1D1NA

Solution structure of the fmet-trnafmet binding domain of becillus stearothermophillus translation initiation factor if2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
99
structure length
99
Chain Sequence
YEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGIVVYEGEIDSLKRYKDDVREVAQGYECGLTIKNFNDIKEGDVIEAYVMQEVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the fMet-tRNA(fMet)-binding domain of B. stearothermophilus initiation factor IF2.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Gene regulation
molecule keywords INITIATION FACTOR 2
total genus 8
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1999-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1d1nA00
1EP1B 2CNDA 1QFZA 1D1NA 1GVHA 1ELOA 1VQPB 2BGIA 1S72B 3CCLB 3AVXA 1ZUNB 3ZBUA 3OZVA 1VQ8B 3E20A 4PC7A 4K1XA 1VQKB 3CCEB 1D2EA 2DETA 4AF7A 4RJLA 1VQ9B 4J0QA 4RD1A 1UMKA 1R5OA 3W2HA 1SKQA 1FNCA 1DDIA 1E62A 1VQNB 4IW3B 3PENA 3JQQA 4U9UA 4RCZA 3JQPA 3MHPA 2OK7A 1QVGB 2BV3A 2BF4A 2QN6A 3E1YE 4G1BA 1BX0A 4AC9A 1OGJA 1K9MD 3CC2B 1DDGA 2OK8A 4B44A 3QSYA 4YAFA 4M2LA 3SJZA 4N3GA 2VZLA 5TR9A 2NPFA 1B23P 2QA4B 2XEXA 1KRHA 1VQOB 2AHOA 4PC3A 4M1KA 3CMEB 3U6BA 5EMNA 4F7DA 1TVCA 3CD6B 3MMPA 1FNDA 3WNDA 1Q82D 1NDHA 1GO2A 1TTTA 2BSAA 3OZWA 4B47A 1YITB 4RD0A 1QVFB 2RC6A 3FJOA 4FK8A 3W5VA 4Y7CA 1S0UA 3U6KA 4BPRA 1KTVA 2VNKA 4M0LA 4EH1A 1FRQA 3P27A 4B4DA 3VMFA 3AVVA 1W34A 3AVTA 4NBSA 1OB2A 3W5HA 1QFYA 3P26A 1JA0A 3OW2B 3VNVA 4HE5A 5H59A 2BM1A 1I7PA 1EP2B 4RD6A 2B7CA 5TV2A 1JA1A 1R5BA 4HE6A 1VQ5B 4R71A 1JB9A 1H85A 1CNFA 4M53A 4UAJA 2OTJB 2QMUA 3ES9A 3JQRA 5GV7A 5DSZA 2FX3A 3W2GA 1U2RA 2YWFA 1QFJA 1WDTA 1YHQB 1W87A 2CRVA 2QTZA 3QFTA 4RD4A 3G71B 3VO2A 4B48A 3CCUB 2YWHA 4LBVA 1KC8D 3ZBTA 4YAUA 3VNUA 3ZZTA 1VQ4B 4YHBA 4ACAA 1ZM9A 3CMAB 4TMWA 1VQMB 2QTLA 2EIXA 2BVNA 2XNJA 1D8TA 3B78A 4AF6A 4PC6A 1OB5A 1N0VC 3W2FA 2HDNB 4LBYA 1QUFA 1Q7YD 2B5OA 5FA6A 2DEUA 3W2IA 4TMZA 2BPOA 1G7RA 4FWTA 4N3NA 3AVWA 2VNJA 3G4SB 2R6HA 2HMAA 4Y9RA 4ZGNB 4TMTA 3VO1A 1M1KD 1FNBA 1IB0A 1QGAA 4G5GA 2B7BA 1GR1A 1CQXA 4YAWA 4Y9UA 1SM4A 3W2EA 1ZM2A 5HXBA 3V76A 3B8HA 4DQLA 1QH0A 4WQMA 1YI2B 4LC0A 4YALA 4G1VA 3G6EB 1EFCA 3U2QA 4QHYA 1N8RD 1ZM4A 1JNYA 5GV8A 3CPWB 2VYQA 4RD2A 1DARA 1DG1G 3OJWA 1HA3A 3LO8A 4B3XA 1GAWA 5THXA 1G7TA 1VQLB 3CC4B 1KJZA 1KD1D 3OZUA 3CCVB 2VNIA 3QFSA 2BGJA 1H42A 4ZGQB 2PMDA 2DY1A 1IJFA 2J7KA 3ZZUA 1KK1A 1XE1A 3WBJA 3CCQB 4P6VF 4H9GA 3CRZA 1W2BB 2YWGA 3LVBA 1EXMA 1QG0A 1Q81D 4C43A 1KK0A 4ZV4A 1FNMA 2X3UA 5H5JA 4PC2A 1J9ZA 3WYAA 4RD3A 3CXCB 2ZITA 4PC1A 2YWEA 3CB4A 3FPKA 4PGOA 1G7SA 3AVYA 1QX4A 1M90D 1K8AD 1B2RA 3CW2A 1Q86D 3QFCA 2DCUA 4TMVA 4MYUA 4FN5A 1EFTA 1G7CA 1TLLA 3I56B 2C78A 1XB2A 3ZC3A 4LBWA 3I55B 1QUEA 1KK3A 2RC5A 4RCYA 2PIAA 1NJID 1BQEA 4M4SA 1R5NA 4TMXA 1ZM3A 4YAOA 3MCAA 1EWYA 1BX1A 3WBKA 2D74A 4MYTA 4DQKA 1VQ6B 2HCJB 2E1RA 3CC7B 1EFUA 1FRNA 1EP3B 2GQFA 3AVUA 3WNCA 1CNEA 1K73D 3WY9A 4LBZA 2PLFA 2EFGA 3W5UA 4QFMA 1IJEA 1KK2A 2GPJA 2QEXB 3AGQA 5KSWB 2BM0A 1KQSB 1W35A 3WXMA 3WNBA 3CCJB 3ZZ0A 4ZCMA 1TUIA 1QGZA 3OJXA 5TY0A 1GJRA 3QFRA 1F20A 1QGYA 1E64A 4TN1A 2VNHA 4B43A 4P3YA 2XNCA 4NCNA 4C0SA 1JJ2B 1BJKA 4ACBA 1GAQA 2C77A 1F60A 1FDRA 1OGIA 4ZCLA 2OTLB 4Q7JB 3CCSB 1AIPA 3B82A 3J81k 1YJWB 4ZCIA 1YJNB 1VQ7B 2BMWA 1YIJB 3AGPA 5JBQA 1AMOA 3CCMB 5AN9A 2DERA 1YJ9B 3I1FA 2BN4A 1A8PA 3CCRB 2QDXA 1E63A 1N0UA 3QE2A
chains in the Genus database with same CATH superfamily
5DN6A 1EP1B 1OB0A 2CNDA 2DOGA 1QFZA 1D1NA 1GVHA 1ELOA 1PJ5A 2ZTNA 2BGIA 1VQPB 2X6WA 4XLFA 1S72B 1VLYA 1WSVA 4KKSA 5A89A 3CCLB 3AVXA 1ZUNB 3ZBUA 3OZVA 4II2A 3T53B 2VBUA 4WZLA 1PKVA 1VQ8B 3E20A 4PC7A 3V7AA 4K1XA 1VF7A 1VQKB 4XORA 3ASRA 3CCEB 1D2EA 2DETA 4AF7A 2WJYA 4Z1MA 4G7XA 4RJLA 1VQ9B 2W6JA 4J0QA 2X8KA 4RD1A 4P12A 1YLOA 1UMKA 3A8IA 1R5OA 2JJ1A 2X85A 1SKQA 2WR8A 1FNCA 3W2HA 1DDIA 5B6IA 2X53S 4G6IA 1E62A 4DNTB 4XL9A 1VQNB 4IW3B 3PENA 3JQQA 4U9UA 3OEHA 3PA1A 4RCZA 1W9XA 3JQPA 3MHPA 2OK7A 3H94A 3NE5B 5FIUA 1QVGB 2BV3A 1MRZA 2BF4A 2QN6A 3E1YE 4G1BA 5IYRA 1BX0A 3PVDA 4RPBA 2V7XA 3CP8A 4AC9A 4OOXA 1OGJA 2DYIA 1K9MD 1WPCA 2F4NA 3CC2B 1DDGA 2OK8A 2ZZEA 4B44A 3QSYA 3LQEA 1RQPA 3SEJA 4YAFA 4M2LA 3BY2A 3SJZA 4N3GA 1H8HA 2VZLA 3ISXA 5TR9A 2NV4A 4P1VA 2XZPA 2NPFA 1B23P 2QA4B 2XEXA 1KRHA 2OBTA 1VQOB 3PUMA 3T51B 2AHOA 4XONA 3KL9A 5IK2A 4PC3A 1WP6A 4M1KA 3CMEB 1W0JA 3U6BA 4RM0A 3OEEA 5EMNA 4F7DA 1TVCA 3ZIAA 3CD6B 1YX2A 4WZTA 3MMPA 4RDLA 1FNDA 1UD2A 3WNDA 1Q82D 1NDHA 1GO2A 1TTTA 1COWA 2BSAA 3OZWA 2V7UA 4UZUA 4XN3A 4B3GA 2V7WA 2Q6IA 4B47A 1V5VA 1YITB 4RD0A 1QVFB 2RC6A 3FJOA 4FK8A 3W5VA 2X0KA 2VJJA 4NNJA 4Y7CA 1S0UA 4BPRA 3U6KA 4B3FX 1KTVA 5F4OA 2VNKA 4M0LA 4EH1A 3GQBA 3Q3AA 3GVKA 4TSFA 1FRQA 3P27A 2QE7A 1XFOA 4B4DA 3VMFA 3AVVA 1W34A 3AVTA 4NBSA 1OB2A 1K28D 2FVGA 3W5HA 1QFYA 1Q9SA 1WOSA 5BSXA 2X6XA 3P26A 1JA0A 3OW2B 3VNVA 2F1LA 2ZBVA 4HE5A 3A35A 4P3IA 4X06A 2I1LA 1UD3A 4AVZA 1OHHA 4OPOA 5H59A 4X8IA 3A3BA 5A88A 2BM1A 1I7PA 4P26A 2XGJA 1EP2B 4RD6A 4ROXA 1E43A 3JU4A 2B7CA 5TV2A 1JA1A 2V7VA 1R5BA 4HE6A 1VQ5B 4XNFA 4R71A 1KZLA 1JB9A 1H85A 1CNFA 2F1MA 2Q6LA 4M53A 4UAJA 1BPLA 4TT3A 4YXWA 2OTJB 2QMUA 2JIZA 3ES9A 1UD8A 3BC9A 4X0CA 1Y0YA 1T6YA 3JQRA 2KVOA 5GV7A 5DSZA 4P25A 2FX3A 4WZEA 5F4JA 3W2GA 1U2RA 2YWFA 1QFJA 1WDTA 1YHQB 1W87A 2CRVA 2QTZA 3QFTA 4RD4A 3G71B 3OE7A 3VO2A 3HAGA 3GIRA 4G7WA 2YWHA 4B48A 3CCUB 1I18A 1NB0A 3DDYA 4LBVA 3GVJA 3Q6RA 2JDIA 1SKYB 3ZBTA 1KC8D 2V7QA 4YAUA 3FKSA 4KKUA 3VNUA 4KKTA 3ZZTA 2XZOA 1VLOA 2D9RA 1PJ6A 4XOPA 1VQ4B 4YHBA 1HZEA 1I8DA 4GQNA 4PABA 4ACAA 1ZM9A 3CMAB 4TMWA 1VQMB 3Q39A 2QTLA 2EIXA 2BVNA 4X7EA 2XNJA 1D8TA 3B78A 4AF6A 3SLDA 3BQJA 2V7TA 4PC6A 1OB5A 1N0VC 3CP2A 3R6KA 4TKOB 2ZTGA 3W2FA 2HDNB 2V4DA 2E1BA 1QUFA 2ZZQA 4LBYA 5HZAA 3OFNA 2B5OA 1NRKA 3LNNA 1Q7YD 4XR6A 5A8AA 5FA6A 3CESA 2DEUA 3W2IA 4TMZA 2ZL6A 1RQRA 2BPOA 1G7RA 1IHMA 4FWTA 4N3NA 3AVWA 2VNJA 3G4SB 2R6HA 5FO1A 3ASPA 2HMAA 4Y9RA 4ZGNB 2V31A 2WZPP 4TMTA 3RY8A 3VO1A 1M1KD 5KNLA 1FNBA 4WZKA 1IB0A 1QGAA 4G5GA 2GJPA 4XLAA 4Z4VA 2B7BA 3ZUGA 3BH4A 4Z4ZA 1PJ7A 1GR1A 5FO0A 1CQXA 3GVLA 4YAWA 4Y9UA 1SM4A 3W2EA 2Q6OA 1ZM2A 2HLDA 5HXBA 3V76A 3LQ6A 2OYNA 3B8HA 3T56B 1VHOA 4UZFA 5FL7A 1KMHA 4DQLA 1QH0A 3BCDA 4WQMA 1YI2B 4LC0A 4YALA 3WQZA 4G1VA 3G6EB 1EFCA 2C4UA 4QHYA 3U2QA 1ZM4A 1N8RD 1JNYA 2QGGA 1BLIA 5GV8A 3CPWB 2VYQA 3ONYA 4RD2A 1DARA 1DG1G 2CF4A 3OJWA 3ONUA 1E1RA 5IYPA 2ZL5A 4RDKA 2Z6BD 1HA3A 2W6IA 2GJRA 3LO8A 4B3XA 1GAWA 4X07A 1WOOA 5THXA 1G7TA 1VQLB 4HIZA 3CC4B 1KJZA 4OP7A 3SJPA 5TRDA 4QVAA 1WSRA 4XM3A 1KD1D 5DS0A 3OZUA 3OAAA 3R6JA 3CCVB 2VNIA 3QFSA 2BGJA 1H42A 4ZGQB 1VHEA 2XOKA 2PMDA 3KEWA 4JMQA 2DY1A 2ZXHA 1IJFA 2J7KA 2JN9A 2VBTA 2OBRA 3ZZUA 1KK1A 2D3NA 1XE1A 3WBJA 3CCQB 3BNWA 4Z4YA 4X7FA 1UD6A 1N07A 2XZLA 4P6VF 4H9GA 3CRZA 3GSIA 4L8JA 2D3LA 2YWGA 3Q38A 1W2BB 2VBSA 3LVBA 1EXMA 1QG0A 1Q81D 4P22A 4C43A 1KK0A 4ZV4A 1FNMA 2X3UA 5H5JA 2C2WA 4PC2A 3ASSA 1J9ZA 1NB9A 4YEJA 1UD4A 3A8JA 3WYAA 1V0FA 4RD3A 3CXCB 2ZITA 1E79A 1H8EA 4PC1A 4X7CA 2YWEA 3CB4A 3FPKA 4PGOA 2GK7A 1G7SA 4QVJA 3AVYA 1EFRA 1QX4A 1VJSA 1M90D 4X7DA 1K8AD 5F4MA 1B2RA 3CW2A 1N08A 1Q86D 3D26A 4ASUA 3QFCA 2DCUA 5J3OA 4TMVA 4MYUA 4FN5A 1EFTA 1G7CA 1TLLA 4Z4WA 4XQFA 3I56B 2C5BA 1XB2A 2C78A 3ZC3A 3A3GA 4LBWA 1N06A 3I55B 1QUEA 1KK3A 2RC5A 4RCYA 2PIAA 1NJID 1BQEA 1E1QA 1FX0A 4M4SA 3OOCA 1R5NA 4OOVA 4TMXA 4XD7A 4DK0A 3Q6QA 4P2NA 4OPSA 1E3XA 4P6YA 5J35A 1ZM3A 4YAOA 2ZZGA 2VBVA 2ZZFA 4E0FA 3MCAA 2XNDA 1EWYA 1BX1A 3WBKA 2ZBUA 1T6XA 2D74A 4MYTA 3VR6A 3BCFA 2HCJB 4XKWA 4DQKA 1VQ6B 2LZJA 2PE3A 2E1RA 2WJVA 3OKXA 3CC7B 4XLCA 1EFUA 1FRNA 1EP3B 2GQFA 3AVUA 3WNCA 1CNEA 1E3ZA 1K73D 1NBMA 2DIEA 3FPPA 3WY9A 3H9NA 4LBZA 4XN0A 3SLNA 2PLFA 2EFGA 1WORA 1Y0RA 1HVXA 3W5UA 4QFMA 4XLEA 2Q6KA 1T5EA 2F43A 1IJEA 4XOTA 1KK2A 4Z4SA 4X05A 2GPJA 2QEXB 3AGQA 4Z4UA 2M5SA 3CPXA 5KSWB 2X6YA 4QUZA 5IYQA 2BM0A 1KQSB 1W35A 3WXMA 3WNBA 3CCJB 3PUNA 2WPDA 3ZZ0A 4ZCMA 1TUIA 1WOPA 1QGZA 3OJXA 4FXUA 5TY0A 5IYNA 1GJRA 3OW7A 4Z4TA 3QFRA 1F20A 1N05A 1QGYA 1E64A 3A1PA 5HZBA 2R9VA 2CW5A 3CMMA 4TN1A 4XLHA 3ASTA 4OPVA 4UZEA 2VNHA 4XKVA 2ZL7A 3CTAA 2JJ2A 2GK6A 4II3A 5FNZA 5HKKA 4B43A 4P3YA 2C4TA 2XNCA 4NCNA 1WTHD 4C0SA 1JJ2B 2C5HA 1BJKA 4ACBA 1GAQA 2C77A 1F60A 1FDRA 1OGIA 2ZXIA 4RLZA 4ZCLA 4DNRB 4Z4RA 2OTLB 1WU8A 4Q7JB 1W0KA 4WWVA 5E6TA 2WSSA 4CQJA 3CCSB 4YELA 5L46A 1AIPA 2GJKA 3B82A 2CK3A 3ZPNA 4DK1A 2WYRA 3J81k 1T6ZA 5BSYA 4ZCIA 3ASQA 1YJWB 1YJNB 3PA2A 1VQ7B 2OBSA 2BMWA 1UD5A 3A8KA 1YIJB 2P3MA 3AGPA 2WZNA 3G05A 5JBQA 4QV2A 2CBXA 1AMOA 4PAAA 2VJIA 1MABA 1P4MA 3CCMB 5LMZA 3OP1A 3SKBA 5AN9A 2CC2A 2DERA 1YJ9B 3I1FA 4OOSA 4RDJA 4XMYA 2BN4A 3OPOA 1A8PA 5CDFA 1V0EA 3CCRB 5IYWA 1S4MA 5KW9A 2QDXA 1E63A 1XQBA 3BY1A 2GREA 4RPDA 4P9SA 1BMFA 1N0UA 3QE2A
chains in the Genus database with same CATH topology
1EP1B 2CNDA 1QFZA 1D1NA 1GVHA 1ELOA 1VQPB 2BGIA 1S72B 3CCLB 3AVXA 1ZUNB 3ZBUA 3OZVA 1VQ8B 3E20A 4PC7A 4K1XA 1VQKB 3CCEB 1D2EA 2DETA 4AF7A 4RJLA 1VQ9B 4J0QA 4RD1A 1UMKA 1R5OA 3W2HA 1SKQA 1FNCA 1DDIA 1E62A 1VQNB 4IW3B 3PENA 3JQQA 4U9UA 4RCZA 3JQPA 3MHPA 2OK7A 1QVGB 2BV3A 2BF4A 2QN6A 3E1YE 4G1BA 1BX0A 4AC9A 1OGJA 1K9MD 3CC2B 1DDGA 2OK8A 4B44A 3QSYA 4YAFA 4M2LA 3SJZA 4N3GA 2VZLA 5TR9A 2NPFA 1B23P 2QA4B 2XEXA 1KRHA 1VQOB 2AHOA 4PC3A 4M1KA 3CMEB 3U6BA 5EMNA 4F7DA 1TVCA 3CD6B 3MMPA 1FNDA 3WNDA 1Q82D 1NDHA 1GO2A 1TTTA 2BSAA 3OZWA 4B47A 1YITB 4RD0A 1QVFB 2RC6A 3FJOA 4FK8A 3W5VA 4Y7CA 1S0UA 3U6KA 4BPRA 1KTVA 2VNKA 4M0LA 4EH1A 1FRQA 3P27A 4B4DA 3VMFA 3AVVA 1W34A 3AVTA 4NBSA 1OB2A 3W5HA 1QFYA 3P26A 1JA0A 3OW2B 3VNVA 4HE5A 5H59A 2BM1A 1I7PA 1EP2B 4RD6A 2B7CA 5TV2A 1JA1A 1R5BA 4HE6A 1VQ5B 4R71A 1JB9A 1H85A 1CNFA 4M53A 4UAJA 2OTJB 2QMUA 3ES9A 3JQRA 5GV7A 5DSZA 2FX3A 3W2GA 1U2RA 2YWFA 1QFJA 1WDTA 1YHQB 1W87A 2CRVA 2QTZA 3QFTA 4RD4A 3G71B 3VO2A 4B48A 3CCUB 2YWHA 4LBVA 1KC8D 3ZBTA 4YAUA 3VNUA 3ZZTA 1VQ4B 4YHBA 4ACAA 1ZM9A 3CMAB 4TMWA 1VQMB 2QTLA 2EIXA 2BVNA 2XNJA 1D8TA 3B78A 4AF6A 4PC6A 1OB5A 1N0VC 3W2FA 2HDNB 4LBYA 1QUFA 1Q7YD 2B5OA 5FA6A 2DEUA 3W2IA 4TMZA 2BPOA 1G7RA 4FWTA 4N3NA 3AVWA 2VNJA 3G4SB 2R6HA 2HMAA 4Y9RA 4ZGNB 4TMTA 3VO1A 1M1KD 1FNBA 1IB0A 1QGAA 4G5GA 2B7BA 1GR1A 1CQXA 4YAWA 4Y9UA 1SM4A 3W2EA 1ZM2A 5HXBA 3V76A 3B8HA 4DQLA 1QH0A 4WQMA 1YI2B 4LC0A 4YALA 4G1VA 3G6EB 1EFCA 3U2QA 4QHYA 1N8RD 1ZM4A 1JNYA 5GV8A 3CPWB 2VYQA 4RD2A 1DARA 1DG1G 3OJWA 1HA3A 3LO8A 4B3XA 1GAWA 5THXA 1G7TA 1VQLB 3CC4B 1KJZA 1KD1D 3OZUA 3CCVB 2VNIA 3QFSA 2BGJA 1H42A 4ZGQB 2PMDA 2DY1A 1IJFA 2J7KA 3ZZUA 1KK1A 1XE1A 3WBJA 3CCQB 4P6VF 4H9GA 3CRZA 1W2BB 2YWGA 3LVBA 1EXMA 1QG0A 1Q81D 4C43A 1KK0A 4ZV4A 1FNMA 2X3UA 5H5JA 4PC2A 1J9ZA 3WYAA 4RD3A 3CXCB 2ZITA 4PC1A 2YWEA 3CB4A 3FPKA 4PGOA 1G7SA 3AVYA 1QX4A 1M90D 1K8AD 1B2RA 3CW2A 1Q86D 3QFCA 2DCUA 4TMVA 4MYUA 4FN5A 1EFTA 1G7CA 1TLLA 3I56B 2C78A 1XB2A 3ZC3A 4LBWA 3I55B 1QUEA 1KK3A 2RC5A 4RCYA 2PIAA 1NJID 1BQEA 4M4SA 1R5NA 4TMXA 1ZM3A 4YAOA 3MCAA 1EWYA 1BX1A 3WBKA 2D74A 4MYTA 4DQKA 1VQ6B 2HCJB 2E1RA 3CC7B 1EFUA 1FRNA 1EP3B 2GQFA 3AVUA 3WNCA 1CNEA 1K73D 3WY9A 4LBZA 2PLFA 2EFGA 3W5UA 4QFMA 1IJEA 1KK2A 2GPJA 2QEXB 3AGQA 5KSWB 2BM0A 1KQSB 1W35A 3WXMA 3WNBA 3CCJB 3ZZ0A 4ZCMA 1TUIA 1QGZA 3OJXA 5TY0A 1GJRA 3QFRA 1F20A 1QGYA 1E64A 4TN1A 2VNHA 4B43A 4P3YA 2XNCA 4NCNA 4C0SA 1JJ2B 1BJKA 4ACBA 1GAQA 2C77A 1F60A 1FDRA 1OGIA 4ZCLA 2OTLB 4Q7JB 3CCSB 1AIPA 3B82A 3J81k 1YJWB 4ZCIA 1YJNB 1VQ7B 2BMWA 1YIJB 3AGPA 5JBQA 1AMOA 3CCMB 5AN9A 2DERA 1YJ9B 3I1FA 2BN4A 1A8PA 3CCRB 2QDXA 1E63A 1N0UA 3QE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EP1 B;  2CND A;  1QFZ A;  1D1N A;  1GVH A;  1ELO A;  1VQP B;  2BGI A;  1S72 B;  3CCL B;  3AVX A;  1ZUN B;  3ZBU A;  3OZV A;  1VQ8 B;  3E20 A;  4PC7 A;  4K1X A;  1VQK B;  3CCE B;  1D2E A;  2DET A;  4AF7 A;  4RJL A;  1VQ9 B;  4J0Q A;  4RD1 A;  1UMK A;  1R5O A;  3W2H A;  1SKQ A;  1FNC A;  1DDI A;  1E62 A;  1VQN B;  4IW3 B;  3PEN A;  3JQQ A;  4U9U A;  4RCZ A;  3JQP A;  3MHP A;  2OK7 A;  1QVG B;  2BV3 A;  2BF4 A;  2QN6 A;  3E1Y E;  4G1B A;  1BX0 A;  4AC9 A;  1OGJ A;  1K9M D;  3CC2 B;  1DDG A;  2OK8 A;  4B44 A;  3QSY A;  4YAF A;  4M2L A;  3SJZ A;  4N3G A;  2VZL A;  5TR9 A;  2NPF A;  1B23 P;  2QA4 B;  2XEX A;  1KRH A;  1VQO B;  2AHO A;  4PC3 A;  4M1K A;  3CME B;  3U6B A;  5EMN A;  4F7D A;  1TVC A;  3CD6 B;  3MMP A;  1FND A;  3WND A;  1Q82 D;  1NDH A;  1GO2 A;  1TTT A;  2BSA A;  3OZW A;  4B47 A;  1YIT B;  4RD0 A;  1QVF B;  2RC6 A;  3FJO A;  4FK8 A;  3W5V A;  4Y7C A;  1S0U A;  3U6K A;  4BPR A;  1KTV A;  2VNK A;  4M0L A;  4EH1 A;  1FRQ A;  3P27 A;  4B4D A;  3VMF A;  3AVV A;  1W34 A;  3AVT A;  4NBS A;  1OB2 A;  3W5H A;  1QFY A;  3P26 A;  1JA0 A;  3OW2 B;  3VNV A;  4HE5 A;  5H59 A;  2BM1 A;  1I7P A;  1EP2 B;  4RD6 A;  2B7C A;  5TV2 A;  1JA1 A;  1R5B A;  4HE6 A;  1VQ5 B;  4R71 A;  1JB9 A;  1H85 A;  1CNF A;  4M53 A;  4UAJ A;  2OTJ B;  2QMU A;  3ES9 A;  3JQR A;  5GV7 A;  5DSZ A;  2FX3 A;  3W2G A;  1U2R A;  2YWF A;  1QFJ A;  1WDT A;  1YHQ B;  1W87 A;  2CRV A;  2QTZ A;  3QFT A;  4RD4 A;  3G71 B;  3VO2 A;  4B48 A;  3CCU B;  2YWH A;  4LBV A;  1KC8 D;  3ZBT A;  4YAU A;  3VNU A;  3ZZT A;  1VQ4 B;  4YHB A;  4ACA A;  1ZM9 A;  3CMA B;  4TMW A;  1VQM B;  2QTL A;  2EIX A;  2BVN A;  2XNJ A;  1D8T A;  3B78 A;  4AF6 A;  4PC6 A;  1OB5 A;  1N0V C;  3W2F A;  2HDN B;  4LBY A;  1QUF A;  1Q7Y D;  2B5O A;  5FA6 A;  2DEU A;  3W2I A;  4TMZ A;  2BPO A;  1G7R A;  4FWT A;  4N3N A;  3AVW A;  2VNJ A;  3G4S B;  2R6H A;  2HMA A;  4Y9R A;  4ZGN B;  4TMT A;  3VO1 A;  1M1K D;  1FNB A;  1IB0 A;  1QGA A;  4G5G A;  2B7B A;  1GR1 A;  1CQX A;  4YAW A;  4Y9U A;  1SM4 A;  3W2E A;  1ZM2 A;  5HXB A;  3V76 A;  3B8H A;  4DQL A;  1QH0 A;  4WQM A;  1YI2 B;  4LC0 A;  4YAL A;  4G1V A;  3G6E B;  1EFC A;  3U2Q A;  4QHY A;  1N8R D;  1ZM4 A;  1JNY A;  5GV8 A;  3CPW B;  2VYQ A;  4RD2 A;  1DAR A;  1DG1 G;  3OJW A;  1HA3 A;  3LO8 A;  4B3X A;  1GAW A;  5THX A;  1G7T A;  1VQL B;  3CC4 B;  1KJZ A;  1KD1 D;  3OZU A;  3CCV B;  2VNI A;  3QFS A;  2BGJ A;  1H42 A;  4ZGQ B;  2PMD A;  2DY1 A;  1IJF A;  2J7K A;  3ZZU A;  1KK1 A;  1XE1 A;  3WBJ A;  3CCQ B;  4P6V F;  4H9G A;  3CRZ A;  1W2B B;  2YWG A;  3LVB A;  1EXM A;  1QG0 A;  1Q81 D;  4C43 A;  1KK0 A;  4ZV4 A;  1FNM A;  2X3U A;  5H5J A;  4PC2 A;  1J9Z A;  3WYA A;  4RD3 A;  3CXC B;  2ZIT A;  4PC1 A;  2YWE A;  3CB4 A;  3FPK A;  4PGO A;  1G7S A;  3AVY A;  1QX4 A;  1M90 D;  1K8A D;  1B2R A;  3CW2 A;  1Q86 D;  3QFC A;  2DCU A;  4TMV A;  4MYU A;  4FN5 A;  1EFT A;  1G7C A;  1TLL A;  3I56 B;  2C78 A;  1XB2 A;  3ZC3 A;  4LBW A;  3I55 B;  1QUE A;  1KK3 A;  2RC5 A;  4RCY A;  2PIA A;  1NJI D;  1BQE A;  4M4S A;  1R5N A;  4TMX A;  1ZM3 A;  4YAO A;  3MCA A;  1EWY A;  1BX1 A;  3WBK A;  2D74 A;  4MYT A;  4DQK A;  1VQ6 B;  2HCJ B;  2E1R A;  3CC7 B;  1EFU A;  1FRN A;  1EP3 B;  2GQF A;  3AVU A;  3WNC A;  1CNE A;  1K73 D;  3WY9 A;  4LBZ A;  2PLF A;  2EFG A;  3W5U A;  4QFM A;  1IJE A;  1KK2 A;  2GPJ A;  2QEX B;  3AGQ A;  5KSW B;  2BM0 A;  1KQS B;  1W35 A;  3WXM A;  3WNB A;  3CCJ B;  3ZZ0 A;  4ZCM A;  1TUI A;  1QGZ A;  3OJX A;  5TY0 A;  1GJR A;  3QFR A;  1F20 A;  1QGY A;  1E64 A;  4TN1 A;  2VNH A;  4B43 A;  4P3Y A;  2XNC A;  4NCN A;  4C0S A;  1JJ2 B;  1BJK A;  4ACB A;  1GAQ A;  2C77 A;  1F60 A;  1FDR A;  1OGI A;  4ZCL A;  2OTL B;  4Q7J B;  3CCS B;  1AIP A;  3B82 A;  3J81 k;  1YJW B;  4ZCI A;  1YJN B;  1VQ7 B;  2BMW A;  1YIJ B;  3AGP A;  5JBQ A;  1AMO A;  3CCM B;  5AN9 A;  2DER A;  1YJ9 B;  3I1F A;  2BN4 A;  1A8P A;  3CCR B;  2QDX A;  1E63 A;  1N0U A;  3QE2 A; 
#chains in the Genus database with same CATH topology
 5DN6 A;  1EP1 B;  1OB0 A;  2CND A;  2DOG A;  1QFZ A;  1D1N A;  1GVH A;  1ELO A;  1PJ5 A;  2ZTN A;  2BGI A;  1VQP B;  2X6W A;  4XLF A;  1S72 B;  1VLY A;  1WSV A;  4KKS A;  5A89 A;  3CCL B;  3AVX A;  1ZUN B;  3ZBU A;  3OZV A;  4II2 A;  3T53 B;  2VBU A;  4WZL A;  1PKV A;  1VQ8 B;  3E20 A;  4PC7 A;  3V7A A;  4K1X A;  1VF7 A;  1VQK B;  4XOR A;  3ASR A;  3CCE B;  1D2E A;  2DET A;  4AF7 A;  2WJY A;  4Z1M A;  4G7X A;  4RJL A;  1VQ9 B;  2W6J A;  4J0Q A;  2X8K A;  4RD1 A;  4P12 A;  1YLO A;  1UMK A;  3A8I A;  1R5O A;  2JJ1 A;  2X85 A;  1SKQ A;  2WR8 A;  1FNC A;  3W2H A;  1DDI A;  5B6I A;  2X53 S;  4G6I A;  1E62 A;  4DNT B;  4XL9 A;  1VQN B;  4IW3 B;  3PEN A;  3JQQ A;  4U9U A;  3OEH A;  3PA1 A;  4RCZ A;  1W9X A;  3JQP A;  3MHP A;  2OK7 A;  3H94 A;  3NE5 B;  5FIU A;  1QVG B;  2BV3 A;  1MRZ A;  2BF4 A;  2QN6 A;  3E1Y E;  4G1B A;  5IYR A;  1BX0 A;  3PVD A;  4RPB A;  2V7X A;  3CP8 A;  4AC9 A;  4OOX A;  1OGJ A;  2DYI A;  1K9M D;  1WPC A;  2F4N A;  3CC2 B;  1DDG A;  2OK8 A;  2ZZE A;  4B44 A;  3QSY A;  3LQE A;  1RQP A;  3SEJ A;  4YAF A;  4M2L A;  3BY2 A;  3SJZ A;  4N3G A;  1H8H A;  2VZL A;  3ISX A;  5TR9 A;  2NV4 A;  4P1V A;  2XZP A;  2NPF A;  1B23 P;  2QA4 B;  2XEX A;  1KRH A;  2OBT A;  1VQO B;  3PUM A;  3T51 B;  2AHO A;  4XON A;  3KL9 A;  5IK2 A;  4PC3 A;  1WP6 A;  4M1K A;  3CME B;  1W0J A;  3U6B A;  4RM0 A;  3OEE A;  5EMN A;  4F7D A;  1TVC A;  3ZIA A;  3CD6 B;  1YX2 A;  4WZT A;  3MMP A;  4RDL A;  1FND A;  1UD2 A;  3WND A;  1Q82 D;  1NDH A;  1GO2 A;  1TTT A;  1COW A;  2BSA A;  3OZW A;  2V7U A;  4UZU A;  4XN3 A;  4B3G A;  2V7W A;  2Q6I A;  4B47 A;  1V5V A;  1YIT B;  4RD0 A;  1QVF B;  2RC6 A;  3FJO A;  4FK8 A;  3W5V A;  2X0K A;  2VJJ A;  4NNJ A;  4Y7C A;  1S0U A;  4BPR A;  3U6K A;  4B3F X;  1KTV A;  5F4O A;  2VNK A;  4M0L A;  4EH1 A;  3GQB A;  3Q3A A;  3GVK A;  4TSF A;  1FRQ A;  3P27 A;  2QE7 A;  1XFO A;  4B4D A;  3VMF A;  3AVV A;  1W34 A;  3AVT A;  4NBS A;  1OB2 A;  1K28 D;  2FVG A;  3W5H A;  1QFY A;  1Q9S A;  1WOS A;  5BSX A;  2X6X A;  3P26 A;  1JA0 A;  3OW2 B;  3VNV A;  2F1L A;  2ZBV A;  4HE5 A;  3A35 A;  4P3I A;  4X06 A;  2I1L A;  1UD3 A;  4AVZ A;  1OHH A;  4OPO A;  5H59 A;  4X8I A;  3A3B A;  5A88 A;  2BM1 A;  1I7P A;  4P26 A;  2XGJ A;  1EP2 B;  4RD6 A;  4ROX A;  1E43 A;  3JU4 A;  2B7C A;  5TV2 A;  1JA1 A;  2V7V A;  1R5B A;  4HE6 A;  1VQ5 B;  4XNF A;  4R71 A;  1KZL A;  1JB9 A;  1H85 A;  1CNF A;  2F1M A;  2Q6L A;  4M53 A;  4UAJ A;  1BPL A;  4TT3 A;  4YXW A;  2OTJ B;  2QMU A;  2JIZ A;  3ES9 A;  1UD8 A;  3BC9 A;  4X0C A;  1Y0Y A;  1T6Y A;  3JQR A;  2KVO A;  5GV7 A;  5DSZ A;  4P25 A;  2FX3 A;  4WZE A;  5F4J A;  3W2G A;  1U2R A;  2YWF A;  1QFJ A;  1WDT A;  1YHQ B;  1W87 A;  2CRV A;  2QTZ A;  3QFT A;  4RD4 A;  3G71 B;  3OE7 A;  3VO2 A;  3HAG A;  3GIR A;  4G7W A;  2YWH A;  4B48 A;  3CCU B;  1I18 A;  1NB0 A;  3DDY A;  4LBV A;  3GVJ A;  3Q6R A;  2JDI A;  1SKY B;  3ZBT A;  1KC8 D;  2V7Q A;  4YAU A;  3FKS A;  4KKU A;  3VNU A;  4KKT A;  3ZZT A;  2XZO A;  1VLO A;  2D9R A;  1PJ6 A;  4XOP A;  1VQ4 B;  4YHB A;  1HZE A;  1I8D A;  4GQN A;  4PAB A;  4ACA A;  1ZM9 A;  3CMA B;  4TMW A;  1VQM B;  3Q39 A;  2QTL A;  2EIX A;  2BVN A;  4X7E A;  2XNJ A;  1D8T A;  3B78 A;  4AF6 A;  3SLD A;  3BQJ A;  2V7T A;  4PC6 A;  1OB5 A;  1N0V C;  3CP2 A;  3R6K A;  4TKO B;  2ZTG A;  3W2F A;  2HDN B;  2V4D A;  2E1B A;  1QUF A;  2ZZQ A;  4LBY A;  5HZA A;  3OFN A;  2B5O A;  1NRK A;  3LNN A;  1Q7Y D;  4XR6 A;  5A8A A;  5FA6 A;  3CES A;  2DEU A;  3W2I A;  4TMZ A;  2ZL6 A;  1RQR A;  2BPO A;  1G7R A;  1IHM A;  4FWT A;  4N3N A;  3AVW A;  2VNJ A;  3G4S B;  2R6H A;  5FO1 A;  3ASP A;  2HMA A;  4Y9R A;  4ZGN B;  2V31 A;  2WZP P;  4TMT A;  3RY8 A;  3VO1 A;  1M1K D;  5KNL A;  1FNB A;  4WZK A;  1IB0 A;  1QGA A;  4G5G A;  2GJP A;  4XLA A;  4Z4V A;  2B7B A;  3ZUG A;  3BH4 A;  4Z4Z A;  1PJ7 A;  1GR1 A;  5FO0 A;  1CQX A;  3GVL A;  4YAW A;  4Y9U A;  1SM4 A;  3W2E A;  2Q6O A;  1ZM2 A;  2HLD A;  5HXB A;  3V76 A;  3LQ6 A;  2OYN A;  3B8H A;  3T56 B;  1VHO A;  4UZF A;  5FL7 A;  1KMH A;  4DQL A;  1QH0 A;  3BCD A;  4WQM A;  1YI2 B;  4LC0 A;  4YAL A;  3WQZ A;  4G1V A;  3G6E B;  1EFC A;  2C4U A;  4QHY A;  3U2Q A;  1ZM4 A;  1N8R D;  1JNY A;  2QGG A;  1BLI A;  5GV8 A;  3CPW B;  2VYQ A;  3ONY A;  4RD2 A;  1DAR A;  1DG1 G;  2CF4 A;  3OJW A;  3ONU A;  1E1R A;  5IYP A;  2ZL5 A;  4RDK A;  2Z6B D;  1HA3 A;  2W6I A;  2GJR A;  3LO8 A;  4B3X A;  1GAW A;  4X07 A;  1WOO A;  5THX A;  1G7T A;  1VQL B;  4HIZ A;  3CC4 B;  1KJZ A;  4OP7 A;  3SJP A;  5TRD A;  4QVA A;  1WSR A;  4XM3 A;  1KD1 D;  5DS0 A;  3OZU A;  3OAA A;  3R6J A;  3CCV B;  2VNI A;  3QFS A;  2BGJ A;  1H42 A;  4ZGQ B;  1VHE A;  2XOK A;  2PMD A;  3KEW A;  4JMQ A;  2DY1 A;  2ZXH A;  1IJF A;  2J7K A;  2JN9 A;  2VBT A;  2OBR A;  3ZZU A;  1KK1 A;  2D3N A;  1XE1 A;  3WBJ A;  3CCQ B;  3BNW A;  4Z4Y A;  4X7F A;  1UD6 A;  1N07 A;  2XZL A;  4P6V F;  4H9G A;  3CRZ A;  3GSI A;  4L8J A;  2D3L A;  2YWG A;  3Q38 A;  1W2B B;  2VBS A;  3LVB A;  1EXM A;  1QG0 A;  1Q81 D;  4P22 A;  4C43 A;  1KK0 A;  4ZV4 A;  1FNM A;  2X3U A;  5H5J A;  2C2W A;  4PC2 A;  3ASS A;  1J9Z A;  1NB9 A;  4YEJ A;  1UD4 A;  3A8J A;  3WYA A;  1V0F A;  4RD3 A;  3CXC B;  2ZIT A;  1E79 A;  1H8E A;  4PC1 A;  4X7C A;  2YWE A;  3CB4 A;  3FPK A;  4PGO A;  2GK7 A;  1G7S A;  4QVJ A;  3AVY A;  1EFR A;  1QX4 A;  1VJS A;  1M90 D;  4X7D A;  1K8A D;  5F4M A;  1B2R A;  3CW2 A;  1N08 A;  1Q86 D;  3D26 A;  4ASU A;  3QFC A;  2DCU A;  5J3O A;  4TMV A;  4MYU A;  4FN5 A;  1EFT A;  1G7C A;  1TLL A;  4Z4W A;  4XQF A;  3I56 B;  2C5B A;  1XB2 A;  2C78 A;  3ZC3 A;  3A3G A;  4LBW A;  1N06 A;  3I55 B;  1QUE A;  1KK3 A;  2RC5 A;  4RCY A;  2PIA A;  1NJI D;  1BQE A;  1E1Q A;  1FX0 A;  4M4S A;  3OOC A;  1R5N A;  4OOV A;  4TMX A;  4XD7 A;  4DK0 A;  3Q6Q A;  4P2N A;  4OPS A;  1E3X A;  4P6Y A;  5J35 A;  1ZM3 A;  4YAO A;  2ZZG A;  2VBV A;  2ZZF A;  4E0F A;  3MCA A;  2XND A;  1EWY A;  1BX1 A;  3WBK A;  2ZBU A;  1T6X A;  2D74 A;  4MYT A;  3VR6 A;  3BCF A;  2HCJ B;  4XKW A;  4DQK A;  1VQ6 B;  2LZJ A;  2PE3 A;  2E1R A;  2WJV A;  3OKX A;  3CC7 B;  4XLC A;  1EFU A;  1FRN A;  1EP3 B;  2GQF A;  3AVU A;  3WNC A;  1CNE A;  1E3Z A;  1K73 D;  1NBM A;  2DIE A;  3FPP A;  3WY9 A;  3H9N A;  4LBZ A;  4XN0 A;  3SLN A;  2PLF A;  2EFG A;  1WOR A;  1Y0R A;  1HVX A;  3W5U A;  4QFM A;  4XLE A;  2Q6K A;  1T5E A;  2F43 A;  1IJE A;  4XOT A;  1KK2 A;  4Z4S A;  4X05 A;  2GPJ A;  2QEX B;  3AGQ A;  4Z4U A;  2M5S A;  3CPX A;  5KSW B;  2X6Y A;  4QUZ A;  5IYQ A;  2BM0 A;  1KQS B;  1W35 A;  3WXM A;  3WNB A;  3CCJ B;  3PUN A;  2WPD A;  3ZZ0 A;  4ZCM A;  1TUI A;  1WOP A;  1QGZ A;  3OJX A;  4FXU A;  5TY0 A;  5IYN A;  1GJR A;  3OW7 A;  4Z4T A;  3QFR A;  1F20 A;  1N05 A;  1QGY A;  1E64 A;  3A1P A;  5HZB A;  2R9V A;  2CW5 A;  3CMM A;  4TN1 A;  4XLH A;  3AST A;  4OPV A;  4UZE A;  2VNH A;  4XKV A;  2ZL7 A;  3CTA A;  2JJ2 A;  2GK6 A;  4II3 A;  5FNZ A;  5HKK A;  4B43 A;  4P3Y A;  2C4T A;  2XNC A;  4NCN A;  1WTH D;  4C0S A;  1JJ2 B;  2C5H A;  1BJK A;  4ACB A;  1GAQ A;  2C77 A;  1F60 A;  1FDR A;  1OGI A;  2ZXI A;  4RLZ A;  4ZCL A;  4DNR B;  4Z4R A;  2OTL B;  1WU8 A;  4Q7J B;  1W0K A;  4WWV A;  5E6T A;  2WSS A;  4CQJ A;  3CCS B;  4YEL A;  5L46 A;  1AIP A;  2GJK A;  3B82 A;  2CK3 A;  3ZPN A;  4DK1 A;  2WYR A;  3J81 k;  1T6Z A;  5BSY A;  4ZCI A;  3ASQ A;  1YJW B;  1YJN B;  3PA2 A;  1VQ7 B;  2OBS A;  2BMW A;  1UD5 A;  3A8K A;  1YIJ B;  2P3M A;  3AGP A;  2WZN A;  3G05 A;  5JBQ A;  4QV2 A;  2CBX A;  1AMO A;  4PAA A;  2VJI A;  1MAB A;  1P4M A;  3CCM B;  5LMZ A;  3OP1 A;  3SKB A;  5AN9 A;  2CC2 A;  2DER A;  1YJ9 B;  3I1F A;  4OOS A;  4RDJ A;  4XMY A;  2BN4 A;  3OPO A;  1A8P A;  5CDF A;  1V0E A;  3CCR B;  5IYW A;  1S4M A;  5KW9 A;  2QDX A;  1E63 A;  1XQB A;  3BY1 A;  2GRE A;  4RPD A;  4P9S A;  1BMF A;  1N0U A;  3QE2 A; 
#chains in the Genus database with same CATH homology
 1EP1 B;  2CND A;  1QFZ A;  1D1N A;  1GVH A;  1ELO A;  1VQP B;  2BGI A;  1S72 B;  3CCL B;  3AVX A;  1ZUN B;  3ZBU A;  3OZV A;  1VQ8 B;  3E20 A;  4PC7 A;  4K1X A;  1VQK B;  3CCE B;  1D2E A;  2DET A;  4AF7 A;  4RJL A;  1VQ9 B;  4J0Q A;  4RD1 A;  1UMK A;  1R5O A;  3W2H A;  1SKQ A;  1FNC A;  1DDI A;  1E62 A;  1VQN B;  4IW3 B;  3PEN A;  3JQQ A;  4U9U A;  4RCZ A;  3JQP A;  3MHP A;  2OK7 A;  1QVG B;  2BV3 A;  2BF4 A;  2QN6 A;  3E1Y E;  4G1B A;  1BX0 A;  4AC9 A;  1OGJ A;  1K9M D;  3CC2 B;  1DDG A;  2OK8 A;  4B44 A;  3QSY A;  4YAF A;  4M2L A;  3SJZ A;  4N3G A;  2VZL A;  5TR9 A;  2NPF A;  1B23 P;  2QA4 B;  2XEX A;  1KRH A;  1VQO B;  2AHO A;  4PC3 A;  4M1K A;  3CME B;  3U6B A;  5EMN A;  4F7D A;  1TVC A;  3CD6 B;  3MMP A;  1FND A;  3WND A;  1Q82 D;  1NDH A;  1GO2 A;  1TTT A;  2BSA A;  3OZW A;  4B47 A;  1YIT B;  4RD0 A;  1QVF B;  2RC6 A;  3FJO A;  4FK8 A;  3W5V A;  4Y7C A;  1S0U A;  3U6K A;  4BPR A;  1KTV A;  2VNK A;  4M0L A;  4EH1 A;  1FRQ A;  3P27 A;  4B4D A;  3VMF A;  3AVV A;  1W34 A;  3AVT A;  4NBS A;  1OB2 A;  3W5H A;  1QFY A;  3P26 A;  1JA0 A;  3OW2 B;  3VNV A;  4HE5 A;  5H59 A;  2BM1 A;  1I7P A;  1EP2 B;  4RD6 A;  2B7C A;  5TV2 A;  1JA1 A;  1R5B A;  4HE6 A;  1VQ5 B;  4R71 A;  1JB9 A;  1H85 A;  1CNF A;  4M53 A;  4UAJ A;  2OTJ B;  2QMU A;  3ES9 A;  3JQR A;  5GV7 A;  5DSZ A;  2FX3 A;  3W2G A;  1U2R A;  2YWF A;  1QFJ A;  1WDT A;  1YHQ B;  1W87 A;  2CRV A;  2QTZ A;  3QFT A;  4RD4 A;  3G71 B;  3VO2 A;  4B48 A;  3CCU B;  2YWH A;  4LBV A;  1KC8 D;  3ZBT A;  4YAU A;  3VNU A;  3ZZT A;  1VQ4 B;  4YHB A;  4ACA A;  1ZM9 A;  3CMA B;  4TMW A;  1VQM B;  2QTL A;  2EIX A;  2BVN A;  2XNJ A;  1D8T A;  3B78 A;  4AF6 A;  4PC6 A;  1OB5 A;  1N0V C;  3W2F A;  2HDN B;  4LBY A;  1QUF A;  1Q7Y D;  2B5O A;  5FA6 A;  2DEU A;  3W2I A;  4TMZ A;  2BPO A;  1G7R A;  4FWT A;  4N3N A;  3AVW A;  2VNJ A;  3G4S B;  2R6H A;  2HMA A;  4Y9R A;  4ZGN B;  4TMT A;  3VO1 A;  1M1K D;  1FNB A;  1IB0 A;  1QGA A;  4G5G A;  2B7B A;  1GR1 A;  1CQX A;  4YAW A;  4Y9U A;  1SM4 A;  3W2E A;  1ZM2 A;  5HXB A;  3V76 A;  3B8H A;  4DQL A;  1QH0 A;  4WQM A;  1YI2 B;  4LC0 A;  4YAL A;  4G1V A;  3G6E B;  1EFC A;  3U2Q A;  4QHY A;  1N8R D;  1ZM4 A;  1JNY A;  5GV8 A;  3CPW B;  2VYQ A;  4RD2 A;  1DAR A;  1DG1 G;  3OJW A;  1HA3 A;  3LO8 A;  4B3X A;  1GAW A;  5THX A;  1G7T A;  1VQL B;  3CC4 B;  1KJZ A;  1KD1 D;  3OZU A;  3CCV B;  2VNI A;  3QFS A;  2BGJ A;  1H42 A;  4ZGQ B;  2PMD A;  2DY1 A;  1IJF A;  2J7K A;  3ZZU A;  1KK1 A;  1XE1 A;  3WBJ A;  3CCQ B;  4P6V F;  4H9G A;  3CRZ A;  1W2B B;  2YWG A;  3LVB A;  1EXM A;  1QG0 A;  1Q81 D;  4C43 A;  1KK0 A;  4ZV4 A;  1FNM A;  2X3U A;  5H5J A;  4PC2 A;  1J9Z A;  3WYA A;  4RD3 A;  3CXC B;  2ZIT A;  4PC1 A;  2YWE A;  3CB4 A;  3FPK A;  4PGO A;  1G7S A;  3AVY A;  1QX4 A;  1M90 D;  1K8A D;  1B2R A;  3CW2 A;  1Q86 D;  3QFC A;  2DCU A;  4TMV A;  4MYU A;  4FN5 A;  1EFT A;  1G7C A;  1TLL A;  3I56 B;  2C78 A;  1XB2 A;  3ZC3 A;  4LBW A;  3I55 B;  1QUE A;  1KK3 A;  2RC5 A;  4RCY A;  2PIA A;  1NJI D;  1BQE A;  4M4S A;  1R5N A;  4TMX A;  1ZM3 A;  4YAO A;  3MCA A;  1EWY A;  1BX1 A;  3WBK A;  2D74 A;  4MYT A;  4DQK A;  1VQ6 B;  2HCJ B;  2E1R A;  3CC7 B;  1EFU A;  1FRN A;  1EP3 B;  2GQF A;  3AVU A;  3WNC A;  1CNE A;  1K73 D;  3WY9 A;  4LBZ A;  2PLF A;  2EFG A;  3W5U A;  4QFM A;  1IJE A;  1KK2 A;  2GPJ A;  2QEX B;  3AGQ A;  5KSW B;  2BM0 A;  1KQS B;  1W35 A;  3WXM A;  3WNB A;  3CCJ B;  3ZZ0 A;  4ZCM A;  1TUI A;  1QGZ A;  3OJX A;  5TY0 A;  1GJR A;  3QFR A;  1F20 A;  1QGY A;  1E64 A;  4TN1 A;  2VNH A;  4B43 A;  4P3Y A;  2XNC A;  4NCN A;  4C0S A;  1JJ2 B;  1BJK A;  4ACB A;  1GAQ A;  2C77 A;  1F60 A;  1FDR A;  1OGI A;  4ZCL A;  2OTL B;  4Q7J B;  3CCS B;  1AIP A;  3B82 A;  3J81 k;  1YJW B;  4ZCI A;  1YJN B;  1VQ7 B;  2BMW A;  1YIJ B;  3AGP A;  5JBQ A;  1AMO A;  3CCM B;  5AN9 A;  2DER A;  1YJ9 B;  3I1F A;  2BN4 A;  1A8P A;  3CCR B;  2QDX A;  1E63 A;  1N0U A;  3QE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...