1G0JA 2DWLA 246LA 3DMZA 2UXBM 4H92A 4HSFA 2RBNA 1NNJA 2LVOC 3FTFA 4HTKA 4IJ4A 1RI8B 2QARC 4AKHA 4QHTA 4KL7A 3C8SA 3RUNA 2BAAA 3P68A 4I7KA 1L09A 3SN6R 1GFUA 4DD9A 4W51A 2H9KA 4HLQA 1C6GA 3ZVQB 1LSGA 5DYGA 2CJLA 1LYGA 4N8ZA 1IWYA 4B3SM 5DN5A 1CX6A 2HWJA 4DT3A 1QS9A 2OU8A 2W1MA 4IATA 1DYCA 1VEDA 3UONA 4AW4A 1Q39A 170LA 2ZBKB 3C80A 4DWXA 1EIJA 4LGYA 2R0IA 1UUZC 1E8LA 1KXWA 2BQAA 3T36A 4I7PA 1L25A 1HSWA 1GB5A 1D3MA 1QUTA 4XBOA 4LZJA 3M0EA 1CU5A 1GFTA 1CU2A 1ZURA 1OUBA 2B6YA 3ODUA 2CV1A 3GLIB 167LA 1G7HC 2CHGA 1Z55A 1QTCA 1NHBA 1UBZA 1JTTL 5KXWA 3IJUA 1BHZA 3FTDA 4DD1A 1LYFA 5C6IA 4B7GA 1QTEA 1NV8A 2I7PA 3HU3A 1TH2A 1BB3A 2RBOA 4JN6A 3E21A 1DGGA 4DDCA 1L39A 3A94A 2ZAOA 2ZTDA 2ZTCA 1L49A 1OAIA 2A7FA 4HL4A 5B06A 2BWBA 1L00A 4DV4M 1LSNA 2F2NA 209LA 1YKYX 3D3DA 1GB8A 2FE8A 1XGPC 4G4RA 1AT5A 1D2NA 2EUCA 4LF7M 1VEJA 5ITXE 1OUJA 2DKVA 2KNVA 3TXJA 1LV7A 1IP4A 2CFOA 1QT4A 2YBLA 3HX3A 4XJHA 3GLGE 4KHPM 5K7OA 207LA 253LA 2OQ4A 4NHSA 4NGJA 3ULRA 3SHGB 4DR1M 1HMLA 2I6ZA 2O5RA 1J1OY 3W3EA 2HEDA 1P37A 5LYZA 4PJZA 1LW9A 3NBIA 2MR9A 1LZDA 3CB7A 5F81A 2H9JA 4ETBA 4FCTA 240LA 1BWIA 3ZC7B 1XXHA 1L55A 227LA 2DQHY 1OYUA 239LA 1YAPA 3GRRA 3PNYA 5KXXA 3GUIA 2LXEA 2OE7X 159LA 1F10A 2R46A 2Y8PA 1BVKC 4Z46A 4TUWA 4KODA 1LZGA 2EQLA 2EKKA 1LSDA 1BB7A 1OVJA 156LA 2ZM6M 3FI7A 3G3VA 1JR3D 1DQJC 1QDTA 5EXPA 2R6FA 1L50A 1IBKM 4IBDA 4K0KM 3QY4A 5IZ7D 2VB1A 1DGHB 1VDQA 1XEIA 3A93A 1L71A 1K3XA 1P3QQ 3HH6A 4E3UA 5EXXA 3EMSA 4ARJA 2MECA 2F5QA 201LA 1LZ1A 1L96A 1GEVA 2CEAA 5BPVA 5KPZA 4H91A 216LA 4G6ZA 5H37D 3RT5X 3HT9A 1HSXA 1RJCB 3K2LA 3ZQJA 1GFJA 1SG9A 1J1XY 1N75A 2MROB 2DQAA 4JI1M 3GP1A 1GLNA 5ITQA 3A96A 1LLHA 4O34A 1F4IA 1NHEA 4NSOB 1UIHA 3NYAA 4DR5M 5DNYA 3F8VA 1LWGA 4DD7A 4QEQA 3R9XB 4RKUF 1LWKA 3SYKA 4H8ZA 4MGIE 3GPXA 2Z12A 2DQCY 2XJWA 3HBDA 4R0FA 139LA 249LA 1HFXA 1QAMA 3LYMA 1LYEA 1DI4A 4GHAA 1XJUA 149LA 2CHVA 1TH3A 2YR0A 1XEKA 4J0LA 3F6ZA 1QZMA 4H9BA 2V6ZM 1HHLA 3HJ8A 2RAYX 4NWEA 1QUDA 2W1YA 3E9SA 3C7ZA 3A34A 2R65A 2WSFF 1A2YC 4W94A 4DBGB 2ZNWY 4LF6M 1JSFA 3HY5A 3VKHA 1QSWA 2Y0TA 1YIKA 4M9XA 3TXHA 1B2KA 1OV5A 2CUUA 1B5UA 4WM3A 175LA 2RBSA 3LCVB 1LSZA 1WJ7A 198LA 4B7HA 1YL0X 2O25A 1GB3A 2F4VM 1YSYA 3GO8A 4BADA 1ZV1A 218LA 2EPEA 221LA 2Z2FA 2RB0X 2QSFX 5FTNA 2NQ8C 1C7YA 1VDLA 3AGHA 171LA 2B6WA 2ANVA 4I7NA 2DZLA 3VLFB 4WM6A 3D8BA 1E9SA 3KP1E 4FJRA 1QUHA 3SP3A 4H9AA 3WUNA 3MK6A 4YY3M 4LT1A 3KS4A 5L8RF 1EPYA 8CATA 2F32A 1REYA 1WQNA 4GCCA 4IBKA 1GXXA 1L18A 1GE1A 1T8FA 3B7ZA 1HEPA 2LHMA 3C83A 4YM8A 2AUBA 5FEKA 4IBFA 1ZAEA 2FYDA 4ITQA 3KXEC 2FFJA 2YBNA 1IEEA 3A8ZA 1CKHA 3GULA 3J2PB 5LA5A 2JNHA
chains in the Genus database with same CATH topology
1L06A 2DQFC 4ETAA 3WL2A 1L70A 3RNXA 4KT3A 3HDEA 3DN3A 4ML7A 1QTBA 5FSTA 102LA 1GBWA 3P66A 4PHIA 1L95A 1XGUC 4PK0A 4XENA 1C43A 1IORA 1B0DA 3W6BA 4WMGA 243LA 241LA 1ZMYL 1XGQC 4N0JA 1CU6A 3WMKA 1C6CA 1JIYA 1IWWA 1OP9B 3HTFA 4EPFA 4YX7C 1XEPA 7LZMA 1LSFA 5I53A 1SWZA 4OW1A 4EPIA 1OUCA 3A67Y 1FLWA 1DI3A 2O4WA 4W56A 1L75A 4N1EI 2B6TA 1B9OA 2Q9EA 5I54A 4DDAA 1KY1A 5KXMA 1L72A 2FBDA 2ZNXY 3HH5A 4KPMA 1D6PA 1WTHA 1LZ5A 1L86A 1REXA 1QUGA 3HFMY 1XGRC 3OE8A 5F14A 1KY0A 4M4OA 242LA 1JJ1A 1L43A 259LA 257LA 3PDSA 1L33A 2A7DA 4H9CA 5LAFA 1LJEA 134LA 1OVKA 4HTNA 2D6BA 150LA 1L81A 4CJ2A 6LZMA 2DQJY 3OE9A 1L90A 4G4CA 3CSQA 1GXV2 261LA 1CV5A 4G4BA 2MEDA 5LXWA 4I7TA 1LZAA 1LJ3A 3N9EA 4NGWA 5IHGA 1OUFA 1HEWA 2BQLA 4RW2A 2BLXA 1ZWNA 2HU3A 1G0KA 5FHWA 151LA 4HV2A 1L68A 1HERA 1CUPA 1BB4A 5E9RA 1L15A 5DL9A 3WH1A 4W54A 4NSIA 1F6RA 1L59A 1L20A 1G0MA 1C6IA 1GAZA 4GLVA 192LA 2D91A 3L64A 5D5FA 3V2YA 3A6BY 1VATA 165LA 4YF2A 1LPIA 2EIZC 5B07A 1L47A 1D3NA 3TXGA 2MEHA 4XYYA 1WTMA 1C6TA 1L48A 130LA 1C61A 4OO9A 1LMAA 1L67A 2B74A 1L27A 5I4YA 1IY3A 1G0QA 4CHXA 2BQHA 1INUA 1P3NA 1HFYA 4HJYA 1JISA 111LA 247LA 191LA 252LA 3IJVA 197LA 1GF7A 3T6UA 3W6EA 4WLXA 4LT2A 1QTDA 2Z2EA 1MLCE 1JPOA 1HFZA 3N9AA 3TXIA 1L80A 4DQ5A 1GEZA 5IDDA 4NIJA 1TAYA 1GFAA 5LYMA 3QE8A 4XJFA 4PRUA 3P64A 110LA 4AQNA 3RW8A 5LAGA 1L51A 2DBTA 1L44A 1T8GA 3GXRA 5KXSA 145LA 1CV4A 5I5QA 2N5ZA 3OK0A 4PJ2C 1IWUA 196LA 1L99A 1L04A 2HU1A 2HULA 183LA 1HEQA 4LDLA 1D0KA 4HPIA 5C6LA 1NMMA 3FE0A 1P7SA 3HU9A 3WYHA 2I26L 1BWJA 1CKFA 2BLYA 4NEBA 3WVXA 5LINA 4DD2A 1IR8A 195LA 148LE 4Z98A 137LA 3VW7A 232LA 1CNSA 1KW7A 1IWVA 1L41A 1L24A 4LYBA 1L54A 1B7OA 2H5ZA 4I8SA 3TMXA 1MELL 1GF4A 2IFFY 1AM7A 1GWDA 4HJVA 224LA 2LYMA 3AJNA 1LZSA 1JUGA 5JENB 3MGWA 1L08A 4N1CC 4H9IA 5M1YA 1GB9A 2CGIA 4NSGA 5DLAA 1NF5A 3EXDA 4NHTA 1LZEA 1WQRA 1LSYA 1UIGA 2A4TA 1C6AA 1B5WA 5LVIA 1D3JA 1HC0A 2BQBA 1FDLY 144LA 1V7TA 3M3UA 4WM4A 3EMLA 1GFEA 1C08C 1G7JC 1HMKA 1LOZA 3A92A 168LA 2OEAX 4RW1A 1K28A 1OVHA 4H94A 231LA 5A3ZA 1DZBX 1GBXA 5HQ1A 1NBYC 3B0OA 1DKJA 235LA 3HH4A 3C81A 1LHLA 3IWRA 1AZFA 4BAFA 164LA 2BQKA 1DYBA 1DXJA 1C6QA 1L34A 3EBAB 3OJPA 131LA 4LT3A 3WU7A 1LZ4A 4I0CA 234LA 3SB8A 3AGGG 230LA 6LYTA 1AKIA 1GHLA 3HU8A 4GCFA 4LDOA 4GN4A 4W57A 1L74A 1L37A 1PQDA 2BPUA 3JR6A 3B0IA 1WVUA 1G0PA 1DYAA 1C69A 4I7OA 1LAAA 1D2WA 4YXCA 1LMPA 1L30A 4NGKA 2B7XA 2LCBA 2LC9A 1QT8A 1PQMA 1JSEA 1L11A 262LA 1L88A 258LA 5FELA 1LSMA 2C8PA 4DD0A 1AT6A 1LI6A 3A91A 1XEJA 4WLTA 3BKVA 4CFPA 1PQOA 4YOPA 1B6IA 1DYEA 1L26A 4QY9A 1C65A 1GF8A 1LHHA 1JKAA 1L56A 4WG1A 4S0WA 2ZYCA 3SBBC 174LA 4B4JA 3HWLA 193LA 9LYZA 161LA 4GCDA 2Z6BA 3GUPA 5F16A 4TUNA 3B0KA 1L01A 4WM5A 2GV0A 2HUMA 4GN3A 4TWSA 1B5XA 1LZ6A 4W59A 1RE2A 1C45A 1JTNA 1HF4A 4W96A 1GD6A 1DYDA 1QT3A 1C64A 1KNIA 1WQPA 1LZTA 1KS3A 1BGIA 220LA 5KXPA 1F6SA 3DN0A 1XJTA 4NHIA 2HUKA 186LA 1C6EA 5KXTA 1C6NA 4OWAA 1GBSA 1UIAA 1GE0A 4HPEA 1L32A 3AW7A 1C68A 1GFGA 1I56A 3G3BB 214LA 5HMJA 1P2RA 126LA 1OWZA 1UIFA 5KKJA 4YEOA 147LA 2ZIJA 2G4NA 3F9LA 248LA 1L73A 2YBIA 3W6DA 4NGYA 4EOFA 4K5YA 3J6KA 3P4ZA 1LMCA 1LSCA 3WPLA 1C6FA 4LFXA 1D9WA 104LA 3AYQA 1L40A 1L10A 1HEMA 1JWRA 1QIOA 123LA 1REZA 1UACY 1C6DA 4LYMA 3WW6A 4DC4A 4A7DA 4FDYA 4I7SA 5I4XA 181LA 1IP2A 1EQ4A 3WULA 3HTGA 219LA 3LYTA 237LA 1IOCA 228LA 1SQ2L 1GFHA 1KIPC 1I20A 1L62A 1XFPL 4DAJA 4ET9A 2B70A 1L16A 1L93A 3HUQA 1QT5A 1N4FA 182LA 4I7QA 1LZ9A 4ARPA 3PBLA 1IP7A 1LHKA 1JKDA 4B1AA 1JTPL 1KIRC 5KXKA 184LA 1LYZA 109LA 1GDXA 1UIDA 5J7CA 4HP0A 120LA 2ZQ3A 166LA 5B1FA 1OUAA 4OOTA 2LZ2A 4WO9A 213LA 3NY8A 3QAKA 2OE4X 2QB0B 140LA 1RCMA 1DI5A 3C82A 1PZYA 4LZTA 4GCBA 3G3AB 141LA 3SB7A 4DD3A 223LA 5KJ9A 1LI2A 1GF3A 4EXMA 2YBHA 3TXBA 4CGEA 1IP1A 1LMQA 4XADA 1NWGA 3AW6A 4I7LA 1B5YA 1QT6A 129LA 2RSCA 3HTDA 3TXEA 2IGCA 3DKEX 2FYCA 1WVVA 3J4GA 1H6MA 3QNGA 225LA 1OV7A 4TSCA 158LA 3CDTA 143LA 4EKPA 4LFPA 4ZEEA 4WL7A 2BQNA 3ATNA 5T3FA 4H9HA 1IVMA 1OWYA 1L12A 4LYZA 4WLYA 2WARA 3A95A 1LGWA 2XTHA 3L2XA 1CU0A 4NWHA 4LYOA 1OUIA 1L52A 1C63A 1L69A 1SSWA 1LJFA 3DN4A 1HELA 1TEWA 4NGOA 1G7LC 1F0WA 3VWOA 4XJDA 1SSYA 3G3XA 2RBQA 5LIOA 4EKRA 1QUSA 2BQMA 250LA 2HEFA 4YENA 5AMYA 5KXZA 4ARQA 5IELA 4EMNA 169LA 1QSQA 1B7RA 1UC0A 4EKQA 1L64A 4IASA 4HTQA 1LZRA 2DQGY 1VFBC 5LVGA 1LMNA 4DKLA 1JQUA 1VDSA 172LA 1LJJA 4NFVA 3HDFA 1GB6A 1OUHA 1T97A 2D4JA 3FI5A 4NSJA 1L91A 1P64A 2HUBA 4LYCA 1IR7A 1P2CC 1LZCA 229LA 2HEEA 3BKHA 3DN2A 4NG1A 1C67A 5KY1A 2Z39A 3ZEKA 226LA 1LJNA 1P36A 1C6JA 1C6KA 127LA 1L19A 2YDGA 1L66A 1FLQA 132LA 2YVBA 1JKBA 4NGLA 3A3RX 4W53A 1L82A 4WL6A 2F4GA 6LYZA 1VDTA 4GLAA 189LA 1NKHA 1L77A 1CJ9A 3RZEA 1WQQA 1JJ0A 2B73A 3DN8A 162LA 4J1AA 1UIBA 2F4AA 1C66A 4NY5A 1QTHA 2ZQ4A 119LA 3WXTA 1QSAA 1L58A 3WXUA 190LA 4J1BA 1D9UA 2G4PA 5APEA 1IP5A 260LA 1JITA 1LHMA 3NY9A 160LA 4B4EA 4I7JA 1L21A 3M18B 1T8AA 5FCPA 1L13A 5ILCA 1J1PY 4C5FA 1LPYA 2NTGA 5FDJA 7LYZA 1L29A 1IC4Y 4RLMA 2ZYPA 2BQCA 1LKRA 1L57A 1V7SA 5LZMA 1DYGA 4G49A 2BQGA 5APCA 1QQYA 3CQLA 1GBZA 187LA 1NQIA 1LZNA 255LA 2OTZX 4II8A 1G1WA 3HH3A 5I14A 2BQOA 3KAMA 5ILFA 1B7QA 4GRVA 114LA 5L9JA 5II3A 1O23A 2IHLA 1CV1A 1P5CA 2RBRA 3SB5A 4QDNA 4ET8A 2LZTA 1IC5Y 1L35A 1WQOA 1LYSA 3LN2A 1LMOA 1RFPA 1SLYA 3V2WA 5A3EA 1YL1X 1C62A 244LA 4MR1A 1GE3A 157LA 1T3PA 4LZMA 3LZTA 4RLNA 2B72A 4ARMB 1JTOL 5KXOA 2DQIY 1LCNA 1LSAA 1G1VA 3DMXA 3AZ7A 1LGUA 3OE0A 211LA 2OU0X 4PGJB 1L65A 4B49A 2ZILA 1CJ8A 4XJBA 1JKCA 2D4KA 1XSFA 1L42A 142LA 1ZVYB 1QDRA 1CX7A 4W58A 4TX7A 1BQLY 4OWHA 5KXNA 1ALCA 1WTNA 1BVXA 1L61A 4ETDA 1TCYA 3DN6A 1P56A 3B6LA 112LA 4LDEA 1JJ3A 1QT7A 4B0DA 4BAPA 4E97A 1CVKA 1G0LA 1UIEA 1LZBA 3AZ5A 1L05A 4H9FA 1TDYA 4NGZA 206LA 2EKSC 1P46A 1L22A 215LA 3TXFA 1GF6A 2D4IA 4ARQB 4DDBA 4DYGA 4L41A 1LYDA 1NDMC 1LGXA 3CT0A 4ZIXA 1L17A 205LA 4BS7A 2DQDY 4YEMA 1SX7A 2OE9X 3W6FA 1C10A 1WQMA 1JTMA 2MEIA 1B7SA 1YKXX 4GCEA 1YROA 1SX2A 4OOOA 5KXRA 1IY4A 3LZ2A 2L78A 3WPKA 4C3WA 1GF9A 1IWZA 3B72A 2BQEA 163LA 4N5RA 1YANA 5LVKA 2F47A 4Z41A 1W08A 2O79A 177LA 1YAMA 113LA 1UA6Y 233LA 2RBPA 1OQMA 1L98A 1QTZA 180LA 1CUQA 1GB2A 3TMVA 2B6XA 4ETCA 5DM9A 1L23A 1CJ6A 1YQVY 4QGZA 3ZVQA 1FBIX 1IX0A 5KXLA 256LA 1LJKA 194LA 125LA 1YILA 2O7AA 3CDOA 199LA 1LSPA 2RAZX 1L03A 1ZVHL 2BQJA 1CV0A 1P2LA 2B75A 1OUEA 1GE4A 4D9ZA 3CDQA 1GB0A 4LGKA 3TXDA 2X0AA 1B7LA 1GPQC 3FA0A 4XJIA 2G4QA 1QSBA 3EO5A 4WG7A 1UICA 1L38A 3RZ4A 1L97A 118LA 3TXKA 1L46A 1BB6A 3GUMA 4NHQA 5KXYA 1PQJA 4H1PA 1LZYA 5DN4A 4G9SA 3C8RA 1GAYA 4OWEA 3DNAA 1W6ZA 1T6HA 1GFVA 1L45A 1DYFA 5L3HA 217LA 5B59A 1LZ8A 1LMTA 5LVHA 1LJHA 4ARMA 1UCOA 1L0KA 4RDSA 5KKIA 2NTHA 3TMWA 1IOTA 5HNLA 3LYOA 222LA 2MEEA 4G4HA 1VDPA 5D5CA 1CKCA 2Z19A 1HEOA 4LT0A 1LSEA 1FLYA 2HEBA 1L84A 155LA 2LYOA 2Q0MX 1L60A 3W6CA 4W55A 3HBHA 1IOSA 1P6YA 4WO6A 2MEBA 1QUOA 3SB6A 1HENA 4EJ4A 1IP6A 1L14A 4X3BA 1DKKA 1C6LA 1KW5A 3GUJA 154LA 1L89A 4UWNA 2OTYX 1QS5A 4AXTA 1IOQA 1B7NA 1QTKA 1I1ZA 1GBOA 1LJ4A 1ZV5L 1CV6A 1LJGA 2BQDA 5F9UA 1IC7Y 1TLAA 2HEAA 3TMUA 3LHMA 1NDGC 1CKGA 1L85A 2ZWBA 2RB2X 3WVYA 3GUKA 1DPXA 1L83A 2XQOA 1T6VL 4XJGA 1CU3A 4I7RA 1D6QA 200LA 2RH1A 4N9RA 208LA 4ETEA 3D9AC 4TSBA 173LA 5HMVA 1GB7A 135LA 1C6BA 1LYHA 1LSBA 1LYYA 3CSRA 5LVJA 3OE6A 2Z18A 2YSSC 245LA 3CT5A 2B6ZA 1FLUA 3DMVA 2YBJA 3WPJA 5C6JA 1IR9A 1YAOA 2HECA 1L02A 1D3FA 3GUOA 3HUAA 1LYOA 1KIQC 5HLLA 1B7PA 4H9EA 4UWUA 1G7MC 1OUDA 4GN5C 133LA 3HT7A 1JEFA 1NBZC 4ZFPA 4Z3MA 4NGVA 4WLDA 1FKVA 4ANRA 2ZIKA 188LA 103LA 3HBEX 2XBSA 1CKDA 1B5VA 1PQKA 1IIZA 3CT1A 2FBBA 3C7WA 178LA 3GUNA 2XBRA 3AGIA 2NWDX 3CSZA 1L53A 1B7MA 1KXXA 3SBAA 1GE2A 2CDSA 2Z38A 5HNCA 2B5ZA 1G07A 254LA 1CTWA 1LYIA 4DJHA 2YBMA 3WUMA 3A3QA 4NGIA 8LYZA 1L07A 251LA 3LZMA 3HTBA 4DQJA 146LA 1IWXA 4IAPA 2BQIA 4H93A 1C46A 3WU8A 1IP3A 1C6HA 4OWBA 4P2EA 3E3DA 1REMA 1D2YA 1L92A 1HNLA 5L3IA 1TBYA 1GBYA 4J7VA 2Q9DA 4HJZA 3FADA 236LA 1A4VA 4H90A 2PC2A 4ZPUA 238LA 5EBHA 1C60A 1D0LA 3P65A 3WW5A 1KXYA 1LJIA 5APFA 2DQEY 1L36A 1L79A 1JHLA 4EKSA 1OUGA 3G3WA 176LA 4UWVA 1PS5A 3DN1A 2LYZA 185LA 4CFOA 5E4PA 2W1XA 3A90A 3D4SA 3AZ4A 1LYJA 128LA 1CV3A 3ATOA 3SB9A 4XN6A 3A6CY 4GBRB 2Z37A 3K3TA 2MEAA 5B1GA 4PRQA 2MEFA 1G06A 1EL1A 1L63A 1ZYTA 2BQFA 4PPOA 4R6CA 3WUAA 1FKQA 1YKZX 4NG8A 1GF0A 4I7MA 3W6AA 4WOAA 1PQIA 5I4WA 4NHPA 152LA 3LYZA 2RB1X 1QTVA 1C6MA 107LA 4H8XA 1G0GA 2HTXA 4H8YA 1GFKA 5LYTA 1GDWA 1L31A 1L94A 2I25L 3GXKA 4MSTA 4WM2A 1LI3A 1BWHA 3N9CA 4AGAA 3CDVA 2LZMA 3K2RA 1IO5A 5APDA 2ANXA 212LA 4MCKA 1LHJA 3C7YA 3CDRA 4W52A 1GF5A 122LA 1YAQA 1H87A 3WU9A 4ARLA 4DQ7A 1EQ5A 4YXAC 1D0MA 1SWYA 4WM1A 138LA 1B5ZA 1L87A 1CJ7A 1LKSA 1C6PA 2F2QA 1L0JA 4NSHA 108LA 3AZ6A 2CWIA 3HT8A 210LA 1BB5A 1DPWA 4B4IA 2OU9A 5F9XA 5B05A 4TTDA 3HT6A 4KXIA 3C8QA 1L76A 1C7PA 2F30A 153LA 4U3XB 5LA8A 1G7IC 1LHIA 3AB6A 115LA 1I6SA 1FN5A 1IWTA 4OWCA 2MEGA 1VAUA 2C8OA 1LTMA 1L28A 1EQEA 4M6DA 1XGTC 3RU5A 2W1LA 1GFRA 4HV1A 4LYTA 3HUKA 1G0JA 246LA 3DMZA 4H92A 4HSFA 2RBNA 4HTKA 4IJ4A 1RI8B 2QARC 4KL7A 3C8SA 3RUNA 2BAAA 3P68A 4I7KA 1L09A 3SN6R 1GFUA 4DD9A 4W51A 2H9KA 1C6GA 3ZVQB 1LSGA 2CJLA 1LYGA 4N8ZA 1IWYA 5DN5A 1CX6A 4DT3A 1QS9A 2OU8A 2W1MA 4IATA 1DYCA 1VEDA 3UONA 170LA 3C80A 4DWXA 1UUZC 1E8LA 1KXWA 2BQAA 3T36A 4I7PA 1L25A 1HSWA 1GB5A 1D3MA 1QUTA 1CU5A 1GFTA 1CU2A 1ZURA 1OUBA 2B6YA 3ODUA 167LA 1G7HC 1Z55A 1QTCA 1NHBA 1UBZA 1JTTL 5KXWA 3IJUA 1BHZA 4DD1A 1LYFA 5C6IA 1QTEA 1BB3A 2RBOA 4DDCA 1L39A 3A94A 1L49A 2A7FA 5B06A 1L00A 1LSNA 2F2NA 209LA 1YKYX 3D3DA 1GB8A 1XGPC 1AT5A 1OUJA 2DKVA 3TXJA 1IP4A 1QT4A 2YBLA 4XJHA 5K7OA 207LA 253LA 4NHSA 4NGJA 3ULRA 2I6ZA 1HMLA 1J1OY 3W3EA 2HEDA 1P37A 5LYZA 4PJZA 1LW9A 1LZDA 3CB7A 5F81A 2H9JA 4ETBA 240LA 1BWIA 1L55A 227LA 2DQHY 1OYUA 239LA 1YAPA 5KXXA 3GUIA 2OE7X 159LA 1F10A 2Y8PA 1BVKC 4Z46A 1LZGA 2EQLA 1LSDA 1BB7A 1OVJA 156LA 3FI7A 3G3VA 1DQJC 1QDTA 1L50A 3QY4A 2VB1A 1XEIA 1VDQA 3A93A 1L71A 3HH6A 4E3UA 3EMSA 4ARJA 2MECA 201LA 1LZ1A 1L96A 1GEVA 4H91A 216LA 3RT5X 3HT9A 1HSXA 1RJCB 1GFJA 1J1XY 2DQAA 3A96A 1LLHA 4O34A 1NHEA 1UIHA 3NYAA 3F8VA 1LWGA 4DD7A 4QEQA 1LWKA 4H8ZA 2Z12A 2DQCY 2XJWA 3HBDA 4R0FA 139LA 249LA 1HFXA 3LYMA 1LYEA 1DI4A 1XJUA 149LA 1XEKA 4J0LA 3F6ZA 4H9BA 2RAYX 1HHLA 4NWEA 1QUDA 2W1YA 3C7ZA 3A34A 1A2YC 4W94A 2ZNWY 1JSFA 1QSWA 1YIKA 3TXHA 1B2KA 1OV5A 2CUUA 1B5UA 4WM3A 175LA 2RBSA 1LSZA 198LA 1YL0X 1GB3A 4BADA 218LA 2EPEA 221LA 2Z2FA 2RB0X 3AGHA 171LA 2B6WA 2ANVA 4I7NA 4WM6A 4FJRA 3SP3A 1QUHA 4H9AA 3WUNA 4LT1A 1EPYA 2F32A 1REYA 1WQNA 4GCCA 1GXXA 1L18A 2LHMA 1GE1A 1T8FA 4YM8A 1HEPA 3C83A 2AUBA 5FEKA 2FYDA 2YBNA 1IEEA 3A8ZA 1CKHA 3GULA 5LA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KXY A;  4MR1 A;  1GE3 A;  1LJI A;  2DQF C;  2ZYC A;  2DQE Y;  5APF A;  3WL2 A;  4ETA A;  1T3P A;  3LZT A;  1JHL A;  4RLN A;  4B4J A;  3RNX A;  1JTO L;  4KT3 A;  5KXO A;  2DQI Y;  193L A;  1LCN A;  1OUG A;  4ML7 A;  1LSA A;  3AZ7 A;  5FST A;  4UWV A;  1PS5 A;  1GBW A;  2LYZ A;  3P66 A;  4GCD A;  4PHI A;  9LYZ A;  1XGU C;  4CFO A;  4PGJ B;  5E4P A;  4B49 A;  2ZIL A;  1C43 A;  1IOR A;  1CJ8 A;  4XEN A;  4XJB A;  1JKC A;  5F16 A;  2W1X A;  2D4K A;  1XSF A;  1B0D A;  3A90 A;  3B0K A;  1ZVY B;  3AZ4 A;  4TUN A;  1QDR A;  4WMG A;  4WM5 A;  2GV0 A;  3W6B A;  1ZMY L;  1XGQ C;  4GN3 A;  4TWS A;  4TX7 A;  1B5X A;  1LZ6 A;  1RE2 A;  4N0J A;  1BQL Y;  1C45 A;  3WMK A;  3ATO A;  4OWH A;  4XN6 A;  3A6C Y;  1HF4 A;  4W96 A;  1GD6 A;  1JIY A;  2Z37 A;  1IWW A;  1OP9 B;  3K3T A;  5KXN A;  2MEA A;  1WQP A;  5B1G A;  4PRQ A;  1ALC A;  2MEF A;  1LZT A;  1WTN A;  1BVX A;  1BGI A;  1EL1 A;  5KXP A;  1LSF A;  4ETD A;  5I53 A;  1TCY A;  2BQF A;  1F6S A;  4PPO A;  4OW1 A;  1OUC A;  4R6C A;  4NHI A;  3A67 Y;  3B6L A;  1FLW A;  1JJ3 A;  5KXT A;  1DI3 A;  3WUA A;  4B0D A;  4OWA A;  1FKQ A;  1YKZ X;  4NG8 A;  4BAP A;  1GBS A;  1GF0 A;  1UIE A;  1UIA A;  1GE0 A;  4HPE A;  1LZB A;  4N1E I;  3AZ5 A;  3W6A A;  4H9F A;  3AW7 A;  4WOA A;  1GFG A;  1TDY A;  1I56 A;  4NGZ A;  5I4W A;  1B9O A;  4NHP A;  3G3B B;  2EKS C;  3LYZ A;  5HMJ A;  5I54 A;  3TXF A;  4DDA A;  1GF6 A;  5KXM A;  2D4I A;  4DDB A;  4DYG A;  2FBD A;  4L41 A;  1UIF A;  4H8X A;  1NDM C;  3CT0 A;  5KKJ A;  2ZNX Y;  4YEO A;  4KPM A;  2HTX A;  4H8Y A;  4ZIX A;  2ZIJ A;  1D6P A;  2G4N A;  1GFK A;  4BS7 A;  2DQD Y;  4YEM A;  5LYT A;  1LZ5 A;  1GDW A;  1REX A;  3W6F A;  2YBI A;  1C10 A;  3HFM Y;  1WQM A;  1XGR C;  3W6D A;  2I25 L;  2MEI A;  4NGY A;  4EOF A;  1B7S A;  3GXK A;  5F14 A;  1YKX X;  3J6K A;  3P65 A;  4M4O A;  3P4Z A;  1LMC A;  4MST A;  4WM2 A;  4GCE A;  1JJ1 A;  1YRO A;  1LSC A;  1BWH A;  3N9C A;  4AGA A;  2A7D A;  4H9C A;  3WPL A;  5LAF A;  1LJE A;  4OOO A;  1IO5 A;  5APD A;  4LFX A;  5KXR A;  1IY4 A;  3LZ2 A;  4MCK A;  1LHJ A;  3AYQ A;  3WPK A;  134L A;  4HTN A;  1GF5 A;  2D6B A;  1GF9 A;  1HEM A;  1JWR A;  1IWZ A;  1QIO A;  1YAQ A;  1H87 A;  2BQE A;  3B72 A;  4CJ2 A;  4N5R A;  1YAN A;  5LVK A;  2DQJ Y;  3WU9 A;  1REZ A;  1UAC Y;  4Z41 A;  4G4C A;  3CSQ A;  1GXV 2;  4LYM A;  3WW6 A;  1W08 A;  4A7D A;  4DC4 A;  4FDY A;  1YAM A;  1EQ5 A;  1UA6 Y;  5I4X A;  1D0M A;  1IP2 A;  4WM1 A;  1B5Z A;  1OQM A;  4G4B A;  1EQ4 A;  2MED A;  5LXW A;  1LZA A;  3WUL A;  1LJ3 A;  3LYT A;  3N9E A;  1CJ7 A;  1LKS A;  1IOC A;  4NGW A;  5IHG A;  1OUF A;  4NSH A;  1GB2 A;  3AZ6 A;  2CWI A;  3TMV A;  1HEW A;  1SQ2 L;  2BQL A;  4ETC A;  4RW2 A;  5DM9 A;  1BB5 A;  1DPW A;  1CJ6 A;  1GFH A;  1YQV Y;  2BLX A;  2HU3 A;  4B4I A;  5F9X A;  4QGZ A;  3ZVQ A;  1FBI X;  5FHW A;  5B05 A;  1KIP C;  1I20 A;  4TTD A;  4KXI A;  1XFP L;  1IX0 A;  5KXL A;  4HV2 A;  1C7P A;  2F30 A;  1HER A;  1BB4 A;  153L A;  1LJK A;  5E9R A;  194L A;  4U3X B;  1G7I C;  5LA8 A;  1LHI A;  3AB6 A;  5DL9 A;  1YIL A;  3WH1 A;  4ET9 A;  4NSI A;  1F6R A;  1LSP A;  1N4F A;  1FN5 A;  1IWT A;  4OWC A;  2MEG A;  1VAU A;  1ZVH L;  2BQJ A;  2C8O A;  1LTM A;  1GAZ A;  4GLV A;  1LZ9 A;  1EQE A;  4B1A A;  1IP7 A;  1LHK A;  1JKD A;  4M6D A;  1JTP L;  1XGT C;  3RU5 A;  2D91 A;  2W1L A;  1KIR C;  1GFR A;  4J1A A;  5KXK A;  1OUE A;  1GE4 A;  1LYZ A;  4HV1 A;  4LYT A;  1GDX A;  1UID A;  5J7C A;  4HP0 A;  4C3W A;  2ZQ3 A;  4HSF A;  4H92 A;  5B1F A;  5D5F A;  4D9Z A;  1OUA A;  4OOT A;  2LZ2 A;  3A6B Y;  4WO9 A;  4HTK A;  4IJ4 A;  1RI8 B;  1RCM A;  1VAT A;  1GB0 A;  1DI5 A;  4LGK A;  4KL7 A;  1PZY A;  2X0A A;  4LZT A;  3TXD A;  4YF2 A;  1LPI A;  1B7L A;  1GPQ C;  2BAA A;  2EIZ C;  3G3A B;  3P68 A;  4GCB A;  4XJI A;  5B07 A;  4DD3 A;  1GFU A;  2G4Q A;  4DD9 A;  2H9K A;  5KJ9 A;  3EO5 A;  3ZVQ B;  1LSG A;  4WG7 A;  3TXG A;  2CJL A;  2MEH A;  1UIC A;  1WTM A;  4N8Z A;  4XYY A;  3RZ4 A;  1GF3 A;  1IWY A;  3TXK A;  5DN5 A;  1BB6 A;  4NHQ A;  5KXY A;  4DT3 A;  2W1M A;  2YBH A;  4H1P A;  4IAT A;  1VED A;  3TXB A;  1LZY A;  1LMA A;  4CGE A;  5DN4 A;  4DWX A;  4G9S A;  1IP1 A;  1LMQ A;  1UUZ C;  1GAY A;  4OWE A;  4XAD A;  1NWG A;  1W6Z A;  1KXW A;  2BQA A;  3AW6 A;  1IY3 A;  1GFV A;  3T36 A;  5I4Y A;  1E8L A;  1B5Y A;  4CHX A;  5L3H A;  5B59 A;  2BQH A;  1HSW A;  1LZ8 A;  1INU A;  1GB5 A;  1LMT A;  2RSC A;  3TXE A;  5LVH A;  1QUT A;  1LJH A;  2FYC A;  1GFT A;  1WVV A;  1OUB A;  1HFY A;  1UCO A;  1JIS A;  3J4G A;  1G7H C;  4HJY A;  4RDS A;  1Z55 A;  5KKI A;  1H6M A;  1UBZ A;  1JTT L;  3QNG A;  1IOT A;  3TMW A;  5KXW A;  3IJU A;  1BHZ A;  4TSC A;  5HNL A;  4DD1 A;  5C6I A;  3LYO A;  1QTE A;  4LFP A;  3IJV A;  4ZEE A;  4WL7 A;  2MEE A;  1GF7 A;  2BQN A;  3ATN A;  4WLX A;  4G4H A;  1BB3 A;  1VDP A;  4LT2 A;  4H9H A;  5D5C A;  5T3F A;  1IVM A;  1CKC A;  2Z2E A;  2Z19 A;  1MLC E;  1JPO A;  1HFZ A;  3N9A A;  3TXI A;  4LYZ A;  1GEZ A;  4WLY A;  5IDD A;  2WAR A;  3A95 A;  4NIJ A;  1HEO A;  1TAY A;  4DDC A;  1GFA A;  2XTH A;  4LT0 A;  1LSE A;  3A94 A;  1FLY A;  2HEB A;  5LYM A;  2A7F A;  4NWH A;  4LYO A;  3QE8 A;  4XJF A;  5B06 A;  1LSN A;  2F2N A;  1OUI A;  1YKY X;  3D3D A;  1GB8 A;  1LJF A;  1XGP C;  1HEL A;  4PRU A;  1TEW A;  3P64 A;  4NGO A;  1G7L C;  1AT5 A;  1F0W A;  3VWO A;  2LYO A;  2Q0M X;  4XJD A;  5LAG A;  3RW8 A;  4ETB A;  2DBT A;  3W6C A;  5LIO A;  1OUJ A;  2DKV A;  3GXR A;  3TXJ A;  3HBH A;  1QUS A;  2BQM A;  1IP4 A;  5KXS A;  2HEF A;  1IOS A;  2YBL A;  4YEN A;  4XJH A;  5AMY A;  5KXZ A;  5I5Q A;  4WO6 A;  5IEL A;  5K7O A;  207L A;  4EMN A;  2MEB A;  2N5Z A;  3OK0 A;  4PJ2 C;  4NHS A;  1IWU A;  1HEN A;  4NGJ A;  3ULR A;  1IP6 A;  1B7R A;  2I6Z A;  2HU1 A;  1HML A;  1UC0 A;  1DKK A;  4X3B A;  1J1O Y;  3W3E A;  154L A;  1HEQ A;  2HED A;  4UWN A;  5LYZ A;  1D0K A;  4HPI A;  4HTQ A;  4IAS A;  1LZR A;  4AXT A;  1LZD A;  3CB7 A;  5F81 A;  2DQG Y;  1VFB C;  2H9J A;  1QTK A;  1IOQ A;  1B7N A;  1NMM A;  1I1Z A;  3FE0 A;  5LVG A;  1GBO A;  1BWI A;  3WYH A;  1LJ4 A;  1LMN A;  1ZV5 L;  2I26 L;  1BWJ A;  2DQH Y;  1YAP A;  1CKF A;  2BLY A;  1LJG A;  2BQD A;  5F9U A;  5KXX A;  1IC7 Y;  2HEA A;  4NEB A;  3WVX A;  3TMU A;  1F10 A;  3LHM A;  2Y8P A;  1BVK C;  1NDG C;  1VDS A;  4Z46 A;  5LIN A;  1LJJ A;  4NFV A;  1IR8 A;  1LZG A;  4DD2 A;  2EQL A;  4Z98 A;  1CKG A;  1GB6 A;  1OUH A;  1LSD A;  2ZWB A;  1BB7 A;  2D4J A;  1CNS A;  3WVY A;  3FI7 A;  1IWV A;  1DPX A;  4NSJ A;  2H5Z A;  1T6V L;  1B7O A;  2HUB A;  4LYB A;  4I8S A;  1DQJ C;  1QDT A;  3TMX A;  1MEL L;  4XJG A;  4LYC A;  1GF4 A;  1IR7 A;  1P2C C;  1D6Q A;  1AM7 A;  1GWD A;  2IFF Y;  3QY4 A;  1LZC A;  4HJV A;  4N9R A;  2VB1 A;  2LYM A;  3AJN A;  2HEE A;  1LZS A;  3BKH A;  1XEI A;  1VDQ A;  208L A;  3A93 A;  1JUG A;  4NG1 A;  5JEN B;  4ETE A;  3MGW A;  3D9A C;  4TSB A;  5KY1 A;  4N1C C;  4E3U A;  4H9I A;  5M1Y A;  5HMV A;  2Z39 A;  1GB7 A;  3EMS A;  3ZEK A;  1GB9 A;  135L A;  1LJN A;  2MEC A;  2CGI A;  1LZ1 A;  4NSG A;  1GEV A;  1LSB A;  2YDG A;  5DLA A;  1LYY A;  1NF5 A;  3CSR A;  1FLQ A;  4H91 A;  5LVJ A;  2Z18 A;  132L A;  3EXD A;  3RT5 X;  4NHT A;  1LZE A;  2YVB A;  1HSX A;  1RJC B;  1JKB A;  4NGL A;  1WQR A;  1LSY A;  1UIG A;  2YSS C;  3A3R X;  4WL6 A;  2F4G A;  1GFJ A;  6LYZ A;  1J1X Y;  1VDT A;  3CT5 A;  1FLU A;  2DQA A;  4GLA A;  1B5W A;  2YBJ A;  3WPJ A;  5C6J A;  1IR9 A;  1YAO A;  3A96 A;  5LVI A;  1NKH A;  2HEC A;  1HC0 A;  1CJ9 A;  2BQB A;  4O34 A;  1FDL Y;  1NHE A;  1LYO A;  1UIH A;  1KIQ C;  1WQQ A;  5HLL A;  1B7P A;  4H9E A;  1JJ0 A;  1V7T A;  4DD7 A;  4QEQ A;  3M3U A;  4UWU A;  4WM4 A;  1OUD A;  1G7M C;  4GN5 C;  1GFE A;  1UIB A;  133L A;  1C08 C;  1G7J C;  1HMK A;  1LOZ A;  1JEF A;  2F4A A;  2Z12 A;  4H8Z A;  2DQC Y;  4NY5 A;  1NBZ C;  2XJW A;  3HBD A;  4R0F A;  4ZFP A;  3A92 A;  2ZQ4 A;  4Z3M A;  4RW1 A;  1HFX A;  4NGV A;  3LYM A;  1FKV A;  4WLD A;  1DI4 A;  4H94 A;  3WXT A;  1QSA A;  5A3Z A;  3WXU A;  1XEK A;  4ANR A;  1DZB X;  1GBX A;  1D9U A;  2G4P A;  2ZIK A;  1NBY C;  3F6Z A;  4J0L A;  4J1B A;  1IP5 A;  3B0O A;  5APE A;  4H9B A;  1HHL A;  1JIT A;  4NWE A;  2W1Y A;  1LHM A;  3HBE X;  2XBS A;  1DKJ A;  1CKD A;  4B4E A;  3A34 A;  1A2Y C;  4W94 A;  1LHL A;  3IWR A;  1AZF A;  4BAF A;  1B5V A;  2BQK A;  2ZNW Y;  3M18 B;  1DXJ A;  1JSF A;  1IIZ A;  3EBA B;  3CT1 A;  5FCP A;  3OJP A;  2FBB A;  5ILC A;  1QSW A;  1YIK A;  1J1P Y;  4LT3 A;  3TXH A;  1LZ4 A;  3WU7 A;  4C5F A;  1B2K A;  1B5U A;  4WM3 A;  4I0C A;  5FDJ A;  2XBR A;  7LYZ A;  1IC4 Y;  3AGI A;  2NWD X;  3AGG G;  3CSZ A;  1LSZ A;  4RLM A;  6LYT A;  2ZYP A;  1AKI A;  1GHL A;  1B7M A;  1KXX A;  2BQC A;  4GCF A;  1LKR A;  1GE2 A;  1YL0 X;  4GN4 A;  1GB3 A;  1V7S A;  2CDS A;  4BAD A;  2Z38 A;  5HNC A;  2B5Z A;  4G49 A;  2BQG A;  2BPU A;  5APC A;  2EPE A;  1QQY A;  3CQL A;  2Z2F A;  3B0I A;  1WVU A;  1GBZ A;  2YBM A;  3WUM A;  3A3Q A;  1LAA A;  4NGI A;  1NQI A;  1LMP A;  4NGK A;  1LZN A;  4II8 A;  3AGH A;  8LYZ A;  2BQO A;  3KAM A;  5ILF A;  1B7Q A;  1JSE A;  4WM6 A;  1IWX A;  4FJR A;  3SP3 A;  5L9J A;  2BQI A;  4H93 A;  1C46 A;  4H9A A;  1O23 A;  1LSM A;  5FEL A;  3WU8 A;  1IP3 A;  3WUN A;  5II3 A;  2IHL A;  4LT1 A;  2C8P A;  5C6L A;  4OWB A;  4P2E A;  4DD0 A;  5L3I A;  3E3D A;  1AT6 A;  1REM A;  3A91 A;  1REY A;  1WQN A;  4GCC A;  1GXX A;  1XEJ A;  2LHM A;  1GE1 A;  3BKV A;  4WLT A;  1HEP A;  4QDN A;  4YM8 A;  4ET8 A;  1HNL A;  4CFP A;  1TBY A;  1GBY A;  3T6U A;  2AUB A;  2LZT A;  3W6E A;  5HQ1 A;  4J7V A;  5FEK A;  4HJZ A;  1IC5 Y;  1WQO A;  3LN2 A;  1LYS A;  2FYD A;  1A4V A;  1RFP A;  1LMO A;  1SLY A;  2YBN A;  2PC2 A;  4H90 A;  4YOP A;  1IEE A;  3A8Z A;  4QY9 A;  5A3E A;  1YL1 X;  5EBH A;  1GF8 A;  1CKH A;  5LA5 A;  1LHH A;  1D0L A;  1JKA A;  3WW5 A;  4WG1 A; 
#chains in the Genus database with same CATH topology
 1L06 A;  3T1H M;  2DQF C;  4ETA A;  3AJI B;  3WL2 A;  1L70 A;  3RNX A;  2HHH M;  4KT3 A;  3HDE A;  3DN3 A;  4P17 A;  4ML7 A;  1QTB A;  5FST A;  102L A;  1GVN A;  1GBW A;  1C1K A;  3U6P A;  3P66 A;  4PHI A;  2UUC M;  1L95 A;  1XGU C;  4PK0 A;  4XEN A;  1C43 A;  1IOR A;  4Z6Y A;  1VEG A;  1B0D A;  3W6B A;  4WMG A;  243L A;  241L A;  4PDG A;  1ZMY L;  1XGQ C;  4DR2 M;  4N0J A;  1DO2 A;  3T15 A;  1CU6 A;  4LJ6 A;  1L2C A;  3WMK A;  3IHP A;  1C6C A;  3SC3 A;  1JIY A;  1IWW A;  1OP9 B;  3HTF A;  4EPF A;  4YX7 C;  4M0D A;  1XEP A;  4JXJ A;  7LZM A;  3HHW A;  2KRU A;  2JZ1 A;  1LSF A;  5I53 A;  4D81 A;  1SWZ A;  4OW1 A;  1DGB A;  4EPI A;  1OUC A;  3A67 Y;  1FLW A;  1IQP A;  1DI3 A;  3J27 B;  1OIP A;  4DUZ M;  2O4W A;  4W56 A;  1L75 A;  4B08 A;  4N1E I;  1JB0 F;  4EIW A;  2B6T A;  3M6A A;  1N77 A;  2KNA A;  1B9O A;  2Q9E A;  5I54 A;  4DDA A;  1KY1 A;  5KXM A;  1L72 A;  2FBD A;  3M7G A;  2ZNX Y;  3HH5 A;  4KPM A;  3SAV A;  2O01 F;  3RE8 A;  1D6P A;  3GLI E;  5C18 A;  1WTH A;  1DO0 A;  3IG5 A;  1YE9 A;  1L86 A;  1XWI A;  1LZ5 A;  1REX A;  1QUG A;  3HFM Y;  1XGR C;  4QHS A;  3OE8 A;  5F14 A;  1KYI A;  1NO1 A;  1KY0 A;  4M4O A;  2JA2 A;  242L A;  3HHZ A;  1TR8 A;  1JJ1 A;  1L43 A;  259L A;  257L A;  3PDS A;  1L33 A;  2A7D A;  4H9C A;  1L8Q A;  4OX9 M;  5LAF A;  1LJE A;  4LF4 M;  4AI6 A;  134L A;  1OVK A;  4HTN A;  2D6B A;  4QOZ C;  150L A;  1L81 A;  4CJ2 A;  6LZM A;  2DQJ Y;  3OE9 A;  4AZF A;  1L90 A;  2Z8Y M;  4G4C A;  2CHQ A;  3CSQ A;  1GXV 2;  3QWL A;  261L A;  3U6Q A;  1CV5 A;  4G4B A;  2MED A;  5LXW A;  4I7T A;  1LZA A;  2BWE A;  2HL7 A;  5EP1 A;  1LJ3 A;  3N9E A;  4I81 A;  2R62 A;  5KQ8 A;  4NGW A;  5IHG A;  3KSJ A;  1OUF A;  4DR6 M;  1HEW A;  3MJ5 A;  2BQL A;  3KSX A;  4L6V 6;  4RW2 A;  2XFT A;  2KXE A;  2BLX A;  4X62 M;  1ZWN A;  2HU3 A;  1G0K A;  5FHW A;  2LHG A;  151L A;  2APL A;  4LRS A;  3SBJ A;  4HV2 A;  1L68 A;  1HER A;  1CUP A;  5IT9 S;  1BB4 A;  5E9R A;  1L15 A;  5DL9 A;  3WH1 A;  3RGP A;  2RGH A;  4NSI A;  4W54 A;  1F6R A;  1L59 A;  1L20 A;  1W5S A;  3I51 A;  1G0M A;  1C6I A;  3J7A S;  1GAZ A;  4GLV A;  192L A;  5ITR A;  2D91 A;  3L64 A;  3HU2 A;  2QHO B;  2J7O A;  3BXW A;  3L28 A;  2EKF A;  5D5F A;  1ZMU A;  1WGL A;  3V2Y A;  3MHV C;  1JQJ C;  4LY6 A;  3A6B Y;  5E26 A;  3GLH E;  2DXI A;  4IJF A;  4LG2 A;  2QBY A;  1VAT A;  165L A;  4YF2 A;  1LPI A;  2EIZ C;  2KW0 A;  5B07 A;  1L47 A;  1D3N A;  2JY7 A;  4M9Z A;  3TXG A;  2MEH A;  4XYY A;  1L48 A;  1C6T A;  1WTM A;  1X37 A;  130L A;  2L09 A;  1C61 A;  3KVW A;  4OO9 A;  1NSF A;  1LMA A;  1L67 A;  2BJV A;  3OTO M;  2B74 A;  4L4U A;  1L27 A;  5I4Y A;  1IY3 A;  3J80 S;  2DZO B;  1G0Q A;  3VK7 A;  4CHX A;  2BQH A;  1INU A;  4M9S A;  4PDI A;  2CP8 A;  4L16 A;  1P3N A;  2GNO A;  1HFY A;  4HJY A;  1JIS A;  111L A;  247L A;  3SAW A;  4CGY B;  191L A;  2YQZ A;  2FS1 A;  252L A;  2G3Q A;  3IJV A;  197L A;  1GF7 A;  3T6U A;  3W6E A;  4WLX A;  4LT2 A;  2OPF A;  1QTD A;  2XSZ D;  2Z2E A;  1MLC E;  1JPO A;  1HFZ A;  3N9A A;  4IBG A;  1L80 A;  3TXI A;  4DQ5 A;  1GEZ A;  5IDD A;  4NIJ A;  1TAY A;  1GFA A;  3LW5 F;  5LYM A;  3QE8 A;  4XJF A;  3FUV A;  4PRU A;  3AOE C;  3P64 A;  110L A;  4AQN A;  3RW8 A;  5LAG A;  1L51 A;  2DBT A;  1L44 A;  1T8G A;  3GXR A;  5KXS A;  2M5Z A;  145L A;  1CV4 A;  5I5Q A;  2F5N A;  3K1J A;  2N5Z A;  3OK0 A;  4PJ2 C;  1IWU A;  196L A;  1L99 A;  1L04 A;  2HU1 A;  1WXQ A;  4G4N A;  2HUL A;  183L A;  2DHR A;  1HEQ A;  3A98 B;  4LDL A;  1T3T A;  4QNR A;  1D0K A;  2Y0Q A;  4HPI A;  5C6L A;  1L1T A;  2CV2 A;  4FWG A;  1NMM A;  3RGS A;  3FE0 A;  1P7S A;  1IY0 A;  3HU9 A;  3WYH A;  2I26 L;  1BWJ A;  1CKF A;  2BLY A;  1FNN A;  3KW6 A;  4NEB A;  3WVX A;  4GH9 A;  2UUB M;  5EJC A;  5LIN A;  4DD2 A;  1IR8 A;  195L A;  1E9R A;  148L E;  3LMM A;  2DAE A;  137L A;  4RF1 A;  4Z98 A;  3VW7 A;  3CTW B;  232L A;  1CNS A;  1KW7 A;  3NBX X;  1WHC A;  1VG5 A;  1IWV A;  4DV5 M;  1L41 A;  1L24 A;  1L54 A;  1B7O A;  2H5Z A;  4LYB A;  4I8S A;  3TMX A;  1MEL L;  1GF4 A;  1XHB A;  2LWX A;  1Q3C A;  1AM7 A;  3GQ5 A;  1IBL M;  1GWD A;  224L A;  2IFF Y;  4HJV A;  2LYM A;  3AJN A;  1LZS A;  1JUG A;  2UU9 M;  5JEN B;  3MGW A;  3SAR A;  1L08 A;  4MH0 E;  4N1C C;  4H9I A;  5M1Y A;  4B3R M;  1GB9 A;  2CGI A;  4NSG A;  3FUT A;  5DLA A;  1NF5 A;  3EXD A;  1XXH B;  1IN4 A;  3LVW A;  1LZE A;  4NHT A;  1WR1 B;  1WQR A;  1LSY A;  1UIG A;  2A4T A;  1C6A A;  1B5W A;  2C9O A;  5LVI A;  1D3J A;  1HC0 A;  5KPT A;  2EO2 A;  2BQB A;  1FDL Y;  144L A;  2C9C A;  1V7T A;  3M3U A;  4WM4 A;  3EML A;  1GFE A;  1C08 C;  1G7J C;  1HMK A;  1LOZ A;  4JV5 M;  2VF8 A;  3A92 A;  168L A;  1Y8G A;  2OEA X;  4RW1 A;  1K28 A;  4XGI A;  1OVH A;  4L78 A;  4H94 A;  2N35 A;  231L A;  1HT1 E;  5A3Z A;  1DZB X;  1GBX A;  5HQ1 A;  3FRH A;  1NBY C;  3B0O A;  4LFB M;  3EIE A;  2L4F A;  4GKJ M;  1DKJ A;  2DWN A;  235L A;  3HH4 A;  3C81 A;  2KRK A;  1J5E M;  1LHL A;  3I04 M;  1AZF A;  3IWR A;  164L A;  4BAF A;  2BQK A;  4FWH A;  1DYB A;  1RU3 A;  4I4L A;  1DXJ A;  1C6Q A;  3U60 A;  1L34 A;  3EBA B;  4MM3 B;  3OJP A;  4G3O A;  131L A;  4LT3 A;  3WU7 A;  1LZ4 A;  1J7K A;  4I0C A;  3L27 A;  234L A;  3SB8 A;  3AGG G;  230L A;  6LYT A;  1AKI A;  1GHL A;  3HU8 A;  4GCF A;  4LDO A;  4GN4 A;  3UMM A;  1IN5 A;  4W57 A;  1L74 A;  3FD9 A;  1MN3 A;  1L37 A;  5ITY A;  1PQD A;  2L7H A;  2BPU A;  3JR6 A;  3U6C A;  3C58 A;  3B0I A;  1K82 A;  1WVU A;  1G0P A;  2HAK A;  1DYA A;  1C69 A;  4I7O A;  1A5T A;  1LAA A;  4QOS A;  1D2W A;  4NXN M;  3K8Z A;  1LMP A;  4YXC A;  1L30 A;  3TWM A;  4NGK A;  2L4E A;  2B7X A;  2VF7 A;  2LCB A;  2LC9 A;  1QT8 A;  1PQM A;  1NJF A;  1JSE A;  2XH9 A;  1L11 A;  262L A;  1L88 A;  4CHT B;  258L A;  1VDD A;  3PNV A;  3U5Z B;  1LSM A;  3GLI A;  5FEL A;  2C8P A;  2YNM D;  3VDU A;  2LVP C;  4DD0 A;  1AT6 A;  1LI6 A;  3A91 A;  3L25 A;  2CE7 A;  1XEJ A;  4WLT A;  3BKV A;  4CFP A;  4MGH A;  2EJS A;  4LF5 M;  2R4J A;  1PQO A;  3K92 A;  4YOP A;  1B6I A;  1DYE A;  1L26 A;  4QY9 A;  1C65 A;  1GF8 A;  1LHH A;  1JKA A;  1L56 A;  4WG1 A;  4S0W A;  2ZYC A;  3SBB C;  174L A;  2XEP A;  4B4J A;  5FTL A;  3HWL A;  4GC9 A;  1EFU B;  193L A;  3CF0 A;  1I4W A;  4R71 A;  3DOA A;  9LYZ A;  161L A;  4GCD A;  1XMQ M;  2Z6B A;  1QVR A;  3GUP A;  5F16 A;  4TUN A;  3B0K A;  1L01 A;  4WM5 A;  2GV0 A;  3FE3 A;  2HUM A;  4GN3 A;  4TWS A;  1B5X A;  2CUZ A;  1LZ6 A;  4W59 A;  2KA6 B;  1ZMW A;  1RE2 A;  3FKE A;  1C45 A;  2LVQ D;  4LGM A;  1GJS A;  2LTU A;  1JTN A;  1HF4 A;  1NY6 A;  1GD6 A;  4W96 A;  1PGY A;  1DYD A;  1QT3 A;  4JI2 M;  1C64 A;  1KNI A;  1WQP A;  4GRI A;  2E5L M;  1LZT A;  1KS3 A;  1YUB A;  1BGI A;  220L A;  1NHG C;  5KXP A;  1XMO M;  1F6S A;  1XNR M;  1IXS B;  3DN0 A;  1XJT A;  4NHI A;  2HUK A;  2XLJ A;  186L A;  1C6E A;  5KXT A;  2LH0 A;  1C6N A;  4OWA A;  3E4R A;  1GBS A;  1UIA A;  1GE0 A;  3UK6 A;  4HPE A;  1L32 A;  3B74 A;  3AW7 A;  1C68 A;  3L2A A;  1GFG A;  1EE8 A;  1I56 A;  3G3B B;  3TE6 A;  214L A;  4OW0 A;  5HMJ A;  1P2R A;  126L A;  5DYI A;  1OWZ A;  1UIF A;  2BNK A;  4YEO A;  5KKJ A;  3GRY A;  147L A;  2ZIJ A;  2G4N A;  2JP7 A;  3F9L A;  248L A;  1L73 A;  3CGW A;  2YBI A;  5KQD A;  4R7G A;  3W6D A;  4NGY A;  4EOF A;  3U61 A;  3J6K A;  1IXR C;  4K5Y A;  4XK8 F;  3P4Z A;  3SMP A;  1LMC A;  1LSC A;  4NXM M;  3WPL A;  1C6F A;  4LFX A;  1D9W A;  104L A;  3CF2 A;  3AYQ A;  3VK8 A;  3C9P A;  1L40 A;  1L10 A;  1HEM A;  1JWR A;  3FUW A;  1QIO A;  2XZU A;  123L A;  2VQF M;  1I94 M;  2V1C A;  1REZ A;  1UAC Y;  2BJW A;  3GPY A;  1C6D A;  3I01 M;  4LYM A;  2Z7J A;  3WW6 A;  4A7D A;  4DC4 A;  4FDY A;  4I7S A;  3SMS A;  5I4X A;  181L A;  1W5T A;  1IP2 A;  3WHK A;  3FUX A;  1EQ4 A;  1PJJ A;  2R45 A;  3WUL A;  1XC8 A;  3HTG A;  219L A;  3U6E A;  237L A;  3LYT A;  3B9P A;  1IOC A;  228L A;  1SQ2 L;  1GFH A;  1KIP C;  1I20 A;  1L62 A;  1XFP L;  4DAJ A;  5GKN A;  4B3M M;  4ET9 A;  4D82 A;  2B70 A;  1L16 A;  1L93 A;  3HUQ A;  1QT5 A;  1N4F A;  4LFA M;  3Q8X A;  182L A;  4I7Q A;  3TQS A;  1LZ9 A;  4ARP A;  3PBL A;  1IP7 A;  1VEK A;  1JKD A;  1LHK A;  1JTP L;  4B1A A;  2DWZ B;  1KIR C;  5KXK A;  2KNZ A;  1IXZ A;  4OVZ A;  3TWK A;  2W82 A;  184L A;  1LYZ A;  109L A;  1GDX A;  1UID A;  5J7C A;  4HP0 A;  120L A;  3SFZ A;  2ZQ3 A;  166L A;  5B1F A;  1OUA A;  5JI2 E;  2LZ2 A;  4OOT A;  4WO9 A;  213L A;  3NY8 A;  3QAK A;  2OE4 X;  2QB0 B;  140L A;  1RCM A;  1DI5 A;  5FTM A;  3C82 A;  1PZY A;  4LZT A;  4JI7 M;  4GCB A;  3G3A B;  141L A;  3SB7 A;  3LCU A;  223L A;  4DD3 A;  5KJ9 A;  3JR5 A;  3L29 A;  4JI8 M;  4PD2 A;  4GEW A;  2QCU A;  1LI2 A;  1GF3 A;  4NRV A;  4P16 A;  3HZJ A;  4EXM A;  2YBH A;  3TXB A;  2UXC M;  4CGE A;  3LVV A;  2YFQ A;  3SAU A;  4KO8 A;  3HGI A;  3A45 A;  1IP1 A;  1LMQ A;  2K9D A;  1WIV A;  4XAD A;  1NWG A;  3AW6 A;  4I7L A;  1B5Y A;  4JI4 M;  3EIH A;  129L A;  1QT6 A;  2RSC A;  4LJ9 A;  3HTD A;  2JXN A;  1IFY A;  2M60 A;  1OJL A;  3TXE A;  2IGC A;  4OVZ B;  3DKE X;  2FYC A;  1WVV A;  3J4G A;  1H6M A;  1K3W A;  3QNG A;  225L A;  4RF0 A;  1OV7 A;  4TSC A;  158L A;  3CDT A;  143L A;  4EKP A;  4LFP A;  4JI3 M;  4ZEE A;  4WL7 A;  2BQN A;  3ATN A;  5T3F A;  4H9H A;  1IVM A;  1OWY A;  1L12 A;  4LYZ A;  3HKP A;  4WLY A;  2WAR A;  3W0L B;  1LGW A;  3A95 A;  3T38 A;  2XTH A;  3L2X A;  3HJQ A;  1CU0 A;  1QAO A;  4NWH A;  4LYO A;  1OAO C;  3CF6 E;  1OUI A;  1V92 A;  1C63 A;  1L52 A;  1L69 A;  1SSW A;  1LJF A;  3DN4 A;  1HEL A;  1TEW A;  4NGO A;  1G7L C;  1F0W A;  4REZ A;  2VQE M;  3VWO A;  4XJD A;  1R2Y A;  1SSY A;  3G3X A;  2RBQ A;  5LIO A;  2HCB A;  4EKR A;  1QUS A;  1XNQ M;  2BQM A;  250L A;  2HEF A;  1MJG M;  4FVM A;  4YEN A;  5AMY A;  3K9O A;  5KXZ A;  4ARQ A;  3GLH B;  4MGZ E;  5IEL A;  4EMN A;  1UM8 A;  3WHL A;  169L A;  1QSQ A;  1B7R A;  1PRB A;  1UC0 A;  1NVM A;  5EP2 A;  1GL6 A;  4EKQ A;  1L64 A;  4IAS A;  4HTQ A;  1LZR A;  2K0B X;  2DQG Y;  2QNJ A;  5EXT A;  2EA0 A;  1VFB C;  5LVG A;  1LMN A;  5FTJ A;  4DKL A;  1JQU A;  1QZE A;  1R6B X;  2WSE F;  2D7E A;  4JI0 M;  1VDS A;  172L A;  1H6U A;  1LJJ A;  4NFV A;  3HDF A;  3DA1 A;  1GB6 A;  4NL4 H;  1OUH A;  1T97 A;  2D4J A;  2XGN A;  2RGO A;  4FCW A;  3GQ3 A;  3FI5 A;  2LHC A;  3GLF B;  4I8O A;  4NSJ A;  1L91 A;  1P64 A;  2HUB A;  4GIP A;  4LYC A;  3B7N A;  4CIZ A;  1IR7 A;  1P2C C;  1LZC A;  229L A;  2C98 A;  3U6O A;  2HEE A;  3BKH A;  3DN2 A;  4NG1 A;  1C67 A;  5KY1 A;  2C5R A;  2KEB A;  2Z39 A;  3ZEK A;  226L A;  1LJN A;  1P36 A;  1C6J A;  1C6K A;  1HR0 M;  127L A;  1L19 A;  2YDG A;  1L66 A;  1FLQ A;  132L A;  2YVB A;  1JKB A;  4NGL A;  3A3R X;  4W53 A;  1L82 A;  4WL6 A;  2F4G A;  3HHY A;  6LYZ A;  1VDT A;  1OQY A;  4A3V B;  5ITU A;  4GLA A;  1V34 A;  3AKZ A;  189L A;  3UJN A;  1NKH A;  4GC5 A;  1L77 A;  1CJ9 A;  1IXS A;  2DAK A;  5KPR A;  4DR4 M;  3RZE A;  1WQQ A;  3U6S A;  1JJ0 A;  4DV1 M;  2B73 A;  3DN8 A;  1E94 E;  162L A;  1UIB A;  2F4A A;  4J1A A;  1C66 A;  4NY5 A;  1QTH A;  2JY5 A;  2ZQ4 A;  1N34 M;  3W0F A;  119L A;  1ORY B;  3WXT A;  1E32 A;  4FD2 A;  4NOO B;  1QSA A;  1L58 A;  3WXU A;  190L A;  4J1B A;  1D9U A;  2G4P A;  1TTE A;  2DAI A;  5APE A;  1IP5 A;  3UZU A;  1NHW C;  2LNH C;  260L A;  1JIT A;  2I7N A;  1SXJ C;  3GPP A;  2JY6 B;  1LHM A;  3NY9 A;  1V33 A;  1DGF A;  160L A;  4B4E A;  4I7J A;  1L21 A;  3M18 B;  1HNW M;  1T8A A;  1DV0 A;  3QAU A;  1IM2 A;  5FCP A;  2J7N A;  1L13 A;  5ILC A;  1J1P Y;  4C5F A;  1LPY A;  2NTG A;  4JI6 M;  5FDJ A;  1L29 A;  7LYZ A;  1IC4 Y;  2X4A A;  4RLM A;  1SXJ A;  2QZ4 A;  4F2L A;  2ZYP A;  4IIW A;  2BQC A;  1LKR A;  3R8F A;  1L57 A;  1V7S A;  5LZM A;  2Y20 A;  4G4O A;  1DYG A;  4G49 A;  2BQG A;  1GKI A;  4B3T M;  5APC A;  1QQY A;  3CQL A;  2MJ5 B;  1GBZ A;  187L A;  1NQI A;  1G8P A;  3RFW A;  1LZN A;  255L A;  2OTZ X;  4II8 A;  1G1W A;  3HH3 A;  5I14 A;  2BQO A;  2XZF A;  3KAM A;  5ILF A;  1B7Q A;  4NC6 A;  5ITX A;  4GRV A;  3JAM S;  114L A;  5L9J A;  3SHF A;  4LFC M;  5II3 A;  1O23 A;  2F5S A;  4LF9 M;  1Z59 A;  2IHL A;  1R7R A;  2L2D A;  4GMQ A;  3GRU A;  1CV1 A;  1P5C A;  1OIZ A;  2RBR A;  3SB5 A;  3TPZ A;  4QDN A;  4ET8 A;  2LZT A;  2XFS A;  4PCZ A;  2D7H A;  1IC5 Y;  1L35 A;  1WQO A;  1LYS A;  3LN2 A;  2Z4S A;  1LMO A;  1RFP A;  1SLY A;  3V2W A;  1Z5C A;  5A3E A;  1YL1 X;  3J7B A;  1C62 A;  244L A;  1HQY E;  1R5L A;  4MR1 A;  1GE3 A;  157L A;  4LJ5 A;  1T3P A;  4LZM A;  3LZT A;  4RLN A;  5KO3 A;  1L2D A;  2B72 A;  4ARM B;  1JTO L;  5KXO A;  2H5X A;  2DQI Y;  1LCN A;  1LSA A;  1G1V A;  3DMX A;  3AZ7 A;  3TL4 X;  1LGU A;  3OE0 A;  211L A;  2OU0 X;  1CUK A;  1JR3 E;  4PGJ B;  4PT5 A;  1L65 A;  4B49 A;  2ZIL A;  1CJ8 A;  4XJB A;  1JKC A;  2D4K A;  1XSF A;  1L42 A;  142L A;  2DAM A;  1ZVY B;  1QDR A;  1CX7 A;  1OTR A;  4W58 A;  4TX7 A;  1HNX M;  1HQC A;  1MX0 A;  1BQL Y;  4NRW A;  4OWH A;  3GLG B;  1FJG M;  4CJ6 A;  5KXN A;  2Z3X A;  1ALC A;  1WTN A;  1BVX A;  1L61 A;  4ETD A;  3MMP A;  1TCY A;  5EP3 A;  2L7I A;  3DN6 A;  1P56 A;  3B6L A;  112L A;  4LDE A;  2RRU A;  1JJ3 A;  1QT7 A;  4B0D A;  4BAP A;  4E97 A;  1CVK A;  1G0L A;  4I5S A;  1UIE A;  3KS8 A;  4IBC A;  1LZB A;  3AZ5 A;  3KDS E;  4DR3 M;  4QNM A;  4RNA A;  1QAQ A;  4UN2 B;  1L05 A;  1QQW A;  4H9F A;  4DR7 M;  1TDY A;  4NGZ A;  206L A;  2FNA A;  1ZMV A;  4G4Q A;  2EKS C;  1P46 A;  1L22 A;  1GL7 A;  215L A;  3TXF A;  1GF6 A;  2D4I A;  4ARQ B;  1Q02 A;  2LVA A;  4DDB A;  4DYG A;  4L41 A;  5FLX S;  3FTE A;  1LYD A;  4L15 A;  1LGX A;  1JR3 A;  1YLA A;  2C99 A;  1NDM C;  3CT0 A;  1Z5A A;  3ZCB B;  4R3D A;  3ILK A;  3KOZ E;  4LJA A;  3HHX A;  1L17 A;  4ZIX A;  2ZAM A;  2JWS A;  205L A;  4BS7 A;  2DQD Y;  4YEM A;  4LRT A;  5BR8 M;  4JI5 M;  1UFZ A;  1SX7 A;  2OE9 X;  3W6F A;  4LJ7 A;  1C10 A;  2FOI C;  1WQM A;  4DV6 M;  1JTM A;  2MEI A;  1B7S A;  1YKX X;  4GCE A;  1YRO A;  1SX2 A;  4OOO A;  4WW0 A;  5KXR A;  1IY4 A;  3LZ2 A;  2L78 A;  1KFV A;  3WPK A;  3KP0 E;  3C3E A;  3LQQ A;  4C3W A;  1GF9 A;  4YHH M;  1IWZ A;  3B72 A;  2BQE A;  2JUJ A;  163L A;  4N5R A;  2OO9 A;  2DNA A;  1YAN A;  5EQT A;  5LVK A;  2F47 A;  4Z41 A;  1W08 A;  2O79 A;  177L A;  1YAM A;  113L A;  1UA6 Y;  233L A;  2RBP A;  1L2B A;  2QPA A;  4DV0 M;  1OQM A;  1IN6 A;  2JZ0 A;  2LVN C;  2UUA M;  1L98 A;  4LJ8 A;  1QTZ A;  180L A;  1CUQ A;  1GB2 A;  3TMV A;  2B6X A;  4ETC A;  5DM9 A;  1L23 A;  1CJ6 A;  1YQV Y;  4QGZ A;  3ZVQ A;  1FBI X;  4S12 A;  4LCB A;  4LF8 M;  1IX0 A;  5KXL A;  256L A;  1PJQ A;  1G3I A;  1LJK A;  194L A;  125L A;  1Z6T A;  1YIL A;  2O7A A;  5F3W A;  3CDO A;  2R18 A;  199L A;  1LSP A;  3GQ4 A;  2RAZ X;  1L03 A;  1ZVH L;  2BQJ A;  5IWA M;  4X66 M;  3W68 A;  1CV0 A;  2KZU A;  2AHM A;  4NSR A;  4DV2 M;  1P2L A;  4DV3 M;  2B75 A;  1OUE A;  3J81 S;  3GLF E;  1GE4 A;  7CAT A;  4CIS A;  2OOB A;  4GHL A;  4D9Z A;  4MB7 A;  1HT2 E;  3CDQ A;  2XSZ A;  1GB0 A;  4LGK A;  3TXD A;  2X0A A;  2G8L A;  2OOA A;  1B7L A;  1GPQ C;  2CRU A;  3FA0 A;  1PJS A;  4XJI A;  2G4Q A;  1QSB A;  3EO5 A;  3I4V A;  4WG7 A;  1UIC A;  1DGH A;  4FCV A;  1L38 A;  1L97 A;  3RZ4 A;  118L A;  1AIP C;  3TXK A;  1L46 A;  1R4G A;  1BB6 A;  3GUM A;  4NHQ A;  5KXY A;  1PQJ A;  3K9P A;  1HNZ M;  4H1P A;  5LMN M;  1LZY A;  5DN4 A;  3IG8 A;  1KSF X;  4G9S A;  1ZQ9 A;  3C8R A;  1GAY A;  4OWE A;  1SXJ D;  3DNA A;  1W6Z A;  1T6H A;  1GFV A;  1NJG A;  1L45 A;  1DYF A;  2VII A;  5L3H A;  217L A;  5B59 A;  1LZ8 A;  1LMT A;  3VDP A;  1HJP A;  2CV0 A;  5LVH A;  1NV9 A;  1LJH A;  1NNU C;  4ARM A;  3NWL A;  1UCO A;  1L0K A;  4RDS A;  2R4E A;  5KKI A;  1IBM M;  2NTH A;  3TMW A;  1IOT A;  2MH8 A;  5HNL A;  2WZJ A;  4DUY M;  4LZZ A;  2B3T A;  1G41 A;  3LYO A;  222L A;  2MEE A;  4G4H A;  1VDP A;  4F1I A;  5D5C A;  1CKC A;  2Z19 A;  3B7Q A;  5LMU M;  1HEO A;  2UXD M;  3FUU A;  4ZPX A;  1LSE A;  4LT0 A;  1FLY A;  3H4J A;  2HEB A;  2DVW B;  5EXS A;  1L84 A;  155L A;  3V76 A;  2LYO A;  2Q0M X;  4L8R C;  1L60 A;  2VDB B;  3W6C A;  2KHH A;  4W55 A;  3HBH A;  1T43 A;  1IOS A;  1PJT A;  1P6Y A;  4WO6 A;  3BOS A;  2MEB A;  2HKJ A;  1QUO A;  3SB6 A;  4FW9 A;  3PVS A;  1HEN A;  4EJ4 A;  1IP6 A;  1L14 A;  4X3B A;  1DKK A;  1C6L A;  1KW5 A;  3GUJ A;  154L A;  1TDH A;  1N36 M;  1L89 A;  4UWN A;  2OTY X;  1QS5 A;  1TH4 A;  4AXT A;  1IOQ A;  1B7N A;  3SYL A;  3UGJ A;  1I1Z A;  1QTK A;  1GBO A;  1LJ4 A;  1ZV5 L;  1CV6 A;  1LJG A;  2BQD A;  5F9U A;  1IC7 Y;  1TLA A;  2HEA A;  3SAS A;  3TMU A;  3LHM A;  1NDG C;  1R2Z A;  1IY1 A;  2F5P A;  1CKG A;  2A5Y B;  1L85 A;  2ZWB A;  3L26 A;  2Y21 A;  2RB2 X;  2MGW A;  3GUK A;  3WVY A;  1MU5 A;  3VKG A;  1DPX A;  1L83 A;  2XQO A;  1T6V L;  4XJG A;  1CU3 A;  1N33 M;  4I7R A;  1D6Q A;  200L A;  5C1B A;  2RH1 A;  4N9R A;  208L A;  1XXH E;  4ETE A;  3D9A C;  4TSB A;  2K47 A;  173L A;  2Q2E B;  5HMV A;  1GB7 A;  135L A;  1C6B A;  1LYH A;  1LSB A;  1LYY A;  3CSR A;  5LVJ A;  2R44 A;  3OE6 A;  2Z18 A;  2DEN A;  2YSS C;  245L A;  2G5G X;  3CT5 A;  2B6Z A;  1FLU A;  3DMV A;  2YBJ A;  3WPJ A;  4OU7 A;  1IR9 A;  1YAO A;  1L1Z A;  5C6J A;  2HEC A;  1L02 A;  1D3F A;  3GUO A;  3HUA A;  3U60 B;  5ITT A;  1LYO A;  3U6M A;  1KIQ C;  5HLL A;  1B7P A;  4H9E A;  2WSC F;  4UWU A;  1G7M C;  1IN8 A;  1GJT A;  1OUD A;  3QYE A;  133L A;  3HT7 A;  4GN5 C;  1JEF A;  4IBI A;  4B7F A;  1NBZ C;  3U5Z A;  4ZFP A;  4JYA M;  4Z3M A;  4NGV A;  4WLD A;  1FKV A;  4BBA A;  2DHY A;  3AL0 C;  1OFH A;  4X64 M;  3GLG A;  4ANR A;  1GAB A;  2ZIK A;  3FYD A;  3HWS A;  188L A;  1NY5 A;  4Q7J A;  4X65 M;  103L A;  3HBE X;  2JY8 A;  4FWD A;  3W67 A;  2XBS A;  1CKD A;  4DV7 M;  2DAG A;  3A46 A;  1B5V A;  1PQK A;  1IIZ A;  1J09 A;  3CT1 A;  2D7G A;  3GLH A;  2FBB A;  2Z4R A;  2C96 A;  2DZN B;  178L A;  3C7W A;  3GUN A;  2XBR A;  4II7 A;  3AGI A;  2NWD X;  3CSZ A;  1L53 A;  4AG6 A;  2DKL A;  4AG5 A;  1B7M A;  4IBJ A;  1KXX A;  3SBA A;  2X8A A;  1GE2 A;  3DFZ A;  3GRV A;  2CDS A;  1TDZ A;  2Z38 A;  5HNC A;  2B5Z A;  1G07 A;  2KDL A;  2ERC A;  2XF3 A;  254L A;  2V1U A;  3A42 A;  1CTW A;  4KT0 F;  1LYI A;  4LJ4 A;  2DI0 A;  4DJH A;  2J5Y A;  2YBM A;  3WUM A;  3A3Q A;  4NGI A;  3PFI A;  8LYZ A;  2L6O A;  5IRE B;  5JI3 E;  1L07 A;  3JR4 A;  4IBB A;  251L A;  3LZM A;  2KZS A;  3HTB A;  4DQJ A;  1IWX A;  1SXJ E;  146L A;  4IAP A;  1GO5 A;  2BQI A;  4H93 A;  1C46 A;  3WU8 A;  1IP3 A;  4M0W A;  4W5W A;  2P5T A;  4Z8X A;  1C6H A;  4OWB A;  4P2E A;  1IY2 A;  3E3D A;  3AOG A;  1REM A;  2ZAN A;  1D2Y A;  1TF0 B;  1L92 A;  2QBY B;  1HNL A;  1TBY A;  1GBY A;  5L3I A;  4AQY M;  4J7V A;  2Q9D A;  4HJZ A;  3FAD A;  1OFI A;  2QEN A;  3I4Y A;  3U6D A;  236L A;  1A4V A;  3U6L A;  4H90 A;  2PC2 A;  4ZPU A;  238L A;  3AFH A;  5EBH A;  4AKI A;  1C60 A;  1D0L A;  1BVS A;  3P65 A;  3WW5 A;  1KXY A;  1XB2 B;  1LJI A;  5APF A;  2DQE Y;  1L36 A;  1L79 A;  1JHL A;  3THG A;  4EKS A;  1OUG A;  3G3W A;  176L A;  4UWV A;  1PM5 A;  1PS5 A;  3DN1 A;  2LYZ A;  1IN7 A;  185L A;  4CFO A;  5E4P A;  2F5O A;  3KFU G;  1Z5B A;  2W1X A;  3C3D A;  1PJI A;  3A90 A;  3D4S A;  3AZ4 A;  3AV0 A;  1LYJ A;  5A2Q S;  2LBC A;  3TWL A;  128L A;  4D80 A;  1CV3 A;  3ATO A;  4GKK M;  3SB9 A;  3KOY E;  4XN6 A;  3A6C Y;  4GBR B;  3B89 A;  2Z37 A;  1TGU A;  3K3T A;  2MEA A;  2CWB A;  5B1G A;  4PRQ A;  3ZH9 B;  2MEF A;  1SXJ B;  1G06 A;  1EL1 A;  2FH0 A;  1L63 A;  2K6B A;  1ZYT A;  1QYR A;  3AOE A;  2BQF A;  5E6J A;  4PPO A;  1N32 M;  4R6C A;  2RKO A;  4BLC A;  3WUA A;  1FKQ A;  1YKZ X;  4NG8 A;  1GF0 A;  1G4A E;  4I7M A;  4WP2 A;  3KOX E;  1AUA A;  3GLF A;  3W6A A;  4WOA A;  2X49 A;  1PQI A;  5I4W A;  4NHP A;  3KOW E;  152L A;  3LYZ A;  2RB1 X;  5DFL A;  1QTV A;  1G71 A;  2QP9 X;  1C6M A;  3U61 B;  107L A;  4H8X A;  1G0G A;  4IJE A;  2HTX A;  5FSW A;  4H8Y A;  1WGN A;  1QAN A;  1OKS A;  2DWM A;  1GFK A;  5LYT A;  1GDW A;  2GQF A;  3FYC A;  3GPU A;  1L31 A;  4Y28 F;  3H4M A;  1L94 A;  2I25 L;  3GXK A;  3T1Y M;  4MST A;  3F92 A;  4WM2 A;  1LI3 A;  3HJS A;  5FTK A;  1BWH A;  3N9C A;  4AGA A;  3CDV A;  2LZM A;  3FRI A;  2QQ8 A;  3K2R A;  4HEO A;  4MGK E;  1IO5 A;  2ANX A;  5APD A;  212L A;  4MCK A;  1LHJ A;  3C7Y A;  3CDR A;  4W52 A;  1Q3B A;  3Q8G A;  1GF5 A;  4WUR A;  122L A;  1YAQ A;  1H87 A;  3WU9 A;  4ARL A;  4DQ7 A;  3SAT A;  1EQ5 A;  4YXA C;  1D0M A;  1SWY A;  4WM1 A;  138L A;  1B5Z A;  3T6P A;  1L87 A;  1CJ7 A;  3DZD A;  1LKS A;  1C6P A;  4GIT A;  2F2Q A;  1L0J A;  4NSH A;  108L A;  3AZ6 A;  2CWI A;  3QYB A;  3HT8 A;  3LQR A;  210L A;  4MGY E;  1BB5 A;  1DPW A;  1S3S A;  1T6O A;  3E46 A;  2OU9 A;  5F9X A;  4B4I A;  4KLN A;  5B05 A;  1N78 A;  4TTD A;  3HT6 A;  4KXI A;  3C8Q A;  1L76 A;  1C7P A;  2F30 A;  3VFD A;  1G59 A;  153L A;  3FTC A;  4U3X B;  5LA8 A;  1G7I C;  4BB9 A;  1LHI A;  3AB6 A;  115L A;  4IBE A;  1I6S A;  1FN5 A;  1IWT A;  4OWC A;  2MEG A;  1VAU A;  2C8O A;  3D8L A;  1LTM A;  1L28 A;  1EQE A;  3HU1 A;  3PXG A;  4M6D A;  1XGT C;  2H1R A;  3RU5 A;  5EP4 A;  2W1L A;  1GFR A;  3BBZ A;  1VQ1 A;  3IEC A;  4HV1 A;  4LYT A;  3HUK A;  4AKG A;  1G0J A;  2DWL A;  246L A;  3DMZ A;  2UXB M;  4H92 A;  4HSF A;  2RBN A;  1NNJ A;  2LVO C;  3FTF A;  4HTK A;  4IJ4 A;  1RI8 B;  2QAR C;  4AKH A;  4QHT A;  4KL7 A;  3C8S A;  3RUN A;  2BAA A;  3P68 A;  4I7K A;  1L09 A;  3SN6 R;  1GFU A;  4DD9 A;  4W51 A;  2H9K A;  4HLQ A;  1C6G A;  3ZVQ B;  1LSG A;  5DYG A;  2CJL A;  1LYG A;  4N8Z A;  1IWY A;  4B3S M;  5DN5 A;  1CX6 A;  2HWJ A;  4DT3 A;  1QS9 A;  2OU8 A;  2W1M A;  4IAT A;  1DYC A;  1VED A;  3UON A;  4AW4 A;  1Q39 A;  170L A;  2ZBK B;  3C80 A;  4DWX A;  1EIJ A;  4LGY A;  2R0I A;  1UUZ C;  1E8L A;  1KXW A;  2BQA A;  3T36 A;  4I7P A;  1L25 A;  1HSW A;  1GB5 A;  1D3M A;  1QUT A;  4XBO A;  4LZJ A;  3M0E A;  1CU5 A;  1GFT A;  1CU2 A;  1ZUR A;  1OUB A;  2B6Y A;  3ODU A;  2CV1 A;  3GLI B;  167L A;  1G7H C;  2CHG A;  1Z55 A;  1QTC A;  1NHB A;  1UBZ A;  1JTT L;  5KXW A;  3IJU A;  1BHZ A;  3FTD A;  4DD1 A;  1LYF A;  5C6I A;  4B7G A;  1QTE A;  1NV8 A;  2I7P A;  3HU3 A;  1TH2 A;  1BB3 A;  2RBO A;  4JN6 A;  3E21 A;  1DGG A;  4DDC A;  1L39 A;  3A94 A;  2ZAO A;  2ZTD A;  2ZTC A;  1L49 A;  1OAI A;  2A7F A;  4HL4 A;  5B06 A;  2BWB A;  1L00 A;  4DV4 M;  1LSN A;  2F2N A;  209L A;  1YKY X;  3D3D A;  1GB8 A;  2FE8 A;  1XGP C;  4G4R A;  1AT5 A;  1D2N A;  2EUC A;  4LF7 M;  1VEJ A;  5ITX E;  1OUJ A;  2DKV A;  2KNV A;  3TXJ A;  1LV7 A;  1IP4 A;  2CFO A;  1QT4 A;  2YBL A;  3HX3 A;  4XJH A;  3GLG E;  4KHP M;  5K7O A;  207L A;  253L A;  2OQ4 A;  4NHS A;  4NGJ A;  3ULR A;  3SHG B;  4DR1 M;  1HML A;  2I6Z A;  2O5R A;  1J1O Y;  3W3E A;  2HED A;  1P37 A;  5LYZ A;  4PJZ A;  1LW9 A;  3NBI A;  2MR9 A;  1LZD A;  3CB7 A;  5F81 A;  2H9J A;  4ETB A;  4FCT A;  240L A;  1BWI A;  3ZC7 B;  1XXH A;  1L55 A;  227L A;  2DQH Y;  1OYU A;  239L A;  1YAP A;  3GRR A;  3PNY A;  5KXX A;  3GUI A;  2LXE A;  2OE7 X;  159L A;  1F10 A;  2R46 A;  2Y8P A;  1BVK C;  4Z46 A;  4TUW A;  4KOD A;  1LZG A;  2EQL A;  2EKK A;  1LSD A;  1BB7 A;  1OVJ A;  156L A;  2ZM6 M;  3FI7 A;  3G3V A;  1JR3 D;  1DQJ C;  1QDT A;  5EXP A;  2R6F A;  1L50 A;  1IBK M;  4IBD A;  4K0K M;  3QY4 A;  5IZ7 D;  2VB1 A;  1DGH B;  1VDQ A;  1XEI A;  3A93 A;  1L71 A;  1K3X A;  1P3Q Q;  3HH6 A;  4E3U A;  5EXX A;  3EMS A;  4ARJ A;  2MEC A;  2F5Q A;  201L A;  1LZ1 A;  1L96 A;  1GEV A;  2CEA A;  5BPV A;  5KPZ A;  4H91 A;  216L A;  4G6Z A;  5H37 D;  3RT5 X;  3HT9 A;  1HSX A;  1RJC B;  3K2L A;  3ZQJ A;  1GFJ A;  1SG9 A;  1J1X Y;  1N75 A;  2MRO B;  2DQA A;  4JI1 M;  3GP1 A;  1GLN A;  5ITQ A;  3A96 A;  1LLH A;  4O34 A;  1F4I A;  1NHE A;  4NSO B;  1UIH A;  3NYA A;  4DR5 M;  5DNY A;  3F8V A;  1LWG A;  4DD7 A;  4QEQ A;  3R9X B;  4RKU F;  1LWK A;  3SYK A;  4H8Z A;  4MGI E;  3GPX A;  2Z12 A;  2DQC Y;  2XJW A;  3HBD A;  4R0F A;  139L A;  249L A;  1HFX A;  1QAM A;  3LYM A;  1LYE A;  1DI4 A;  4GHA A;  1XJU A;  149L A;  2CHV A;  1TH3 A;  2YR0 A;  1XEK A;  4J0L A;  3F6Z A;  1QZM A;  4H9B A;  2V6Z M;  1HHL A;  3HJ8 A;  2RAY X;  4NWE A;  1QUD A;  2W1Y A;  3E9S A;  3C7Z A;  3A34 A;  2R65 A;  2WSF F;  1A2Y C;  4W94 A;  4DBG B;  2ZNW Y;  4LF6 M;  1JSF A;  3HY5 A;  3VKH A;  1QSW A;  2Y0T A;  1YIK A;  4M9X A;  3TXH A;  1B2K A;  1OV5 A;  2CUU A;  1B5U A;  4WM3 A;  175L A;  2RBS A;  3LCV B;  1LSZ A;  1WJ7 A;  198L A;  4B7H A;  1YL0 X;  2O25 A;  1GB3 A;  2F4V M;  1YSY A;  3GO8 A;  4BAD A;  1ZV1 A;  218L A;  2EPE A;  221L A;  2Z2F A;  2RB0 X;  2QSF X;  5FTN A;  2NQ8 C;  1C7Y A;  1VDL A;  3AGH A;  171L A;  2B6W A;  2ANV A;  4I7N A;  2DZL A;  3VLF B;  4WM6 A;  3D8B A;  1E9S A;  3KP1 E;  4FJR A;  1QUH A;  3SP3 A;  4H9A A;  3WUN A;  3MK6 A;  4YY3 M;  4LT1 A;  3KS4 A;  5L8R F;  1EPY A;  8CAT A;  2F32 A;  1REY A;  1WQN A;  4GCC A;  4IBK A;  1GXX A;  1L18 A;  1GE1 A;  1T8F A;  3B7Z A;  1HEP A;  2LHM A;  3C83 A;  4YM8 A;  2AUB A;  5FEK A;  4IBF A;  1ZAE A;  2FYD A;  4ITQ A;  3KXE C;  2FFJ A;  2YBN A;  1IEE A;  3A8Z A;  1CKH A;  3GUL A;  3J2P B;  5LA5 A;  2JNH A; 
#chains in the Genus database with same CATH homology
 1L06 A;  2DQF C;  4ETA A;  3WL2 A;  1L70 A;  3RNX A;  4KT3 A;  3HDE A;  3DN3 A;  4ML7 A;  1QTB A;  5FST A;  102L A;  1GBW A;  3P66 A;  4PHI A;  1L95 A;  1XGU C;  4PK0 A;  4XEN A;  1C43 A;  1IOR A;  1B0D A;  3W6B A;  4WMG A;  243L A;  241L A;  1ZMY L;  1XGQ C;  4N0J A;  1CU6 A;  3WMK A;  1C6C A;  1JIY A;  1IWW A;  1OP9 B;  3HTF A;  4EPF A;  4YX7 C;  1XEP A;  7LZM A;  1LSF A;  5I53 A;  1SWZ A;  4OW1 A;  4EPI A;  1OUC A;  3A67 Y;  1FLW A;  1DI3 A;  2O4W A;  4W56 A;  1L75 A;  4N1E I;  2B6T A;  1B9O A;  2Q9E A;  5I54 A;  4DDA A;  1KY1 A;  5KXM A;  1L72 A;  2FBD A;  2ZNX Y;  3HH5 A;  4KPM A;  1D6P A;  1WTH A;  1LZ5 A;  1L86 A;  1REX A;  1QUG A;  3HFM Y;  1XGR C;  3OE8 A;  5F14 A;  1KY0 A;  4M4O A;  242L A;  1JJ1 A;  1L43 A;  259L A;  257L A;  3PDS A;  1L33 A;  2A7D A;  4H9C A;  5LAF A;  1LJE A;  134L A;  1OVK A;  4HTN A;  2D6B A;  150L A;  1L81 A;  4CJ2 A;  6LZM A;  2DQJ Y;  3OE9 A;  1L90 A;  4G4C A;  3CSQ A;  1GXV 2;  261L A;  1CV5 A;  4G4B A;  2MED A;  5LXW A;  4I7T A;  1LZA A;  1LJ3 A;  3N9E A;  4NGW A;  5IHG A;  1OUF A;  1HEW A;  2BQL A;  4RW2 A;  2BLX A;  1ZWN A;  2HU3 A;  1G0K A;  5FHW A;  151L A;  4HV2 A;  1L68 A;  1HER A;  1CUP A;  1BB4 A;  5E9R A;  1L15 A;  5DL9 A;  3WH1 A;  4W54 A;  4NSI A;  1F6R A;  1L59 A;  1L20 A;  1G0M A;  1C6I A;  1GAZ A;  4GLV A;  192L A;  2D91 A;  3L64 A;  5D5F A;  3V2Y A;  3A6B Y;  1VAT A;  165L A;  4YF2 A;  1LPI A;  2EIZ C;  5B07 A;  1L47 A;  1D3N A;  3TXG A;  2MEH A;  4XYY A;  1WTM A;  1C6T A;  1L48 A;  130L A;  1C61 A;  4OO9 A;  1LMA A;  1L67 A;  2B74 A;  1L27 A;  5I4Y A;  1IY3 A;  1G0Q A;  4CHX A;  2BQH A;  1INU A;  1P3N A;  1HFY A;  4HJY A;  1JIS A;  111L A;  247L A;  191L A;  252L A;  3IJV A;  197L A;  1GF7 A;  3T6U A;  3W6E A;  4WLX A;  4LT2 A;  1QTD A;  2Z2E A;  1MLC E;  1JPO A;  1HFZ A;  3N9A A;  3TXI A;  1L80 A;  4DQ5 A;  1GEZ A;  5IDD A;  4NIJ A;  1TAY A;  1GFA A;  5LYM A;  3QE8 A;  4XJF A;  4PRU A;  3P64 A;  110L A;  4AQN A;  3RW8 A;  5LAG A;  1L51 A;  2DBT A;  1L44 A;  1T8G A;  3GXR A;  5KXS A;  145L A;  1CV4 A;  5I5Q A;  2N5Z A;  3OK0 A;  4PJ2 C;  1IWU A;  196L A;  1L99 A;  1L04 A;  2HU1 A;  2HUL A;  183L A;  1HEQ A;  4LDL A;  1D0K A;  4HPI A;  5C6L A;  1NMM A;  3FE0 A;  1P7S A;  3HU9 A;  3WYH A;  2I26 L;  1BWJ A;  1CKF A;  2BLY A;  4NEB A;  3WVX A;  5LIN A;  4DD2 A;  1IR8 A;  195L A;  148L E;  4Z98 A;  137L A;  3VW7 A;  232L A;  1CNS A;  1KW7 A;  1IWV A;  1L41 A;  1L24 A;  4LYB A;  1L54 A;  1B7O A;  2H5Z A;  4I8S A;  3TMX A;  1MEL L;  1GF4 A;  2IFF Y;  1AM7 A;  1GWD A;  4HJV A;  224L A;  2LYM A;  3AJN A;  1LZS A;  1JUG A;  5JEN B;  3MGW A;  1L08 A;  4N1C C;  4H9I A;  5M1Y A;  1GB9 A;  2CGI A;  4NSG A;  5DLA A;  1NF5 A;  3EXD A;  4NHT A;  1LZE A;  1WQR A;  1LSY A;  1UIG A;  2A4T A;  1C6A A;  1B5W A;  5LVI A;  1D3J A;  1HC0 A;  2BQB A;  1FDL Y;  144L A;  1V7T A;  3M3U A;  4WM4 A;  3EML A;  1GFE A;  1C08 C;  1G7J C;  1HMK A;  1LOZ A;  3A92 A;  168L A;  2OEA X;  4RW1 A;  1K28 A;  1OVH A;  4H94 A;  231L A;  5A3Z A;  1DZB X;  1GBX A;  5HQ1 A;  1NBY C;  3B0O A;  1DKJ A;  235L A;  3HH4 A;  3C81 A;  1LHL A;  3IWR A;  1AZF A;  4BAF A;  164L A;  2BQK A;  1DYB A;  1DXJ A;  1C6Q A;  1L34 A;  3EBA B;  3OJP A;  131L A;  4LT3 A;  3WU7 A;  1LZ4 A;  4I0C A;  234L A;  3SB8 A;  3AGG G;  230L A;  6LYT A;  1AKI A;  1GHL A;  3HU8 A;  4GCF A;  4LDO A;  4GN4 A;  4W57 A;  1L74 A;  1L37 A;  1PQD A;  2BPU A;  3JR6 A;  3B0I A;  1WVU A;  1G0P A;  1DYA A;  1C69 A;  4I7O A;  1LAA A;  1D2W A;  4YXC A;  1LMP A;  1L30 A;  4NGK A;  2B7X A;  2LCB A;  2LC9 A;  1QT8 A;  1PQM A;  1JSE A;  1L11 A;  262L A;  1L88 A;  258L A;  5FEL A;  1LSM A;  2C8P A;  4DD0 A;  1AT6 A;  1LI6 A;  3A91 A;  1XEJ A;  4WLT A;  3BKV A;  4CFP A;  1PQO A;  4YOP A;  1B6I A;  1DYE A;  1L26 A;  4QY9 A;  1C65 A;  1GF8 A;  1LHH A;  1JKA A;  1L56 A;  4WG1 A;  4S0W A;  2ZYC A;  3SBB C;  174L A;  4B4J A;  3HWL A;  193L A;  9LYZ A;  161L A;  4GCD A;  2Z6B A;  3GUP A;  5F16 A;  4TUN A;  3B0K A;  1L01 A;  4WM5 A;  2GV0 A;  2HUM A;  4GN3 A;  4TWS A;  1B5X A;  1LZ6 A;  4W59 A;  1RE2 A;  1C45 A;  1JTN A;  1HF4 A;  4W96 A;  1GD6 A;  1DYD A;  1QT3 A;  1C64 A;  1KNI A;  1WQP A;  1LZT A;  1KS3 A;  1BGI A;  220L A;  5KXP A;  1F6S A;  3DN0 A;  1XJT A;  4NHI A;  2HUK A;  186L A;  1C6E A;  5KXT A;  1C6N A;  4OWA A;  1GBS A;  1UIA A;  1GE0 A;  4HPE A;  1L32 A;  3AW7 A;  1C68 A;  1GFG A;  1I56 A;  3G3B B;  214L A;  5HMJ A;  1P2R A;  126L A;  1OWZ A;  1UIF A;  5KKJ A;  4YEO A;  147L A;  2ZIJ A;  2G4N A;  3F9L A;  248L A;  1L73 A;  2YBI A;  3W6D A;  4NGY A;  4EOF A;  4K5Y A;  3J6K A;  3P4Z A;  1LMC A;  1LSC A;  3WPL A;  1C6F A;  4LFX A;  1D9W A;  104L A;  3AYQ A;  1L40 A;  1L10 A;  1HEM A;  1JWR A;  1QIO A;  123L A;  1REZ A;  1UAC Y;  1C6D A;  4LYM A;  3WW6 A;  4DC4 A;  4A7D A;  4FDY A;  4I7S A;  5I4X A;  181L A;  1IP2 A;  1EQ4 A;  3WUL A;  3HTG A;  219L A;  3LYT A;  237L A;  1IOC A;  228L A;  1SQ2 L;  1GFH A;  1KIP C;  1I20 A;  1L62 A;  1XFP L;  4DAJ A;  4ET9 A;  2B70 A;  1L16 A;  1L93 A;  3HUQ A;  1QT5 A;  1N4F A;  182L A;  4I7Q A;  1LZ9 A;  4ARP A;  3PBL A;  1IP7 A;  1LHK A;  1JKD A;  4B1A A;  1JTP L;  1KIR C;  5KXK A;  184L A;  1LYZ A;  109L A;  1GDX A;  1UID A;  5J7C A;  4HP0 A;  120L A;  2ZQ3 A;  166L A;  5B1F A;  1OUA A;  4OOT A;  2LZ2 A;  4WO9 A;  213L A;  3NY8 A;  3QAK A;  2OE4 X;  2QB0 B;  140L A;  1RCM A;  1DI5 A;  3C82 A;  1PZY A;  4LZT A;  4GCB A;  3G3A B;  141L A;  3SB7 A;  4DD3 A;  223L A;  5KJ9 A;  1LI2 A;  1GF3 A;  4EXM A;  2YBH A;  3TXB A;  4CGE A;  1IP1 A;  1LMQ A;  4XAD A;  1NWG A;  3AW6 A;  4I7L A;  1B5Y A;  1QT6 A;  129L A;  2RSC A;  3HTD A;  3TXE A;  2IGC A;  3DKE X;  2FYC A;  1WVV A;  3J4G A;  1H6M A;  3QNG A;  225L A;  1OV7 A;  4TSC A;  158L A;  3CDT A;  143L A;  4EKP A;  4LFP A;  4ZEE A;  4WL7 A;  2BQN A;  3ATN A;  5T3F A;  4H9H A;  1IVM A;  1OWY A;  1L12 A;  4LYZ A;  4WLY A;  2WAR A;  3A95 A;  1LGW A;  2XTH A;  3L2X A;  1CU0 A;  4NWH A;  4LYO A;  1OUI A;  1L52 A;  1C63 A;  1L69 A;  1SSW A;  1LJF A;  3DN4 A;  1HEL A;  1TEW A;  4NGO A;  1G7L C;  1F0W A;  3VWO A;  4XJD A;  1SSY A;  3G3X A;  2RBQ A;  5LIO A;  4EKR A;  1QUS A;  2BQM A;  250L A;  2HEF A;  4YEN A;  5AMY A;  5KXZ A;  4ARQ A;  5IEL A;  4EMN A;  169L A;  1QSQ A;  1B7R A;  1UC0 A;  4EKQ A;  1L64 A;  4IAS A;  4HTQ A;  1LZR A;  2DQG Y;  1VFB C;  5LVG A;  1LMN A;  4DKL A;  1JQU A;  1VDS A;  172L A;  1LJJ A;  4NFV A;  3HDF A;  1GB6 A;  1OUH A;  1T97 A;  2D4J A;  3FI5 A;  4NSJ A;  1L91 A;  1P64 A;  2HUB A;  4LYC A;  1IR7 A;  1P2C C;  1LZC A;  229L A;  2HEE A;  3BKH A;  3DN2 A;  4NG1 A;  1C67 A;  5KY1 A;  2Z39 A;  3ZEK A;  226L A;  1LJN A;  1P36 A;  1C6J A;  1C6K A;  127L A;  1L19 A;  2YDG A;  1L66 A;  1FLQ A;  132L A;  2YVB A;  1JKB A;  4NGL A;  3A3R X;  4W53 A;  1L82 A;  4WL6 A;  2F4G A;  6LYZ A;  1VDT A;  4GLA A;  189L A;  1NKH A;  1L77 A;  1CJ9 A;  3RZE A;  1WQQ A;  1JJ0 A;  2B73 A;  3DN8 A;  162L A;  4J1A A;  1UIB A;  2F4A A;  1C66 A;  4NY5 A;  1QTH A;  2ZQ4 A;  119L A;  3WXT A;  1QSA A;  1L58 A;  3WXU A;  190L A;  4J1B A;  1D9U A;  2G4P A;  5APE A;  1IP5 A;  260L A;  1JIT A;  1LHM A;  3NY9 A;  160L A;  4B4E A;  4I7J A;  1L21 A;  3M18 B;  1T8A A;  5FCP A;  1L13 A;  5ILC A;  1J1P Y;  4C5F A;  1LPY A;  2NTG A;  5FDJ A;  7LYZ A;  1L29 A;  1IC4 Y;  4RLM A;  2ZYP A;  2BQC A;  1LKR A;  1L57 A;  1V7S A;  5LZM A;  1DYG A;  4G49 A;  2BQG A;  5APC A;  1QQY A;  3CQL A;  1GBZ A;  187L A;  1NQI A;  1LZN A;  255L A;  2OTZ X;  4II8 A;  1G1W A;  3HH3 A;  5I14 A;  2BQO A;  3KAM A;  5ILF A;  1B7Q A;  4GRV A;  114L A;  5L9J A;  5II3 A;  1O23 A;  2IHL A;  1CV1 A;  1P5C A;  2RBR A;  3SB5 A;  4QDN A;  4ET8 A;  2LZT A;  1IC5 Y;  1L35 A;  1WQO A;  1LYS A;  3LN2 A;  1LMO A;  1RFP A;  1SLY A;  3V2W A;  5A3E A;  1YL1 X;  1C62 A;  244L A;  4MR1 A;  1GE3 A;  157L A;  1T3P A;  4LZM A;  3LZT A;  4RLN A;  2B72 A;  4ARM B;  1JTO L;  5KXO A;  2DQI Y;  1LCN A;  1LSA A;  1G1V A;  3DMX A;  3AZ7 A;  1LGU A;  3OE0 A;  211L A;  2OU0 X;  4PGJ B;  1L65 A;  4B49 A;  2ZIL A;  1CJ8 A;  4XJB A;  1JKC A;  2D4K A;  1XSF A;  1L42 A;  142L A;  1ZVY B;  1QDR A;  1CX7 A;  4W58 A;  4TX7 A;  1BQL Y;  4OWH A;  5KXN A;  1ALC A;  1WTN A;  1BVX A;  1L61 A;  4ETD A;  1TCY A;  3DN6 A;  1P56 A;  3B6L A;  112L A;  4LDE A;  1JJ3 A;  1QT7 A;  4B0D A;  4BAP A;  4E97 A;  1CVK A;  1G0L A;  1UIE A;  1LZB A;  3AZ5 A;  1L05 A;  4H9F A;  1TDY A;  4NGZ A;  206L A;  2EKS C;  1P46 A;  1L22 A;  215L A;  3TXF A;  1GF6 A;  2D4I A;  4ARQ B;  4DDB A;  4DYG A;  4L41 A;  1LYD A;  1NDM C;  1LGX A;  3CT0 A;  4ZIX A;  1L17 A;  205L A;  4BS7 A;  2DQD Y;  4YEM A;  1SX7 A;  2OE9 X;  3W6F A;  1C10 A;  1WQM A;  1JTM A;  2MEI A;  1B7S A;  1YKX X;  4GCE A;  1YRO A;  1SX2 A;  4OOO A;  5KXR A;  1IY4 A;  3LZ2 A;  2L78 A;  3WPK A;  4C3W A;  1GF9 A;  1IWZ A;  3B72 A;  2BQE A;  163L A;  4N5R A;  1YAN A;  5LVK A;  2F47 A;  4Z41 A;  1W08 A;  2O79 A;  177L A;  1YAM A;  113L A;  1UA6 Y;  233L A;  2RBP A;  1OQM A;  1L98 A;  1QTZ A;  180L A;  1CUQ A;  1GB2 A;  3TMV A;  2B6X A;  4ETC A;  5DM9 A;  1L23 A;  1CJ6 A;  1YQV Y;  4QGZ A;  3ZVQ A;  1FBI X;  1IX0 A;  5KXL A;  256L A;  1LJK A;  194L A;  125L A;  1YIL A;  2O7A A;  3CDO A;  199L A;  1LSP A;  2RAZ X;  1L03 A;  1ZVH L;  2BQJ A;  1CV0 A;  1P2L A;  2B75 A;  1OUE A;  1GE4 A;  4D9Z A;  3CDQ A;  1GB0 A;  4LGK A;  3TXD A;  2X0A A;  1B7L A;  1GPQ C;  3FA0 A;  4XJI A;  2G4Q A;  1QSB A;  3EO5 A;  4WG7 A;  1UIC A;  1L38 A;  3RZ4 A;  1L97 A;  118L A;  3TXK A;  1L46 A;  1BB6 A;  3GUM A;  4NHQ A;  5KXY A;  1PQJ A;  4H1P A;  1LZY A;  5DN4 A;  4G9S A;  3C8R A;  1GAY A;  4OWE A;  3DNA A;  1W6Z A;  1T6H A;  1GFV A;  1L45 A;  1DYF A;  5L3H A;  217L A;  5B59 A;  1LZ8 A;  1LMT A;  5LVH A;  1LJH A;  4ARM A;  1UCO A;  1L0K A;  4RDS A;  5KKI A;  2NTH A;  3TMW A;  1IOT A;  5HNL A;  3LYO A;  222L A;  2MEE A;  4G4H A;  1VDP A;  5D5C A;  1CKC A;  2Z19 A;  1HEO A;  4LT0 A;  1LSE A;  1FLY A;  2HEB A;  1L84 A;  155L A;  2LYO A;  2Q0M X;  1L60 A;  3W6C A;  4W55 A;  3HBH A;  1IOS A;  1P6Y A;  4WO6 A;  2MEB A;  1QUO A;  3SB6 A;  1HEN A;  4EJ4 A;  1IP6 A;  1L14 A;  4X3B A;  1DKK A;  1C6L A;  1KW5 A;  3GUJ A;  154L A;  1L89 A;  4UWN A;  2OTY X;  1QS5 A;  4AXT A;  1IOQ A;  1B7N A;  1QTK A;  1I1Z A;  1GBO A;  1LJ4 A;  1ZV5 L;  1CV6 A;  1LJG A;  2BQD A;  5F9U A;  1IC7 Y;  1TLA A;  2HEA A;  3TMU A;  3LHM A;  1NDG C;  1CKG A;  1L85 A;  2ZWB A;  2RB2 X;  3WVY A;  3GUK A;  1DPX A;  1L83 A;  2XQO A;  1T6V L;  4XJG A;  1CU3 A;  4I7R A;  1D6Q A;  200L A;  2RH1 A;  4N9R A;  208L A;  4ETE A;  3D9A C;  4TSB A;  173L A;  5HMV A;  1GB7 A;  135L A;  1C6B A;  1LYH A;  1LSB A;  1LYY A;  3CSR A;  5LVJ A;  3OE6 A;  2Z18 A;  2YSS C;  245L A;  3CT5 A;  2B6Z A;  1FLU A;  3DMV A;  2YBJ A;  3WPJ A;  5C6J A;  1IR9 A;  1YAO A;  2HEC A;  1L02 A;  1D3F A;  3GUO A;  3HUA A;  1LYO A;  1KIQ C;  5HLL A;  1B7P A;  4H9E A;  4UWU A;  1G7M C;  1OUD A;  4GN5 C;  133L A;  3HT7 A;  1JEF A;  1NBZ C;  4ZFP A;  4Z3M A;  4NGV A;  4WLD A;  1FKV A;  4ANR A;  2ZIK A;  188L A;  103L A;  3HBE X;  2XBS A;  1CKD A;  1B5V A;  1PQK A;  1IIZ A;  3CT1 A;  2FBB A;  3C7W A;  178L A;  3GUN A;  2XBR A;  3AGI A;  2NWD X;  3CSZ A;  1L53 A;  1B7M A;  1KXX A;  3SBA A;  1GE2 A;  2CDS A;  2Z38 A;  5HNC A;  2B5Z A;  1G07 A;  254L A;  1CTW A;  1LYI A;  4DJH A;  2YBM A;  3WUM A;  3A3Q A;  4NGI A;  8LYZ A;  1L07 A;  251L A;  3LZM A;  3HTB A;  4DQJ A;  146L A;  1IWX A;  4IAP A;  2BQI A;  4H93 A;  1C46 A;  3WU8 A;  1IP3 A;  1C6H A;  4OWB A;  4P2E A;  3E3D A;  1REM A;  1D2Y A;  1L92 A;  1HNL A;  5L3I A;  1TBY A;  1GBY A;  4J7V A;  2Q9D A;  4HJZ A;  3FAD A;  236L A;  1A4V A;  4H90 A;  2PC2 A;  4ZPU A;  238L A;  5EBH A;  1C60 A;  1D0L A;  3P65 A;  3WW5 A;  1KXY A;  1LJI A;  5APF A;  2DQE Y;  1L36 A;  1L79 A;  1JHL A;  4EKS A;  1OUG A;  3G3W A;  176L A;  4UWV A;  1PS5 A;  3DN1 A;  2LYZ A;  185L A;  4CFO A;  5E4P A;  2W1X A;  3A90 A;  3D4S A;  3AZ4 A;  1LYJ A;  128L A;  1CV3 A;  3ATO A;  3SB9 A;  4XN6 A;  3A6C Y;  4GBR B;  2Z37 A;  3K3T A;  2MEA A;  5B1G A;  4PRQ A;  2MEF A;  1G06 A;  1EL1 A;  1L63 A;  1ZYT A;  2BQF A;  4PPO A;  4R6C A;  3WUA A;  1FKQ A;  1YKZ X;  4NG8 A;  1GF0 A;  4I7M A;  3W6A A;  4WOA A;  1PQI A;  5I4W A;  4NHP A;  152L A;  3LYZ A;  2RB1 X;  1QTV A;  1C6M A;  107L A;  4H8X A;  1G0G A;  2HTX A;  4H8Y A;  1GFK A;  5LYT A;  1GDW A;  1L31 A;  1L94 A;  2I25 L;  3GXK A;  4MST A;  4WM2 A;  1LI3 A;  1BWH A;  3N9C A;  4AGA A;  3CDV A;  2LZM A;  3K2R A;  1IO5 A;  5APD A;  2ANX A;  212L A;  4MCK A;  1LHJ A;  3C7Y A;  3CDR A;  4W52 A;  1GF5 A;  122L A;  1YAQ A;  1H87 A;  3WU9 A;  4ARL A;  4DQ7 A;  1EQ5 A;  4YXA C;  1D0M A;  1SWY A;  4WM1 A;  138L A;  1B5Z A;  1L87 A;  1CJ7 A;  1LKS A;  1C6P A;  2F2Q A;  1L0J A;  4NSH A;  108L A;  3AZ6 A;  2CWI A;  3HT8 A;  210L A;  1BB5 A;  1DPW A;  4B4I A;  2OU9 A;  5F9X A;  5B05 A;  4TTD A;  3HT6 A;  4KXI A;  3C8Q A;  1L76 A;  1C7P A;  2F30 A;  153L A;  4U3X B;  5LA8 A;  1G7I C;  1LHI A;  3AB6 A;  115L A;  1I6S A;  1FN5 A;  1IWT A;  4OWC A;  2MEG A;  1VAU A;  2C8O A;  1LTM A;  1L28 A;  1EQE A;  4M6D A;  1XGT C;  3RU5 A;  2W1L A;  1GFR A;  4HV1 A;  4LYT A;  3HUK A;  1G0J A;  246L A;  3DMZ A;  4H92 A;  4HSF A;  2RBN A;  4HTK A;  4IJ4 A;  1RI8 B;  2QAR C;  4KL7 A;  3C8S A;  3RUN A;  2BAA A;  3P68 A;  4I7K A;  1L09 A;  3SN6 R;  1GFU A;  4DD9 A;  4W51 A;  2H9K A;  1C6G A;  3ZVQ B;  1LSG A;  2CJL A;  1LYG A;  4N8Z A;  1IWY A;  5DN5 A;  1CX6 A;  4DT3 A;  1QS9 A;  2OU8 A;  2W1M A;  4IAT A;  1DYC A;  1VED A;  3UON A;  170L A;  3C80 A;  4DWX A;  1UUZ C;  1E8L A;  1KXW A;  2BQA A;  3T36 A;  4I7P A;  1L25 A;  1HSW A;  1GB5 A;  1D3M A;  1QUT A;  1CU5 A;  1GFT A;  1CU2 A;  1ZUR A;  1OUB A;  2B6Y A;  3ODU A;  167L A;  1G7H C;  1Z55 A;  1QTC A;  1NHB A;  1UBZ A;  1JTT L;  5KXW A;  3IJU A;  1BHZ A;  4DD1 A;  1LYF A;  5C6I A;  1QTE A;  1BB3 A;  2RBO A;  4DDC A;  1L39 A;  3A94 A;  1L49 A;  2A7F A;  5B06 A;  1L00 A;  1LSN A;  2F2N A;  209L A;  1YKY X;  3D3D A;  1GB8 A;  1XGP C;  1AT5 A;  1OUJ A;  2DKV A;  3TXJ A;  1IP4 A;  1QT4 A;  2YBL A;  4XJH A;  5K7O A;  207L A;  253L A;  4NHS A;  4NGJ A;  3ULR A;  2I6Z A;  1HML A;  1J1O Y;  3W3E A;  2HED A;  1P37 A;  5LYZ A;  4PJZ A;  1LW9 A;  1LZD A;  3CB7 A;  5F81 A;  2H9J A;  4ETB A;  240L A;  1BWI A;  1L55 A;  227L A;  2DQH Y;  1OYU A;  239L A;  1YAP A;  5KXX A;  3GUI A;  2OE7 X;  159L A;  1F10 A;  2Y8P A;  1BVK C;  4Z46 A;  1LZG A;  2EQL A;  1LSD A;  1BB7 A;  1OVJ A;  156L A;  3FI7 A;  3G3V A;  1DQJ C;  1QDT A;  1L50 A;  3QY4 A;  2VB1 A;  1XEI A;  1VDQ A;  3A93 A;  1L71 A;  3HH6 A;  4E3U A;  3EMS A;  4ARJ A;  2MEC A;  201L A;  1LZ1 A;  1L96 A;  1GEV A;  4H91 A;  216L A;  3RT5 X;  3HT9 A;  1HSX A;  1RJC B;  1GFJ A;  1J1X Y;  2DQA A;  3A96 A;  1LLH A;  4O34 A;  1NHE A;  1UIH A;  3NYA A;  3F8V A;  1LWG A;  4DD7 A;  4QEQ A;  1LWK A;  4H8Z A;  2Z12 A;  2DQC Y;  2XJW A;  3HBD A;  4R0F A;  139L A;  249L A;  1HFX A;  3LYM A;  1LYE A;  1DI4 A;  1XJU A;  149L A;  1XEK A;  4J0L A;  3F6Z A;  4H9B A;  2RAY X;  1HHL A;  4NWE A;  1QUD A;  2W1Y A;  3C7Z A;  3A34 A;  1A2Y C;  4W94 A;  2ZNW Y;  1JSF A;  1QSW A;  1YIK A;  3TXH A;  1B2K A;  1OV5 A;  2CUU A;  1B5U A;  4WM3 A;  175L A;  2RBS A;  1LSZ A;  198L A;  1YL0 X;  1GB3 A;  4BAD A;  218L A;  2EPE A;  221L A;  2Z2F A;  2RB0 X;  3AGH A;  171L A;  2B6W A;  2ANV A;  4I7N A;  4WM6 A;  4FJR A;  3SP3 A;  1QUH A;  4H9A A;  3WUN A;  4LT1 A;  1EPY A;  2F32 A;  1REY A;  1WQN A;  4GCC A;  1GXX A;  1L18 A;  2LHM A;  1GE1 A;  1T8F A;  4YM8 A;  1HEP A;  3C83 A;  2AUB A;  5FEK A;  2FYD A;  2YBN A;  1IEE A;  3A8Z A;  1CKH A;  3GUL A;  5LA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...