1D0LA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
322
structure length
314
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 112
structure length 314
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0lA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0lA02
4XJHA 3ATOA 5APEA 2CWIA 2MEHA 1FN5A 2Z2EA 1RCMA 1IEEA 3BKHA 5C6IA 3W6EA 7LYZA 4NHPA 1DZBX 5JENB 1LMPA 3N9CA 5KXKA 4E3UA 2I25L 1GB6A 1IR7A 2Z18A 4B49A 4ETAA 3SP3A 5LYMA 1JITA 4J1BA 5KKJA 1B7LA 1PS5A 4PJ2C 4HP0A 1WVVA 4WLDA 1B0DA 1LHHA 4OWBA 2CJLA 1CKFA 4LT0A 3W3EA 2MEDA 1LJGA 1HSWA 4H9CA 4O34A 2ZIJA 5I4XA 5B1GA 1WQQA 1LSZA 1YAOA 3A91A 5KKIA 1HC0A 2LYMA 4NGYA 1OUGA 5T3FA 4R6CA 4WM6A 1VAUA 4XJIA 3P4ZA 1IOTA 4ANRA 2ZQ4A 1CKDA 2DQCY 4H9IA 4HJZA 1BWHA 1XEJA 1Z55A 1OUEA 4KXIA 4DD9A 1ALCA 1HFYA 3WUNA 1XGUC 2Y8PA 1B7PA 1CJ8A 4NIJA 2IFFY 3E3DA 1JSEA 1GFKA 1JUGA 5ILCA 2LYOA 4LYOA 3G3AB 1QSAA 4NEBA 4ZIXA 4OWAA 4RDSA 5FCPA 1IC5Y 2ZIKA 2BPUA 4L41A 6LYZA 1GF0A 1XGPC 3EBAB 4H90A 5M1YA 4A7DA 1LMAA 1GEZA 1RE2A 1GXV2 2DQEY 1B5VA 5A3EA 5KXSA 3TXEA 2GV0A 4NGKA 3A8ZA 1V7TA 4ET9A 3A6BY 2LHMA 4LT2A 5DL9A 1OUAA 4GLVA 1JJ0A 1NQIA 1YKZX 4H9FA 1GB2A 2B5ZA 4LT1A 2MECA 2DQFC 1SLYA 1NF5A 2HUBA 1C08C 3AZ4A 4NFVA 4WOAA 4CFPA 1JTPL 4M6DA 1JKBA 3ZEKA 3B0OA 4XJGA 5KXZA 1AT6A 1IP1A 3RNXA 1VATA 4PHIA 5J7CA 1D6QA 1HEQA 1XGQC 1P2CC 2D91A 2DQGY 4NGIA 3WVXA 1GB3A 1JKAA 1YKXX 3AZ5A 1YL0X 1HELA 4BAFA 1UIGA 5L3IA 1GFRA 1CKGA 1LZAA 1VFBC 1WQOA 5LVIA 5KXYA 3F6ZA 1ZMYL 2N5ZA 2YBLA 4GN3A 1LSGA 2BQAA 4NWHA 2FBDA 1QUSA 4H9EA 1LYSA 1B5WA 1LJ4A 1YL1X 4GN5C 1NHEA 3TXFA 5ILFA 1FLWA 1REYA 3N9EA 5FEKA 3WU7A 3WW5A 1LZ6A 1UIHA 2DQIY 5DLAA 4WMGA 4YF2A 1UIFA 153LA 1LJJA 4YM8A 1AM7A 1I20A 3J4GA 4LYZA 2BQBA 5I54A 4NGLA 1GFHA 6LYTA 4ZFPA 1IP7A 3TMWA 1LMTA 2ZILA 3W6DA 4WG7A 1HFXA 3AJNA 4WM1A 4HTKA 2YVBA 3B0IA 4NSHA 3A3QA 4PRQA 1EQ5A 3TXIA 9LYZA 1LZDA 4OWCA 1IR8A 2HTXA 1IC4Y 5FELA 2ZQ3A 1GDWA 4LT3A 2CGIA 1F10A 1LZYA 1JKCA 2C8PA 5K7OA 1IWYA 2Z37A 3CT5A 1VDPA 5I4YA 1IWZA 1LMCA 4MR1A 2BQMA 1DI5A 1EL1A 1LSNA 1G7JC 2HECA 4CGEA 4DD0A 1SQ2L 1J1PY 3B0KA 2D4KA 4QDNA 2W1MA 1LJNA 5DM9A 1BGIA 2ZYCA 1VDQA 2F4AA 1IP3A 1D0KA 1B7RA 4BAPA 1LSAA 1HFZA 1UUZC 3IWRA 2MEIA 1NDMC 1NWGA 4H8ZA 2BQFA 3TMXA 1GF5A 2MEGA 1JKDA 2YBIA 3J6KA 5F81A 4BS7A 4GCFA 1YKYX 3WU9A 4J1AA 4ET8A 5HNCA 1GE3A 3P65A 1YQVY 4G4HA 4LYMA 5FDJA 4AXTA 5KXMA 1IOCA 1LZGA 4LFXA 194LA 1UACY 3HFMY 1LJKA 135LA 5KXXA 4B0DA 3GXKA 4FDYA 1GFUA 1FLYA 2EQLA 1QTKA 1E8LA 1MLCE 1UA6Y 1LKRA 5F14A 3ZVQB 1OUIA 4ETEA 4UWVA 4NGJA 3K3TA 3M18B 4D9ZA 4NGVA 4B4EA 4NSGA 3MGWA 1GB0A 3TXJA 3RZ4A 1B7OA 5I4WA 1DPWA 1GBZA 2HU3A 1HNLA 1LJIA 1QSWA 1IY3A 1LZEA 1JTTL 4H9AA 3P66A 4XJDA 3G3BB 4QGZA 3TMVA 1RI8B 1BVXA 1D9UA 4BADA 1LHIA 2F2NA 4QEQA 1LMOA 5I5QA 1A2YC 1GD6A 4M4OA 1TAYA 1OUCA 3W6FA 1TCYA 1CNSA 1T3PA 1LHLA 4PRUA 1CJ6A 3T36A 4LZTA 3D9AC 5LXWA 1BVKC 1LZTA 2G4NA 5DN4A 1WTNA 1CJ7A 1G7LC 2XBSA 1ZVYB 1EQ4A 1GBOA 3TXHA 5HMVA 1HMKA 4HJVA 3ATNA 4N1EI 4H9HA 4DD3A 4TTDA 4H1PA 4HSFA 5APCA 1G7IC 4OWEA 4WM3A 2BQIA 4XENA 5HNLA 5LVKA 4MSTA 1LSPA 1F6RA 3WL2A 1UIBA 3AW7A 4H92A 2Z19A 4TX7A 3WU8A 1NMMA 1LZ4A 1NDGC 1GE1A 4NY5A 2A7DA 2HEEA 2WARA 4YENA 5L3HA 3WPLA 1FKVA 1TBYA 4IATA 4YEMA 4N1CC 4WLYA 3WPJA 193LA 3QNGA 1UCOA 2BLXA 1WQRA 3OJPA 4Z46A 4W94A 1GBXA 1KIPC 4NHQA 2BQCA 1YILA 1IWWA 4J0LA 1DXJA 1A4VA 1VDSA 4Z3MA 1IWXA 5EBHA 1LJ3A 1LMNA 2MEFA 3QY4A 2G4PA 4RLMA 4AGAA 1AKIA 1GF6A 3N9AA 1GEVA 4TWSA 5KXTA 2DQDY 1HF4A 2XTHA 1JWRA 2X0AA 2BQOA 5KXPA 3AGHA 4HJYA 1HEWA 1REXA 1WVUA 2XBRA 3GXRA 3CSRA 3M3UA 2D4IA 1YAPA 1GE0A 4HTNA 4YEOA 1GF8A 1T6VL 1W08A 1W6ZA 134LA 4I0CA 4NGZA 4DT3A 4EMNA 1GB8A 2Q0MX 3ULRA 1B7QA 1LCNA 1REZA 3QE8A 1F6SA 4DDBA 3WXUA 1B5XA 4GCDA 4LYTA 2HEFA 5KXRA 4WM5A 1UBZA 1LHMA 4G9SA 4HPEA 5D5CA 5KJ9A 4DDCA 4DWXA 1G7MC 4OOTA 1YROA 1UIEA 1IY4A 4OW1A 8LYZA 2A7FA 1LZCA 3AZ7A 1I1ZA 4GCEA 4H91A 2LZ2A 4TSCA 4HV2A 1LSMA 4H8XA 1JEFA 4FJRA 4CHXA 1LJHA 1LZRA 1IWUA 5KXOA 4RLNA 5F9UA 4NG1A 1BWJA 1WQMA 4Z98A 1LMQA 2BQJA 3A34A 4LYBA 3WYHA 4NGOA 1NBYC 3WXTA 4NSJA 2AUBA 4YOPA 1OUDA 3LYZA 5L9JA 3LHMA 2BLYA 4WM4A 5APFA 1GDXA 1XEKA 1IWVA 133LA 3WW6A 4RW2A 1LSBA 1YANA 1LHKA 1J1OY 4HPIA 1CJ9A 1WQNA 2H5ZA 1PZYA 3LYOA 2DQHY 1UIAA 1GB5A 1BB3A 1LKSA 2YBJA 3LZ2A 2CDSA 1CKHA 3LN2A 5LA5A 1DKKA 5HQ1A 1GFGA 4WG1A 3OK0A 1FBIX 1GPQC 1B5YA 5KXWA 1GXXA 1HSXA 4C3WA 154LA 1RJCB 1DKJA 5A3ZA 1BB4A 1GB7A 1MELL 1GE2A 1J1XY 1GFJA 4PGJB 1EQEA 1JTOL 2FYDA 4N8ZA 1B7NA 2ZYPA 4R0FA 1GHLA 1BB6A 3ZVQA 4Z41A 1FDLY 2BQKA 2RSCA 5KXNA 1D0MA 4NGWA 5B07A 3AZ6A 1B7SA 1LZ9A 2YDGA 3VWOA 2YSSC 2EIZC 4ETDA 2F30A 3WPKA 4GLAA 1TDYA 1G7HC 1JISA 5LAGA 1GFTA 1QIOA 1YIKA 1ZVHL 2I26L 1BHZA 5E9RA 3TXDA 1UIDA 3CB7A 1HHLA 3P68A 3TMUA 3W6CA 5HLLA 4CJ2A 2MEEA 4DD1A 1GF4A 2DQAA 4LFPA 4ETBA 1HERA 1LJFA 2YBNA 3T6UA 1QTEA 1C45A 5F16A 4IJ4A 5F9XA 3LYTA 5C6JA 1IP2A 1JJ3A 4WM2A 4G4BA 4WO6A 1XEIA 1DQJC 2HEAA 3A6CY 4DDAA 1F0WA 1BQLY 5IDDA 1REMA 4NHTA 3A93A 1OUFA 208LA 2HEBA 4NHIA 5B05A 4N5RA 3A67Y 2Z39A 3WMKA 1LZ8A 1YAQA 207LA 1XGRC 1CKCA 5B1FA 1B9OA 3TXBA 3IJVA 1FLUA 1GFAA 1GFEA 1XSFA 3AYQA 1V7SA 3BKVA 4OWHA 1B7MA 1HEMA 1LJEA 1N4FA 4DD7A 1LZBA 3EO5A 3CSQA 1C43A 1LSEA 1XGTC 4KL7A 5LYTA 1LSCA 1B5UA 5LIOA 1C10A 4HV1A 2BQHA 3AGIA 2ZNXY 1HMLA 1KIQC 2LYZA 4W96A 3CT0A 4G49A 4CFOA 2I6ZA 5IHGA 4ML7A 1C46A 3RU5A 1XFPL 3D3DA 2XJWA 1UICA 3A92A 1LZ5A 3FI7A 3RW8A 1IP5A 4IASA 4EOFA 1IO5A 3AW6A 1KXXA 2HU1A 3AGGG 2F4GA 2YBHA 5LVGA 5II3A 4H94A 4PPOA 132LA 2BQDA 2W1LA 4KT3A 4XJBA 1QUTA 1BB5A 5AMYA 3RT5X 4N0JA 2H9KA 2PC2A 1LZ1A 4B4JA 1BWIA 3B6LA 5E4PA 1OP9B 4WL6A 1OQMA 4C5FA 3A3RX 1JPOA 1IOSA 4B4IA 4DD2A 1OUBA 2G4QA 5LVJA 1IC7Y 4WLXA 1KXWA 1LSYA 2EPEA 1LAAA 1LTMA 1DI3A 3CQLA 5B06A 2BQEA 2DQJY 1B2KA 5D5FA 1GAYA 1RFPA 1GWDA 2BQLA 4MCKA 4P2EA 5APDA 2MEBA 3W6AA 3TXKA 1JIYA 1H87A 1H6MA 5LYZA 1GFVA 3AB6A 4UWUA 1GBYA 1GF9A 3CT1A 1D0LA 4U3XB 5IELA 1YAMA 4WO9A 2H9JA 4II8A 1O23A 3FE0A 2Z38A 1VDTA 3B72A 4LGKA 1FKQA 1KIRC 2IHLA 2VB1A 3IJUA 4G4CA 4NWEA 4OOOA 3TXGA 1IORA 4UWNA 1IR9A 5HMJA 4ZEEA 1GBSA 1DPXA 2BAAA 2EKSC 1QDRA 4NHSA 3WUMA 3HBDA 1LZSA 1OUJA 3CSZA 1GE4A 2DKVA 1NBZC 3A90A 3HBEX 3WVYA 5B59A 3W6BA 1NKHA 4I8SA 2LZTA 4XJFA 4N9RA 1IOQA 3LYMA 2ZWBA 1KXYA 2W1XA 4RW1A 1TEWA 1WTMA 3P64A 5KY1A 4HTQA 1WQPA 2YBMA 1JJ1A 1HEPA 1QQYA 3A95A 2C8OA 4TSBA 5LAFA 5KXLA 4DYGA 1VEDA 5FSTA 4WLTA 4GN4A 3EMSA 1QDTA 2DBTA 3WUAA 1FLQA 4XYYA 1LPIA 1GB9A 1GBWA 3A96A 4NSIA 3WULA 2Z12A 1LSDA 1HEOA 5LINA 1LZNA 3A94A 2MEAA 1JSFA 1AZFA 1LOZA 1LYZA 4DC4A 3WH1A 1IP4A 1AT5A 4ETCA 1IVMA 4H93A 3EXDA 4H8YA 5I53A 1I56A 2D4JA 5DN5A 1HENA 1LYOA 2Z2FA 4GCBA 2FYCA 3KAMA 4NG8A 4WL7A 4J7VA 2BQGA 1B5ZA 2ZNWY 1D6PA 2FBBA 1DI4A 1ZV5L 3LZTA 1IWTA 1JHLA 1GAZA 5LVHA 4GCCA 1LYYA 4TUNA 4X3BA 1GF7A 1IP6A 5LA8A 1UC0A 1LSFA 2BQNA 2D6BA 5C6LA 3HBHA 2HEDA 1IX0A 1LHJA 4XN6A 1GF3A 1INUA 1C7PA 1OUHA 4XADA 1IIZA 4B1AA 4LYCA 4H9BA 4QY9A 5FHWA 2W1YA 1BB7A 2NWDX 4KPMA
chains in the Genus database with same CATH superfamily
5APEA 139LA 2CWIA 4EJ4A 4GMQA 1FN5A 1SWYA 3BKHA 1X37A 1CU2A 3W6EA 113LA 1DZBX 1C6QA 183LA 1LMPA 3N9CA 1IR7A 2NTGA 4ETAA 3U61B 224LA 5A2QS 195LA 4HP0A 1L05A 3U60A 1L09A 1HSWA 4O34A 3LVWA 1L38A 1LI2A 3A91A 5T3FA 257LA 1QT6A 258LA 3IECA 4LJ6A 1DGFA 4DD9A 4D80A 1HFYA 1OV5A 3HH6A 2QHOB 3HU8A 4NIJA 1E9SA 2IFFY 3E3DA 4QNRA 3C80A 1F4IA 246LA 2CRUA 4LYOA 4PCZA 3CDVA 3OTOM 1IC5Y 2DHRA 2MROB 1QT7A 4I81A 5M1YA 1CV4A 1S3SA 3HKPA 1GXV2 2DQEY 192LA 245LA 2FNAA 3HT6A 8CATA 1V7TA 4GITA 4LT2A 4MGIE 1JJ0A 3HTDA 138LA 1KY0A 1G0PA 3ZEKA 2RBOA 2F2QA 3CDOA 1L03A 4IBDA 4FCTA 3AL0C 1CU5A 1VATA 102LA 1D6QA 2D91A 1WGLA 1P2CC 1P2LA 3F9LA 4AG6A 3RUNA 4D82A 4LF5M 3IG5A 221LA 3QWLA 1WQOA 5KXYA 2YBLA 1TH4A 4NWHA 4H9EA 3SHFA 1YL1X 4LJ9A 1REYA 1UIHA 1L63A 4W55A 2BQBA 4NGLA 1GFHA 4L16A 2C96A 1IP7A 2R6FA 2ZILA 3DN2A 1L16A 1L50A 2LNHC 1OVKA 1HFXA 3RGPA 143LA 3T15A 1L66A 2UU9M 9LYZA 3A3QA 1EQ5A 3TXIA 4YY3M 1SSWA 1OFHA 1IR8A 2RBPA 3E4RA 4DV4M 178LA 1L96A 247LA 4LT3A 1Q39A 2CGIA 2LVOC 5ITXE 1F10A 1LZYA 3GLGA 5K7OA 1IWYA 1QT4A 5I4YA 1LMCA 3FUUA 1C6TA 3PVSA 1CUQA 1EL1A 1L0JA 4DD0A 3HJSA 2Z6BA 2F4VM 4QDNA 1VEKA 1BGIA 3SYLA 249LA 4OO9A 2DAGA 2LH0A 103LA 1HFZA 1LSAA 3JR4A 2RBSA 2MEIA 3TMXA 1GF5A 1JB0F 3L27A 1OQYA 1JKDA 2YBIA 5DYGA 2NQ8C 4BS7A 1YKYX 4ET8A 1GE3A 4AXTA 5FDJA 2ZTCA 1L31A 1IOCA 1WIVA 4CHTB 1LJKA 2EQLA 3WHLA 1QTKA 1QUOA 1MLCE 1UA6Y 1LKRA 2R4JA 1IFYA 1OUIA 5ITYA 3QYEA 4NGJA 3J2PB 2RRUA 229LA 2CHGA 1L73A 3RZ4A 2BWBA 1C65A 1L94A 251LA 1QSWA 3NY9A 2MJ5B 3SARA 1R2YA 170LA 3GP1A 1BVXA 2C99A 4QEQA 1LMOA 3C3DA 1L34A 1A2YC 4LDOA 3U6EA 3GULA 1LHLA 2EA0A 1CJ6A 2L09A 2HWJA 1QUDA 1WTNA 1CJ7A 2XBSA 1GBOA 2WZJA 3ATNA 2VF7A 1LWKA 4DD3A 4TTDA 1G71A 1G41A 2LHGA 5LVKA 4DV3M 1LSPA 4KLNA 1P3NA 1UIBA 3AW7A 3VLFB 2Z19A 4H92A 1L14A 1LZ4A 1GE1A 1NY5A 3LCUA 1KSFX 2BNKA 5DNYA 1L24A 2A7DA 3HUAA 3WPLA 1NSFA 4IATA 4AG5A 5FLXS 193LA 1L20A 3R8FA 3H4JA 2OQ4A 4FD2A 4NHQA 1IN4A 2OU0X 3A45A 3FYDA 1VDSA 1L48A 252LA 4DR7M 1C6JA 3N9AA 4NC6A 4EIWA 5C1BA 1YUBA 1HF4A 2XTHA 2B6TA 4M0WA 2OE4X 2YR0A 248LA 3CSRA 4EKRA 3FI5A 1GF8A 4I0CA 4NGZA 4DT3A 1GB8A 4DDBA 3QE8A 200LA 4LJ7A 1B5XA 1UBZA 4G9SA 5KJ9A 1QTCA 2QARC 1YROA 1LZCA 2L78A 3AZ7A 4M0DA 1EIJA 1L76A 1LSMA 2XSZD 6LZMA 2K0BX 128LA 3IHPA 5KXOA 4LF7M 199LA 1BWJA 2ZBKB 4B7FA 3WYHA 4I5SA 2AUBA 1L84A 2HCBA 166LA 5EQTA 4ZPXA 1UM8A 5L9JA 1NJFA 5FTJA 4LRSA 2OOAA 5APFA 4RW2A 1V33A 172LA 2OE7X 3HUKA 4ITQA 4IBGA 1KY1A 1QSBA 4C3WA 1P6YA 3DN8A 1DKJA 1CV1A 3DN3A 3G3XA 120LA 160LA 196LA 4DR6M 1J1XY 2CHQA 3B89A 1GFJA 3SBBC 1EQEA 1QTZA 2FYDA 1L80A 1B7NA 1L89A 3Q8XA 5KXNA 2RSCA 3FUTA 1CU6A 4F2LA 2JY6B 1XJUA 3HH5A 1IN7A 3U6OA 2YDGA 4ETDA 1L92A 4M9ZA 5IWAM 1G06A 4LZMA 1JISA 4AI6A 2D7GA 1YIKA 1ZVHL 2I26L 3GLHB 1BHZA 5E9RA 3DMVA 3B74A 3P68A 3TMUA 4CJ2A 2MEEA 2DQAA 4B7GA 191LA 5EXPA 2B6WA 5EXTA 1WR1B 4G4BA 4DDAA 4DV0M 1REMA 1OUFA 2W82A 5BPVA 4N5RA 2HUMA 4ARMA 3KSJA 5B1FA 2G3QA 2G5GX 3IJVA 232LA 1L53A 123LA 1B7MA 1NV9A 1HEMA 1YE9A 4IJFA 5DYIA 2N35A 4AKHA 3DNAA 1I4WA 189LA 2ZNXY 1KIQC 2O5RA 3T1HM 4CJ6A 4ML7A 5KPRA 1UICA 1LZ5A 1C63A 2OU9A 3AW6A 1LYJA 3GRRA 4FCVA 2F4GA 2YBHA 3B7NA 5II3A 4PPOA 4EKQA 3A42A 1G0QA 1SSYA 5E6JA 2BQDA 1YLAA 1DV0A 2OU8A 4P17A 1QUTA 4DUZM 3HT9A 1CV3A 1LZ1A 2L7HA 4C5FA 1L85A 3A3RX 7LZMA 1JPOA 3GRUA 1LGWA 4B4IA 2L4EA 1DYDA 5LVJA 2EPEA 5KPZA 1DGHA 1DI3A 3NWLA 4NRVA 4TUWA 1GAYA 3GRYA 4REZA 3W6AA 3TXKA 4CGYB 1H6MA 2CE7A 3GPUA 1GFVA 3FKEA 1D0LA 1FJGM 3VDUA 5IELA 2KDLA 1GVNA 3W0LB 151LA 4WO9A 1SXJA 1QS5A 2M60A 1FKQA 141LA 4NWEA 1QUHA 1IR9A 4ZEEA 1GBSA 1IBLM 1C6AA 1QDRA 3CDTA 3HBDA 3CSZA 3AV0A 2QBYB 4AKIA 3WVYA 1NKHA 1L99A 2JZ0A 1K3WA 4L6V6 1IOQA 4RW1A 1KXYA 1HT2E 206LA 5KY1A 1Y8GA 1WQPA 1K28A 3M7GA 5LAFA 3HDFA 5KXLA 1T6OA 1L00A 2DBTA 4XYYA 3WULA 1L56A 3HZJA 4LF8M 2MEAA 2YQZA 1WJ7A 1L95A 225LA 1L07A 4DC4A 4PD2A 4ETCA 163LA 3M6AA 2D4JA 4GBRB 5DN5A 2Z2FA 4NG8A 1L72A 3HTFA 2YNMD 2FBBA 3LZTA 1J09A 5EJCA 1IP6A 4AZFA 1LHJA 3AJIB 4QOZC 1INUA 1OUHA 3ILKA 1IIZA 3DMXA 4LYCA 4M6DA 4DDCA 1G0GA 4XJHA 2MEHA 1L29A 1RCMA 3K9PA 2ZANA 5KXKA 3GLFB 2RGOA 3HUQA 4J1BA 4ARLA 2L6OA 1PS5A 4WLDA 1QS9A 1B0DA 1FNNA 1L2BA 2MEDA 5IREB 4DR2M 4H9CA 3HT7A 1CV5A 1WQQA 4FVMA 4NGYA 210LA 4AQNA 4R6CA 2ERCA 1VAUA 4XJIA 3C58A 4KODA 1BWHA 1XEJA 129LA 1L83A 1OUEA 1G0KA 4B3SM 4PDIA 1C6HA 4HL4A 3GQ5A 5ILCA 3G3AB 4I7SA 4ZIXA 149LA 3K2LA 1G0LA 4I7QA 6LYZA 1GF0A 1XGPC 4H90A 1LMAA 1GEZA 1RE2A 1XMQM 4PT5A 1L35A 1L45A 1B5VA 5KXSA 1IXSB 4NGKA 1QTDA 2DWNA 3KS8A 4LFBM 1L91A 4H9FA 131LA 2B5ZA 2X49A 3ODUA 2KEBA 3UJNA 1SLYA 4CFPA 3AZ4A 4WOAA 2JXNA 1RU3A 1KW5A 1C6MA 1JTNA 2R18A 1L41A 3QAUA 3KW6A 1XGQC 4NGIA 3E21A 1GB3A 1OIZA 4QNMA 1YKXX 2J7OA 1YL0X 1HELA 3OE0A 1E32A 3F6ZA 1ZMYL 2BQAA 2FBDA 1QUSA 1L60A 4DUYM 1IQPA 1B5WA 3TXFA 1IY2A 1FLWA 3FTCA 3WW5A 2R45A 5C18A 4X66M 2NTHA 5DLAA 4M9XA 3F92A 1UIFA 1LJJA 4YM8A 1L71A 1I20A 5I54A 1A5TA 1HQCA 3W6DA 1W5TA 2XGNA 3AJNA 4HTKA 3B0IA 2K47A 4OWCA 1IY1A 1PRBA 2HTXA 3LQQA 2GNOA 1KYIA 150LA 1L33A 5KO3A 1JKCA 2C8PA 137LA 212LA 1IWZA 3SFZA 4JI1M 1DYFA 1QUGA 3SMSA 4EKSA 4G4OA 3B0KA 184LA 2D4KA 3HHYA 1LJNA 2ZYCA 1VDQA 2F4AA 3NY8A 1IP3A 1D0KA 1ZV1A 2MH8A 4BAPA 3IWRA 4I8OA 2UUCM 3GPXA 1L58A 4LYMA 1LZGA 5KXXA 135LA 3V2WA 4FDYA 3G3VA 2B6XA 4Y28F 1P56A 5F14A 3ZVQB 2EJSA 3K3TA 219LA 3M18B 4D9ZA 4NSGA 1GB0A 3TXJA 1TH2A 1B7OA 2XFSA 3SB7A 187LA 3K8ZA 2LVQD 3R9XB 3D8BA 4QGZA 3SATA 2OOBA 1DYBA 228LA 1OWZA 233LA 1TCYA 4FCWA 1G07A 4PRUA 1BVSA 1BVKC 3JAMS 2G4NA 5DN4A 1G7LC 1EQ4A 4G4RA 5HMVA 1HMKA 4HJVA 2OEAX 222LA 1GL6A 4H1PA 4G4QA 4I7TA 1G7IC 3U6LA 4XENA 4MSTA 3EMLA 5EP4A 4TX7A 3WU8A 4NL4H 108LA 1NDGC 2LCBA 1W5SA 2WARA 4AW4A 1TBYA 1MN3A 2R62A 4LY6A 3QNGA 2VF8A 2QCUA 1GBXA 2A4TA 3LMMA 2DI0A 3SMPA 2EUCA 2BQCA 3SN6R 3K92A 4J0LA 1A4VA 2F5PA 1LJ3A 1DYEA 1GF6A 4NRWA 1QAQA 1GEVA 4YXCA 1JQJC 1JWRA 1G3IA 1REXA 2XBRA 3M3UA 1L87A 2D4IA 1YAPA 134LA 3SAWA 1B7QA 2DZOB 4LGMA 127LA 4I7JA 2B75A 4GRIA 3AOEA 4GCDA 4XBOA 1LHMA 4HPEA 3A98B 4DWXA 158LA 1UIEA 3GUMA 2GQFA 2QQ8A 4P16A 2B70A 1L77A 4Z8XA 1I1ZA 1LI3A 4H91A 177LA 1XEPA 4HV2A 4CHXA 1LJHA 1GKIA 3FRIA 3IG8A 2KZSA 1L8QA 2XEPA 175LA 3L2AA 1LMQA 4LYBA 239LA 4NSJA 1OUDA 2Y0TA 3LYZA 1L65A 4R7GA 1QYRA 1XEKA 4QHTA 1IWVA 5L8RF 1LSBA 2L7IA 3GLFE 4HPIA 1WQNA 2H5ZA 4B3TM 1VEJA 3TWMA 4IBBA 1BB3A 1LKSA 4GH9A 2CDSA 1CKHA 3GLIA 5LZMA 3U6QA 1QZMA 2JNHA 1JTMA 3HWLA 1Q3CA 2CHVA 5HQ1A 3OK0A 5KXWA 1RJCB 4OW0A 1BB4A 205LA 1L11A 2OTYX 4DQJA 2DZNB 4PGJB 1JTOL 2ZYPA 3FADA 1ZAEA 4IBJA 4R0FA 1BB6A 2LTUA 3SC3A 3K1JA 2UXBM 1NO1A 1D0MA 1L13A 4NOOB 1C6PA 1LZ9A 4GKJM 3CDQA 2YSSC 2EIZC 1CX6A 3VW7A 5IT9S 3GLHA 2C9CA 1G7HC 1TH3A 3GO8A 1GFTA 3TXDA 3W6CA 3MK6A 1C6GA 3U6MA 4W56A 2LWXA 1LPYA 2YBNA 111LA 161LA 1QTEA 1C45A 4IJ4A 5F9XA 1IP2A 3LCVB 1JJ3A 2O25A 162LA 5JI2E 3A6CY 2HEAA 1F0WA 5EP3A 4MH0E 4NHTA 3A93A 3D8LA 2HEBA 3GUJA 2QZ4A 3FA0A 3I51A 3WMKA 207LA 1ZMVA 1CKCA 3HU9A 2A5YB 2WSFF 2V6ZM 4RNAA 1GFEA 1XSFA 2RB1X 3SYKA 4OWHA 3KOZE 3G3WA 1N4FA 2J5YA 1XGTC 5LYTA 5LIOA 2KRUA 146LA 1C10A 4EPIA 3JR5A 4EXMA 3AGIA 2B73A 3CT0A 3I4VA 4JI7M 2O4WA 4CFOA 1ZQ9A 3RU5A 3L28A 1XFPL 2RAZX 3D3DA 2OPFA 256LA 3RW8A 3FUVA 4IASA 1VDDA 2HUKA 2I7NA 4FW9A 2HU1A 4QOSA 4II7A 1SG9A 3CTWB 5LVGA 3FTDA 155LA 4H94A 2CEAA 4DKLA 1WGNA 2W1LA 1VQ1A 3FRHA 1L62A 5AMYA 3RT5X 2H5XA 1BWIA 5E4PA 1I94M 1OQMA 244LA 1QT5A 1OUBA 118LA 2G4QA 190LA 1KXWA 1LAAA 1LTMA 1QVRA 1SX2A 114LA 2BQEA 2DQJY 1B2KA 2D7HA 5D5FA 1GWDA 2QP9X 1L2CA 168LA 1C64A 2KXEA 1Z6TA 2JP7A 1GBYA 3CT1A 220LA 4U3XB 2XQOA 253LA 2Z4SA 2H9JA 1L59A 1PJQA 3U5ZA 1VDTA 2I7PA 1KIRC 260LA 1NVMA 3UGJA 2M5ZA 1L04A 2BAAA 2P5TA 1L82A 4GC5A 1LZSA 1OUJA 1K82A 1NBZC 3A90A 2B6YA 1C6DA 1LYFA 3L64A 4IBEA 4L78A 4JN6A 145LA 1N75A 3LYMA 4N9RA 4XJFA 4G3OA 2FOIC 1TEWA 1WTMA 1SXJD 4HTQA 1JJ1A 1PQKA 1HEPA 1L28A 4TSBA 4DYGA 254LA 1QDTA 1QTBA 4RF1A 1GB9A 3SB8A 4NSIA 2VDBB 3PDSA 2QNJA 1D2WA 1SXJC 2KA6B 2R4EA 1LZNA 2EKFA 3HTBA 2L4FA 1LOZA 4DV7M 1CV6A 3GLGB 4I7RA 3JR6A 3EXDA 4H93A 1L02A 1I56A 214LA 1HENA 2RH1A 3DN1A 4GCBA 4ARJA 3HHZA 2LHCA 3KAMA 5KQ8A 2EO2A 3J7BA 4J7VA 1AIPC 2ZNWY 1Z5CA 3CDRA 157LA 1LYYA 4Q7JA 1UC0A 2BQNA 2HEDA 1IX0A 4XN6A 1GF3A 2RB2X 1L42A 1QAMA 1C7PA 4M9SA 1GJSA 3L29A 1EFUB 1KNIA 1L23A 1PQOA 5FHWA 227LA 5ITXA 3HU3A 2NWDX 1XXHE 1WHCA 3L26A 2JZ1A 1IEEA 3C81A 5JENB 7LYZA 1L30A 4MM3B 1OFIA 4WW0A 3HY5A 4E3UA 2I25L 2RAYX 1GB6A 1MX0A 1QANA 2LXEA 1JITA 1XHBA 4JI4M 4W54A 4PJ2C 1IN8A 3J7AS 1WVVA 1LHHA 1LWGA 1KW7A 2B74A 1TDZA 2ZIJA 3SAUA 4R3DA 5B1GA 5IZ7D 5I4XA 1LSZA 1YAOA 1HC0A 1IN6A 2LYMA 1OUGA 4LG2A 5F3WA 1ZURA 3CGWA 4JYAM 1CKDA 4HJZA 2K9DA 4YXAC 4KXIA 5FSWA 1HR0M 1ALCA 2DAMA 4IBCA 5EXXA 2HAKA 1L27A 1B7PA 1CJ8A 4K0KM 1JSEA 1JUGA 4L8RC 3BXWA 2JA2A 1L37A 3NYAA 3L25A 1C6LA 1L70A 4OWAA 4RDSA 231LA 2ZIKA 1JQUA 2BPUA 3EBAB 4A7DA 2MGWA 2Q9DA 5A3EA 3TXEA 2GV0A 174LA 3A8ZA 3C7WA 3A6BY 1NNUC 4GLVA 2LBCA 1YKZX 2HUBA 181LA 1C08C 1JTPL 1JKBA 5LMUM 236LA 3HT8A 4LF9M 3RNXA 4R71A 4GRVA 1HEQA 2DQGY 3WVXA 3DOAA 4BAFA 1UIGA 1OV7A 7CATA 1GFRA 4IBKA 3W68A 1CKGA 1LZAA 5LVIA 2N5ZA 4GN3A 1LSGA 4PDGA 1LYHA 1TF0B 1LYSA 1L79A 4I7MA 4GIPA 1NHEA 3N9EA 4D81A 3DN0A 4LF6M 1C6EA 1MU5A 2DQIY 4GKKM 153LA 1LV7A 4W57A 5FTMA 1LGUA 6LYTA 1GL7A 4ZFPA 3KSXA 1LMTA 3TMWA 2JY7A 197LA 109LA 4WM1A 1L51A 2YVBA 4NSHA 4PRQA 259LA 1LZDA 1IC4Y 2ZQ3A 4ARQA 2ZAOA 1L75A 142LA 3BBZA 3GUOA 2C98A 5I14A 3GUKA 4MR1A 1G59A 1DO2A 1C6KA 1DI5A 2HECA 1G7JC 1SQ2L 1J1PY 4LF4M 2W1MA 5DM9A 4FWDA 1ORYB 1UUZC 1HJPA 1NDMC 1NWGA 2BQFA 1L90A 2F5QA 2MEGA 3J6KA 3C7YA 1NNJA 1L01A 4J1AA 3WU9A 1JR3D 1YQVY 3SHGB 1XWIA 1C69A 3P65A 4G4HA 4PK0A 5KXMA 1UACY 3HFMY 3GXKA 1GFUA 1FLYA 1E8LA 1L67A 1VEGA 1DO0A 4AQYM 4UWVA 1CVKA 4NGVA 2LVAA 3MGWA 2C5RA 3U61A 1N32M 1DPWA 1HNLA 1LJIA 3T1YM 1LZEA 4H9AA 167LA 3P66A 4DR3M 3RZEA 4OX9M 4XJDA 3TMVA 4DR5M 4LZZA 1RI8B 2YFQA 3U6DA 1P46A 1QSQA 147LA 4S0WA 2DXIA 2F5NA 3T6PA 209LA 4M4OA 1TAYA 1TTEA 4MGHA 1T3PA 3RFWA 2DZLA 4OVZB 4LZTA 3HH3A 3C8QA 5LXWA 1IXZA 1LZTA 4NXNM 1DYCA 2F5SA 3J80S 217LA 4ARMB 1E94E 4HSFA 4IAPA 1LYGA 4OWEA 5HNLA 4G6ZA 1F6RA 2ZAMA 211LA 3WL2A 1LLHA 3E46A 1K3XA 1NMMA 2QSFX 4NY5A 2HEEA 1L18A 1P64A 4GEWA 186LA 2B6ZA 4YEMA 4N1CC 2FH0A 3ZQJA 3MJ5A 4WLYA 1J5EM 2HHHM 2BLXA 112LA 1LYEA 3GUIA 2DNAA 1L39A 1YILA 4OU7A 1IWWA 3M0EA 3KFUG 1PQIA 1DXJA 1L22A 1XJTA 1OAOC 1IWXA 5EBHA 4XGIA 4AGAA 3QY4A 4L15A 4IIWA 4TWSA 2C9OA 2DQDY 2DHYA 5KXPA 2CFOA 1HEWA 3GXRA 1T3TA 2ANXA 3I01M 4W51A 3GLGE 2RBNA 4EMNA 3FD9A 1REZA 234LA 1F6SA 4LYTA 1IN5A 2HEFA 1IBKM 5KXRA 4WM5A 1IXRC 3GLIE 1CV0A 1L19A 3EIEA 5FTKA 4OW1A 8LYZA 3NBIA 1L68A 2A7FA 3HX3A 1TR8A 3MMPA 3UK6A 4GCEA 4TSCA 5H37D 1LZRA 173LA 4JI0M 4B08A 1VG5A 4RLNA 4LDLA 1WQMA 4Z98A 1T8FA 1L12A 240LA 3VK7A 3C7ZA 3WXTA 3GPPA 3Q8GA 1OJLA 2XZUA 1JR3A 1T97A 2BLYA 1C62A 4BLCA 3LHMA 2LZMA 133LA 3WW6A 1J1OY 3NBXX 2DQHY 4WURA 3E9SA 1GB5A 2Z4RA 3AOEC 1NHWC 1DKKA 1GFGA 4WG1A 1GPQC 1B5YA 1GXXA 4GHAA 2VIIA 3AOGA 122LA 2HKJA 1QT8A 5A3ZA 1IBMM 3UZUA 1GB7A 2Q9EA 1GE2A 1L74A 4N8ZA 3AFHA 3VK8A 3TE6A 1GHLA 4Z41A 3PNVA 2Q2EB 2H1RA 4LFCM 4NSRA 1L55A 1PGYA 4DJHA 4NGWA 5B07A 3AZ6A 1CUPA 2AHMA 3VWOA 3UONA 3J81S 2F30A 230LA 1TDYA 4I7LA 1C60A 1QIOA 1Q02A 1NHBA 1UIDA 119LA 3T38A 3CB7A 1HHLA 5HLLA 188LA 2J7NA 4DD1A 1GF4A 4LRTA 1R6BX 5DFLA 1HERA 2Y0QA 4DBGB 3C82A 5F16A 3TL4X 148LE 3LYTA 4WM2A 2VQEM 2UUBM 1DQJC 4DQ7A 4MGZE 3THGA 3FTFA 208LA 169LA 4QHSA 4NHIA 2Z39A 3HU1A 3TWKA 1YAQA 1XGRC 1B9OA 3OE9A 3C83A 1FLUA 3AYQA 4W52A 3SBAA 1V7SA 3BKVA 3K2RA 1C43A 4KL7A 1L1TA 1LSCA 262LA 2DWMA 4JI8M 2O79A 2B7XA 2R44A 1HMLA 201LA 185LA 5IHGA 2DENA 1C46A 2XJWA 4DR4M 4LJ5A 1SX7A 3FI7A 1IP5A 2CV1A 1D3NA 250LA 3AGGG 4I7NA 1NHGC 1XXHB 1Z59A 132LA 1PJTA 3HU2A 4B7HA 1BB5A 4UN2B 2PC2A 4I7KA 3B6LA 1OP9B 4WL6A 1XNQM 4JV5M 4MGYE 4DD2A 3KVWA 180LA 2X4AA 3CQLA 3SBJA 1RFPA 2BQLA 4P2EA 4WP2A 5APDA 4Z6YA 2R65A 1JIYA 1H87A 216LA 1AUAA 3AB6A 3W0FA 2CV0A 1GF9A 1QTHA 4UWUA 4GHLA 215LA 1YAMA 1L52A 1L10A 2LVNC 3FE0A 4W59A 3FYCA 2Z38A 3B72A 4LGKA 1NY6A 4DV2M 1I6SA 3IJUA 1C61A 3C9PA 1DPXA 2EKSC 4EKPA 1P2RA 4NHSA 2Z8YM 1L93A 4IBFA 2DKVA 3FUWA 1OKSA 2V1CA 4I8SA 1R7RA 1OWYA 255LA 3J27B 1C6NA 2Y20A 3CF2A 1D2NA 3P64A 3I4YA 4DQ5A 1QQYA 2DAEA 3A95A 3QYBA 1OIPA 1VEDA 4G4NA 5LMNM 4GN4A 3EMSA 3WUAA 3TWLA 4A3VB 1LPIA 1GBWA 3PXGA 2Z12A 1XC8A 1HEOA 176LA 1JSFA 1AZFA 3HTGA 2RB0X 3CF6E 2JWSA 3DFZA 1G0JA 2KNZA 3HWSA 4JI2M 3FUXA 1L26A 1B5ZA 1DI4A 1G1VA 3SASA 1IWTA 4JI3M 1GAZA 4X3BA 2XFTA 5LA8A 2ANVA 5C6LA 3DKEX 3HBHA 2OO9A 3W67A 3DN4A 2W1YA 1BB7A 4FWGA 1R4GA 3ATOA 4NSOB 1CTWA 2Z2EA 2CUZA 5C6IA 1L81A 2R0IA 3KDSE 4FWHA 4NHPA 3FTEA 2Z18A 4B49A 5LYMA 3SP3A 5ITUA 5KKJA 182LA 1B7LA 4HEOA 5JI3E 1P36A 2CJLA 1CKFA 4LT0A 4OWBA 3W3EA 1LJGA 2DAIA 4DV6M 3K9OA 3HH4A 5KKIA 3U60B 1D3JA 4CIZA 4WM6A 2OE9X 3P4ZA 4W53A 1IOTA 4ANRA 4HLQA 3VKGA 2ZQ4A 2DKLA 2DQCY 4H9IA 1L2DA 1Z55A 3WUNA 4LZJA 1XGUC 1Z5AA 4CISA 2Y8PA 3KS4A 1L08A 3B9PA 5FTNA 1GFKA 2B3TA 2BJWA 2LYOA 5EP2A 5ITTA 1D3MA 4MB7A 1QSAA 4NEBA 5FCPA 1SXJE 1N34M 2IGCA 4L41A 1T8AA 3PNYA 226LA 1OAIA 242LA 1C7YA 2UXCM 4LCBA 4I4LA 4ET9A 1XMOM 2LHMA 1QT3A 5DL9A 1OUAA 1NQIA 4RKUF 1GB2A 1G8PA 2R46A 1CU0A 2MECA 4LT1A 2DQFC 1NF5A 4NFVA 1L86A 5EXSA 1L47A 1J7KA 2HL7A 1IY0A 1PJSA 3B0OA 4XJGA 5KXZA 1AT6A 1IP1A 5ITRA 4PHIA 5J7CA 1P5CA 2XZFA 4DV1M 3SB6A 1JKAA 2JY5A 1L46A 3AZ5A 1CX7A 3GQ4A 5L3IA 1VFBC 1C6IA 126LA 4BB9A 2QBYA 2Z3XA 3V76A 3DZDA 198LA 1LJ4A 4GN5C 1C66A 5ILFA 171LA 2KNAA 5FEKA 3WU7A 1LZ6A 237LA 3OE6A 4WMGA 1N77A 4YF2A 3HHWA 1PJJA 1AM7A 3J4GA 4LYZA 1XB2B 4KHPM 1NV8A 2UXDM 3MHVC 165LA 4WG7A 5BR8M 4BBAA 1N78A 3AKZA 2QENA 1L17A 3U6PA 2L2DA 2RGHA 2CV2A 4X65M 5FELA 1GDWA 1LYDA 1WTHA 2Z7JA 1QTVA 2Z37A 3CT5A 1VDPA 2G8LA 2BQMA 1N36M 1VDLA 1LSNA 1QZEA 3QAKA 3DA1A 4CGEA 1R2ZA 1TDHA 1R5LA 3PBLA 1ZYTA 3VFDA 1DGGA 2E5LM 4PJZA 3GLIB 1L61A 1B7RA 4H8ZA 1G1WA 4LJ4A 5F81A 4GCFA 5HNCA 3U6CA 3GUPA 1ZWNA 4LFXA 144LA 2MR9A 194LA 2UUAM 159LA 4B0DA 1Q3BA 2DWZB 115LA 1C6CA 2X8AA 3UMMA 4ETEA 4B4EA 3GLFA 4W58A 5I4WA 3DMZA 1L15A 1L25A 1GBZA 1YSYA 2HU3A 2DWLA 1IY3A 4LJAA 2CWBA 1JTTL 3G3BB 5KPTA 3C8RA 1CU3A 3U6SA 1D9UA 2DVWB 3B7ZA 3HHXA 1LHIA 4BADA 3WHKA 2F2NA 5I5QA 1GABA 1GD6A 4B3RM 4OVZA 2QPAA 1OUCA 3W6FA 3D4SA 1CNSA 4GC9A 3T36A 3D9AC 3ZCBB 2LVPC 4B3MM 1QQWA 1ZVYB 3TXHA 3KOYE 1DGBA 1C67A 4N1EI 1G4AE 1OYUA 4H9HA 223LA 4RF0A 5APCA 4LGYA 3SB9A 4WM3A 2BQIA 2K6BA 3SAVA 2OTZX 1HNXM 1L54A 1IXSA 4IBIA 2JY8A 1LI6A 3VKHA 4YENA 5L3HA 3B7QA 1FKVA 3HJQA 1TLAA 3BOSA 1GO5A 3HDEA 3WPJA 1UCOA 1WQRA 3OJPA 4W94A 1L44A 1L06A 2EKKA 1KIPC 4XK8F 164LA 4JXJA 213LA 3KOWE 1WXQA 4I7PA 4Z3MA 4LFAM 3F8VA 1EPYA 1LMNA 2MEFA 2G4PA 4RLMA 1AKIA 4YHHM 2KZUA 2KRKA 5KXTA 1ZMUA 2X0AA 2XSZA 2BQOA 3AGHA 4HJYA 2RBRA 1WVUA 3GRVA 3RE8A 1DYGA 1JR3E 1GE0A 4HTNA 4YEOA 4DAJA 1L49A 1T6VL 1W08A 1W6ZA 4Z46A 2Q0MX 3ULRA 1LCNA 4LDEA 3LVVA 1C68A 3WXUA 3EIHA 5D5CA 2JUJA 241LA 1G7MC 4OOTA 1IY4A 3A46A 1OTRA 1PQJA 1LYIA 2LZ2A 156LA 4H8XA 2D7EA 1JEFA 3I04M 5KQDA 2CUUA 4FJRA 3HJ8A 5ITQA 1IWUA 3FE3A 3LW5F 1N33M 2RBQA 235LA 4F1IA 4NG1A 5F9UA 2BQJA 3A34A 3U5ZB 2VQFM 4NGOA 1NBYC 4YOPA 4WM4A 2BJVA 1GDXA 1T6HA 1YANA 1LHKA 1CJ9A 1D3FA 1PZYA 243LA 3LYOA 1L0KA 1UIAA 4IJEA 3LZ2A 2YBJA 2ZTDA 3LN2A 1SWZA 5LA5A 2F32A 110LA 1T8GA 1E9RA 1C6FA 1FBIX 107LA 2FE8A 154LA 1HSXA 1L32A 1ZMWA 140LA 1MELL 4DV5M 5EP1A 3SB5A 3ZVQA 4S12A 1FDLY 2BQKA 2HULA 104LA 2O01F 1L88A 1XNRM 1B7SA 3C8SA 1DYAA 3WPKA 4GLAA 2LC9A 2ZM6M 5LAGA 1UFZA 1L64A 2O7AA 1G0MA 1L97A 2V1UA 1MJGM 4LFPA 4ETBA 2F5OA 3ZC7B 3ZH9B 1LJFA 3H4MA 3OE8A 2XLJA 3T6UA 1L40A 4JI5M 1LGXA 3DN6A 5C6JA 1TGUA 4WO6A 1XEIA 1BQLY 4W5WA 5IDDA 1L69A 4L4UA 5B05A 3A67Y 1LZ8A 1PJIA 3V2YA 5FTLA 1LW9A 1HNZM 3TXBA 4NXMM 1GFAA 1PQMA 1CUKA 1HT1E 4X62M 3KOXE 4I7OA 1LJEA 4DD7A 3VDPA 3GQ3A 1LZBA 3EO5A 3CSQA 1LSEA 2WSEF 3GUNA 1QAOA 1B5UA 4HV1A 1GLNA 2BQHA 2APLA 4JI6M 1C1KA 4W96A 2LYZA 4G49A 2I6ZA 1PM5A 2KHHA 3A92A 1XXHA 4EOFA 4AKGA 1IO5A 2FS1A 1KXXA 1L21A 2F47A 4KT3A 4XJBA 1T43A 4N0JA 2H9KA 4B4JA 1P3QQ 1L1ZA 218LA 2FFJA 3KP0E 3KP1E 1IOSA 3LQRA 3HGIA 125LA 4LJ8A 1IC7Y 4WLXA 2WSCF 1LSYA 1KS3A 3L2XA 1P37A 5B06A 4DR1M 2Y21A 1DGHB 4MCKA 2MEBA 5LYZA 1D9WA 4MGKE 261LA 3KXEC 3TPZA 4II8A 1NJGA 1O23A 4KT0F 1OVJA 4KO8A 4OOOA 3TXGA 2IHLA 2VB1A 4G4CA 1SXJB 1IORA 1EE8A 4UWNA 5HMJA 1D2YA 1C6BA 1H6UA 2XF3A 3WUMA 5GKNA 1GE4A 3C3EA 238LA 2CP8A 1L43A 3HBEX 3GLHE 5B59A 3W6BA 2LZTA 2ZWBA 2W1XA 1OVHA 2XH9A 5E26A 2QB0B 3RGSA 4E97A 152LA 1P7SA 1V92A 1V34A 2YBMA 3PFIA 2RKOA 2C8OA 4EPFA 5FSTA 1Z5BA 4WLTA 4X64M 1L98A 1FLQA 4YX7C 3A96A 2B72A 1LSDA 1HNWM 3CF0A 1GJTA 5LINA 4ARQB 2KNVA 3A94A 4ZPUA 1PQDA 1LYZA 3WH1A 1IP4A 1AT5A 1IVMA 4H8YA 5I53A 1LYOA 1B6IA 2FYCA 1KFVA 4WL7A 4ARPA 2BWEA 2BQGA 1D6PA 1ZV5L 2KW0A 1JHLA 5LVHA 4GCCA 4TUNA 1GF7A 3LZMA 1L36A 1LSFA 1L57A 1IM2A 3GPYA 2D6BA 2DAKA 130LA 4B1AA 4K5YA 4H9BA 4QY9A 3TQSA 1HQYE 4XADA 4KPMA
chains in the Genus database with same CATH topology
5APEA 139LA 2CWIA 4EJ4A 1SWYA 1FN5A 3BKHA 1CU2A 3W6EA 113LA 1DZBX 1C6QA 183LA 1LMPA 3N9CA 1IR7A 2NTGA 4ETAA 224LA 195LA 4HP0A 1L05A 1L09A 1HSWA 4O34A 1L38A 1LI2A 3A91A 5T3FA 257LA 1QT6A 258LA 4DD9A 1HFYA 1OV5A 3HH6A 3HU8A 4NIJA 2IFFY 3E3DA 3C80A 246LA 4LYOA 3CDVA 1IC5Y 1QT7A 5M1YA 1CV4A 1GXV2 2DQEY 192LA 245LA 3HT6A 1V7TA 4LT2A 1JJ0A 3HTDA 138LA 1KY0A 1G0PA 3ZEKA 2RBOA 2F2QA 3CDOA 1L03A 1CU5A 1VATA 102LA 1D6QA 2D91A 1P2CC 1P2LA 3F9LA 3RUNA 221LA 1WQOA 5KXYA 2YBLA 4NWHA 4H9EA 1YL1X 1REYA 1UIHA 1L63A 4W55A 2BQBA 4NGLA 1GFHA 1IP7A 3DN2A 2ZILA 1L16A 1L50A 1OVKA 1HFXA 143LA 1L66A 9LYZA 3A3QA 1EQ5A 3TXIA 1SSWA 1IR8A 2RBPA 178LA 1L96A 247LA 4LT3A 2CGIA 1F10A 1LZYA 5K7OA 1IWYA 1QT4A 5I4YA 1LMCA 1C6TA 1EL1A 1CUQA 1L0JA 4DD0A 2Z6BA 4QDNA 1BGIA 249LA 4OO9A 103LA 1HFZA 1LSAA 2MEIA 2RBSA 3TMXA 1GF5A 2YBIA 1JKDA 4BS7A 1YKYX 4ET8A 1GE3A 4AXTA 5FDJA 1L31A 1IOCA 1LJKA 2EQLA 1QTKA 1QUOA 1MLCE 1UA6Y 1LKRA 1OUIA 4NGJA 229LA 1L73A 3RZ4A 1C65A 1L94A 251LA 1QSWA 3NY9A 170LA 1BVXA 4QEQA 1LMOA 1L34A 1A2YC 4LDOA 3GULA 1LHLA 1CJ6A 1QUDA 1WTNA 1CJ7A 2XBSA 1GBOA 3ATNA 1LWKA 4DD3A 4TTDA 5LVKA 1LSPA 1P3NA 1UIBA 3AW7A 4H92A 2Z19A 1L14A 1LZ4A 1GE1A 1L24A 2A7DA 3HUAA 3WPLA 4IATA 193LA 1L20A 4NHQA 2OU0X 1VDSA 1L48A 252LA 1C6JA 3N9AA 2XTHA 1HF4A 2B6TA 2OE4X 248LA 3CSRA 4EKRA 3FI5A 1GF8A 4I0CA 4NGZA 4DT3A 1GB8A 4DDBA 3QE8A 200LA 1B5XA 1UBZA 4G9SA 5KJ9A 1QTCA 2QARC 1YROA 1LZCA 2L78A 3AZ7A 1L76A 1LSMA 6LZMA 128LA 5KXOA 199LA 1BWJA 3WYHA 2AUBA 1L84A 166LA 5L9JA 5APFA 4RW2A 172LA 2OE7X 3HUKA 1KY1A 1QSBA 4C3WA 1P6YA 3DN8A 1DKJA 1CV1A 3DN3A 3G3XA 120LA 160LA 196LA 1J1XY 3SBBC 1GFJA 1EQEA 1QTZA 2FYDA 1L80A 1B7NA 1L89A 5KXNA 2RSCA 1CU6A 1XJUA 3HH5A 2YDGA 4ETDA 1L92A 1G06A 4LZMA 1JISA 1YIKA 1ZVHL 2I26L 1BHZA 5E9RA 3DMVA 3P68A 3TMUA 4CJ2A 2MEEA 2DQAA 191LA 2B6WA 4G4BA 4DDAA 1REMA 1OUFA 4N5RA 2HUMA 4ARMA 5B1FA 3IJVA 232LA 1L53A 123LA 1B7MA 1HEMA 3DNAA 189LA 2ZNXY 1KIQC 4ML7A 1UICA 1LZ5A 1C63A 2OU9A 3AW6A 1LYJA 2F4GA 2YBHA 5II3A 4PPOA 4EKQA 1G0QA 1SSYA 2BQDA 2OU8A 1QUTA 3HT9A 1CV3A 1LZ1A 4C5FA 1L85A 3A3RX 7LZMA 1JPOA 1LGWA 4B4IA 1DYDA 5LVJA 2EPEA 1DI3A 1GAYA 3W6AA 3TXKA 1H6MA 1GFVA 1D0LA 5IELA 151LA 4WO9A 1QS5A 1FKQA 141LA 4NWEA 1QUHA 1IR9A 4ZEEA 1GBSA 1C6AA 1QDRA 3CDTA 3HBDA 3CSZA 3WVYA 1NKHA 1L99A 1IOQA 4RW1A 1KXYA 206LA 5KY1A 1WQPA 1K28A 5LAFA 3HDFA 5KXLA 1L00A 2DBTA 4XYYA 3WULA 1L56A 2MEAA 1L95A 225LA 1L07A 4DC4A 4ETCA 163LA 4GBRB 2D4JA 5DN5A 2Z2FA 4NG8A 1L72A 3HTFA 2FBBA 3LZTA 1IP6A 1LHJA 1INUA 1OUHA 1IIZA 3DMXA 4LYCA 4M6DA 4DDCA 1G0GA 4XJHA 2MEHA 1L29A 1RCMA 5KXKA 3HUQA 4J1BA 4ARLA 1PS5A 4WLDA 1QS9A 1B0DA 2MEDA 4H9CA 3HT7A 1CV5A 1WQQA 4NGYA 210LA 4AQNA 4R6CA 1VAUA 4XJIA 1BWHA 1XEJA 129LA 1L83A 1OUEA 1G0KA 1C6HA 5ILCA 3G3AB 4I7SA 4ZIXA 149LA 1G0LA 4I7QA 6LYZA 1GF0A 1XGPC 4H90A 1LMAA 1GEZA 1RE2A 1L35A 1L45A 1B5VA 5KXSA 4NGKA 1QTDA 1L91A 4H9FA 131LA 2B5ZA 3ODUA 1SLYA 4CFPA 3AZ4A 4WOAA 1KW5A 1C6MA 1JTNA 1L41A 1XGQC 4NGIA 1GB3A 1YKXX 1YL0X 1HELA 3OE0A 3F6ZA 1ZMYL 2BQAA 2FBDA 1QUSA 1L60A 1B5WA 3TXFA 1FLWA 3WW5A 2NTHA 5DLAA 1UIFA 1LJJA 4YM8A 1L71A 1I20A 5I54A 3W6DA 3AJNA 4HTKA 3B0IA 4OWCA 2HTXA 150LA 1L33A 1JKCA 2C8PA 137LA 212LA 1IWZA 1DYFA 1QUGA 4EKSA 3B0KA 184LA 2D4KA 1LJNA 2ZYCA 1VDQA 2F4AA 3NY8A 1IP3A 1D0KA 4BAPA 3IWRA 1L58A 4LYMA 1LZGA 5KXXA 135LA 3V2WA 4FDYA 3G3VA 2B6XA 1P56A 5F14A 3ZVQB 3K3TA 219LA 3M18B 4D9ZA 4NSGA 1GB0A 3TXJA 1B7OA 3SB7A 187LA 4QGZA 1DYBA 228LA 1OWZA 233LA 1TCYA 1G07A 4PRUA 1BVKC 2G4NA 5DN4A 1G7LC 1EQ4A 5HMVA 1HMKA 4HJVA 2OEAX 222LA 4H1PA 4I7TA 1G7IC 4XENA 4MSTA 3EMLA 4TX7A 3WU8A 108LA 1NDGC 2LCBA 2WARA 1TBYA 3QNGA 1GBXA 2A4TA 2BQCA 3SN6R 4J0LA 1A4VA 1LJ3A 1DYEA 1GF6A 1GEVA 4YXCA 1JWRA 1REXA 2XBRA 3M3UA 1L87A 2D4IA 1YAPA 134LA 1B7QA 4I7JA 127LA 2B75A 4GCDA 1LHMA 4HPEA 4DWXA 158LA 1UIEA 3GUMA 2B70A 1L77A 1I1ZA 1LI3A 4H91A 177LA 1XEPA 4HV2A 4CHXA 1LJHA 175LA 1LMQA 4LYBA 239LA 4NSJA 1OUDA 3LYZA 1L65A 1XEKA 1IWVA 1LSBA 4HPIA 1WQNA 2H5ZA 1BB3A 1LKSA 2CDSA 1CKHA 5LZMA 1JTMA 5HQ1A 3HWLA 3OK0A 5KXWA 1RJCB 1BB4A 205LA 1L11A 2OTYX 4DQJA 4PGJB 1JTOL 2ZYPA 3FADA 4R0FA 1BB6A 1D0MA 1L13A 1C6PA 1LZ9A 3CDQA 2YSSC 2EIZC 1CX6A 3VW7A 1G7HC 1GFTA 3TXDA 3W6CA 1C6GA 4W56A 1LPYA 2YBNA 111LA 161LA 1QTEA 1C45A 4IJ4A 5F9XA 1IP2A 1JJ3A 162LA 3A6CY 2HEAA 1F0WA 4NHTA 3A93A 2HEBA 3GUJA 3FA0A 3WMKA 207LA 1CKCA 3HU9A 1GFEA 1XSFA 2RB1X 4OWHA 3G3WA 1N4FA 1XGTC 5LYTA 5LIOA 1C10A 146LA 4EPIA 4EXMA 3AGIA 2B73A 3CT0A 2O4WA 4CFOA 3RU5A 1XFPL 3D3DA 2RAZX 256LA 3RW8A 4IASA 2HUKA 2HU1A 5LVGA 155LA 4H94A 4DKLA 2W1LA 1L62A 5AMYA 3RT5X 1BWIA 5E4PA 1OQMA 244LA 1QT5A 1OUBA 118LA 2G4QA 190LA 1KXWA 1LAAA 1LTMA 1SX2A 114LA 2BQEA 2DQJY 1B2KA 5D5FA 1GWDA 1C64A 168LA 1GBYA 3CT1A 220LA 4U3XB 2XQOA 253LA 2H9JA 1L59A 1VDTA 1KIRC 260LA 1L04A 2BAAA 1L82A 1LZSA 1OUJA 1NBZC 3A90A 2B6YA 1C6DA 1LYFA 3L64A 145LA 4N9RA 4XJFA 3LYMA 1TEWA 1WTMA 4HTQA 1JJ1A 1PQKA 1HEPA 1L28A 4TSBA 4DYGA 254LA 1QDTA 1QTBA 1GB9A 3SB8A 4NSIA 3PDSA 1D2WA 1LZNA 3HTBA 1LOZA 1CV6A 4I7RA 3JR6A 3EXDA 4H93A 1L02A 1I56A 214LA 1HENA 2RH1A 3DN1A 4GCBA 4ARJA 3KAMA 4J7VA 2ZNWY 3CDRA 157LA 1LYYA 1UC0A 2BQNA 2HEDA 1IX0A 4XN6A 1GF3A 2RB2X 1L42A 1C7PA 1KNIA 1L23A 1PQOA 5FHWA 227LA 2NWDX 1IEEA 5JENB 3C81A 7LYZA 1L30A 4E3UA 2I25L 2RAYX 1GB6A 1JITA 4W54A 4PJ2C 1WVVA 1LHHA 1LWGA 1KW7A 2B74A 2ZIJA 5I4XA 5B1GA 1LSZA 1YAOA 1HC0A 2LYMA 1OUGA 1ZURA 1CKDA 4HJZA 4YXAC 4KXIA 1ALCA 1L27A 1B7PA 1CJ8A 1JSEA 1JUGA 1L37A 3NYAA 1C6LA 1L70A 4OWAA 4RDSA 231LA 2ZIKA 1JQUA 2BPUA 3EBAB 4A7DA 2Q9DA 5A3EA 3TXEA 2GV0A 174LA 3A8ZA 3C7WA 3A6BY 4GLVA 1YKZX 2HUBA 181LA 1C08C 1JTPL 1JKBA 236LA 3HT8A 3RNXA 4GRVA 1HEQA 2DQGY 3WVXA 4BAFA 1UIGA 1OV7A 1GFRA 1CKGA 1LZAA 5LVIA 2N5ZA 4GN3A 1LSGA 1LYHA 1LYSA 1L79A 4I7MA 1NHEA 3N9EA 3DN0A 1C6EA 2DQIY 153LA 4W57A 1LGUA 6LYTA 4ZFPA 3TMWA 1LMTA 197LA 109LA 4WM1A 1L51A 2YVBA 4NSHA 4PRQA 259LA 1LZDA 1IC4Y 2ZQ3A 4ARQA 1L75A 142LA 3GUOA 5I14A 3GUKA 4MR1A 1C6KA 1DI5A 2HECA 1G7JC 1SQ2L 1J1PY 2W1MA 5DM9A 1UUZC 1NDMC 1NWGA 2BQFA 1L90A 2MEGA 3J6KA 3C7YA 1L01A 4J1AA 3WU9A 3P65A 1YQVY 1C69A 4G4HA 4PK0A 5KXMA 1UACY 3HFMY 3GXKA 1GFUA 1FLYA 1E8LA 1L67A 4UWVA 1CVKA 4NGVA 3MGWA 1DPWA 1HNLA 1LJIA 1LZEA 4H9AA 167LA 3P66A 3RZEA 4XJDA 3TMVA 1RI8B 1QSQA 1P46A 147LA 4S0WA 209LA 4M4OA 1TAYA 1T3PA 4LZTA 3HH3A 3C8QA 5LXWA 1LZTA 1DYCA 217LA 4ARMB 4HSFA 4IAPA 1LYGA 4OWEA 5HNLA 1F6RA 211LA 3WL2A 1LLHA 1NMMA 4NY5A 2HEEA 1L18A 1P64A 186LA 2B6ZA 4YEMA 4N1CC 4WLYA 2BLXA 112LA 1LYEA 3GUIA 1L39A 1YILA 1IWWA 1PQIA 1DXJA 1L22A 1XJTA 1IWXA 5EBHA 4AGAA 3QY4A 4TWSA 2DQDY 5KXPA 1HEWA 3GXRA 2ANXA 4W51A 2RBNA 4EMNA 1REZA 234LA 1F6SA 4LYTA 2HEFA 5KXRA 4WM5A 1CV0A 1L19A 4OW1A 8LYZA 1L68A 2A7FA 4GCEA 4TSCA 1LZRA 173LA 4RLNA 4LDLA 1WQMA 4Z98A 1T8FA 1L12A 240LA 3C7ZA 3WXTA 3LHMA 2BLYA 1T97A 1C62A 2LZMA 133LA 3WW6A 1J1OY 2DQHY 1GB5A 1DKKA 1GFGA 4WG1A 1GPQC 1B5YA 1GXXA 122LA 5A3ZA 1QT8A 1GB7A 2Q9EA 1GE2A 1L74A 4N8ZA 1GHLA 4Z41A 1L55A 4DJHA 4NGWA 5B07A 3AZ6A 1CUPA 3VWOA 3UONA 2F30A 230LA 1TDYA 4I7LA 1C60A 1QIOA 1NHBA 1UIDA 119LA 3CB7A 1HHLA 5HLLA 188LA 4DD1A 1GF4A 1HERA 3C82A 5F16A 148LE 3LYTA 4WM2A 1DQJC 4DQ7A 208LA 169LA 4NHIA 2Z39A 1YAQA 1XGRC 1B9OA 3OE9A 3C83A 1FLUA 3AYQA 4W52A 3SBAA 1V7SA 3BKVA 3K2RA 1C43A 4KL7A 1LSCA 262LA 2O79A 2B7XA 1HMLA 201LA 185LA 5IHGA 1C46A 2XJWA 1SX7A 3FI7A 1IP5A 1D3NA 250LA 3AGGG 4I7NA 132LA 1BB5A 2PC2A 4I7KA 3B6LA 1OP9B 4WL6A 4DD2A 180LA 3CQLA 1RFPA 2BQLA 4P2EA 5APDA 1JIYA 1H87A 216LA 3AB6A 4UWUA 1GF9A 1QTHA 215LA 1YAMA 1L52A 1L10A 4W59A 3FE0A 2Z38A 3B72A 3IJUA 1I6SA 1C61A 1DPXA 2EKSC 4EKPA 1P2RA 4NHSA 1L93A 2DKVA 4I8SA 1OWYA 255LA 1C6NA 4DQ5A 3P64A 1QQYA 3A95A 1VEDA 4GN4A 3EMSA 3WUAA 1LPIA 1GBWA 2Z12A 1HEOA 176LA 1JSFA 1AZFA 3HTGA 2RB0X 1G0JA 1L26A 1B5ZA 1DI4A 1G1VA 1IWTA 1GAZA 4X3BA 5LA8A 2ANVA 5C6LA 3DKEX 3HBHA 3DN4A 2W1YA 1BB7A 3ATOA 1CTWA 2Z2EA 5C6IA 1L81A 4NHPA 2Z18A 4B49A 5LYMA 3SP3A 5KKJA 182LA 1B7LA 1P36A 2CJLA 1CKFA 4LT0A 4OWBA 3W3EA 1LJGA 3HH4A 5KKIA 1D3JA 4WM6A 2OE9X 3P4ZA 4W53A 1IOTA 4ANRA 2ZQ4A 2DQCY 4H9IA 1Z55A 3WUNA 1XGUC 2Y8PA 1L08A 1GFKA 2LYOA 1D3MA 1QSAA 4NEBA 5FCPA 2IGCA 4L41A 1T8AA 226LA 242LA 4ET9A 2LHMA 1QT3A 5DL9A 1OUAA 1NQIA 1GB2A 1CU0A 2MECA 4LT1A 2DQFC 1NF5A 4NFVA 1L86A 1L47A 3B0OA 4XJGA 5KXZA 1AT6A 1IP1A 4PHIA 5J7CA 1P5CA 3SB6A 1JKAA 3AZ5A 1L46A 1CX7A 5L3IA 1VFBC 1C6IA 126LA 198LA 1LJ4A 4GN5C 1C66A 5ILFA 171LA 5FEKA 3WU7A 1LZ6A 237LA 3OE6A 4WMGA 4YF2A 1AM7A 3J4GA 4LYZA 4WG7A 165LA 1L17A 5FELA 1GDWA 1LYDA 1WTHA 1QTVA 2Z37A 3CT5A 1VDPA 2BQMA 1LSNA 3QAKA 4CGEA 3PBLA 1ZYTA 4PJZA 1L61A 1B7RA 4H8ZA 1G1WA 5F81A 4GCFA 5HNCA 3GUPA 1ZWNA 4LFXA 144LA 194LA 159LA 4B0DA 115LA 1C6CA 4ETEA 4B4EA 4W58A 5I4WA 3DMZA 1L15A 1L25A 1GBZA 2HU3A 1IY3A 1JTTL 3G3BB 3C8RA 1CU3A 1D9UA 4BADA 1LHIA 2F2NA 5I5QA 1GD6A 1OUCA 3W6FA 3D4SA 1CNSA 3T36A 3D9AC 1ZVYB 3TXHA 1C67A 4N1EI 1OYUA 4H9HA 223LA 5APCA 3SB9A 4WM3A 2BQIA 2OTZX 1L54A 1LI6A 4YENA 5L3HA 1FKVA 1TLAA 3HDEA 3WPJA 1UCOA 1WQRA 3OJPA 4W94A 1L44A 1L06A 1KIPC 164LA 213LA 4I7PA 4Z3MA 3F8VA 1EPYA 1LMNA 2MEFA 2G4PA 4RLMA 1AKIA 5KXTA 2X0AA 2BQOA 3AGHA 4HJYA 2RBRA 1WVUA 1DYGA 1GE0A 4HTNA 4YEOA 4DAJA 1L49A 1T6VL 1W08A 1W6ZA 4Z46A 2Q0MX 3ULRA 1LCNA 4LDEA 1C68A 3WXUA 5D5CA 241LA 1G7MC 4OOTA 1IY4A 1PQJA 1LYIA 2LZ2A 156LA 4H8XA 1JEFA 4FJRA 2CUUA 1IWUA 5F9UA 2RBQA 235LA 4NG1A 2BQJA 3A34A 4NGOA 1NBYC 4YOPA 4WM4A 1GDXA 1T6HA 1YANA 1LHKA 1CJ9A 1D3FA 1PZYA 243LA 3LYOA 1L0KA 1UIAA 3LZ2A 2YBJA 3LN2A 1SWZA 5LA5A 2F32A 110LA 1T8GA 1C6FA 1FBIX 107LA 154LA 1HSXA 1L32A 140LA 1MELL 3SB5A 3ZVQA 1FDLY 2BQKA 2HULA 104LA 1L88A 1B7SA 3C8SA 1DYAA 3WPKA 4GLAA 2LC9A 5LAGA 1L64A 2O7AA 1G0MA 1L97A 4LFPA 4ETBA 3OE8A 1LJFA 3T6UA 1L40A 1LGXA 3DN6A 5C6JA 4WO6A 1XEIA 1BQLY 5IDDA 1L69A 5B05A 3A67Y 1LZ8A 3V2YA 1LW9A 3TXBA 1GFAA 1PQMA 4I7OA 1LJEA 4DD7A 1LZBA 3EO5A 3CSQA 1LSEA 3GUNA 1B5UA 4HV1A 2BQHA 4W96A 2LYZA 4G49A 2I6ZA 3A92A 4EOFA 1IO5A 1KXXA 1L21A 2F47A 4KT3A 4XJBA 4N0JA 2H9KA 4B4JA 218LA 1IOSA 125LA 1IC7Y 4WLXA 1LSYA 1KS3A 3L2XA 1P37A 5B06A 4MCKA 2MEBA 5LYZA 1D9WA 261LA 4II8A 1O23A 1OVJA 4OOOA 3TXGA 2IHLA 2VB1A 4G4CA 1IORA 4UWNA 5HMJA 1D2YA 1C6BA 3WUMA 1GE4A 238LA 1L43A 3HBEX 5B59A 3W6BA 2LZTA 2ZWBA 2W1XA 1OVHA 2QB0B 4E97A 152LA 1P7SA 2YBMA 2C8OA 4EPFA 5FSTA 4WLTA 1L98A 1FLQA 4YX7C 3A96A 2B72A 1LSDA 5LINA 4ARQB 3A94A 4ZPUA 1PQDA 1LYZA 3WH1A 1IP4A 1AT5A 1IVMA 4H8YA 5I53A 1LYOA 1B6IA 2FYCA 4WL7A 4ARPA 2BQGA 1D6PA 1ZV5L 1JHLA 5LVHA 4GCCA 4TUNA 1GF7A 3LZMA 1L36A 1LSFA 1L57A 2D6BA 130LA 4B1AA 4K5YA 4H9BA 4QY9A 4LGKA 4XADA 4KPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJH A;  3ATO A;  5APE A;  2CWI A;  2MEH A;  1FN5 A;  2Z2E A;  1RCM A;  1IEE A;  3BKH A;  5C6I A;  3W6E A;  7LYZ A;  4NHP A;  1DZB X;  5JEN B;  1LMP A;  3N9C A;  5KXK A;  4E3U A;  2I25 L;  1GB6 A;  1IR7 A;  2Z18 A;  4B49 A;  4ETA A;  3SP3 A;  5LYM A;  1JIT A;  4J1B A;  5KKJ A;  1B7L A;  1PS5 A;  4PJ2 C;  4HP0 A;  1WVV A;  4WLD A;  1B0D A;  1LHH A;  4OWB A;  2CJL A;  1CKF A;  4LT0 A;  3W3E A;  2MED A;  1LJG A;  1HSW A;  4H9C A;  4O34 A;  2ZIJ A;  5I4X A;  5B1G A;  1WQQ A;  1LSZ A;  1YAO A;  3A91 A;  5KKI A;  1HC0 A;  2LYM A;  4NGY A;  1OUG A;  5T3F A;  4R6C A;  4WM6 A;  1VAU A;  4XJI A;  3P4Z A;  1IOT A;  4ANR A;  2ZQ4 A;  1CKD A;  2DQC Y;  4H9I A;  4HJZ A;  1BWH A;  1XEJ A;  1Z55 A;  1OUE A;  4KXI A;  4DD9 A;  1ALC A;  1HFY A;  3WUN A;  1XGU C;  2Y8P A;  1B7P A;  1CJ8 A;  4NIJ A;  2IFF Y;  3E3D A;  1JSE A;  1GFK A;  1JUG A;  5ILC A;  2LYO A;  4LYO A;  3G3A B;  1QSA A;  4NEB A;  4ZIX A;  4OWA A;  4RDS A;  5FCP A;  1IC5 Y;  2ZIK A;  2BPU A;  4L41 A;  6LYZ A;  1GF0 A;  1XGP C;  3EBA B;  4H90 A;  5M1Y A;  4A7D A;  1LMA A;  1GEZ A;  1RE2 A;  1GXV 2;  2DQE Y;  1B5V A;  5A3E A;  5KXS A;  3TXE A;  2GV0 A;  4NGK A;  3A8Z A;  1V7T A;  4ET9 A;  3A6B Y;  2LHM A;  4LT2 A;  5DL9 A;  1OUA A;  4GLV A;  1JJ0 A;  1NQI A;  1YKZ X;  4H9F A;  1GB2 A;  2B5Z A;  4LT1 A;  2MEC A;  2DQF C;  1SLY A;  1NF5 A;  2HUB A;  1C08 C;  3AZ4 A;  4NFV A;  4WOA A;  4CFP A;  1JTP L;  4M6D A;  1JKB A;  3ZEK A;  3B0O A;  4XJG A;  5KXZ A;  1AT6 A;  1IP1 A;  3RNX A;  1VAT A;  4PHI A;  5J7C A;  1D6Q A;  1HEQ A;  1XGQ C;  1P2C C;  2D91 A;  2DQG Y;  4NGI A;  3WVX A;  1GB3 A;  1JKA A;  1YKX X;  3AZ5 A;  1YL0 X;  1HEL A;  4BAF A;  1UIG A;  5L3I A;  1GFR A;  1CKG A;  1LZA A;  1VFB C;  1WQO A;  5LVI A;  5KXY A;  3F6Z A;  1ZMY L;  2N5Z A;  2YBL A;  4GN3 A;  1LSG A;  2BQA A;  4NWH A;  2FBD A;  1QUS A;  4H9E A;  1LYS A;  1B5W A;  1LJ4 A;  1YL1 X;  4GN5 C;  1NHE A;  3TXF A;  5ILF A;  1FLW A;  1REY A;  3N9E A;  5FEK A;  3WU7 A;  3WW5 A;  1LZ6 A;  1UIH A;  2DQI Y;  5DLA A;  4WMG A;  4YF2 A;  1UIF A;  153L A;  1LJJ A;  4YM8 A;  1AM7 A;  1I20 A;  3J4G A;  4LYZ A;  2BQB A;  5I54 A;  4NGL A;  1GFH A;  6LYT A;  4ZFP A;  1IP7 A;  3TMW A;  1LMT A;  2ZIL A;  3W6D A;  4WG7 A;  1HFX A;  3AJN A;  4WM1 A;  4HTK A;  2YVB A;  3B0I A;  4NSH A;  3A3Q A;  4PRQ A;  1EQ5 A;  3TXI A;  9LYZ A;  1LZD A;  4OWC A;  1IR8 A;  2HTX A;  1IC4 Y;  5FEL A;  2ZQ3 A;  1GDW A;  4LT3 A;  2CGI A;  1F10 A;  1LZY A;  1JKC A;  2C8P A;  5K7O A;  1IWY A;  2Z37 A;  3CT5 A;  1VDP A;  5I4Y A;  1IWZ A;  1LMC A;  4MR1 A;  2BQM A;  1DI5 A;  1EL1 A;  1LSN A;  1G7J C;  2HEC A;  4CGE A;  4DD0 A;  1SQ2 L;  1J1P Y;  3B0K A;  2D4K A;  4QDN A;  2W1M A;  1LJN A;  5DM9 A;  1BGI A;  2ZYC A;  1VDQ A;  2F4A A;  1IP3 A;  1D0K A;  1B7R A;  4BAP A;  1LSA A;  1HFZ A;  1UUZ C;  3IWR A;  2MEI A;  1NDM C;  1NWG A;  4H8Z A;  2BQF A;  3TMX A;  1GF5 A;  2MEG A;  1JKD A;  2YBI A;  3J6K A;  5F81 A;  4BS7 A;  4GCF A;  1YKY X;  3WU9 A;  4J1A A;  4ET8 A;  5HNC A;  1GE3 A;  3P65 A;  1YQV Y;  4G4H A;  4LYM A;  5FDJ A;  4AXT A;  5KXM A;  1IOC A;  1LZG A;  4LFX A;  194L A;  1UAC Y;  3HFM Y;  1LJK A;  135L A;  5KXX A;  4B0D A;  3GXK A;  4FDY A;  1GFU A;  1FLY A;  2EQL A;  1QTK A;  1E8L A;  1MLC E;  1UA6 Y;  1LKR A;  5F14 A;  3ZVQ B;  1OUI A;  4ETE A;  4UWV A;  4NGJ A;  3K3T A;  3M18 B;  4D9Z A;  4NGV A;  4B4E A;  4NSG A;  3MGW A;  1GB0 A;  3TXJ A;  3RZ4 A;  1B7O A;  5I4W A;  1DPW A;  1GBZ A;  2HU3 A;  1HNL A;  1LJI A;  1QSW A;  1IY3 A;  1LZE A;  1JTT L;  4H9A A;  3P66 A;  4XJD A;  3G3B B;  4QGZ A;  3TMV A;  1RI8 B;  1BVX A;  1D9U A;  4BAD A;  1LHI A;  2F2N A;  4QEQ A;  1LMO A;  5I5Q A;  1A2Y C;  1GD6 A;  4M4O A;  1TAY A;  1OUC A;  3W6F A;  1TCY A;  1CNS A;  1T3P A;  1LHL A;  4PRU A;  1CJ6 A;  3T36 A;  4LZT A;  3D9A C;  5LXW A;  1BVK C;  1LZT A;  2G4N A;  5DN4 A;  1WTN A;  1CJ7 A;  1G7L C;  2XBS A;  1ZVY B;  1EQ4 A;  1GBO A;  3TXH A;  5HMV A;  1HMK A;  4HJV A;  3ATN A;  4N1E I;  4H9H A;  4DD3 A;  4TTD A;  4H1P A;  4HSF A;  5APC A;  1G7I C;  4OWE A;  4WM3 A;  2BQI A;  4XEN A;  5HNL A;  5LVK A;  4MST A;  1LSP A;  1F6R A;  3WL2 A;  1UIB A;  3AW7 A;  4H92 A;  2Z19 A;  4TX7 A;  3WU8 A;  1NMM A;  1LZ4 A;  1NDG C;  1GE1 A;  4NY5 A;  2A7D A;  2HEE A;  2WAR A;  4YEN A;  5L3H A;  3WPL A;  1FKV A;  1TBY A;  4IAT A;  4YEM A;  4N1C C;  4WLY A;  3WPJ A;  193L A;  3QNG A;  1UCO A;  2BLX A;  1WQR A;  3OJP A;  4Z46 A;  4W94 A;  1GBX A;  1KIP C;  4NHQ A;  2BQC A;  1YIL A;  1IWW A;  4J0L A;  1DXJ A;  1A4V A;  1VDS A;  4Z3M A;  1IWX A;  5EBH A;  1LJ3 A;  1LMN A;  2MEF A;  3QY4 A;  2G4P A;  4RLM A;  4AGA A;  1AKI A;  1GF6 A;  3N9A A;  1GEV A;  4TWS A;  5KXT A;  2DQD Y;  1HF4 A;  2XTH A;  1JWR A;  2X0A A;  2BQO A;  5KXP A;  3AGH A;  4HJY A;  1HEW A;  1REX A;  1WVU A;  2XBR A;  3GXR A;  3CSR A;  3M3U A;  2D4I A;  1YAP A;  1GE0 A;  4HTN A;  4YEO A;  1GF8 A;  1T6V L;  1W08 A;  1W6Z A;  134L A;  4I0C A;  4NGZ A;  4DT3 A;  4EMN A;  1GB8 A;  2Q0M X;  3ULR A;  1B7Q A;  1LCN A;  1REZ A;  3QE8 A;  1F6S A;  4DDB A;  3WXU A;  1B5X A;  4GCD A;  4LYT A;  2HEF A;  5KXR A;  4WM5 A;  1UBZ A;  1LHM A;  4G9S A;  4HPE A;  5D5C A;  5KJ9 A;  4DDC A;  4DWX A;  1G7M C;  4OOT A;  1YRO A;  1UIE A;  1IY4 A;  4OW1 A;  8LYZ A;  2A7F A;  1LZC A;  3AZ7 A;  1I1Z A;  4GCE A;  4H91 A;  2LZ2 A;  4TSC A;  4HV2 A;  1LSM A;  4H8X A;  1JEF A;  4FJR A;  4CHX A;  1LJH A;  1LZR A;  1IWU A;  5KXO A;  4RLN A;  5F9U A;  4NG1 A;  1BWJ A;  1WQM A;  4Z98 A;  1LMQ A;  2BQJ A;  3A34 A;  4LYB A;  3WYH A;  4NGO A;  1NBY C;  3WXT A;  4NSJ A;  2AUB A;  4YOP A;  1OUD A;  3LYZ A;  5L9J A;  3LHM A;  2BLY A;  4WM4 A;  5APF A;  1GDX A;  1XEK A;  1IWV A;  133L A;  3WW6 A;  4RW2 A;  1LSB A;  1YAN A;  1LHK A;  1J1O Y;  4HPI A;  1CJ9 A;  1WQN A;  2H5Z A;  1PZY A;  3LYO A;  2DQH Y;  1UIA A;  1GB5 A;  1BB3 A;  1LKS A;  2YBJ A;  3LZ2 A;  2CDS A;  1CKH A;  3LN2 A;  5LA5 A;  1DKK A;  5HQ1 A;  1GFG A;  4WG1 A;  3OK0 A;  1FBI X;  1GPQ C;  1B5Y A;  5KXW A;  1GXX A;  1HSX A;  4C3W A;  154L A;  1RJC B;  1DKJ A;  5A3Z A;  1BB4 A;  1GB7 A;  1MEL L;  1GE2 A;  1J1X Y;  1GFJ A;  4PGJ B;  1EQE A;  1JTO L;  2FYD A;  4N8Z A;  1B7N A;  2ZYP A;  4R0F A;  1GHL A;  1BB6 A;  3ZVQ A;  4Z41 A;  1FDL Y;  2BQK A;  2RSC A;  5KXN A;  1D0M A;  4NGW A;  5B07 A;  3AZ6 A;  1B7S A;  1LZ9 A;  2YDG A;  3VWO A;  2YSS C;  2EIZ C;  4ETD A;  2F30 A;  3WPK A;  4GLA A;  1TDY A;  1G7H C;  1JIS A;  5LAG A;  1GFT A;  1QIO A;  1YIK A;  1ZVH L;  2I26 L;  1BHZ A;  5E9R A;  3TXD A;  1UID A;  3CB7 A;  1HHL A;  3P68 A;  3TMU A;  3W6C A;  5HLL A;  4CJ2 A;  2MEE A;  4DD1 A;  1GF4 A;  2DQA A;  4LFP A;  4ETB A;  1HER A;  1LJF A;  2YBN A;  3T6U A;  1QTE A;  1C45 A;  5F16 A;  4IJ4 A;  5F9X A;  3LYT A;  5C6J A;  1IP2 A;  1JJ3 A;  4WM2 A;  4G4B A;  4WO6 A;  1XEI A;  1DQJ C;  2HEA A;  3A6C Y;  4DDA A;  1F0W A;  1BQL Y;  5IDD A;  1REM A;  4NHT A;  3A93 A;  1OUF A;  208L A;  2HEB A;  4NHI A;  5B05 A;  4N5R A;  3A67 Y;  2Z39 A;  3WMK A;  1LZ8 A;  1YAQ A;  207L A;  1XGR C;  1CKC A;  5B1F A;  1B9O A;  3TXB A;  3IJV A;  1FLU A;  1GFA A;  1GFE A;  1XSF A;  3AYQ A;  1V7S A;  3BKV A;  4OWH A;  1B7M A;  1HEM A;  1LJE A;  1N4F A;  4DD7 A;  1LZB A;  3EO5 A;  3CSQ A;  1C43 A;  1LSE A;  1XGT C;  4KL7 A;  5LYT A;  1LSC A;  1B5U A;  5LIO A;  1C10 A;  4HV1 A;  2BQH A;  3AGI A;  2ZNX Y;  1HML A;  1KIQ C;  2LYZ A;  4W96 A;  3CT0 A;  4G49 A;  4CFO A;  2I6Z A;  5IHG A;  4ML7 A;  1C46 A;  3RU5 A;  1XFP L;  3D3D A;  2XJW A;  1UIC A;  3A92 A;  1LZ5 A;  3FI7 A;  3RW8 A;  1IP5 A;  4IAS A;  4EOF A;  1IO5 A;  3AW6 A;  1KXX A;  2HU1 A;  3AGG G;  2F4G A;  2YBH A;  5LVG A;  5II3 A;  4H94 A;  4PPO A;  132L A;  2BQD A;  2W1L A;  4KT3 A;  4XJB A;  1QUT A;  1BB5 A;  5AMY A;  3RT5 X;  4N0J A;  2H9K A;  2PC2 A;  1LZ1 A;  4B4J A;  1BWI A;  3B6L A;  5E4P A;  1OP9 B;  4WL6 A;  1OQM A;  4C5F A;  3A3R X;  1JPO A;  1IOS A;  4B4I A;  4DD2 A;  1OUB A;  2G4Q A;  5LVJ A;  1IC7 Y;  4WLX A;  1KXW A;  1LSY A;  2EPE A;  1LAA A;  1LTM A;  1DI3 A;  3CQL A;  5B06 A;  2BQE A;  2DQJ Y;  1B2K A;  5D5F A;  1GAY A;  1RFP A;  1GWD A;  2BQL A;  4MCK A;  4P2E A;  5APD A;  2MEB A;  3W6A A;  3TXK A;  1JIY A;  1H87 A;  1H6M A;  5LYZ A;  1GFV A;  3AB6 A;  4UWU A;  1GBY A;  1GF9 A;  3CT1 A;  1D0L A;  4U3X B;  5IEL A;  1YAM A;  4WO9 A;  2H9J A;  4II8 A;  1O23 A;  3FE0 A;  2Z38 A;  1VDT A;  3B72 A;  4LGK A;  1FKQ A;  1KIR C;  2IHL A;  2VB1 A;  3IJU A;  4G4C A;  4NWE A;  4OOO A;  3TXG A;  1IOR A;  4UWN A;  1IR9 A;  5HMJ A;  4ZEE A;  1GBS A;  1DPX A;  2BAA A;  2EKS C;  1QDR A;  4NHS A;  3WUM A;  3HBD A;  1LZS A;  1OUJ A;  3CSZ A;  1GE4 A;  2DKV A;  1NBZ C;  3A90 A;  3HBE X;  3WVY A;  5B59 A;  3W6B A;  1NKH A;  4I8S A;  2LZT A;  4XJF A;  4N9R A;  1IOQ A;  3LYM A;  2ZWB A;  1KXY A;  2W1X A;  4RW1 A;  1TEW A;  1WTM A;  3P64 A;  5KY1 A;  4HTQ A;  1WQP A;  2YBM A;  1JJ1 A;  1HEP A;  1QQY A;  3A95 A;  2C8O A;  4TSB A;  5LAF A;  5KXL A;  4DYG A;  1VED A;  5FST A;  4WLT A;  4GN4 A;  3EMS A;  1QDT A;  2DBT A;  3WUA A;  1FLQ A;  4XYY A;  1LPI A;  1GB9 A;  1GBW A;  3A96 A;  4NSI A;  3WUL A;  2Z12 A;  1LSD A;  1HEO A;  5LIN A;  1LZN A;  3A94 A;  2MEA A;  1JSF A;  1AZF A;  1LOZ A;  1LYZ A;  4DC4 A;  3WH1 A;  1IP4 A;  1AT5 A;  4ETC A;  1IVM A;  4H93 A;  3EXD A;  4H8Y A;  5I53 A;  1I56 A;  2D4J A;  5DN5 A;  1HEN A;  1LYO A;  2Z2F A;  4GCB A;  2FYC A;  3KAM A;  4NG8 A;  4WL7 A;  4J7V A;  2BQG A;  1B5Z A;  2ZNW Y;  1D6P A;  2FBB A;  1DI4 A;  1ZV5 L;  3LZT A;  1IWT A;  1JHL A;  1GAZ A;  5LVH A;  4GCC A;  1LYY A;  4TUN A;  4X3B A;  1GF7 A;  1IP6 A;  5LA8 A;  1UC0 A;  1LSF A;  2BQN A;  2D6B A;  5C6L A;  3HBH A;  2HED A;  1IX0 A;  1LHJ A;  4XN6 A;  1GF3 A;  1INU A;  1C7P A;  1OUH A;  4XAD A;  1IIZ A;  4B1A A;  4LYC A;  4H9B A;  4QY9 A;  5FHW A;  2W1Y A;  1BB7 A;  2NWD X;  4KPM A; 
#chains in the Genus database with same CATH topology
 5APE A;  139L A;  2CWI A;  4EJ4 A;  4GMQ A;  1FN5 A;  1SWY A;  3BKH A;  1X37 A;  1CU2 A;  3W6E A;  113L A;  1DZB X;  1C6Q A;  183L A;  1LMP A;  3N9C A;  1IR7 A;  2NTG A;  4ETA A;  3U61 B;  224L A;  5A2Q S;  195L A;  4HP0 A;  1L05 A;  3U60 A;  1L09 A;  1HSW A;  4O34 A;  3LVW A;  1L38 A;  1LI2 A;  3A91 A;  5T3F A;  257L A;  1QT6 A;  258L A;  3IEC A;  4LJ6 A;  1DGF A;  4DD9 A;  4D80 A;  1HFY A;  1OV5 A;  3HH6 A;  2QHO B;  3HU8 A;  4NIJ A;  1E9S A;  2IFF Y;  3E3D A;  4QNR A;  3C80 A;  1F4I A;  246L A;  2CRU A;  4LYO A;  4PCZ A;  3CDV A;  3OTO M;  1IC5 Y;  2DHR A;  2MRO B;  1QT7 A;  4I81 A;  5M1Y A;  1CV4 A;  1S3S A;  3HKP A;  1GXV 2;  2DQE Y;  192L A;  245L A;  2FNA A;  3HT6 A;  8CAT A;  1V7T A;  4GIT A;  4LT2 A;  4MGI E;  1JJ0 A;  3HTD A;  138L A;  1KY0 A;  1G0P A;  3ZEK A;  2RBO A;  2F2Q A;  3CDO A;  1L03 A;  4IBD A;  4FCT A;  3AL0 C;  1CU5 A;  1VAT A;  102L A;  1D6Q A;  2D91 A;  1WGL A;  1P2C C;  1P2L A;  3F9L A;  4AG6 A;  3RUN A;  4D82 A;  4LF5 M;  3IG5 A;  221L A;  3QWL A;  1WQO A;  5KXY A;  2YBL A;  1TH4 A;  4NWH A;  4H9E A;  3SHF A;  1YL1 X;  4LJ9 A;  1REY A;  1UIH A;  1L63 A;  4W55 A;  2BQB A;  4NGL A;  1GFH A;  4L16 A;  2C96 A;  1IP7 A;  2R6F A;  2ZIL A;  3DN2 A;  1L16 A;  1L50 A;  2LNH C;  1OVK A;  1HFX A;  3RGP A;  143L A;  3T15 A;  1L66 A;  2UU9 M;  9LYZ A;  3A3Q A;  1EQ5 A;  3TXI A;  4YY3 M;  1SSW A;  1OFH A;  1IR8 A;  2RBP A;  3E4R A;  4DV4 M;  178L A;  1L96 A;  247L A;  4LT3 A;  1Q39 A;  2CGI A;  2LVO C;  5ITX E;  1F10 A;  1LZY A;  3GLG A;  5K7O A;  1IWY A;  1QT4 A;  5I4Y A;  1LMC A;  3FUU A;  1C6T A;  3PVS A;  1CUQ A;  1EL1 A;  1L0J A;  4DD0 A;  3HJS A;  2Z6B A;  2F4V M;  4QDN A;  1VEK A;  1BGI A;  3SYL A;  249L A;  4OO9 A;  2DAG A;  2LH0 A;  103L A;  1HFZ A;  1LSA A;  3JR4 A;  2RBS A;  2MEI A;  3TMX A;  1GF5 A;  1JB0 F;  3L27 A;  1OQY A;  1JKD A;  2YBI A;  5DYG A;  2NQ8 C;  4BS7 A;  1YKY X;  4ET8 A;  1GE3 A;  4AXT A;  5FDJ A;  2ZTC A;  1L31 A;  1IOC A;  1WIV A;  4CHT B;  1LJK A;  2EQL A;  3WHL A;  1QTK A;  1QUO A;  1MLC E;  1UA6 Y;  1LKR A;  2R4J A;  1IFY A;  1OUI A;  5ITY A;  3QYE A;  4NGJ A;  3J2P B;  2RRU A;  229L A;  2CHG A;  1L73 A;  3RZ4 A;  2BWB A;  1C65 A;  1L94 A;  251L A;  1QSW A;  3NY9 A;  2MJ5 B;  3SAR A;  1R2Y A;  170L A;  3GP1 A;  1BVX A;  2C99 A;  4QEQ A;  1LMO A;  3C3D A;  1L34 A;  1A2Y C;  4LDO A;  3U6E A;  3GUL A;  1LHL A;  2EA0 A;  1CJ6 A;  2L09 A;  2HWJ A;  1QUD A;  1WTN A;  1CJ7 A;  2XBS A;  1GBO A;  2WZJ A;  3ATN A;  2VF7 A;  1LWK A;  4DD3 A;  4TTD A;  1G71 A;  1G41 A;  2LHG A;  5LVK A;  4DV3 M;  1LSP A;  4KLN A;  1P3N A;  1UIB A;  3AW7 A;  3VLF B;  2Z19 A;  4H92 A;  1L14 A;  1LZ4 A;  1GE1 A;  1NY5 A;  3LCU A;  1KSF X;  2BNK A;  5DNY A;  1L24 A;  2A7D A;  3HUA A;  3WPL A;  1NSF A;  4IAT A;  4AG5 A;  5FLX S;  193L A;  1L20 A;  3R8F A;  3H4J A;  2OQ4 A;  4FD2 A;  4NHQ A;  1IN4 A;  2OU0 X;  3A45 A;  3FYD A;  1VDS A;  1L48 A;  252L A;  4DR7 M;  1C6J A;  3N9A A;  4NC6 A;  4EIW A;  5C1B A;  1YUB A;  1HF4 A;  2XTH A;  2B6T A;  4M0W A;  2OE4 X;  2YR0 A;  248L A;  3CSR A;  4EKR A;  3FI5 A;  1GF8 A;  4I0C A;  4NGZ A;  4DT3 A;  1GB8 A;  4DDB A;  3QE8 A;  200L A;  4LJ7 A;  1B5X A;  1UBZ A;  4G9S A;  5KJ9 A;  1QTC A;  2QAR C;  1YRO A;  1LZC A;  2L78 A;  3AZ7 A;  4M0D A;  1EIJ A;  1L76 A;  1LSM A;  2XSZ D;  6LZM A;  2K0B X;  128L A;  3IHP A;  5KXO A;  4LF7 M;  199L A;  1BWJ A;  2ZBK B;  4B7F A;  3WYH A;  4I5S A;  2AUB A;  1L84 A;  2HCB A;  166L A;  5EQT A;  4ZPX A;  1UM8 A;  5L9J A;  1NJF A;  5FTJ A;  4LRS A;  2OOA A;  5APF A;  4RW2 A;  1V33 A;  172L A;  2OE7 X;  3HUK A;  4ITQ A;  4IBG A;  1KY1 A;  1QSB A;  4C3W A;  1P6Y A;  3DN8 A;  1DKJ A;  1CV1 A;  3DN3 A;  3G3X A;  120L A;  160L A;  196L A;  4DR6 M;  1J1X Y;  2CHQ A;  3B89 A;  1GFJ A;  3SBB C;  1EQE A;  1QTZ A;  2FYD A;  1L80 A;  1B7N A;  1L89 A;  3Q8X A;  5KXN A;  2RSC A;  3FUT A;  1CU6 A;  4F2L A;  2JY6 B;  1XJU A;  3HH5 A;  1IN7 A;  3U6O A;  2YDG A;  4ETD A;  1L92 A;  4M9Z A;  5IWA M;  1G06 A;  4LZM A;  1JIS A;  4AI6 A;  2D7G A;  1YIK A;  1ZVH L;  2I26 L;  3GLH B;  1BHZ A;  5E9R A;  3DMV A;  3B74 A;  3P68 A;  3TMU A;  4CJ2 A;  2MEE A;  2DQA A;  4B7G A;  191L A;  5EXP A;  2B6W A;  5EXT A;  1WR1 B;  4G4B A;  4DDA A;  4DV0 M;  1REM A;  1OUF A;  2W82 A;  5BPV A;  4N5R A;  2HUM A;  4ARM A;  3KSJ A;  5B1F A;  2G3Q A;  2G5G X;  3IJV A;  232L A;  1L53 A;  123L A;  1B7M A;  1NV9 A;  1HEM A;  1YE9 A;  4IJF A;  5DYI A;  2N35 A;  4AKH A;  3DNA A;  1I4W A;  189L A;  2ZNX Y;  1KIQ C;  2O5R A;  3T1H M;  4CJ6 A;  4ML7 A;  5KPR A;  1UIC A;  1LZ5 A;  1C63 A;  2OU9 A;  3AW6 A;  1LYJ A;  3GRR A;  4FCV A;  2F4G A;  2YBH A;  3B7N A;  5II3 A;  4PPO A;  4EKQ A;  3A42 A;  1G0Q A;  1SSY A;  5E6J A;  2BQD A;  1YLA A;  1DV0 A;  2OU8 A;  4P17 A;  1QUT A;  4DUZ M;  3HT9 A;  1CV3 A;  1LZ1 A;  2L7H A;  4C5F A;  1L85 A;  3A3R X;  7LZM A;  1JPO A;  3GRU A;  1LGW A;  4B4I A;  2L4E A;  1DYD A;  5LVJ A;  2EPE A;  5KPZ A;  1DGH A;  1DI3 A;  3NWL A;  4NRV A;  4TUW A;  1GAY A;  3GRY A;  4REZ A;  3W6A A;  3TXK A;  4CGY B;  1H6M A;  2CE7 A;  3GPU A;  1GFV A;  3FKE A;  1D0L A;  1FJG M;  3VDU A;  5IEL A;  2KDL A;  1GVN A;  3W0L B;  151L A;  4WO9 A;  1SXJ A;  1QS5 A;  2M60 A;  1FKQ A;  141L A;  4NWE A;  1QUH A;  1IR9 A;  4ZEE A;  1GBS A;  1IBL M;  1C6A A;  1QDR A;  3CDT A;  3HBD A;  3CSZ A;  3AV0 A;  2QBY B;  4AKI A;  3WVY A;  1NKH A;  1L99 A;  2JZ0 A;  1K3W A;  4L6V 6;  1IOQ A;  4RW1 A;  1KXY A;  1HT2 E;  206L A;  5KY1 A;  1Y8G A;  1WQP A;  1K28 A;  3M7G A;  5LAF A;  3HDF A;  5KXL A;  1T6O A;  1L00 A;  2DBT A;  4XYY A;  3WUL A;  1L56 A;  3HZJ A;  4LF8 M;  2MEA A;  2YQZ A;  1WJ7 A;  1L95 A;  225L A;  1L07 A;  4DC4 A;  4PD2 A;  4ETC A;  163L A;  3M6A A;  2D4J A;  4GBR B;  5DN5 A;  2Z2F A;  4NG8 A;  1L72 A;  3HTF A;  2YNM D;  2FBB A;  3LZT A;  1J09 A;  5EJC A;  1IP6 A;  4AZF A;  1LHJ A;  3AJI B;  4QOZ C;  1INU A;  1OUH A;  3ILK A;  1IIZ A;  3DMX A;  4LYC A;  4M6D A;  4DDC A;  1G0G A;  4XJH A;  2MEH A;  1L29 A;  1RCM A;  3K9P A;  2ZAN A;  5KXK A;  3GLF B;  2RGO A;  3HUQ A;  4J1B A;  4ARL A;  2L6O A;  1PS5 A;  4WLD A;  1QS9 A;  1B0D A;  1FNN A;  1L2B A;  2MED A;  5IRE B;  4DR2 M;  4H9C A;  3HT7 A;  1CV5 A;  1WQQ A;  4FVM A;  4NGY A;  210L A;  4AQN A;  4R6C A;  2ERC A;  1VAU A;  4XJI A;  3C58 A;  4KOD A;  1BWH A;  1XEJ A;  129L A;  1L83 A;  1OUE A;  1G0K A;  4B3S M;  4PDI A;  1C6H A;  4HL4 A;  3GQ5 A;  5ILC A;  3G3A B;  4I7S A;  4ZIX A;  149L A;  3K2L A;  1G0L A;  4I7Q A;  6LYZ A;  1GF0 A;  1XGP C;  4H90 A;  1LMA A;  1GEZ A;  1RE2 A;  1XMQ M;  4PT5 A;  1L35 A;  1L45 A;  1B5V A;  5KXS A;  1IXS B;  4NGK A;  1QTD A;  2DWN A;  3KS8 A;  4LFB M;  1L91 A;  4H9F A;  131L A;  2B5Z A;  2X49 A;  3ODU A;  2KEB A;  3UJN A;  1SLY A;  4CFP A;  3AZ4 A;  4WOA A;  2JXN A;  1RU3 A;  1KW5 A;  1C6M A;  1JTN A;  2R18 A;  1L41 A;  3QAU A;  3KW6 A;  1XGQ C;  4NGI A;  3E21 A;  1GB3 A;  1OIZ A;  4QNM A;  1YKX X;  2J7O A;  1YL0 X;  1HEL A;  3OE0 A;  1E32 A;  3F6Z A;  1ZMY L;  2BQA A;  2FBD A;  1QUS A;  1L60 A;  4DUY M;  1IQP A;  1B5W A;  3TXF A;  1IY2 A;  1FLW A;  3FTC A;  3WW5 A;  2R45 A;  5C18 A;  4X66 M;  2NTH A;  5DLA A;  4M9X A;  3F92 A;  1UIF A;  1LJJ A;  4YM8 A;  1L71 A;  1I20 A;  5I54 A;  1A5T A;  1HQC A;  3W6D A;  1W5T A;  2XGN A;  3AJN A;  4HTK A;  3B0I A;  2K47 A;  4OWC A;  1IY1 A;  1PRB A;  2HTX A;  3LQQ A;  2GNO A;  1KYI A;  150L A;  1L33 A;  5KO3 A;  1JKC A;  2C8P A;  137L A;  212L A;  1IWZ A;  3SFZ A;  4JI1 M;  1DYF A;  1QUG A;  3SMS A;  4EKS A;  4G4O A;  3B0K A;  184L A;  2D4K A;  3HHY A;  1LJN A;  2ZYC A;  1VDQ A;  2F4A A;  3NY8 A;  1IP3 A;  1D0K A;  1ZV1 A;  2MH8 A;  4BAP A;  3IWR A;  4I8O A;  2UUC M;  3GPX A;  1L58 A;  4LYM A;  1LZG A;  5KXX A;  135L A;  3V2W A;  4FDY A;  3G3V A;  2B6X A;  4Y28 F;  1P56 A;  5F14 A;  3ZVQ B;  2EJS A;  3K3T A;  219L A;  3M18 B;  4D9Z A;  4NSG A;  1GB0 A;  3TXJ A;  1TH2 A;  1B7O A;  2XFS A;  3SB7 A;  187L A;  3K8Z A;  2LVQ D;  3R9X B;  3D8B A;  4QGZ A;  3SAT A;  2OOB A;  1DYB A;  228L A;  1OWZ A;  233L A;  1TCY A;  4FCW A;  1G07 A;  4PRU A;  1BVS A;  1BVK C;  3JAM S;  2G4N A;  5DN4 A;  1G7L C;  1EQ4 A;  4G4R A;  5HMV A;  1HMK A;  4HJV A;  2OEA X;  222L A;  1GL6 A;  4H1P A;  4G4Q A;  4I7T A;  1G7I C;  3U6L A;  4XEN A;  4MST A;  3EML A;  5EP4 A;  4TX7 A;  3WU8 A;  4NL4 H;  108L A;  1NDG C;  2LCB A;  1W5S A;  2WAR A;  4AW4 A;  1TBY A;  1MN3 A;  2R62 A;  4LY6 A;  3QNG A;  2VF8 A;  2QCU A;  1GBX A;  2A4T A;  3LMM A;  2DI0 A;  3SMP A;  2EUC A;  2BQC A;  3SN6 R;  3K92 A;  4J0L A;  1A4V A;  2F5P A;  1LJ3 A;  1DYE A;  1GF6 A;  4NRW A;  1QAQ A;  1GEV A;  4YXC A;  1JQJ C;  1JWR A;  1G3I A;  1REX A;  2XBR A;  3M3U A;  1L87 A;  2D4I A;  1YAP A;  134L A;  3SAW A;  1B7Q A;  2DZO B;  4LGM A;  127L A;  4I7J A;  2B75 A;  4GRI A;  3AOE A;  4GCD A;  4XBO A;  1LHM A;  4HPE A;  3A98 B;  4DWX A;  158L A;  1UIE A;  3GUM A;  2GQF A;  2QQ8 A;  4P16 A;  2B70 A;  1L77 A;  4Z8X A;  1I1Z A;  1LI3 A;  4H91 A;  177L A;  1XEP A;  4HV2 A;  4CHX A;  1LJH A;  1GKI A;  3FRI A;  3IG8 A;  2KZS A;  1L8Q A;  2XEP A;  175L A;  3L2A A;  1LMQ A;  4LYB A;  239L A;  4NSJ A;  1OUD A;  2Y0T A;  3LYZ A;  1L65 A;  4R7G A;  1QYR A;  1XEK A;  4QHT A;  1IWV A;  5L8R F;  1LSB A;  2L7I A;  3GLF E;  4HPI A;  1WQN A;  2H5Z A;  4B3T M;  1VEJ A;  3TWM A;  4IBB A;  1BB3 A;  1LKS A;  4GH9 A;  2CDS A;  1CKH A;  3GLI A;  5LZM A;  3U6Q A;  1QZM A;  2JNH A;  1JTM A;  3HWL A;  1Q3C A;  2CHV A;  5HQ1 A;  3OK0 A;  5KXW A;  1RJC B;  4OW0 A;  1BB4 A;  205L A;  1L11 A;  2OTY X;  4DQJ A;  2DZN B;  4PGJ B;  1JTO L;  2ZYP A;  3FAD A;  1ZAE A;  4IBJ A;  4R0F A;  1BB6 A;  2LTU A;  3SC3 A;  3K1J A;  2UXB M;  1NO1 A;  1D0M A;  1L13 A;  4NOO B;  1C6P A;  1LZ9 A;  4GKJ M;  3CDQ A;  2YSS C;  2EIZ C;  1CX6 A;  3VW7 A;  5IT9 S;  3GLH A;  2C9C A;  1G7H C;  1TH3 A;  3GO8 A;  1GFT A;  3TXD A;  3W6C A;  3MK6 A;  1C6G A;  3U6M A;  4W56 A;  2LWX A;  1LPY A;  2YBN A;  111L A;  161L A;  1QTE A;  1C45 A;  4IJ4 A;  5F9X A;  1IP2 A;  3LCV B;  1JJ3 A;  2O25 A;  162L A;  5JI2 E;  3A6C Y;  2HEA A;  1F0W A;  5EP3 A;  4MH0 E;  4NHT A;  3A93 A;  3D8L A;  2HEB A;  3GUJ A;  2QZ4 A;  3FA0 A;  3I51 A;  3WMK A;  207L A;  1ZMV A;  1CKC A;  3HU9 A;  2A5Y B;  2WSF F;  2V6Z M;  4RNA A;  1GFE A;  1XSF A;  2RB1 X;  3SYK A;  4OWH A;  3KOZ E;  3G3W A;  1N4F A;  2J5Y A;  1XGT C;  5LYT A;  5LIO A;  2KRU A;  146L A;  1C10 A;  4EPI A;  3JR5 A;  4EXM A;  3AGI A;  2B73 A;  3CT0 A;  3I4V A;  4JI7 M;  2O4W A;  4CFO A;  1ZQ9 A;  3RU5 A;  3L28 A;  1XFP L;  2RAZ X;  3D3D A;  2OPF A;  256L A;  3RW8 A;  3FUV A;  4IAS A;  1VDD A;  2HUK A;  2I7N A;  4FW9 A;  2HU1 A;  4QOS A;  4II7 A;  1SG9 A;  3CTW B;  5LVG A;  3FTD A;  155L A;  4H94 A;  2CEA A;  4DKL A;  1WGN A;  2W1L A;  1VQ1 A;  3FRH A;  1L62 A;  5AMY A;  3RT5 X;  2H5X A;  1BWI A;  5E4P A;  1I94 M;  1OQM A;  244L A;  1QT5 A;  1OUB A;  118L A;  2G4Q A;  190L A;  1KXW A;  1LAA A;  1LTM A;  1QVR A;  1SX2 A;  114L A;  2BQE A;  2DQJ Y;  1B2K A;  2D7H A;  5D5F A;  1GWD A;  2QP9 X;  1L2C A;  168L A;  1C64 A;  2KXE A;  1Z6T A;  2JP7 A;  1GBY A;  3CT1 A;  220L A;  4U3X B;  2XQO A;  253L A;  2Z4S A;  2H9J A;  1L59 A;  1PJQ A;  3U5Z A;  1VDT A;  2I7P A;  1KIR C;  260L A;  1NVM A;  3UGJ A;  2M5Z A;  1L04 A;  2BAA A;  2P5T A;  1L82 A;  4GC5 A;  1LZS A;  1OUJ A;  1K82 A;  1NBZ C;  3A90 A;  2B6Y A;  1C6D A;  1LYF A;  3L64 A;  4IBE A;  4L78 A;  4JN6 A;  145L A;  1N75 A;  3LYM A;  4N9R A;  4XJF A;  4G3O A;  2FOI C;  1TEW A;  1WTM A;  1SXJ D;  4HTQ A;  1JJ1 A;  1PQK A;  1HEP A;  1L28 A;  4TSB A;  4DYG A;  254L A;  1QDT A;  1QTB A;  4RF1 A;  1GB9 A;  3SB8 A;  4NSI A;  2VDB B;  3PDS A;  2QNJ A;  1D2W A;  1SXJ C;  2KA6 B;  2R4E A;  1LZN A;  2EKF A;  3HTB A;  2L4F A;  1LOZ A;  4DV7 M;  1CV6 A;  3GLG B;  4I7R A;  3JR6 A;  3EXD A;  4H93 A;  1L02 A;  1I56 A;  214L A;  1HEN A;  2RH1 A;  3DN1 A;  4GCB A;  4ARJ A;  3HHZ A;  2LHC A;  3KAM A;  5KQ8 A;  2EO2 A;  3J7B A;  4J7V A;  1AIP C;  2ZNW Y;  1Z5C A;  3CDR A;  157L A;  1LYY A;  4Q7J A;  1UC0 A;  2BQN A;  2HED A;  1IX0 A;  4XN6 A;  1GF3 A;  2RB2 X;  1L42 A;  1QAM A;  1C7P A;  4M9S A;  1GJS A;  3L29 A;  1EFU B;  1KNI A;  1L23 A;  1PQO A;  5FHW A;  227L A;  5ITX A;  3HU3 A;  2NWD X;  1XXH E;  1WHC A;  3L26 A;  2JZ1 A;  1IEE A;  3C81 A;  5JEN B;  7LYZ A;  1L30 A;  4MM3 B;  1OFI A;  4WW0 A;  3HY5 A;  4E3U A;  2I25 L;  2RAY X;  1GB6 A;  1MX0 A;  1QAN A;  2LXE A;  1JIT A;  1XHB A;  4JI4 M;  4W54 A;  4PJ2 C;  1IN8 A;  3J7A S;  1WVV A;  1LHH A;  1LWG A;  1KW7 A;  2B74 A;  1TDZ A;  2ZIJ A;  3SAU A;  4R3D A;  5B1G A;  5IZ7 D;  5I4X A;  1LSZ A;  1YAO A;  1HC0 A;  1IN6 A;  2LYM A;  1OUG A;  4LG2 A;  5F3W A;  1ZUR A;  3CGW A;  4JYA M;  1CKD A;  4HJZ A;  2K9D A;  4YXA C;  4KXI A;  5FSW A;  1HR0 M;  1ALC A;  2DAM A;  4IBC A;  5EXX A;  2HAK A;  1L27 A;  1B7P A;  1CJ8 A;  4K0K M;  1JSE A;  1JUG A;  4L8R C;  3BXW A;  2JA2 A;  1L37 A;  3NYA A;  3L25 A;  1C6L A;  1L70 A;  4OWA A;  4RDS A;  231L A;  2ZIK A;  1JQU A;  2BPU A;  3EBA B;  4A7D A;  2MGW A;  2Q9D A;  5A3E A;  3TXE A;  2GV0 A;  174L A;  3A8Z A;  3C7W A;  3A6B Y;  1NNU C;  4GLV A;  2LBC A;  1YKZ X;  2HUB A;  181L A;  1C08 C;  1JTP L;  1JKB A;  5LMU M;  236L A;  3HT8 A;  4LF9 M;  3RNX A;  4R71 A;  4GRV A;  1HEQ A;  2DQG Y;  3WVX A;  3DOA A;  4BAF A;  1UIG A;  1OV7 A;  7CAT A;  1GFR A;  4IBK A;  3W68 A;  1CKG A;  1LZA A;  5LVI A;  2N5Z A;  4GN3 A;  1LSG A;  4PDG A;  1LYH A;  1TF0 B;  1LYS A;  1L79 A;  4I7M A;  4GIP A;  1NHE A;  3N9E A;  4D81 A;  3DN0 A;  4LF6 M;  1C6E A;  1MU5 A;  2DQI Y;  4GKK M;  153L A;  1LV7 A;  4W57 A;  5FTM A;  1LGU A;  6LYT A;  1GL7 A;  4ZFP A;  3KSX A;  1LMT A;  3TMW A;  2JY7 A;  197L A;  109L A;  4WM1 A;  1L51 A;  2YVB A;  4NSH A;  4PRQ A;  259L A;  1LZD A;  1IC4 Y;  2ZQ3 A;  4ARQ A;  2ZAO A;  1L75 A;  142L A;  3BBZ A;  3GUO A;  2C98 A;  5I14 A;  3GUK A;  4MR1 A;  1G59 A;  1DO2 A;  1C6K A;  1DI5 A;  2HEC A;  1G7J C;  1SQ2 L;  1J1P Y;  4LF4 M;  2W1M A;  5DM9 A;  4FWD A;  1ORY B;  1UUZ C;  1HJP A;  1NDM C;  1NWG A;  2BQF A;  1L90 A;  2F5Q A;  2MEG A;  3J6K A;  3C7Y A;  1NNJ A;  1L01 A;  4J1A A;  3WU9 A;  1JR3 D;  1YQV Y;  3SHG B;  1XWI A;  1C69 A;  3P65 A;  4G4H A;  4PK0 A;  5KXM A;  1UAC Y;  3HFM Y;  3GXK A;  1GFU A;  1FLY A;  1E8L A;  1L67 A;  1VEG A;  1DO0 A;  4AQY M;  4UWV A;  1CVK A;  4NGV A;  2LVA A;  3MGW A;  2C5R A;  3U61 A;  1N32 M;  1DPW A;  1HNL A;  1LJI A;  3T1Y M;  1LZE A;  4H9A A;  167L A;  3P66 A;  4DR3 M;  3RZE A;  4OX9 M;  4XJD A;  3TMV A;  4DR5 M;  4LZZ A;  1RI8 B;  2YFQ A;  3U6D A;  1P46 A;  1QSQ A;  147L A;  4S0W A;  2DXI A;  2F5N A;  3T6P A;  209L A;  4M4O A;  1TAY A;  1TTE A;  4MGH A;  1T3P A;  3RFW A;  2DZL A;  4OVZ B;  4LZT A;  3HH3 A;  3C8Q A;  5LXW A;  1IXZ A;  1LZT A;  4NXN M;  1DYC A;  2F5S A;  3J80 S;  217L A;  4ARM B;  1E94 E;  4HSF A;  4IAP A;  1LYG A;  4OWE A;  5HNL A;  4G6Z A;  1F6R A;  2ZAM A;  211L A;  3WL2 A;  1LLH A;  3E46 A;  1K3X A;  1NMM A;  2QSF X;  4NY5 A;  2HEE A;  1L18 A;  1P64 A;  4GEW A;  186L A;  2B6Z A;  4YEM A;  4N1C C;  2FH0 A;  3ZQJ A;  3MJ5 A;  4WLY A;  1J5E M;  2HHH M;  2BLX A;  112L A;  1LYE A;  3GUI A;  2DNA A;  1L39 A;  1YIL A;  4OU7 A;  1IWW A;  3M0E A;  3KFU G;  1PQI A;  1DXJ A;  1L22 A;  1XJT A;  1OAO C;  1IWX A;  5EBH A;  4XGI A;  4AGA A;  3QY4 A;  4L15 A;  4IIW A;  4TWS A;  2C9O A;  2DQD Y;  2DHY A;  5KXP A;  2CFO A;  1HEW A;  3GXR A;  1T3T A;  2ANX A;  3I01 M;  4W51 A;  3GLG E;  2RBN A;  4EMN A;  3FD9 A;  1REZ A;  234L A;  1F6S A;  4LYT A;  1IN5 A;  2HEF A;  1IBK M;  5KXR A;  4WM5 A;  1IXR C;  3GLI E;  1CV0 A;  1L19 A;  3EIE A;  5FTK A;  4OW1 A;  8LYZ A;  3NBI A;  1L68 A;  2A7F A;  3HX3 A;  1TR8 A;  3MMP A;  3UK6 A;  4GCE A;  4TSC A;  5H37 D;  1LZR A;  173L A;  4JI0 M;  4B08 A;  1VG5 A;  4RLN A;  4LDL A;  1WQM A;  4Z98 A;  1T8F A;  1L12 A;  240L A;  3VK7 A;  3C7Z A;  3WXT A;  3GPP A;  3Q8G A;  1OJL A;  2XZU A;  1JR3 A;  1T97 A;  2BLY A;  1C62 A;  4BLC A;  3LHM A;  2LZM A;  133L A;  3WW6 A;  1J1O Y;  3NBX X;  2DQH Y;  4WUR A;  3E9S A;  1GB5 A;  2Z4R A;  3AOE C;  1NHW C;  1DKK A;  1GFG A;  4WG1 A;  1GPQ C;  1B5Y A;  1GXX A;  4GHA A;  2VII A;  3AOG A;  122L A;  2HKJ A;  1QT8 A;  5A3Z A;  1IBM M;  3UZU A;  1GB7 A;  2Q9E A;  1GE2 A;  1L74 A;  4N8Z A;  3AFH A;  3VK8 A;  3TE6 A;  1GHL A;  4Z41 A;  3PNV A;  2Q2E B;  2H1R A;  4LFC M;  4NSR A;  1L55 A;  1PGY A;  4DJH A;  4NGW A;  5B07 A;  3AZ6 A;  1CUP A;  2AHM A;  3VWO A;  3UON A;  3J81 S;  2F30 A;  230L A;  1TDY A;  4I7L A;  1C60 A;  1QIO A;  1Q02 A;  1NHB A;  1UID A;  119L A;  3T38 A;  3CB7 A;  1HHL A;  5HLL A;  188L A;  2J7N A;  4DD1 A;  1GF4 A;  4LRT A;  1R6B X;  5DFL A;  1HER A;  2Y0Q A;  4DBG B;  3C82 A;  5F16 A;  3TL4 X;  148L E;  3LYT A;  4WM2 A;  2VQE M;  2UUB M;  1DQJ C;  4DQ7 A;  4MGZ E;  3THG A;  3FTF A;  208L A;  169L A;  4QHS A;  4NHI A;  2Z39 A;  3HU1 A;  3TWK A;  1YAQ A;  1XGR C;  1B9O A;  3OE9 A;  3C83 A;  1FLU A;  3AYQ A;  4W52 A;  3SBA A;  1V7S A;  3BKV A;  3K2R A;  1C43 A;  4KL7 A;  1L1T A;  1LSC A;  262L A;  2DWM A;  4JI8 M;  2O79 A;  2B7X A;  2R44 A;  1HML A;  201L A;  185L A;  5IHG A;  2DEN A;  1C46 A;  2XJW A;  4DR4 M;  4LJ5 A;  1SX7 A;  3FI7 A;  1IP5 A;  2CV1 A;  1D3N A;  250L A;  3AGG G;  4I7N A;  1NHG C;  1XXH B;  1Z59 A;  132L A;  1PJT A;  3HU2 A;  4B7H A;  1BB5 A;  4UN2 B;  2PC2 A;  4I7K A;  3B6L A;  1OP9 B;  4WL6 A;  1XNQ M;  4JV5 M;  4MGY E;  4DD2 A;  3KVW A;  180L A;  2X4A A;  3CQL A;  3SBJ A;  1RFP A;  2BQL A;  4P2E A;  4WP2 A;  5APD A;  4Z6Y A;  2R65 A;  1JIY A;  1H87 A;  216L A;  1AUA A;  3AB6 A;  3W0F A;  2CV0 A;  1GF9 A;  1QTH A;  4UWU A;  4GHL A;  215L A;  1YAM A;  1L52 A;  1L10 A;  2LVN C;  3FE0 A;  4W59 A;  3FYC A;  2Z38 A;  3B72 A;  4LGK A;  1NY6 A;  4DV2 M;  1I6S A;  3IJU A;  1C61 A;  3C9P A;  1DPX A;  2EKS C;  4EKP A;  1P2R A;  4NHS A;  2Z8Y M;  1L93 A;  4IBF A;  2DKV A;  3FUW A;  1OKS A;  2V1C A;  4I8S A;  1R7R A;  1OWY A;  255L A;  3J27 B;  1C6N A;  2Y20 A;  3CF2 A;  1D2N A;  3P64 A;  3I4Y A;  4DQ5 A;  1QQY A;  2DAE A;  3A95 A;  3QYB A;  1OIP A;  1VED A;  4G4N A;  5LMN M;  4GN4 A;  3EMS A;  3WUA A;  3TWL A;  4A3V B;  1LPI A;  1GBW A;  3PXG A;  2Z12 A;  1XC8 A;  1HEO A;  176L A;  1JSF A;  1AZF A;  3HTG A;  2RB0 X;  3CF6 E;  2JWS A;  3DFZ A;  1G0J A;  2KNZ A;  3HWS A;  4JI2 M;  3FUX A;  1L26 A;  1B5Z A;  1DI4 A;  1G1V A;  3SAS A;  1IWT A;  4JI3 M;  1GAZ A;  4X3B A;  2XFT A;  5LA8 A;  2ANV A;  5C6L A;  3DKE X;  3HBH A;  2OO9 A;  3W67 A;  3DN4 A;  2W1Y A;  1BB7 A;  4FWG A;  1R4G A;  3ATO A;  4NSO B;  1CTW A;  2Z2E A;  2CUZ A;  5C6I A;  1L81 A;  2R0I A;  3KDS E;  4FWH A;  4NHP A;  3FTE A;  2Z18 A;  4B49 A;  5LYM A;  3SP3 A;  5ITU A;  5KKJ A;  182L A;  1B7L A;  4HEO A;  5JI3 E;  1P36 A;  2CJL A;  1CKF A;  4LT0 A;  4OWB A;  3W3E A;  1LJG A;  2DAI A;  4DV6 M;  3K9O A;  3HH4 A;  5KKI A;  3U60 B;  1D3J A;  4CIZ A;  4WM6 A;  2OE9 X;  3P4Z A;  4W53 A;  1IOT A;  4ANR A;  4HLQ A;  3VKG A;  2ZQ4 A;  2DKL A;  2DQC Y;  4H9I A;  1L2D A;  1Z55 A;  3WUN A;  4LZJ A;  1XGU C;  1Z5A A;  4CIS A;  2Y8P A;  3KS4 A;  1L08 A;  3B9P A;  5FTN A;  1GFK A;  2B3T A;  2BJW A;  2LYO A;  5EP2 A;  5ITT A;  1D3M A;  4MB7 A;  1QSA A;  4NEB A;  5FCP A;  1SXJ E;  1N34 M;  2IGC A;  4L41 A;  1T8A A;  3PNY A;  226L A;  1OAI A;  242L A;  1C7Y A;  2UXC M;  4LCB A;  4I4L A;  4ET9 A;  1XMO M;  2LHM A;  1QT3 A;  5DL9 A;  1OUA A;  1NQI A;  4RKU F;  1GB2 A;  1G8P A;  2R46 A;  1CU0 A;  2MEC A;  4LT1 A;  2DQF C;  1NF5 A;  4NFV A;  1L86 A;  5EXS A;  1L47 A;  1J7K A;  2HL7 A;  1IY0 A;  1PJS A;  3B0O A;  4XJG A;  5KXZ A;  1AT6 A;  1IP1 A;  5ITR A;  4PHI A;  5J7C A;  1P5C A;  2XZF A;  4DV1 M;  3SB6 A;  1JKA A;  2JY5 A;  1L46 A;  3AZ5 A;  1CX7 A;  3GQ4 A;  5L3I A;  1VFB C;  1C6I A;  126L A;  4BB9 A;  2QBY A;  2Z3X A;  3V76 A;  3DZD A;  198L A;  1LJ4 A;  4GN5 C;  1C66 A;  5ILF A;  171L A;  2KNA A;  5FEK A;  3WU7 A;  1LZ6 A;  237L A;  3OE6 A;  4WMG A;  1N77 A;  4YF2 A;  3HHW A;  1PJJ A;  1AM7 A;  3J4G A;  4LYZ A;  1XB2 B;  4KHP M;  1NV8 A;  2UXD M;  3MHV C;  165L A;  4WG7 A;  5BR8 M;  4BBA A;  1N78 A;  3AKZ A;  2QEN A;  1L17 A;  3U6P A;  2L2D A;  2RGH A;  2CV2 A;  4X65 M;  5FEL A;  1GDW A;  1LYD A;  1WTH A;  2Z7J A;  1QTV A;  2Z37 A;  3CT5 A;  1VDP A;  2G8L A;  2BQM A;  1N36 M;  1VDL A;  1LSN A;  1QZE A;  3QAK A;  3DA1 A;  4CGE A;  1R2Z A;  1TDH A;  1R5L A;  3PBL A;  1ZYT A;  3VFD A;  1DGG A;  2E5L M;  4PJZ A;  3GLI B;  1L61 A;  1B7R A;  4H8Z A;  1G1W A;  4LJ4 A;  5F81 A;  4GCF A;  5HNC A;  3U6C A;  3GUP A;  1ZWN A;  4LFX A;  144L A;  2MR9 A;  194L A;  2UUA M;  159L A;  4B0D A;  1Q3B A;  2DWZ B;  115L A;  1C6C A;  2X8A A;  3UMM A;  4ETE A;  4B4E A;  3GLF A;  4W58 A;  5I4W A;  3DMZ A;  1L15 A;  1L25 A;  1GBZ A;  1YSY A;  2HU3 A;  2DWL A;  1IY3 A;  4LJA A;  2CWB A;  1JTT L;  3G3B B;  5KPT A;  3C8R A;  1CU3 A;  3U6S A;  1D9U A;  2DVW B;  3B7Z A;  3HHX A;  1LHI A;  4BAD A;  3WHK A;  2F2N A;  5I5Q A;  1GAB A;  1GD6 A;  4B3R M;  4OVZ A;  2QPA A;  1OUC A;  3W6F A;  3D4S A;  1CNS A;  4GC9 A;  3T36 A;  3D9A C;  3ZCB B;  2LVP C;  4B3M M;  1QQW A;  1ZVY B;  3TXH A;  3KOY E;  1DGB A;  1C67 A;  4N1E I;  1G4A E;  1OYU A;  4H9H A;  223L A;  4RF0 A;  5APC A;  4LGY A;  3SB9 A;  4WM3 A;  2BQI A;  2K6B A;  3SAV A;  2OTZ X;  1HNX M;  1L54 A;  1IXS A;  4IBI A;  2JY8 A;  1LI6 A;  3VKH A;  4YEN A;  5L3H A;  3B7Q A;  1FKV A;  3HJQ A;  1TLA A;  3BOS A;  1GO5 A;  3HDE A;  3WPJ A;  1UCO A;  1WQR A;  3OJP A;  4W94 A;  1L44 A;  1L06 A;  2EKK A;  1KIP C;  4XK8 F;  164L A;  4JXJ A;  213L A;  3KOW E;  1WXQ A;  4I7P A;  4Z3M A;  4LFA M;  3F8V A;  1EPY A;  1LMN A;  2MEF A;  2G4P A;  4RLM A;  1AKI A;  4YHH M;  2KZU A;  2KRK A;  5KXT A;  1ZMU A;  2X0A A;  2XSZ A;  2BQO A;  3AGH A;  4HJY A;  2RBR A;  1WVU A;  3GRV A;  3RE8 A;  1DYG A;  1JR3 E;  1GE0 A;  4HTN A;  4YEO A;  4DAJ A;  1L49 A;  1T6V L;  1W08 A;  1W6Z A;  4Z46 A;  2Q0M X;  3ULR A;  1LCN A;  4LDE A;  3LVV A;  1C68 A;  3WXU A;  3EIH A;  5D5C A;  2JUJ A;  241L A;  1G7M C;  4OOT A;  1IY4 A;  3A46 A;  1OTR A;  1PQJ A;  1LYI A;  2LZ2 A;  156L A;  4H8X A;  2D7E A;  1JEF A;  3I04 M;  5KQD A;  2CUU A;  4FJR A;  3HJ8 A;  5ITQ A;  1IWU A;  3FE3 A;  3LW5 F;  1N33 M;  2RBQ A;  235L A;  4F1I A;  4NG1 A;  5F9U A;  2BQJ A;  3A34 A;  3U5Z B;  2VQF M;  4NGO A;  1NBY C;  4YOP A;  4WM4 A;  2BJV A;  1GDX A;  1T6H A;  1YAN A;  1LHK A;  1CJ9 A;  1D3F A;  1PZY A;  243L A;  3LYO A;  1L0K A;  1UIA A;  4IJE A;  3LZ2 A;  2YBJ A;  2ZTD A;  3LN2 A;  1SWZ A;  5LA5 A;  2F32 A;  110L A;  1T8G A;  1E9R A;  1C6F A;  1FBI X;  107L A;  2FE8 A;  154L A;  1HSX A;  1L32 A;  1ZMW A;  140L A;  1MEL L;  4DV5 M;  5EP1 A;  3SB5 A;  3ZVQ A;  4S12 A;  1FDL Y;  2BQK A;  2HUL A;  104L A;  2O01 F;  1L88 A;  1XNR M;  1B7S A;  3C8S A;  1DYA A;  3WPK A;  4GLA A;  2LC9 A;  2ZM6 M;  5LAG A;  1UFZ A;  1L64 A;  2O7A A;  1G0M A;  1L97 A;  2V1U A;  1MJG M;  4LFP A;  4ETB A;  2F5O A;  3ZC7 B;  3ZH9 B;  1LJF A;  3H4M A;  3OE8 A;  2XLJ A;  3T6U A;  1L40 A;  4JI5 M;  1LGX A;  3DN6 A;  5C6J A;  1TGU A;  4WO6 A;  1XEI A;  1BQL Y;  4W5W A;  5IDD A;  1L69 A;  4L4U A;  5B05 A;  3A67 Y;  1LZ8 A;  1PJI A;  3V2Y A;  5FTL A;  1LW9 A;  1HNZ M;  3TXB A;  4NXM M;  1GFA A;  1PQM A;  1CUK A;  1HT1 E;  4X62 M;  3KOX E;  4I7O A;  1LJE A;  4DD7 A;  3VDP A;  3GQ3 A;  1LZB A;  3EO5 A;  3CSQ A;  1LSE A;  2WSE F;  3GUN A;  1QAO A;  1B5U A;  4HV1 A;  1GLN A;  2BQH A;  2APL A;  4JI6 M;  1C1K A;  4W96 A;  2LYZ A;  4G49 A;  2I6Z A;  1PM5 A;  2KHH A;  3A92 A;  1XXH A;  4EOF A;  4AKG A;  1IO5 A;  2FS1 A;  1KXX A;  1L21 A;  2F47 A;  4KT3 A;  4XJB A;  1T43 A;  4N0J A;  2H9K A;  4B4J A;  1P3Q Q;  1L1Z A;  218L A;  2FFJ A;  3KP0 E;  3KP1 E;  1IOS A;  3LQR A;  3HGI A;  125L A;  4LJ8 A;  1IC7 Y;  4WLX A;  2WSC F;  1LSY A;  1KS3 A;  3L2X A;  1P37 A;  5B06 A;  4DR1 M;  2Y21 A;  1DGH B;  4MCK A;  2MEB A;  5LYZ A;  1D9W A;  4MGK E;  261L A;  3KXE C;  3TPZ A;  4II8 A;  1NJG A;  1O23 A;  4KT0 F;  1OVJ A;  4KO8 A;  4OOO A;  3TXG A;  2IHL A;  2VB1 A;  4G4C A;  1SXJ B;  1IOR A;  1EE8 A;  4UWN A;  5HMJ A;  1D2Y A;  1C6B A;  1H6U A;  2XF3 A;  3WUM A;  5GKN A;  1GE4 A;  3C3E A;  238L A;  2CP8 A;  1L43 A;  3HBE X;  3GLH E;  5B59 A;  3W6B A;  2LZT A;  2ZWB A;  2W1X A;  1OVH A;  2XH9 A;  5E26 A;  2QB0 B;  3RGS A;  4E97 A;  152L A;  1P7S A;  1V92 A;  1V34 A;  2YBM A;  3PFI A;  2RKO A;  2C8O A;  4EPF A;  5FST A;  1Z5B A;  4WLT A;  4X64 M;  1L98 A;  1FLQ A;  4YX7 C;  3A96 A;  2B72 A;  1LSD A;  1HNW M;  3CF0 A;  1GJT A;  5LIN A;  4ARQ B;  2KNV A;  3A94 A;  4ZPU A;  1PQD A;  1LYZ A;  3WH1 A;  1IP4 A;  1AT5 A;  1IVM A;  4H8Y A;  5I53 A;  1LYO A;  1B6I A;  2FYC A;  1KFV A;  4WL7 A;  4ARP A;  2BWE A;  2BQG A;  1D6P A;  1ZV5 L;  2KW0 A;  1JHL A;  5LVH A;  4GCC A;  4TUN A;  1GF7 A;  3LZM A;  1L36 A;  1LSF A;  1L57 A;  1IM2 A;  3GPY A;  2D6B A;  2DAK A;  130L A;  4B1A A;  4K5Y A;  4H9B A;  4QY9 A;  3TQS A;  1HQY E;  4XAD A;  4KPM A; 
#chains in the Genus database with same CATH homology
 5APE A;  139L A;  2CWI A;  4EJ4 A;  1SWY A;  1FN5 A;  3BKH A;  1CU2 A;  3W6E A;  113L A;  1DZB X;  1C6Q A;  183L A;  1LMP A;  3N9C A;  1IR7 A;  2NTG A;  4ETA A;  224L A;  195L A;  4HP0 A;  1L05 A;  1L09 A;  1HSW A;  4O34 A;  1L38 A;  1LI2 A;  3A91 A;  5T3F A;  257L A;  1QT6 A;  258L A;  4DD9 A;  1HFY A;  1OV5 A;  3HH6 A;  3HU8 A;  4NIJ A;  2IFF Y;  3E3D A;  3C80 A;  246L A;  4LYO A;  3CDV A;  1IC5 Y;  1QT7 A;  5M1Y A;  1CV4 A;  1GXV 2;  2DQE Y;  192L A;  245L A;  3HT6 A;  1V7T A;  4LT2 A;  1JJ0 A;  3HTD A;  138L A;  1KY0 A;  1G0P A;  3ZEK A;  2RBO A;  2F2Q A;  3CDO A;  1L03 A;  1CU5 A;  1VAT A;  102L A;  1D6Q A;  2D91 A;  1P2C C;  1P2L A;  3F9L A;  3RUN A;  221L A;  1WQO A;  5KXY A;  2YBL A;  4NWH A;  4H9E A;  1YL1 X;  1REY A;  1UIH A;  1L63 A;  4W55 A;  2BQB A;  4NGL A;  1GFH A;  1IP7 A;  3DN2 A;  2ZIL A;  1L16 A;  1L50 A;  1OVK A;  1HFX A;  143L A;  1L66 A;  9LYZ A;  3A3Q A;  1EQ5 A;  3TXI A;  1SSW A;  1IR8 A;  2RBP A;  178L A;  1L96 A;  247L A;  4LT3 A;  2CGI A;  1F10 A;  1LZY A;  5K7O A;  1IWY A;  1QT4 A;  5I4Y A;  1LMC A;  1C6T A;  1EL1 A;  1CUQ A;  1L0J A;  4DD0 A;  2Z6B A;  4QDN A;  1BGI A;  249L A;  4OO9 A;  103L A;  1HFZ A;  1LSA A;  2MEI A;  2RBS A;  3TMX A;  1GF5 A;  2YBI A;  1JKD A;  4BS7 A;  1YKY X;  4ET8 A;  1GE3 A;  4AXT A;  5FDJ A;  1L31 A;  1IOC A;  1LJK A;  2EQL A;  1QTK A;  1QUO A;  1MLC E;  1UA6 Y;  1LKR A;  1OUI A;  4NGJ A;  229L A;  1L73 A;  3RZ4 A;  1C65 A;  1L94 A;  251L A;  1QSW A;  3NY9 A;  170L A;  1BVX A;  4QEQ A;  1LMO A;  1L34 A;  1A2Y C;  4LDO A;  3GUL A;  1LHL A;  1CJ6 A;  1QUD A;  1WTN A;  1CJ7 A;  2XBS A;  1GBO A;  3ATN A;  1LWK A;  4DD3 A;  4TTD A;  5LVK A;  1LSP A;  1P3N A;  1UIB A;  3AW7 A;  4H92 A;  2Z19 A;  1L14 A;  1LZ4 A;  1GE1 A;  1L24 A;  2A7D A;  3HUA A;  3WPL A;  4IAT A;  193L A;  1L20 A;  4NHQ A;  2OU0 X;  1VDS A;  1L48 A;  252L A;  1C6J A;  3N9A A;  2XTH A;  1HF4 A;  2B6T A;  2OE4 X;  248L A;  3CSR A;  4EKR A;  3FI5 A;  1GF8 A;  4I0C A;  4NGZ A;  4DT3 A;  1GB8 A;  4DDB A;  3QE8 A;  200L A;  1B5X A;  1UBZ A;  4G9S A;  5KJ9 A;  1QTC A;  2QAR C;  1YRO A;  1LZC A;  2L78 A;  3AZ7 A;  1L76 A;  1LSM A;  6LZM A;  128L A;  5KXO A;  199L A;  1BWJ A;  3WYH A;  2AUB A;  1L84 A;  166L A;  5L9J A;  5APF A;  4RW2 A;  172L A;  2OE7 X;  3HUK A;  1KY1 A;  1QSB A;  4C3W A;  1P6Y A;  3DN8 A;  1DKJ A;  1CV1 A;  3DN3 A;  3G3X A;  120L A;  160L A;  196L A;  1J1X Y;  3SBB C;  1GFJ A;  1EQE A;  1QTZ A;  2FYD A;  1L80 A;  1B7N A;  1L89 A;  5KXN A;  2RSC A;  1CU6 A;  1XJU A;  3HH5 A;  2YDG A;  4ETD A;  1L92 A;  1G06 A;  4LZM A;  1JIS A;  1YIK A;  1ZVH L;  2I26 L;  1BHZ A;  5E9R A;  3DMV A;  3P68 A;  3TMU A;  4CJ2 A;  2MEE A;  2DQA A;  191L A;  2B6W A;  4G4B A;  4DDA A;  1REM A;  1OUF A;  4N5R A;  2HUM A;  4ARM A;  5B1F A;  3IJV A;  232L A;  1L53 A;  123L A;  1B7M A;  1HEM A;  3DNA A;  189L A;  2ZNX Y;  1KIQ C;  4ML7 A;  1UIC A;  1LZ5 A;  1C63 A;  2OU9 A;  3AW6 A;  1LYJ A;  2F4G A;  2YBH A;  5II3 A;  4PPO A;  4EKQ A;  1G0Q A;  1SSY A;  2BQD A;  2OU8 A;  1QUT A;  3HT9 A;  1CV3 A;  1LZ1 A;  4C5F A;  1L85 A;  3A3R X;  7LZM A;  1JPO A;  1LGW A;  4B4I A;  1DYD A;  5LVJ A;  2EPE A;  1DI3 A;  1GAY A;  3W6A A;  3TXK A;  1H6M A;  1GFV A;  1D0L A;  5IEL A;  151L A;  4WO9 A;  1QS5 A;  1FKQ A;  141L A;  4NWE A;  1QUH A;  1IR9 A;  4ZEE A;  1GBS A;  1C6A A;  1QDR A;  3CDT A;  3HBD A;  3CSZ A;  3WVY A;  1NKH A;  1L99 A;  1IOQ A;  4RW1 A;  1KXY A;  206L A;  5KY1 A;  1WQP A;  1K28 A;  5LAF A;  3HDF A;  5KXL A;  1L00 A;  2DBT A;  4XYY A;  3WUL A;  1L56 A;  2MEA A;  1L95 A;  225L A;  1L07 A;  4DC4 A;  4ETC A;  163L A;  4GBR B;  2D4J A;  5DN5 A;  2Z2F A;  4NG8 A;  1L72 A;  3HTF A;  2FBB A;  3LZT A;  1IP6 A;  1LHJ A;  1INU A;  1OUH A;  1IIZ A;  3DMX A;  4LYC A;  4M6D A;  4DDC A;  1G0G A;  4XJH A;  2MEH A;  1L29 A;  1RCM A;  5KXK A;  3HUQ A;  4J1B A;  4ARL A;  1PS5 A;  4WLD A;  1QS9 A;  1B0D A;  2MED A;  4H9C A;  3HT7 A;  1CV5 A;  1WQQ A;  4NGY A;  210L A;  4AQN A;  4R6C A;  1VAU A;  4XJI A;  1BWH A;  1XEJ A;  129L A;  1L83 A;  1OUE A;  1G0K A;  1C6H A;  5ILC A;  3G3A B;  4I7S A;  4ZIX A;  149L A;  1G0L A;  4I7Q A;  6LYZ A;  1GF0 A;  1XGP C;  4H90 A;  1LMA A;  1GEZ A;  1RE2 A;  1L35 A;  1L45 A;  1B5V A;  5KXS A;  4NGK A;  1QTD A;  1L91 A;  4H9F A;  131L A;  2B5Z A;  3ODU A;  1SLY A;  4CFP A;  3AZ4 A;  4WOA A;  1KW5 A;  1C6M A;  1JTN A;  1L41 A;  1XGQ C;  4NGI A;  1GB3 A;  1YKX X;  1YL0 X;  1HEL A;  3OE0 A;  3F6Z A;  1ZMY L;  2BQA A;  2FBD A;  1QUS A;  1L60 A;  1B5W A;  3TXF A;  1FLW A;  3WW5 A;  2NTH A;  5DLA A;  1UIF A;  1LJJ A;  4YM8 A;  1L71 A;  1I20 A;  5I54 A;  3W6D A;  3AJN A;  4HTK A;  3B0I A;  4OWC A;  2HTX A;  150L A;  1L33 A;  1JKC A;  2C8P A;  137L A;  212L A;  1IWZ A;  1DYF A;  1QUG A;  4EKS A;  3B0K A;  184L A;  2D4K A;  1LJN A;  2ZYC A;  1VDQ A;  2F4A A;  3NY8 A;  1IP3 A;  1D0K A;  4BAP A;  3IWR A;  1L58 A;  4LYM A;  1LZG A;  5KXX A;  135L A;  3V2W A;  4FDY A;  3G3V A;  2B6X A;  1P56 A;  5F14 A;  3ZVQ B;  3K3T A;  219L A;  3M18 B;  4D9Z A;  4NSG A;  1GB0 A;  3TXJ A;  1B7O A;  3SB7 A;  187L A;  4QGZ A;  1DYB A;  228L A;  1OWZ A;  233L A;  1TCY A;  1G07 A;  4PRU A;  1BVK C;  2G4N A;  5DN4 A;  1G7L C;  1EQ4 A;  5HMV A;  1HMK A;  4HJV A;  2OEA X;  222L A;  4H1P A;  4I7T A;  1G7I C;  4XEN A;  4MST A;  3EML A;  4TX7 A;  3WU8 A;  108L A;  1NDG C;  2LCB A;  2WAR A;  1TBY A;  3QNG A;  1GBX A;  2A4T A;  2BQC A;  3SN6 R;  4J0L A;  1A4V A;  1LJ3 A;  1DYE A;  1GF6 A;  1GEV A;  4YXC A;  1JWR A;  1REX A;  2XBR A;  3M3U A;  1L87 A;  2D4I A;  1YAP A;  134L A;  1B7Q A;  4I7J A;  127L A;  2B75 A;  4GCD A;  1LHM A;  4HPE A;  4DWX A;  158L A;  1UIE A;  3GUM A;  2B70 A;  1L77 A;  1I1Z A;  1LI3 A;  4H91 A;  177L A;  1XEP A;  4HV2 A;  4CHX A;  1LJH A;  175L A;  1LMQ A;  4LYB A;  239L A;  4NSJ A;  1OUD A;  3LYZ A;  1L65 A;  1XEK A;  1IWV A;  1LSB A;  4HPI A;  1WQN A;  2H5Z A;  1BB3 A;  1LKS A;  2CDS A;  1CKH A;  5LZM A;  1JTM A;  5HQ1 A;  3HWL A;  3OK0 A;  5KXW A;  1RJC B;  1BB4 A;  205L A;  1L11 A;  2OTY X;  4DQJ A;  4PGJ B;  1JTO L;  2ZYP A;  3FAD A;  4R0F A;  1BB6 A;  1D0M A;  1L13 A;  1C6P A;  1LZ9 A;  3CDQ A;  2YSS C;  2EIZ C;  1CX6 A;  3VW7 A;  1G7H C;  1GFT A;  3TXD A;  3W6C A;  1C6G A;  4W56 A;  1LPY A;  2YBN A;  111L A;  161L A;  1QTE A;  1C45 A;  4IJ4 A;  5F9X A;  1IP2 A;  1JJ3 A;  162L A;  3A6C Y;  2HEA A;  1F0W A;  4NHT A;  3A93 A;  2HEB A;  3GUJ A;  3FA0 A;  3WMK A;  207L A;  1CKC A;  3HU9 A;  1GFE A;  1XSF A;  2RB1 X;  4OWH A;  3G3W A;  1N4F A;  1XGT C;  5LYT A;  5LIO A;  1C10 A;  146L A;  4EPI A;  4EXM A;  3AGI A;  2B73 A;  3CT0 A;  2O4W A;  4CFO A;  3RU5 A;  1XFP L;  3D3D A;  2RAZ X;  256L A;  3RW8 A;  4IAS A;  2HUK A;  2HU1 A;  5LVG A;  155L A;  4H94 A;  4DKL A;  2W1L A;  1L62 A;  5AMY A;  3RT5 X;  1BWI A;  5E4P A;  1OQM A;  244L A;  1QT5 A;  1OUB A;  118L A;  2G4Q A;  190L A;  1KXW A;  1LAA A;  1LTM A;  1SX2 A;  114L A;  2BQE A;  2DQJ Y;  1B2K A;  5D5F A;  1GWD A;  1C64 A;  168L A;  1GBY A;  3CT1 A;  220L A;  4U3X B;  2XQO A;  253L A;  2H9J A;  1L59 A;  1VDT A;  1KIR C;  260L A;  1L04 A;  2BAA A;  1L82 A;  1LZS A;  1OUJ A;  1NBZ C;  3A90 A;  2B6Y A;  1C6D A;  1LYF A;  3L64 A;  145L A;  4N9R A;  4XJF A;  3LYM A;  1TEW A;  1WTM A;  4HTQ A;  1JJ1 A;  1PQK A;  1HEP A;  1L28 A;  4TSB A;  4DYG A;  254L A;  1QDT A;  1QTB A;  1GB9 A;  3SB8 A;  4NSI A;  3PDS A;  1D2W A;  1LZN A;  3HTB A;  1LOZ A;  1CV6 A;  4I7R A;  3JR6 A;  3EXD A;  4H93 A;  1L02 A;  1I56 A;  214L A;  1HEN A;  2RH1 A;  3DN1 A;  4GCB A;  4ARJ A;  3KAM A;  4J7V A;  2ZNW Y;  3CDR A;  157L A;  1LYY A;  1UC0 A;  2BQN A;  2HED A;  1IX0 A;  4XN6 A;  1GF3 A;  2RB2 X;  1L42 A;  1C7P A;  1KNI A;  1L23 A;  1PQO A;  5FHW A;  227L A;  2NWD X;  1IEE A;  5JEN B;  3C81 A;  7LYZ A;  1L30 A;  4E3U A;  2I25 L;  2RAY X;  1GB6 A;  1JIT A;  4W54 A;  4PJ2 C;  1WVV A;  1LHH A;  1LWG A;  1KW7 A;  2B74 A;  2ZIJ A;  5I4X A;  5B1G A;  1LSZ A;  1YAO A;  1HC0 A;  2LYM A;  1OUG A;  1ZUR A;  1CKD A;  4HJZ A;  4YXA C;  4KXI A;  1ALC A;  1L27 A;  1B7P A;  1CJ8 A;  1JSE A;  1JUG A;  1L37 A;  3NYA A;  1C6L A;  1L70 A;  4OWA A;  4RDS A;  231L A;  2ZIK A;  1JQU A;  2BPU A;  3EBA B;  4A7D A;  2Q9D A;  5A3E A;  3TXE A;  2GV0 A;  174L A;  3A8Z A;  3C7W A;  3A6B Y;  4GLV A;  1YKZ X;  2HUB A;  181L A;  1C08 C;  1JTP L;  1JKB A;  236L A;  3HT8 A;  3RNX A;  4GRV A;  1HEQ A;  2DQG Y;  3WVX A;  4BAF A;  1UIG A;  1OV7 A;  1GFR A;  1CKG A;  1LZA A;  5LVI A;  2N5Z A;  4GN3 A;  1LSG A;  1LYH A;  1LYS A;  1L79 A;  4I7M A;  1NHE A;  3N9E A;  3DN0 A;  1C6E A;  2DQI Y;  153L A;  4W57 A;  1LGU A;  6LYT A;  4ZFP A;  3TMW A;  1LMT A;  197L A;  109L A;  4WM1 A;  1L51 A;  2YVB A;  4NSH A;  4PRQ A;  259L A;  1LZD A;  1IC4 Y;  2ZQ3 A;  4ARQ A;  1L75 A;  142L A;  3GUO A;  5I14 A;  3GUK A;  4MR1 A;  1C6K A;  1DI5 A;  2HEC A;  1G7J C;  1SQ2 L;  1J1P Y;  2W1M A;  5DM9 A;  1UUZ C;  1NDM C;  1NWG A;  2BQF A;  1L90 A;  2MEG A;  3J6K A;  3C7Y A;  1L01 A;  4J1A A;  3WU9 A;  3P65 A;  1YQV Y;  1C69 A;  4G4H A;  4PK0 A;  5KXM A;  1UAC Y;  3HFM Y;  3GXK A;  1GFU A;  1FLY A;  1E8L A;  1L67 A;  4UWV A;  1CVK A;  4NGV A;  3MGW A;  1DPW A;  1HNL A;  1LJI A;  1LZE A;  4H9A A;  167L A;  3P66 A;  3RZE A;  4XJD A;  3TMV A;  1RI8 B;  1QSQ A;  1P46 A;  147L A;  4S0W A;  209L A;  4M4O A;  1TAY A;  1T3P A;  4LZT A;  3HH3 A;  3C8Q A;  5LXW A;  1LZT A;  1DYC A;  217L A;  4ARM B;  4HSF A;  4IAP A;  1LYG A;  4OWE A;  5HNL A;  1F6R A;  211L A;  3WL2 A;  1LLH A;  1NMM A;  4NY5 A;  2HEE A;  1L18 A;  1P64 A;  186L A;  2B6Z A;  4YEM A;  4N1C C;  4WLY A;  2BLX A;  112L A;  1LYE A;  3GUI A;  1L39 A;  1YIL A;  1IWW A;  1PQI A;  1DXJ A;  1L22 A;  1XJT A;  1IWX A;  5EBH A;  4AGA A;  3QY4 A;  4TWS A;  2DQD Y;  5KXP A;  1HEW A;  3GXR A;  2ANX A;  4W51 A;  2RBN A;  4EMN A;  1REZ A;  234L A;  1F6S A;  4LYT A;  2HEF A;  5KXR A;  4WM5 A;  1CV0 A;  1L19 A;  4OW1 A;  8LYZ A;  1L68 A;  2A7F A;  4GCE A;  4TSC A;  1LZR A;  173L A;  4RLN A;  4LDL A;  1WQM A;  4Z98 A;  1T8F A;  1L12 A;  240L A;  3C7Z A;  3WXT A;  3LHM A;  2BLY A;  1T97 A;  1C62 A;  2LZM A;  133L A;  3WW6 A;  1J1O Y;  2DQH Y;  1GB5 A;  1DKK A;  1GFG A;  4WG1 A;  1GPQ C;  1B5Y A;  1GXX A;  122L A;  5A3Z A;  1QT8 A;  1GB7 A;  2Q9E A;  1GE2 A;  1L74 A;  4N8Z A;  1GHL A;  4Z41 A;  1L55 A;  4DJH A;  4NGW A;  5B07 A;  3AZ6 A;  1CUP A;  3VWO A;  3UON A;  2F30 A;  230L A;  1TDY A;  4I7L A;  1C60 A;  1QIO A;  1NHB A;  1UID A;  119L A;  3CB7 A;  1HHL A;  5HLL A;  188L A;  4DD1 A;  1GF4 A;  1HER A;  3C82 A;  5F16 A;  148L E;  3LYT A;  4WM2 A;  1DQJ C;  4DQ7 A;  208L A;  169L A;  4NHI A;  2Z39 A;  1YAQ A;  1XGR C;  1B9O A;  3OE9 A;  3C83 A;  1FLU A;  3AYQ A;  4W52 A;  3SBA A;  1V7S A;  3BKV A;  3K2R A;  1C43 A;  4KL7 A;  1LSC A;  262L A;  2O79 A;  2B7X A;  1HML A;  201L A;  185L A;  5IHG A;  1C46 A;  2XJW A;  1SX7 A;  3FI7 A;  1IP5 A;  1D3N A;  250L A;  3AGG G;  4I7N A;  132L A;  1BB5 A;  2PC2 A;  4I7K A;  3B6L A;  1OP9 B;  4WL6 A;  4DD2 A;  180L A;  3CQL A;  1RFP A;  2BQL A;  4P2E A;  5APD A;  1JIY A;  1H87 A;  216L A;  3AB6 A;  4UWU A;  1GF9 A;  1QTH A;  215L A;  1YAM A;  1L52 A;  1L10 A;  4W59 A;  3FE0 A;  2Z38 A;  3B72 A;  3IJU A;  1I6S A;  1C61 A;  1DPX A;  2EKS C;  4EKP A;  1P2R A;  4NHS A;  1L93 A;  2DKV A;  4I8S A;  1OWY A;  255L A;  1C6N A;  4DQ5 A;  3P64 A;  1QQY A;  3A95 A;  1VED A;  4GN4 A;  3EMS A;  3WUA A;  1LPI A;  1GBW A;  2Z12 A;  1HEO A;  176L A;  1JSF A;  1AZF A;  3HTG A;  2RB0 X;  1G0J A;  1L26 A;  1B5Z A;  1DI4 A;  1G1V A;  1IWT A;  1GAZ A;  4X3B A;  5LA8 A;  2ANV A;  5C6L A;  3DKE X;  3HBH A;  3DN4 A;  2W1Y A;  1BB7 A;  3ATO A;  1CTW A;  2Z2E A;  5C6I A;  1L81 A;  4NHP A;  2Z18 A;  4B49 A;  5LYM A;  3SP3 A;  5KKJ A;  182L A;  1B7L A;  1P36 A;  2CJL A;  1CKF A;  4LT0 A;  4OWB A;  3W3E A;  1LJG A;  3HH4 A;  5KKI A;  1D3J A;  4WM6 A;  2OE9 X;  3P4Z A;  4W53 A;  1IOT A;  4ANR A;  2ZQ4 A;  2DQC Y;  4H9I A;  1Z55 A;  3WUN A;  1XGU C;  2Y8P A;  1L08 A;  1GFK A;  2LYO A;  1D3M A;  1QSA A;  4NEB A;  5FCP A;  2IGC A;  4L41 A;  1T8A A;  226L A;  242L A;  4ET9 A;  2LHM A;  1QT3 A;  5DL9 A;  1OUA A;  1NQI A;  1GB2 A;  1CU0 A;  2MEC A;  4LT1 A;  2DQF C;  1NF5 A;  4NFV A;  1L86 A;  1L47 A;  3B0O A;  4XJG A;  5KXZ A;  1AT6 A;  1IP1 A;  4PHI A;  5J7C A;  1P5C A;  3SB6 A;  1JKA A;  3AZ5 A;  1L46 A;  1CX7 A;  5L3I A;  1VFB C;  1C6I A;  126L A;  198L A;  1LJ4 A;  4GN5 C;  1C66 A;  5ILF A;  171L A;  5FEK A;  3WU7 A;  1LZ6 A;  237L A;  3OE6 A;  4WMG A;  4YF2 A;  1AM7 A;  3J4G A;  4LYZ A;  4WG7 A;  165L A;  1L17 A;  5FEL A;  1GDW A;  1LYD A;  1WTH A;  1QTV A;  2Z37 A;  3CT5 A;  1VDP A;  2BQM A;  1LSN A;  3QAK A;  4CGE A;  3PBL A;  1ZYT A;  4PJZ A;  1L61 A;  1B7R A;  4H8Z A;  1G1W A;  5F81 A;  4GCF A;  5HNC A;  3GUP A;  1ZWN A;  4LFX A;  144L A;  194L A;  159L A;  4B0D A;  115L A;  1C6C A;  4ETE A;  4B4E A;  4W58 A;  5I4W A;  3DMZ A;  1L15 A;  1L25 A;  1GBZ A;  2HU3 A;  1IY3 A;  1JTT L;  3G3B B;  3C8R A;  1CU3 A;  1D9U A;  4BAD A;  1LHI A;  2F2N A;  5I5Q A;  1GD6 A;  1OUC A;  3W6F A;  3D4S A;  1CNS A;  3T36 A;  3D9A C;  1ZVY B;  3TXH A;  1C67 A;  4N1E I;  1OYU A;  4H9H A;  223L A;  5APC A;  3SB9 A;  4WM3 A;  2BQI A;  2OTZ X;  1L54 A;  1LI6 A;  4YEN A;  5L3H A;  1FKV A;  1TLA A;  3HDE A;  3WPJ A;  1UCO A;  1WQR A;  3OJP A;  4W94 A;  1L44 A;  1L06 A;  1KIP C;  164L A;  213L A;  4I7P A;  4Z3M A;  3F8V A;  1EPY A;  1LMN A;  2MEF A;  2G4P A;  4RLM A;  1AKI A;  5KXT A;  2X0A A;  2BQO A;  3AGH A;  4HJY A;  2RBR A;  1WVU A;  1DYG A;  1GE0 A;  4HTN A;  4YEO A;  4DAJ A;  1L49 A;  1T6V L;  1W08 A;  1W6Z A;  4Z46 A;  2Q0M X;  3ULR A;  1LCN A;  4LDE A;  1C68 A;  3WXU A;  5D5C A;  241L A;  1G7M C;  4OOT A;  1IY4 A;  1PQJ A;  1LYI A;  2LZ2 A;  156L A;  4H8X A;  1JEF A;  4FJR A;  2CUU A;  1IWU A;  5F9U A;  2RBQ A;  235L A;  4NG1 A;  2BQJ A;  3A34 A;  4NGO A;  1NBY C;  4YOP A;  4WM4 A;  1GDX A;  1T6H A;  1YAN A;  1LHK A;  1CJ9 A;  1D3F A;  1PZY A;  243L A;  3LYO A;  1L0K A;  1UIA A;  3LZ2 A;  2YBJ A;  3LN2 A;  1SWZ A;  5LA5 A;  2F32 A;  110L A;  1T8G A;  1C6F A;  1FBI X;  107L A;  154L A;  1HSX A;  1L32 A;  140L A;  1MEL L;  3SB5 A;  3ZVQ A;  1FDL Y;  2BQK A;  2HUL A;  104L A;  1L88 A;  1B7S A;  3C8S A;  1DYA A;  3WPK A;  4GLA A;  2LC9 A;  5LAG A;  1L64 A;  2O7A A;  1G0M A;  1L97 A;  4LFP A;  4ETB A;  3OE8 A;  1LJF A;  3T6U A;  1L40 A;  1LGX A;  3DN6 A;  5C6J A;  4WO6 A;  1XEI A;  1BQL Y;  5IDD A;  1L69 A;  5B05 A;  3A67 Y;  1LZ8 A;  3V2Y A;  1LW9 A;  3TXB A;  1GFA A;  1PQM A;  4I7O A;  1LJE A;  4DD7 A;  1LZB A;  3EO5 A;  3CSQ A;  1LSE A;  3GUN A;  1B5U A;  4HV1 A;  2BQH A;  4W96 A;  2LYZ A;  4G49 A;  2I6Z A;  3A92 A;  4EOF A;  1IO5 A;  1KXX A;  1L21 A;  2F47 A;  4KT3 A;  4XJB A;  4N0J A;  2H9K A;  4B4J A;  218L A;  1IOS A;  125L A;  1IC7 Y;  4WLX A;  1LSY A;  1KS3 A;  3L2X A;  1P37 A;  5B06 A;  4MCK A;  2MEB A;  5LYZ A;  1D9W A;  261L A;  4II8 A;  1O23 A;  1OVJ A;  4OOO A;  3TXG A;  2IHL A;  2VB1 A;  4G4C A;  1IOR A;  4UWN A;  5HMJ A;  1D2Y A;  1C6B A;  3WUM A;  1GE4 A;  238L A;  1L43 A;  3HBE X;  5B59 A;  3W6B A;  2LZT A;  2ZWB A;  2W1X A;  1OVH A;  2QB0 B;  4E97 A;  152L A;  1P7S A;  2YBM A;  2C8O A;  4EPF A;  5FST A;  4WLT A;  1L98 A;  1FLQ A;  4YX7 C;  3A96 A;  2B72 A;  1LSD A;  5LIN A;  4ARQ B;  3A94 A;  4ZPU A;  1PQD A;  1LYZ A;  3WH1 A;  1IP4 A;  1AT5 A;  1IVM A;  4H8Y A;  5I53 A;  1LYO A;  1B6I A;  2FYC A;  4WL7 A;  4ARP A;  2BQG A;  1D6P A;  1ZV5 L;  1JHL A;  5LVH A;  4GCC A;  4TUN A;  1GF7 A;  3LZM A;  1L36 A;  1LSF A;  1L57 A;  2D6B A;  130L A;  4B1A A;  4K5Y A;  4H9B A;  4QY9 A;  4LGK A;  4XAD A;  4KPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...