1D2CA

Methyltransferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
292
structure length
292
Chain Sequence
b'VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLYCINE N-METHYLTRANSFERASE)
publication title Mechanisms for auto-inhibition and forced product release in glycine N-methyltransferase: crystal structures of wild-type, mutant R175K and S-adenosylhomocysteine-bound R175K enzymes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 76
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1999-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1d2cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1d2cA02
3VC2A 2PX4A 5DM1A 5GINE 5E8JA 1KPHA 3PS9A 2ZBQA 1RI3A 3HNRA 3HA7A 3ID6C 4ISCA 3TLJA 4F86A 5KQRA 1AQIA 5EKXA 4PYNA 1DCTA 5LSAA 3LCUA 2N47A 4WXHA 2HNKA 5EQJB 2G70A 3VSEA 5CD1A 3HCEA 1R8YA 3LDGA 3GCZA 4H0NA 3HTXA 4FGZA 4E2ZA 2P41A 3SSMA 3LSTA 1X19A 1FP1D 3P2IA 4OX9Y 1ZGAA 2QE6A 3HCAA 4X1OA 4PYMA 3OCJA 3TPZA 3UBTA 5LR6A 4R8RA 4ER0A 4C03A 4YMHA 5JUWA 2OZVA 3P97A 2NYUA 5FTWA 3M6UA 3LPMA 1MJFA 4P58A 4RVFA 4Y30A 3P9KA 4HGZA 2P40A 3FPFA 3OU2A 2PY6A 4GOLD 4RSRA 5CVUA 1BHJA 2PXAA 4CWAA 5DXAA 3CJTA 3FPGA 3KR9A 2KW5A 2OPBA 4RYLA 3UA3A 3CKKA 2Y1WA 3GIWA 1KHHA 3UWPA 3BWYA 3SMQA 1KPIA 3DMHA 3FPJA 3MGGA 4YMGA 1ZQ9A 5E9JA 3HM2A 5F2OA 1BC5A 2ZTHA 4ER5A 5K0JA 1RI5A 2O05A 2JHPA 2O06A 4FR0A 4R6XA 1NV8A 3C3YA 5CVDA 2IP2A 5LQKA 2JHAA 5EG5A 3S68A 4MIKA 4DKJA 1WXWA 3PVCA 1VQ1A 1D2HA 3UJBA 3NDJA 4X41A 4HH4A 2ZW9A 5F2KA 4HC4A 1I9GA 3T7RA 1JTFA 5ICGA 4RX1A 4X60A 1YUBA 1RJEA 3KU1A 4M36A 1XJ5A 3E7PA 4RTRA 2VZ9A 3NVKI 3EVDA 2V7EA 3LHDA 2DULA 5EHIA 10MHA 1R00A 2B78A 1L3CA 3QV2A 4GUAA 2ZIGA 3DUWA 5CVJA 3TQSA 5K01A 3KQYA 4PIMA 5LQRA 2H1RA 3G8AA 5DX0A 3KQOA 5T67A 1YF3A 5D1HA 1NW8A 3K0BA 3NJRA 5EZQA 5CVVA 2PT6A 2YXDA 4C05A 1SUSA 1SQFA 2JH9A 4AZTA 5GIOE 3UZUA 2AN5A 2ONYA 2ZWVA 2FK8A 3A4TA 2B25A 1R74A 4F85A 4IKPA 1JG1A 3PTAA 2OO3A 2O0LA 2ZLBA 3GRRA 5EMLA 3GNLA 3DMFA 1WS6A 3LGAA 2R6ZA 5EC8A 5EVJA 4RTLA 5DTMA 2JH8A 2JG3A 3OZSA 3MHTA 3H2BA 4YUVA 1VP9A 3KPUA 5DPMA 4K6MA 1JQ3A 5E1DA 3L8DA 4EQZA 5CVEA 5LQUA 1L9KA 1RJGA 2G8NA 3DXZA 1KYZA 1G8AA 2PX2A 4O29A 5LQJA 3NW9A 4PWYA 2OKCA 4V0QA 2QM3A 5HIKA 2G71A 3I53A 4RTKA 2PXXA 4GBED 1QYRA 5K03A 4V0RA 1VLMA 1ORHA 5K0NA 2IBSA 3PX3A 1XDSA 3MERA 4XCXA 3DH0A 4FZVA 1G60A 5FHRA 2P3OA 4YUXA 4MHTA 3BGDA 3R3HA 1JG3A 1JG2A 2ZBPA 3HCDA 4MQ4A 1NV9A 2QRVB 1P39A 1FPQA 2Z6QA 3G2QA 5K05A 2Z6AA 1RJFA 3A25A 3AXTA 3EVBA 3G88A 2AOWA 4LG1A 1YFJA 4CXMA 1FBNA 2OBFA 2BH2A 3HVIA 3G5TA 3KKZA 1L1EA 1QANA 4GOOD 3G2PA 2VDWA 5EHGA 4QPPA 3MCZA 2AZTA 3B89A 3LBFA 5HIIA 5FQNA 1KR5A 3I9FA 4RWZA 3QOWA 5C1IA 3UJ6A 4EMSA 1NW5A 2GS9A 3M6VA 5DX1A 1M0EA 3EVAA 4PIPA 5MHTA 5K0GA 5E9QA 4YUYA 2NXEA 3UJ8A 5KQSA 3V8VA 3DP7A 1M6EX 1NE2A 5EIFA 3CJQA 5FULA 2PV0A 4KDRA 3EEOA 2H11A 5EMJA 2AOUA 2JJQA 3CCFA 3KQMA 2IBTA 4PONA 5DTRA 2F8LA 3CC8A 3MTIA 5B1SA 4BY9E 3FTCA 1Z3CA 2A14A 4QVKA 5DRYA 3DMGA 3I58A 3NWBA 5FUBA 4OQDA 1EIZA 3E05A 3HA5A 5DT2A 2VDVE 3R6TA 1D2CA 3G2OA 2PXCA 3BWCA 3KQTA 3LBYA 3DXXA 4Z2YA 4OA8A 4M38A 3KR0A 4M37A 2IH4A 3B7PA 2AN3A 1JQDA 1XCLA 2ZIFA 4U7TB 2P3LA 3KPVA 1G38A 7MHTA 3EGEA 3GXOA 4RTJA 2ZULA 3SR4A 3UJ9A 1WZNA 3SSNA 1SQGA 3GDHA 1ORIA 3FPHA 4E70A 2P7IA 4FT4A 2PSSA 2B2CA 1XTPA 1JSZA 2YQZA 3D2LA 5P8WA 3KQVA 4OBWA 3KQQA 3JWIA 4P7KA 2O57A 5DX8A 1VE3A 1YB2A 4DZRA 5HOQA 2CWWA 5HIJA 3I5UA 1IM8A 1DL5A 3O4FA 1F3LA 3HVJA 5F2NA 5GM1A 3NDIA 2PBFA 3ELDA 4QVGA 5DRTA 4BP3A 3OU7A 3BKWA 4HG2A 3THSA 3BGIA 4QDJA 4C04A 5K8VA 1P1BA 3UJ7A 1I4WA 1RI2A 3HCCA 1EJ0A 1HNNA 3K6RA 2AOUB 5K0LA 5K0EA 3R9XB 4Y2HA 5CCXA 1OR8A 3GRYA 1I1NA 3BT7A 5LQAA 5JR3A 3FUVA 1SVUA 1T43A 2XVAA 3LECA 3OE4A 4GOMD 1G55A 3MTEA 4KIGA 4X61A 2P3QA 2YXEA 3B3FA 5DSXA 5E8RA 5K0BA 2IIPA 5GM2A 2QRVA 3NVMB 1X1BA 3RODA 3X0DA 5HEKA 3IEIA 2PJDA 2HR1A 2YX1A 4G56A 4YUWA 4B17A 2P7HA 1JTEA 5EGSA 1XVAA 3AWIA 5IH3A 1JG4A 1ZG3A 2XBMA 1NW7A 3GGDA 4X63A 3GJYA 4AZWA 2P8JA 3IV6A 2YVLA 3KQSA 3R24A 4P7FA 4PYLA 5ICFA 3VYWA 2GH1A 2FHPA 5CUQA 1TPYA 5EKUA 1L3BA 4A6DA 2HV9A 2E5WA 3G8BA 1P1CA 2P35A 5U4XA 3FTEA 2GAFA 2ERCA 5FWDA 2PWYA 3EPPA 2BZGA 3P2EA 4E2WA 1SG9A 1R18A 2HMYB 4RVGA 1RI1A 1Q0SA 1NKVA 1O9HA 2XYQA 4EKGA 3M6WA 2O07A 3M70A 1KXZA 2ZCJA 1KPGA 2B9EA 2XYRA 3C3PA 4LECA 1RJDA 2FRXA 3BXOA 2VP3A 5EOVA 4DQ0A 4YUZA 4E32A 5EIWA 1G8SA 2YTZA 4ER6A 2PX5A 4IWNA 1NBIA 3KHKA 2CMHA 2BR5A 3MB5A 2NXJA 3QOXA 4P7GA 2ZIEA 3OE5A 1X1AA 3HCBA 4DF3A 1SUIA 2AN4A 2EFJA 2ZZKA 3C6KA 3SGLA 3KQPA 2FYTA 4JXJA 1Q0TA 2FK7A 4EVIA 1JQEA 4U7PB 3G5LA 4YV0A 1YFLA 3EMBA 3F4KA 3BZBA 3EGIA 4GQBA 5FA5A 1NW6A 4HRAA 4DCGA 3MQ2A 2UYCA 2IGTA 4OA5A 4CKEA 4XUDA 1R8XA 2PVCA 3TKYA 4HTFA 3BWMA 1R6AA 5T6BA 4LWPA 3HVKA 1UIRA 2PX8A 3MCTA 4RTPA 1H1DA 3CVOA 3EVZA 5DXJA 1NW3A 1XDUA 3TM4A 1MHTA 1QAMA 1RI4A 3PT9A 4M7RA 4RTNA 5FWAA 5G02A 3DULA 1SKMA 3FUWA 4QDKA 3RW9A 2HTEA 3EMDA 4EKIA 4HSGA 1XXLA 3BGVA 2VS1A 1WXXA 4ZTBA 4R05A 5K0CA 2ZZMA 2ZVJA 2K4MA 5DM0A 2NXCA 4XUEA 2AOXA 3AXSA 3FTFA 1VBFA 3GWZA 4QTTB 5BXYA 3M4XA 3NWEA 3OPNA 2GB4A 2NXNA 2ORED 3UJDA 4RV9A 5DWQA 5KS2A 2EX4A 3JWGA 3O31A 4RVHA 4A6EA 5K0FA 2UZ4A 2C7QA 2BR3A 1UWVA 3EVGA 5HFJA 5GP1A 3BKXA 5HILA 3HCFA 3EEYA 5LQCA 3LX6A 4PGGA 3CGGA 2OB1A 5FA8A 5ICEA 1N7IA 3GO4A 1VL5A 3M6XA 4BLUA 4LWOA 3V97A 4MWZA 1FP2A 1NT2A 3CJRA 5FHQA 2OXTA 2XYVA 1X1CA 3PLAE 2BR4A 2FCAA 4E31A 3FZGA 2ZBRA 3G7UA 2PWPA 2AOVA 3PFGA 4EK9A 1BKYA 3SVZA 2G1PA 2IFTA 2OB2A 5KYGA 2EJTA 1WG8A 3A7EA 1B42A 5E1OA 4PYOA 1N2XA 3JWHA 4WVLA 3OFKA 3LDUA 4PYQA 3UJAA 4HTFB 1YZHA 2AOTA 3LKZA 2AVDA 3HVHA 3R0QA 2CL5A 4DMGA 2HWKA 2DPMA 2IDJA 4CKCA 1WY7A 1EQAA 3P9CA 2GPYA 3AJDA 4QPNA 2I7CA 3TOSA 5DLYA 3KR2A 4GC9A 3ANXA 4KWCA 4C07A 2ADMA 4HGYA 4AUKA 3CBGA 4PCAA 3M33A 3OFJA 3NTVA 3KR1A 1YZ3A 5E1BA 1EJ6A 2B3TA 5C9ZA 4CTKA 3ORHA 4OQEA 2OYRA 1AQJA 3SSOA 1JR4A 4FS8A 4FSXA 5IKMA 1KP9A 1O54A 4KW7A 3FYCA 3T0IA 3PFHA 2I9KA 2ONZA 1PJZA 3VC1A 4E2YA 5KVAA 1P91A 3OU6A 3P71T 3TMAA 4BLWA 1O9GA 1BOOA 1Y8CA 3TM5A 2NNWB 3FUTA 3JWJA 4AZSA 3UA4A 3FUUA 4ER3A 5BW4A 2GA9A 2XVMA 1NBHA 3UFBA 3BWBA 4QQKA 3NMUF 1VIDA 4F84A 1VPTA 1DUSA 3A27A 5EMMA 5CCBA 1QAOA 2PGXA 1XCJA 2YUIA 3B5IA 3DOUA 2PLWA 4DCMA 4RTMA 3DTNA 3P8ZA 4QQNA 3REOA 3FTDA 3ERCA 1EG2A 2JHCA 1L3IA 2Q41A 1G6Q1 1UFKA 2H00A 1QZZA 5GOZA 4PNEA 1AV6A 3KPWA 1ZGJA 5ICCA 4P7JA 3SX0A 2BM9A 1IY9A 4IV8A 4PYJA 2UYHA 2AOTB 3P9NA 3TFWA 2G72A 3WSTA 4RTSA 4KIFA 3DR5A 3KPYA 1F38A 1X1DA 4R8SA 2AVNA 5DM4A 5CIYA 2IH2A 5D1NA 3Q87B 5DTQA 4GEKA 3T7TA 1D2GA 3ER9A 1PRYA 1XDZA 1N7JA 3IYLW 3TKAA 4PYKA 3TR6A 4PCLA 3C6MA 2AR0A 4AX8A 5EEGA 4PGHA 2GLUA 4QTUB 1ZHFA 2QY6A 2UYQA 3A26A 3TRKA 4POOA 1M6YA 4ATNA 3EVEA 5EMKA 2ZFUA 3I64A 5EEHA 3ER8A 4RTOA 4DM3A 3AY0A 3LCCA 5FADA 5T64A 2WA2A 5FQOA 3A7DA 1VP3A 3U81A 3DXYA 4AZVA 5BP7A 1EAMA 3FRHA 2I62A 4MTLA 2EG5A 2YR0A 5K09A 2CMGA 4E30A 2OY0A 4E33A 2AS0A 3LKDA 5FCDA 3UJCA 2ZZNA 5E2AA 2WA1A 4FSDA 5BW5A 5M5BA 3MAGA 2Z6UA 4BLVA 3GRUA 2V74B 3KQWA 3PB3A 3EVCA 3LL7A 3ELYA 2BM8A 2NP6A 3PX2A 4KVZA 4RVDA 4E2XA 4C06A 4XUCA 5E1MA 3RIEA 4ER7A 1JSXA 3DLCA 1INLA 8MHTA 3G2MA 3FYDA 2VDUE 3O7WA 3GRZA 4PYIA 2Y1XA 3OZTA 3ELUA 4NECA 5GIPE 3HP7A 5CM2Z 2P1DA 5ERGB 2YXLA 3LDFA 1V39A 3E8SA 4DA4A 5HZMA 3E23A 1U2ZA 3GRVA 2QYOA 2R3SA 2ZWAA 3EGVA 4FT2A 3ELWA 3P2KA 4IV0A 5E2BA 5EZSA 4UOEA 4YV2A 5LQNA 3P9IA 2EJUA 2LD4A 2WK1A 3BUSA 3GU3A 3Q7EA 3HEMA 4PINA 5HIMA 3T7SA 4GF5A 4C08A 9MHTA 4GOND 2PT9A 3B3JA 3IHTA 4KRGA 5H02A 4GC5A 1IXKA 3THRA 5C0OE 2PKWA 4L7VA 5EPEA 2ZSUA 2C7PA 3OZRA 2I6GA 2C7RA 3FPEA 1FJXA 3EVFA 1TW3A 3FUXA 4CTJA 1HMYA 1ZKDA 2NP7A 3FRIA 1QAQA 4YV1A 5DSTA 1KIAA 3DLIA 1AF7A 2IDKA 4FP9A 2IH5A 4C4AA 5GWXA 3SXJA 3SM3A 3HA3A 4RTQA 1TW2A 3G89A 2ESRA 2IPXA 2CKDA 2FPOA 3C0KA 4OBXA 4BP1A 4CKBA 2C7OA 3KPJA 4R6WA 3LCVB 3ME5A 5E9WA 4KDCA 2UYOA 3B3GA 5DM2A 1KYWA
chains in the Genus database with same CATH superfamily
4PPNA 2DWUA 4CLEA 4F3TA 4AG5A 1ZO8A 1NUSA 3AG5A 3L41A 1RLUA 1PL6A 3JR7A 4P81A 2HMVA 4GOXA 2FN8A 2GPAA 3U4GA 5LSAA 1K4MA 1MW9X 1SWWA 2O6LA 2OYCA 2VDMB 3E4DA 3K6JA 3VNVA 3LDGA 2TRSB 4M83A 1PGPA 1W4AA 1X19A 1FP1D 3VZCA 3KTFA 3S4YA 3IL2A 4XWAA 2W98A 3HCAA 4R2IA 3OCJA 3QU4A 4X1OA 2RK4A 3TPZA 4R8RA 1AG9A 2CNWD 1U5CA 3FKSA 4IVRA 4JUCA 4XSVA 5JATA 4BZXA 1XRLA 2NYUA 2Z3VA 1CEYA 1RRMA 4RVFA 4WXMA 4GBJA 2GERA 4JGIA 3I0MA 4G0XA 4RH0A 3VZPA 4C0AC 5ALYA 5JECA 2P40A 1UQRA 2AC7A 1LC3A 4TKVB 1T91A 3HFRA 3ZJVA 5MGBA 2Q2QA 2WZQA 4M88A 4YQYA 3ZE6A 3MJ4A 4BVFA 4H1HA 3PEVA 5L4LA 1Q1QA 1VYTA 2SKCA 1JIIA 4ZQIA 3AH8A 3FMFA 1Y9DA 4K0KB 2JHPA 3RYHB 1NV8A 3TLCA 3ROPA 4B4UA 3X2FA 3EWNA 3A70A 4AY4A 1ZIPA 4D45A 1ZD1A 4E5PA 2REQB 3OMLA 3ZDRA 2J59A 3JQEA 4B9EA 4CT4B 3NRJA 4DG5A 4JEIA 1HDIA 3E58A 1XRMA 4K28A 3WIBA 1JEQA 3RJ9A 4ZYXA 3MHPA 4DJTA 2XCLA 2O52A 1H0RA 2Z9CA 4U6QA 3RREA 1GILA 4BCDA 3UMVA 2FUNB 4KODA 1O5OA 1ADBA 4NU8X 3RJ5A 3R4CA 2G1AA 4JC0A 1LJ8A 4LPKA 3STXA 2PZJA 3F8TA 2QV0A 1XPRA 1PF7E 2ZU6A 3ESQA 2H1VA 1CC1S 1QMPA 2Q7OE 2PFGA 3G23A 4HGOA 1TO6A 4PZPA 1U0RA 4LMPA 5EZQA 2BKUA 3B48A 4RIFA 3PJDA 2QM0A 5CVVA 3WWDA 2V98A 1KI1A 4B45A 5KYNA 4HDMA 1PX0A 4X1IB 1K06A 2UYGA 2JAPA 3N8KA 2Q3HA 4C0KA 1Z4MA 3VR5H 4BRWA 1XTJA 1A4RA 1A9TA 1EINA 1QHSA 3MLBA 5DV9A 4ARSA 3FOEC 2Q3DA 4MI1A 4X6UA 3ZNOA 1XQ1A 1E3IA 3R9IA 4FOOA 3QXHA 2R1TB 1Z5WA 1OFVA 2NP7A 2CDCA 3UV7A 3QY0A 4JR1A 1A2OA 2WAMA 3BIOA 5CVEA 3HE3A 2FMUA 3U3DA 4ZO9A 3QMWA 4HGNA 1KAHA 2VYNA 4V03A 1R0LA 2OKCA 1N4AA 2H8GA 2I2WA 1LWOA 1ZJJA 1SU6A 4I3FA 2QN2A 3PX3A 4CMHA 1ST2A 2O0MA 3HFJA 4NK5A 4BC1A 3RAFC 3BXFA 5LLSA 1YVUA 4WDQA 3KJNA 4BNXA 3K0SA 1KJJA 2Y4NA 1RYZA 1QOZA 1V11B 2WQZA 3HBFA 3T6KA 1XZ8A 4D9KA 4MQ4A 2AMJA 4R8LA 3SZRA 4DLUA 1LZKA 3MJEA 2BFCA 4HDRA 4GGMX 3EGWA 3RFCA 3KOYA 4GI5A 4I66A 4MI9A 4LOAA 3M82A 3GLUA 2D2VA 2XZTA 2XIQA 1FRQA 1RHMA 2R6DA 3KFLA 4P54A 4QBHA 2NT4A 2X8JA 4BFUA 1XMXA 2CWDA 3OICA 2O5RA 2QKYA 4N3AA 3EASA 4RLSA 1YMVA 1EJ2A 1KYIA 4HAOA 3RBAA 3IERA 1M0EA 2VWGA 4BAZA 4ZT5A 1QM5A 1SXJE 2DBYA 4IFBA 4OJNA 1F14A 2DPYA 5AM0A 4I50B 4P92A 1YS7A 1THZA 5E3HA 1ZY2A 3PDJA 3WLPA 3S3TA 4B75A 2AKAB 1GR1A 1ZMOA 2GO1A 4L8WB 4UW9A 5DBFA 3ZDEA 1JG7A 1IBRA 3GOQA 4JUDX 1H3FA 1F60A 3K20A 3G5UA 2XNKA 4YJHB 5JNUA 3R7LA 1U7HA 4BMNA 3EDRA 2FWJA 2X76A 2YOFA 4DV0B 4OQYA 3VO1A 2OLKA 1AUVA 4MMZB 1ADCA 3K5IA 4H7FA 1U2SA 2JGMA 1ECBA 3GN1A 4LYEA 5CB4A 3CMMA 4K6CA 3P0EA 1IIRA 2OO5A 2VDVE 5KWSA 2WINI 1HQYE 4IS2A 1L5VA 2OBLA 3JQQA 2PXCA 3KO8A 4DQLA 2GZ3A 2W6JD 1ADJA 2UZ1A 4LKRA 3GN2A 4LJ6A 2XB9A 5DTEA 5KYKA 2H5LA 4JY7A 5JXJA 4BFZA 3PZRA 3LRXA 4L3OA 2HRCA 1EVYA 2YHIB 3ZCQA 3O84A 3DE4X 3IKMB 3LOPA 3OJEA 3RABA 3WXBA 1N8KA 2FN3A 4P08A 4DMRA 1XNJA 4HR7A 1E7RA 4N01A 1FPMA 1XTPA 1RT9A 1PGOA 2ZJ5A 3BK1A 4R5MA 5P8WA 1LDBA 1I7QB 1TZKA 4UCFA 3UV6A 4Y7CA 1MPTA 4DZRA 2P2DA 3ETHA 4ZGGA 1GPAA 5TSDA 1R1DA 3C98A 3EVNA 1KWKA 3A11A 3BKWA 1F4LA 3WV5A 5B5SA 4C4TA 1H2BA 3OOHA 2GXSA 3KE9A 3PTLA 2PS0A 2ZE7A 4YGXB 1XOIA 5K0EA 2QRMA 4NDAA 3PUKA 2PS3A 4PLPA 5KNBH 1NVGA 1II9A 2HWUA 2OGZA 4M22A 1L2TA 1RWMA 4N5LA 2FPLA 3UCEA 5CA0F 1RKUA 1PDOA 2JIDA 2XVAA 4R1LA 1FCJA 3MTEA 2ZVQX 1EPUA 4RGYA 4C88A 1NVFA 2V7WA 4BN5A 1DDIA 5AFSA 1X1BA 5CNJA 1O94D 2OXRA 1U8AA 4HJRA 1ESZA 2HEIA 1X8XA 3BCHA 1PJBA 3A28A 4YUWA 5C5CA 5FLXA 4MR8A 1AXRA 4TMVA 1QCDA 5BUSA 3SQLA 4ENPA 2FNAA 4CYMA 4JU9A 3RF7A 5K5EA 3SM9A 2VPYA 2EKPA 3TI9A 1XMOB 3LUPA 5CGZA 1E6WA 1SRQA 3VNRA 2GEUA 4FNMA 4PZUA 1P4AA 3VGJA 3QQ5A 4OHWA 2QU8A 1PVVA 2I5PO 4G9BA 4BUJA 4JLDA 4KE7A 4EJ2A 1NVAA 1LPBB 4YJFB 4NQZA 4FM9A 4KMSA 3TNLA 1HF3A 2QTFA 4GQIA 3AERA 3ZGZA 3MT7A 1U0TA 4ZMRA 3F73A 3U7GA 2L17A 1A5ZA 1M34B 4KTTE 4JFAA 3M70A 3OCYA 5AXDA 2HO4A 3K16A 1H1LB 1NF2A 4HXEB 2C8JA 3W0LB 2XAUA 6LDHA 4GX5A 4B09A 2A7XA 2JL1A 1IPFA 3GJ7A 4HUQA 3G7SA 1UMBB 4IIFA 3L6RA 2R62A 5K3OA 4JXZA 4Y6OA 4ECEA 3LPDA 4N76A 1A7UA 3H8WA 3NFRA 4H59A 2DLDA 3O1JC 5A6SB 2C59A 1V5GA 2OO5C 5FV4A 1V0JA 1XRSB 4TPKA 3GD7A 4NJMB 1F2UB 5C8YA 1YFLA 5BQOA 2H4FA 4GQBA 5DFAA 1JKMA 4EUKA 3CLRC 4YT4A 1S4MA 4QHYA 3NCTA 2Q1YA 3IKJA 2O23A 4WZAE 2DFVA 1DPGA 1KE1A 4EEXA 3D2CA 1QGDA 3LC2O 3DE3X 4HNTA 3A6KA 5BSKA 1FTNA 2A3RA 2VF2A 2W2LD 5DW0A 2YZNA 4IF4A 2OQIA 3RC3A 1YJ5A 1NN3A 2IZ1A 2K7ZA 3NGLA 4RKFA 1XDUA 5E6RA 3MGCA 2Z04A 2JARA 2WJ6A 5IFLA 2Q5OA 4B35A 2I54A 1NT4A 3RVJA 5JQGF 2KBFA 4ZJZA 1PCXA 2HTEA 4WZ6A 4BMYA 4N47A 4HEQA 3RBXA 3V55A 2VS1A 1JDNA 3DTVD 1GFWA 1TNDA 2GAJA 4QARA 3W5DA 1X42A 4DLVA 1DPFA 1O6CA 1LNZA 3D4NA 2K4MA 2FWAA 3QIVA 5H3HA 1JQ5A 4UMFA 2QT9A 1NNUA 1ISFA 1WCYA 3HV2A 1YDFA 3PGKA 4MS1A 4W1PA 5H83A 5A2QA 5J4KA 1NSFA 3H05A 1G3MA 3LZ6A 3CVVA 3UWDA 4FE7A 1QS0B 4BP9A 3FCEA 1J7KA 4CDMA 4QDTA 3EVTA 5HF8A 2O7QA 3WISA 3L6CA 1T5BA 2UKDA 4RVHA 2XQIA 2WMOB 1NWCA 2F8SA 5EE9A 3O2SB 4GBGA 3KSMA 5EQFA 1JHOA 2WVAA 5LMZA 4L7QA 5DK6A 4LE1A 5TMBA 3UJPA 4ZI2A 4R2HA 2QL5A 3MPOA 3V97A 1TU0A 3BBPA 1ACLA 4MP3A 4ZI7B 4HEJA 1RKVA 1G9SA 4MPJA 5F2EA 5SYNA 5C3UA 3VFDA 2QMUA 3FGPA 4M0LA 1XEWY 3AZQA 3K0FB 4X6LA 5CT5A 3VI4B 3DR3A 1N2XA 2X6TA 1U11A 2H0AA 3AFGA 4A8JB 1JZSA 3I12A 4Y1EA 5FOSA 1KYYA 3OWOA 1QIEA 4ZMBA 3LTNC 3WHLA 1XMSA 2HRRA 4DV7B 2ZT7A 1OXVA 2O14A 4M53A 1NUHA 1NP7A 5HFAA 1ZN7A 3LQ2A 2F1OA 2I71A 3Q88A 3AJDA 1MOZA 1YAHA 4DSNA 3ZK8A 2XDAA 3AGQA 4NS1A 1W36D 2QN8A 3D4BA 3E70C 3NNNA 1X39A 4FYHA 2ADMA 4L9WA 2J3DA 2CHGA 2IYLD 1X87A 4PCAA 1FFDA 5AKZA 2IQ5A 2Q29A 1T1JA 5BSMA 4ZFNA 4FC7A 5HJ5A 3UF0A 1SJ9A 1TC1A 4BQPA 1YVPA 3T5GA 3Q7PA 1ZLXA 3W6NA 2Z58A 1GRCA 1NSYA 4DR3B 4KR6A 1H2RS 1TL7C 2ST1A 3PHJA 2IZ5A 1GNRA 2E6UX 2HV8A 3GNQA 4ND4A 3ABZA 5I8ZA 4AY5A 5CX4A 3I5YA 1OROA 3PE6A 4NE7A 1BRMA 5AHOA 1JLSA 3ZDYB 5BUCA 3K0AB 3SFVA 5FOUA 3V34A 2ZJBA 4DJFC 3VSBA 2O8VA 2BAGA 4ZHQF 3OESA 4J0DA 4ND8B 3E15A 1FDOA 1VBNA 3TAXA 4G0UA 4IR7A 5DCWA 4G2TA 4L02A 4R0NA 2WM9B 3ROMA 1LDGA 1TZCA 2WU3A 2TMGA 4AICA 3TGLA 2FPIB 4I9UA 3R40A 3KP1A 1BS2A 5EYPA 2PWZA 1RAAA 4CF4A 5J2UA 2N9UA 4S2UA 2DPXA 1GLVA 5KNCA 3TNYA 4DQUA 4LISA 1E3DA 1HDYA 3F49S 4GI2A 3JD0A 5KX5A 3P9NA 4H7IA 4UM7A 2QVZX 1T0BA 4C0BA 4MW9A 2V8OA 4CU2A 1SXQA 3U3MA 4R8SA 1V7PC 4PCVA 3ICEA 1J9GA 1I0IA 1CSEE 2QORA 8OHMA 1E77A 2E55A 4B6FA 4DLYA 2G5PA 1Y4AE 3LX8A 3T5CA 1GO2A 3UT6A 4OP3A 4AX8A 2Y92A 4RKYA 1NBMD 4J7UA 3MVEA 2GLUA 4ZKEA 1OASA 3WKDA 4C7OB 3UMFA 3UKDA 5EUBA 3DE6X 4ATNA 4ID9A 4CLRB 1B0ZA 5KYWA 3U09A 4IXNA 1K5HA 2HYIC 1N6OA 2GRUA 3AY0A 3M83A 3PEFA 4PXYA 1AO3A 4Y9DA 1YWGO 3AF2A 2HFKA 5JO9A 3U3RA 2LKCA 5T5QA 4M4SA 2GD1O 5I9MA 4BX0A 4P0TA 4RHCA 4MDEA 5D6OA 2NVUA 3C3CA 4FGJA 2DWPA 3WB1A 2CMGA 1E6UA 2E85A 1ZC3A 3BL6A 3WSWA 4EVSA 4G63A 1O8CA 4DQXA 5C32A 1Q7RA 2R79A 1ORWA 2QSJA 4B8ZA 2JVJA 1A97A 3OSZA 1SBYA 2OPHA 2GQ0A 3IBSA 1CUAA 1Q3TA 3AU9A 2NP6A 3SK0A 2I1WA 2BIFA 1D1TA 1DRVA 1JQLB 3BH7A 4E2XA 3KAJA 3RVOA 1MQ8B 1H93A 4IZHA 1YA6A 4QU0A 3KV1A 3MMZA 3ZWPA 1LCIA 3PR3A 1SOUA 1YDHA 4N7RA 4JS0A 4UHCA 2YIDA 3SR3A 5DN6A 1VYUA 2AG5A 4AJIA 4D3YA 1WMFA 2EX0A 3ON5A 5DCUA 3HDJA 2GJ9A 2R6GA 3QVXA 4S1WA 4WK0B 1JKFA 1ISRA 3OE1A 3TLAA 1MO3A 5KSYA 3U4MA 3CRW1 3A2MA 4HHEA 2WM8A 3NEJA 1Z5UA 1KARA 3AI3A 1RPTA 2VP4A 3PQ4A 2YIJA 5EPEA 2JIRA 2GAAA 5JY6A 1DAOA 2G1KA 1CW2B 3RVSA 3P2OA 1DRWA 5F1KA 3TCNA 1S01A 4RVSA 3TX2A 1CQXA 1LW6E 1L5MA 1GU7A 2CNOA 2W22A 2DSNA 4OSPA 4Q48A 3OFSA 1W29A 3CUTA 4GAEA 5AVUA 1S02A 2P4QA 3DUFB 4RMHA 1JFSA 5EXEA 4ITVA 3NWJA 1G2QA 1O6ZA 1P6QA 2HFJA 1NOIA 3ENZA 3MW8A 3IRUA 4PS1A 1KQOA 2O2EA 3SXJA 4LFAB 1U7OA 3F0TA 4CKBA 5HQJA 2PUVA 2C00A 2E48A 4KDEA 4BQNA 4EW2A 3K70B 2E0IA 3PYLA 2ZWMA 4HBZA 1GJRA 3M9WA 4PC6A 4UPEA 5E8JA 3EXHB 3ASUA 4LY6A 3FMOB 1RXYA 4U63A 3IQXA 1X7ZB 2BZSA 4LXUA 2B8EA 5F5NA 4E6PA 1X9IA 4DJEC 5E4YA 2XCOA 2NZXA 5ELMA 5KTOA 1I1OA 2NGRA 3C5WP 4ZALA 5AVTA 1Z4PX 1NU6A 3A05A 3H2GA 4W5RA 3IPXA 1HG1A 3BJMA 2Z2XA 3NG1A 3NS7A 4GI7A 1O0CA 3OLZA 1R8SA 3GGPA 3OWHA 5IYZA 2VNKA 3ZJ5A 5CPBA 2QE6A 1SKUA 2NTNA 1G59A 2OL4A 3N7AA 1KQ3A 1A72A 2VRCA 3ZCXA 3ZLUA 3ZW9A 5LJLA 3G79A 3GLSA 1FX0A 1P60A 2VN8A 2PQ2A 2BBSA 4V0NA 4B74A 3ITDA 4Q4JA 2HHJA 2Y8EA 4HGZA 3OWXA 2EWVA 2G0NA 2IOFK 3IKLA 1TI7A 3ZCRA 2KW5A 3IP7A 5B4TA 3QLJA 3SYKA 1QKIA 1UWCA 2ZJOA 2V0NA 3QPBA 4YYZA 4S1TA 2RC5A 2HA3A 4GXRA 3WWEA 1P61B 1QG2A 4U6SA 4E7PA 1N5JA 2BM0A 4A3SA 2FW0A 4FFSA 2D54A 1YZGA 2TECE 4HDKB 3S68A 4G85A 4GG1A 1LW7A 1NPTO 4G26A 4H4EA 1QCCA 2ZP1A 2IUTA 3DDUA 1PDWA 1N2JA 3LF2A 3WB2A 4HC4A 1M1NA 1ULSA 4O4JB 4LGCA 3ZHCA 1E9AA 3OLVA 5TMEA 2IZ7A 2I4OA 3KU1A 3SSAA 4RTRA 2O7RA 1A5BB 4O1HA 3ESRA 5EHIA 4R40A 4MJXA 5GONA 1TVKB 1X1EA 2F3PA 2FPMA 2IK8A 1U02A 3DUWA 1S6YA 3GX1A 5TVKA 3TQSA 4RY8A 3UMYA 1Y6FA 3QIAA 1VE6A 2GEDA 2RBGA 4WPGA 2H48A 1D9ZA 2BGNA 3VHRA 4K9KA 3ZZ1A 2VR1A 2ZM6B 2GN4A 3C87A 3OTIA 1OXXK 4KYIB 2MCFA 4F9TA 4E1AA 1PJTA 5A9RA 4LDNA 2J5BA 4J3JA 1F2VA 4EHHA 5C35A 2JEOA 3FETA 3FNBA 3WZMA 1PS0A 4RJKA 5H8WA 5K3FA 4ZZ1A 5EE1A 5DI3B 5DTMA 2G80A 4D4LA 4BNUA 5AESA 1NW4A 2D1SA 2AR9A 3QVLA 2BCGY 1C9MA 5CA1B 1T0UA 2DXIA 1DAPA 1RPAA 4C7VA 1CDOA 3A6GA 5C1PA 2KE5A 4WXEA 4XDYA 4ZICA 4DCJA 3EE6A 2UXCB 3RTBA 2YWGA 3QI7A 1CUHA 1I13A 3E6AA 2ETVA 4X20A 4EB8A 3ZZTA 1I2BA 3ZNPA 1VLMA 2AF4C 2HDOA 5K0NA 4GZLA 3VTKA 4FN4A 1RQPA 3WWYA 4KSCA 3WGMA 4BMSA 1KEVA 2HWWA 3MERA 1V2HE 1I6KA 3IUYA 4KITB 1AA9A 1WD5A 2A9VA 2VTBB 4TMZA 2E4UA 3VO8A 4KXQA 4RMNA 1GQQA 4IEEA 1S8NA 5FL7D 4MVJD 4O0LA 4OIMA 1PKXA 5TQVA 4BO2A 3V1MA 1V2GA 3B82A 2LNDA 1HRDA 1TU4A 4MV1A 4YP0A 4IZOA 1JDPA 2IYYA 2ISCA 2VH5R 3IDFA 4IX1A 1E3TA 2J3HA 5EHGA 1WQ1R 1ESNA 4C78A 2GFHA 3WGYA 4CL0A 1CULC 4J6EA 2JI4A 1UJNA 5HIIA 3SPXA 1E2QA 3UJ6A 2QR2A 2EG9A 4JL5A 5KYTA 4ZVUA 3S2EA 4WUTA 4ZJUA 1CT9A 1WXFA 3PPYA 3WTCA 4OEHA 2F43B 2P9JA 1CUUA 3V8VA 3O4VA 4JA2A 1N8NA 4YREA 4KDRA 4NZZA 3EEOA 2OYSA 4G1EB 3DWGA 4U2GA 3KQMA 2YZMA 4HEA1 3HCNA 5EZ5A 2QD3A 4BE7B 1O08A 5CB4F 1Y1QA 3QTBA 4X3PA 2RGAA 1IHYA 3MTIA 4L51A 4RJIA 1MAAA 1GG5A 1SXJA 2O8EA 3WKCA 4GZ3A 3T3PB 4L5AA 3D3EA 3ZKWA 2OKGA 3U7FB 1OZFA 5LOVB 3JTEA 5J58A 1DBSA 4KUGA 2IW1A 1XZAA 1MXFA 1LZLA 3ELBA 4OA8A 1Z36A 4DA6A 5KNDA 3GLFE 2FETA 4Q93A 1K6EA 3R5TA 2P3LA 4Q9IA 2HJHA 5KDDA 4MVJF 1ZXLA 1VG1A 3ONWA 3EXG2 4IHJA 1C3OA 1SBCA 3MSXA 4TKZA 4D46A 1RZ3A 3FVQA 1BXGA 3HC7A 4X1IA 2PZBA 5IU6A 3BH0A 2GPJA 6AT1A 5CFQA 2G67A 2CHEA 2R65A 1L5QA 3CBQA 2QJRA 3CEMA 4TYMA 2QUJA 1KTIA 4P7KA 3RVLA 2C2KA 1DOAA 5JXIA 3J80A 4UNNA 3BMOB 2B7LA 5G2OA 5IZ4A 2OZKA 4PNHA 3L7CA 5FO0A 1ZSYA 2B69A 5JANA 3NDIA 1ONBA 1GQYA 2D2FA 2F8MA 2PRSA 3WICA 2CFSA 4OMUA 1FYXA 1BZYA 4B44A 1T36B 2EAUA 2NWQA 1UKEA 2I3BA 2R5WA 3L1JA 3LUDA 1ZGGA 2H3EA 4LV8B 4WVFA 5GV8A 3L4SO 4UVEA 5K0LA 3EN0A 2J0SA 2BFDB 1M33A 3ZVKA 1N0VC 2Q9BA 5LQAA 1I5OA 5E1OA 3PTAA 1JFFB 1Y34E 1G55A 3PQ3A 4X61A 3DWFA 5E8RA 1AURA 3HY3A 4P3XA 4IY1A 4AB1A 2FVXA 5FTLA 1WSDA 1FXWF 2JFYA 1W85A 3AKYA 1JB9A 1QGUB 1JNXX 3P4UA 5T3YA 5IM5A 5I7WA 2BEKA 1UKCA 1DADA 1S2IA 1J8QA 1TYAE 2FP4B 2P2CA 3AM4A 3GGDA 3IV6A 1Q92A 4BKMA 4X0EA 3VYWA 1VL1A 4J4TA 1I5RA 3VH1A 1YQEA 2X1VA 3OZFA 4PAOA 4MITA 3VMMA 2HHHB 2BGWA 4BJ3A 1P1CA 3HJCA 1G42A 1I2MA 2GAFA 5IUKC 3F67A 4AJNA 1DI0A 2BUAA 4I9HA 1UPBA 3M4ZA 1L4KA 4LRQA 2W11A 3HP4A 2BTEA 1ZNZA 2G07A 3H99A 4FGUA 5IHXA 1FMJA 1I30A 3VTAA 4OXRA 4P34A 4C4SA 5JY1A 5LU8A 2VK8A 4B3MB 2XGJA 1GY8A 1A69A 4QUDA 2NUBA 2FEOA 1H0HA 3JRNA 5EOVA 3LFHA 3DEFA 1D2MA 1G8SA 3HYSA 3ILHA 5C8XA 2IKQA 3ZVLA 1O3YA 1KH1A 1NBIA 1NX6A 3KAKA 3KUXA 5CHEA 3RNOA 1GN8A 3MB5A 1LGYA 2FX2A 1DIGA 1SXJC 2G6TA 3PEEA 3QOXA 3GRAA 2LXNA 1MLDA 4DNFA 5ITSA 1JXAA 2VT6A 3IDAA 4RDIA 2FYTA 1UZUA 5TVGA 1A50B 1T26A 3R76A 1UXHA 4DARA 1E1QD 2ZU0C 5JS8A 4HRAA 1Z18A 3AFMA 3G6WA 3CPEA 3FKJA 3NT4A 5LQMA 2BSQA 2FZ4A 5EP4A 4CDGA 1E0DA 3F1LA 2W6IA 4DC0A 3G0BA 2WKPA 4I55B 3R23A 4YMIA 5F5LA 4C7KA 2C0QA 2W83A 2AMFA 3L1VA 2O2ZA 3WIUA 1N75A 4BKPA 4DUYB 5LD2B 1BMQA 1R9JA 3KZCA 4BVHA 1HE2A 2G8LA 4DKXA 4RTPA 3HEBA 4XARA 3W5SA 1W5BA 1Q1AA 4Q01A 1YE5A 5B3KA 1W4CA 4V0LA 2JC3A 2V6IA 1H6AA 3B2QA 3DULA 4NARA 4WZAA 1UPCA 3OQJA 4HPJB 3PXGA 3GRPA 3SYMA 3TEJA 3WGHA 1EX9A 2J33A 2J31A 1AUPA 4JITA 3TOXA 2G0TA 4QUGA 1JYFA 4JI8B 3UK1A 2DUNA 1GTSA 1QSGA 3JQAD 3E9ZA 2VPPA 5KKCA 2FGKA 3RGGA 1EESA 2HA7A 3NWEA 2G1UA 1T3SA 3AKDA 3ILXA 4G1BA 2NXNA 4V0SA 4TWZA 1NJ8A 2VVTA 4NBNA 1IM2A 5DGTA 1G8HA 5I7OA 3ETLA 2AWOA 2HKIA 4YTEA 4D0SA 4JJAA 3PXDA 2CE2X 5HCNA 2C5FA 4ZV9A 4WHMA 3ULKA 3VSCA 5FWNA 1RXIA 3A6ZA 4UBKA 4WKPA 3ZI4A 2EFEB 3BKXA 3CNOA 4OHUA 4OSEA 4FGKA 4PGGA 4UZFA 1Z25A 4WKGA 3RRNA 3GO4A 4HJXA 2YOHA 1XKLA 2PZKA 2V8BA 4ZO4A 4O08A 2AOVA 1NE7A 1ZH6A 1WB4A 4ACAA 4QXPA 2G1PA 3KU4A 1UMDA 3SOZA 2XUPA 2NQ8A 2PL9A 1UR5A 3DDSA 3L5KA 1TCCA 1EM8A 1JWLA 3ZW8A 4RZHA 1QZ3A 1TOAA 1CE8B 2DPMA 4LRYA 3UEOA 2JF0A 4EY5A 5M34A 4QPNA 4ZV4A 1BVYF 3KEOA 4V38A 3TVYA 1B8OA 2PMBA 3ANSA 2R1VB 3BILA 4I5IA 3OURA 1G18A 1H2EA 3DYVA 3F3SA 2WSSD 2FY8A 3U7RA 1CQWA 5JC8A 1C0IA 3LFUA 2V7QD 1A76A 1W47A 1XP5A 2Q7XA 5ALOA 4CT0A 2XBUA 4JBIA 3A3NA 1VL6A 1CY7A 1U7XA 5DW3A 1IBKB 2FPKA 1G3IA 2GUWA 2H85A 2M98A 3OHSX 2JKZA 5AOBA 3LXUX 3OMWA 3V7FA 2PQ6A 1JLMA 3I2FA 3C7DB 1S89A 3BH6A 2FN7A 1J9EA 5DT9A 3NU1A 4PRZA 3CVUA 1BHQ1 1E2KA 2PUTA 3B85A 3W3AA 1KETA 3OEWA 1IQ0A 1C1XB 2BHTA 2DFTA 2IQIA 2JGFA 2WSLA 3B1KA 4WUVA 1RE0A 4KKVA 4NYJQ 4JI0B 4QQRA 4DCMA 4BFCA 1M2KA 3KS9A 3UT0A 1DG3A 4UE2A 3DTNA 2GCOB 1PZFA 4QQNA 5DF1A 3MC1A 5LXTB 3TF5A 4NPAA 4B8WA 4IZ6A 4P80A 3VJKA 3N75A 5KX5F 3B7WA 3EQ6A 2Z9DA 2J41A 1PGQA 3GRFA 4DGSA 4EB3A 5KNLA 4QVIA 1XTVA 4ZC8A 2VWPA 2KPOA 3A1WA 4BO1A 4PQGA 2ZM5A 1L6RA 4J0QA 5BW6B 3IAUA 4IJVA 4WBNB 2Z09A 2GZ1A 1F38A 2PZAA 5KC8A 2E4WA 1EHCA 3O2NA 5LQSA 1UBHS 5PGMA 3RUPA 2JD1A 4BJ5A 4C0HA 4L8VA 1PRYA 4YRRA 2H4ZA 2G7MC 3NYQA 1U04A 4MX8A 4TZ0A 4YRMA 3HY4A 3P5SA 4KWHA 4NNPA 4UTXA 4ALJA 5HF5A 1JMVA 1L5RA 4QUIA 2FHSA 2C2BA 4EKGA 3E2PA 2ATIA 1YIAA 3D59A 4G3XA 2OFFA 4G4JA 2CVHA 5AKIA 1HLDA 2ANCA 5C7LO 1FUKA 4MUKA 4FLMA 1M2EA 3VJMA 3Q5EA 1XTBA 3ROGA 1TIBA 3NHLA 2CDRA 1AGNA 4FYKA 1PL8A 1E63A 2V6FA 3AEXA 4C3UA 4DIDA 3R5HA 5K09A 4E30A 621PA 4CFYA 1E7QA 2HL6A 1YKGA 4ETMA 1XZIA 4M0PA 2HU8A 3MAGA 1Q20A 1ND5A 1QLJA 2QRKA 4UC0A 4I1PA 1K4KA 3V6LA 1N0UA 2BFBB 2B0JA 3O3NB 2Z3WA 2LIVA 4JODA 4EO9A 3T15A 5B36A 5B4VA 1MJGM 2BDEA 2QYSA 2NACA 1Q0PA 1QFJA 3QFHA 4GLFA 3NM4A 4QDOA 1J2YA 1R6TA 1ZZGA 1I32A 3K9BA 2H2DA 4V24A 3Q8KA 1G7RA 4XD7D 3GB9A 3QFFA 4AY3A 1OXMA 2L18A 1MVNA 1SCDA 4XYMA 4FMDB 5C5DA 1B8PA 5BR8B 1ZP6A 4QU5A 2ZREA 3M2TA 3QGMA 1VPLA 3R6WA 4ZT7A 2O2HA 2HSEA 3L02A 1NKTA 3KQHA 4K9NA 5HZMA 1T9AA 3JYNA 1PX2A 2HA5A 5TF4A 1OV6A 2OK7A 1EXVA 3JQDA 4GF5A 2XADA 4JI3B 3B3JA 4WKCA 3FCYA 4PSCA 4WZBE 1SXHA 5FJJA 2OZPA 1Q1EA 3M4NA 3TQRA 3L01A 3W8NA 2B6HA 2IYTA 2H9AA 2PIDA 4O5OA 4LYDA 3RT7A 1D1QA 3FPEA 3KD3A 4KXYA 3KSRA 1D3AA 5ENZA 3R7WA 2HUNA 2KSQA 1NULA 4AO8A 2O3JA 1JXMA 4R68A 3FRIA 3IA7A 3I0ZA 5A9SB 4IWXA 2YL2A 4OY3A 3I2GA 1KIAA 1AF7A 2JAUA 4LW8A 4KQJA 4JMLA 2IXTA 4D8XA 4IJUA 4DNOA 1O95C 4E5MA 1NY6A 4BZZA 2E4VA 4HNSA 3SM3A 2ZYRA 3NAGA 3WYNA 5BV1A 2EZ8A 5HYVA 1VKJA 3C0KA 1PL0A 1R12A 2XQJA 3J81A 2C7OA 3PYXA 1S8FA 4R6WA 2H2FA 3WMWA 3JD4A 2HO5A 3B3GA 3DL2A 1WEKA 1YC2A 3DBRA 3SIPA 5GINE 1YT5A 4TWIA 4WCDA 4BX2A 1ORDA 2FQYA 4ISCA 4ZVPA 5LWQA 5HWSA 1DAIA 1COWD 1R0KA 3DC2A 2ZRGA 3IR5A 4HYEA 1EX7A 4DYHA 4LOIA 1WPQA 4MLPA 4MLDA 2F3SA 4IIJF 3L84A 5EQJB 3ZNNA 1MQAA 2MSEB 3OM9A 5IYZF 2P90A 5C1OA 3TBKA 5F5XA 1IJBA 1EZ1A 4XFDA 1Y3CE 4ZVNA 5A5GA 5JFOA 1H5UA 1ZK3A 2ACVA 5CLGA 3W04A 4C0XA 4X6XA 4CLRA 2BGLA 4RL6A 1XLWA 5MF6A 1XCMA 1CQJB 4RCZA 3Q9SA 1KYTA 2P2YA 1WNFA 2XOXA 2OZVA 1BX1A 4BVEA 1DXOA 4MS3B 1QHHB 2IT1A 1MJFA 3F47A 4I1SA 1N2BA 4Y30A 5BVGB 5JNLA 2OGTA 3CNEA 4BX8A 3W2EA 3UB2A 1DRUA 1OHHD 4YRGA 2GZ2A 1K7CA 4QG3A 5JSQA 4TXNA 5LD2C 1BHJA 1V6AA 2B98A 2NV2B 3FDIA 4EB0A 4F9FA 4LF6B 2HK9A 3LY9A 2P79A 4WK4B 1RFLA 4KN6A 4L4RA 3CKKA 3MT8A 1NASA 2BLNA 4PLYA 4RS4A 1P1KA 3BWYA 5ITVA 4G0ZA 3ZHRA 3FPJA 2PL5A 1SA0A 2ZROA 3S27A 3PL1A 4DNQA 2M6LA 3OQMA 3D7RA 5CVDA 3IQGX 3QVSA 5B3JA 4YBRA 3RCBA 1XJWA 3C6QA 3D5QA 3ESBA 2IGBA 3DNMA 4IOJA 4MKXA 3GJSA 1DTSA 1KAQA 3CS3A 4PHTA 4R1UA 5AI5A 2OECA 3W4IA 4E6EA 4DIBA 4GR5A 4FDAA 3VMFA 2WUEA 4EZEA 4B79A 4G4SP 1H8ED 4AJEA 2ZOSA 3NOVA 3OC6A 4CIWA 1XXHB 5TS2A 1YFKA 1BN6A 1U8UA 1YR7A 2HC9A 4IUBS 4Q1FA 5H59A 1BH2A 1DHRA 1Y8RA 2SICE 3SR0A 1EFPB 4UVIA 5G40A 2ZSAA 2V4UA 3LP8A 2ZIGA 4LJ7A 5G0SA 3RVRA 3VR4H 2CNKA 1Z8HA 4A36A 2H9IA 5E9AA 2ZRLA 3Q7IA 1GPDG 4YRSA 3NC0C 3IP1A 4JD5A 1YF3A 3F7NA 1JH9A 2Q1SA 3R6DA 1QU3A 2ZT6A 3AUKA 3OTQA 4M54A 1SQFA 4XLTA 1ECLA 3N28A 4FD2A 1QFZA 1YH3A 3K4HA 4JB2A 2VXOA 3GJ5A 3H87A 2ZI5A 4KR9A 3DEZA 4JYBA 3K9LA 3K0CA 4R83A 4IQFA 4CM7A 5FTJA 4DA0A 3VU9B 1V7CA 3AIIA 3MUNA 5ICMA 3VDMA 2WDZA 3AYZB 4HX5A 2CVFA 1NOKA 3N0WA 4MVXA 1NBEA 1GITA 3OX2A 3AKCA 2TYSB 3OJ0A 3AC0A 4OJKA 3QSGA 4LTDA 1Z74A 1RHQA 2QM3A 4V0QA 3I53A 2WHQA 1D1SA 3D6MA 3QVGB 5TPWA 4B2PA 4V0RA 4P1ZA 2J0UA 3F8SA 4HQKA 4H0CA 5F4BA 4DFDA 1SG0A 1KKMA 5TIIA 3FUCA 1W0CA 3FY4A 1GXSA 3NDPA 1J99A 1ESCA 3V2UA 3KJQA 4XJXA 5U9CA 1PZEA 3HRHA 4GL2A 4N39A 4PLTA 3RLFA 3GUZA 2FXIA 3GXBA 1Y6GA 2QRVB 3M3PA 2IITA 2WAAA 2ZYTX 2NU6B 3DOHA 3K53A 5SYMA 3D6HA 4UQPA 5IUJC 1MUUA 1II8A 1B8NA 3LGSA 2CBZA 1APBA 1W2WB 1IBSA 2E4YA 1M2OB 1XQ9A 1QP4A 3DBOB 1RRFA 2JEZA 4PYRA 1YB5A 5CBKA 3CVXA 2A5GA 1BFUA 4QPPA 1W0JA 2R6R1 1CZHA 1CUCA 4LRWA 3KDSE 3LWZA 4CVNA 4DCPA 2PLAA 5CFZA 4I3HA 4NOKA 3CZAA 4FDUA 1GUZA 3QPVA 2J9FA 5JZSA 2DECA 2AEJA 3FVVA 4PIPA 2PPVA 2Y71A 4JIMA 1EP2B 4Q1CA 4QOSA 4M55A 5K0GA 3FSRA 3OCXA 2HCTA 1LFAA 2BFEA 3OUTA 3A58B 3QX9A 1Z6QA 3H04A 5DP1A 3V4PB 2CLFB 4A0GA 2DY1A 2VCHA 2Z98A 2LCQA 1O8BA 1UBOS 1LBQA 2GEKA 1U6IA 4MQBA 5B3JC 1ICIA 3BMNA 1GU1A 2WWRA 1GA6A 4O4JA 3FE2A 4ZOQI 4CL8A 1SHLA 1D04A 5LKAA 2XCQA 3N07A 2GNOA 2ATVA 4M9RA 4IHKA 1J97A 2QSYA 2HMSA 2YYYA 4C29A 1N0HA 4IPTA 4LGYA 4MGYR 4M38A 2IZ6A 2I7VA 1W6RA 1XZPA 2DR0A 3KYDA 4K88A 4NATA 4WCVA 4XXHA 3C8DA 4W99A 3ZPXA 4F8JA 4MQEB 4YP1A 4HWOA 3SDZA 3SLGA 3H0KA 1BD3A 2BGRA 4RH3A 3RM3A 4B76A 1D8AA 4ERXA 1ADYA 2CMDA 4MQ5A 4OH7A 3NHUA 5I5GA 2EGUA 4UU0A 1U3WA 5GJVC 3S6JA 1I1QB 1VGQA 4BZWA 2B2CA 3O0TA 1U7PA 2HM7A 3K0CC 4INPA 4BB6A 5B7QA 1AZWA 1RWQA 2VDJA 4RQBA 3ZE2B 3GLFA 3H17A 3IEXA 2ZYIA 1P33A 4NBWA 1IWBB 4Y9RA 3HLYA 5DX8A 4TGLA 1NVEA 3KDPA 5HIJA 2YFKA 3I5UA 2I4IA 5F7XA 1HC7A 1V8OA 1E1NA 3NAMA 2G25A 2JJYA 2QD5A 3BRCA 3HU2A 5F2NA 1DZ3A 1B8UA 1M0WA 2ORVA 3BK2A 3P9XA 1QH9A 4J4BA 1RCTE 3COSA 1GNLA 5EWJA 2ACEA 3PDUA 4C14A 1ZQ1A 2PNJA 1NJ6A 3EUAA 4D44A 4YRIA 2Z9BA 4AUKA 5DSXA 2YVUA 4DIKA 1NLFA 2PE5A 2YXEA 2VHTA 1BOFA 3IDQA 4PSKA 3TMYA 2C82A 1OA1A 4R0VA 2X5JO 1TM2A 1FX1A 1VJ0A 4JNKA 2OAGA 4NBKA 5ILGA 2PJDA 4B85A 3VU0A 1T2AA 1XFDA 1U2QA 2AEEA 3SZOA 4CM9A 1RM4A 1T5LA 1TEXA 2ZS7A 1TJ3A 1FU8A 5JT1A 1P5JA 2ZI7A 1J23A 2I4NA 1AHIA 1Z38A 1RXUA 2YV1A 3R24A 1N32B 1WHSB 1GSHA 2Q4OA 3IELA 3O90A 3P52A 2A9OA 2PKXA 4W8OA 2B1JA 4HPWA 3G82C 1MABB 3DD1A 2WABA 1BHSA 2ZGVA 3B5JA 3NIFB 4I50F 2X3UA 3V4OA 5I7FA 5IJWA 4MO2A 4A6PA 2C7GA 3AVPA 2WHRA 5A3VA 1K6MA 5FWDA 2C98A 5AVRA 4WOCA 1CS4C 1Z4NA 4NABA 1X92A 1G6OA 3S55A 3GEMA 1SG9A 2HMYB 2ZXEA 1ZRHA 2WG0A 3BXPA 1YGYA 2ZPAA 3EA5A 3EDOA 3HR4A 4FS3A 8ABPA 5I7EA 2X0JA 4NXNB 5A6VA 1JV2B 1YI1A 1KPGA 3C3PA 5BN5B 4DQ0A 5EHNA 3AFHA 2VP3A 1PS8A 1GYQA 2CXUA 2QLJA 1XV5A 3Q0IA 1N2CE 4ER6A 4J6FA 4K9RA 4IWNA 4JMPA 3NC1C 3L7OA 3ADCA 1G2PA 4Q4HB 4F12A 5KOJB 1LDMA 2ZI4A 2Z1NA 5JI3E 3H13A 1AKQA 2HN9A 2HCBA 4I81A 4GR9A 3A4VA 3PSHA 5AI8A 5JCZA 2LV8A 1E2PA 3DZCA 2IIBA 1LI5A 1G20E 2Q6IA 3B8EA 3KKQA 4LXQA 3CG0A 4YNBA 1CP2A 3GI1A 4A8TA 5FA5A 2H17A 1NW6A 2WU1A 2E7ZA 2FJUA 3W5JA 1RLTA 3CVJA 2QUKA 3I61A 1F12A 5AKYA 2HGZA 3HU3A 4XSGA 4ID3A 4Q4LA 5BWBA 4W9RA 1LSUA 2MIIA 4B43A 5KTSA 2IPMA 1NVVR 1Q0LA 1U1IA 3FYUA 2HCFA 3BWMA 4HTFA 4M1MA 4UHKA 4YC7A 4A0HA 2YWBA 5F73A 5BOSA 3W2HA 1WJGA 1VI5A 3HJNA 1U81A 1E2FA 3GRCA 1J8MF 1QKKA 1Y1SA 3OH8A 3NBMA 1CDDA 4EFLA 4OHYA 2OCLA 3ECSA 4DNPA 2NO9A 3BTUA 5G02A 4B6PA 4BASA 4F8YA 1ZUNA 1H66A 3OCZA 1URPA 3Q1LA 3LQYA 4DKJA 2HK6A 4RFSB 1XMJA 7AT1A 2I8CA 1I0LA 5CCEA 4W63A 2P9FA 4LJ8A 1LU9A 3TLGB 4RGBA 1UK9A 1P2TA 1QIKA 1EUQA 2D00A 2V3VA 5E6UA 3ETDA 4YJGB 3WL7A 1Z15A 1Y8AA 3JASB 5E3IA 5EIXA 2GB4A 3C5EA 3FFBA 3L1IA 2Y2VA 4LCEA 3MBOA 4YDRA 1TF7A 1W96A 1WVGA 5DNEA 2UU9B 3MLEA 5A1JA 1KY4A 4L73A 1W4BA 5AK5A 5LB2A 4F8EA 4N7MA 4I1OA 1SIOA 1UWVA 1T4CB 4JU8A 6REQA 2FLWA 4TYPA 1WL8A 5COAA 5IK2D 1X8LA 2QG4A 1AZTA 3GCXA 3HCFA 3KRTA 1XAHA 4N3CA 4XKJA 3PJFA 2WJHA 4BC0A 3STWA 5IC4A 1KH2A 2FWBA 4DPMA 1USGA 2JI7A 3D4LA 2C61A 2R8XA 2OXTA 1X0XA 4MMYB 2V5VA 3W90A 2C0PA 2XUKA 3ZE7A 4HUTA 4GX0A 2R96A 3A0RB 4BAUA 2EIXA 2YN4A 1NXSA 1PFUA 3EZ2A 1IEWA 1QYXA 2GK3A 2DPGA 2VSOA 3O83A 2ZUFA 5IF9A 4MCJA 1RU3A 3TI7A 4JP8A 3GMDA 421PA 4DA8A 1EEXB 3LKZA 3AWDA 3M6LA 2QUHA 3R0QA 2CL5A 2W71A 3C3AA 2HWKA 4D92A 4DB4A 2DFDA 4M89A 4FYVA 1X1RA 3U4QA 2XOKA 3IAS6 5AJWA 3WQSB 2SKDA 5JARA 1K89A 3DBVO 1XX6A 2H0QA 3QFCA 4KWCA 3U39A 5IN4A 3AT1A 3NTVA 3OAAD 1XQXA 2HUPA 3T06B 4BPBA 4IRXA 4CM4A 5CJPA 1ZWKA 2BP7A 1CS0A 4Q47A 3TTVA 3UB3A 4EIWA 4W9NA 4NV3A 4CN9A 4YPOA 1NQ5A 5EVCA 3CH7A 3O4IA 2FB9A 2WP8J 1THGA 2OAP1 4AZSA 1K27A 4CV1A 3QOYA 4IJ6A 3WGLA 1BHO1 1HNZB 2HLPA 2O0HA 1V5EA 3K3PA 1AUQA 1RPNA 1UPUA 3TDMA 3AX6A 5HHTA 1WBJB 4AJ2A 3EGDB 1QIGA 1VIDA 2FI1A 4L50A 4F84A 4QYWA 1KDOA 1YCDA 4JL8A 2NU8B 2CDBA 3L7LA 2G76A 4UM8B 1BAPA 4JHLA 1LLUA 1E3SA 1KDZA 4AYWA 1R5BA 3FYUC 1BEZA 2AYZA 2NW6A 5ITZA 4YCDA 1LXCA 3ERCA 3TRHA 2IP1A 2JHCA 2Q41A 3P4XA 1SBZA 4D4HA 5JQWA 4WE3A 1W7AA 1NR5A 4G5OA 2P6UA 4ADSG 3PK0A 5LNK1 2H4WA 1G5PA 4QXRA 3VHXB 4NMHA 1W94A 2AOTB 3UUWA 1TECE 1GPKA 1VE5A 1VFPA 3QYAA 4KYUA 3VYTB 2AVNA 1KQGA 3QE9Y 2IH2A 4BUCA 2WFAA 1EWQA 1E3EA 1OWNA 5KJ1A 1M6VB 4RVUA 3H1PA 5J2TB 1LC0A 2FG5A 3M4YA 1D4ZA 3DCJA 4FCWA 2IUFA 3H2ZA 4MVJI 1DNPA 4PCLA 2V7GA 3TQIA 5JMOA 3ICWA 3C5HA 4U02A 3VPHA 4WKBA 2Q8QA 1Y4ZA 2ZR7A 1Q2XA 2Q49A 4UMDA 5EHXA 2I66A 3QWHA 1U98A 3PC7A 5AW6A 2H1OA 3RQIA 4ZI7F 3D5EA 3LCCA 4LYFA 2F67A 3E5HA 4M9XA 2OG2A 2OMEA 5EUCA 2Z83A 1ZCBA 3AEZA 1LBIA 1YRHA 3R7DA 2WIBA 1EP9A 2EG5A 2HU5A 2QRJA 2W0SA 4DEXA 1GPMA 5LC1A 5C8DA 2WT9A 1G5TA 4L4YA 1D5CA 2QYHA 2Z6UA 3PVZA 5BYBA 4HX9A 4FOSA 3P5BA 2DH6A 3QJGA 3VU1A 3BFVA 3F4BA 4QE3A 4G0QA 5BR1A 4H15A 1YR2A 3L6EA 4WXYB 1E7SA 1AB5A 1D7AA 3HB1A 1MBZA 1H85A 2UVQA 5YASA 3VGPA 2ECKA 5CIWA 2HK8A 4N54A 1ETUA 2DUUA 2QUAA 2OILA 1BFDA 5FNVA 5G4LA 4ZEXA 4Z3OA 1QQAA 3ZE8A 3GJ8A 4P82A 4V1CB 2R1VA 3LYHA 3EARA 1SXGA 2R8ZA 1BXKA 5TPZD 3H1EA 3GJQA 3GLGB 5M3BA 3ZHZA 3BFXA 1BMTA 3GELA 4UNIA 3BMCA 1BKSB 2P9TA 1QRRA 3GRVA 1PKEA 4NY1A 3ZD9A 3JVVA 1XF1A 4AN4A 1H42A 4DVGA 3Q7EA 4FDMA 3HKCB 4H7KA 4PINA 5FH9A 2YQ5A 2IHZA 1OPRA 3LQKA 1M7GA 2CVOA 4HP8A 4JJKA 4W9NC 1M73E 4C08A 1ZSVA 3UHAA 4TWAA 1JR3A 4IMIB 3EZ6A 4TLDA 1XJCA 2ZIVB 5A4KA 2EJCA 5KQLA 2VNIA 4BNFA 1PJQA 1VI2A 1MIOB 2D4HA 2FA9A 3LPAA 3RSQA 2RHCA 1HMYA 3QXSA 1PFQA 3WNDA 4AF7A 1ODJA 1T24A 2W5UA 1QAQA 3DEHA 4MHSA 5T4EA 1M2VB 4BGUA 1F0NA 2I4LA 1JL3A 1PLLA 1UKVY 1Z6PA 3BDVA 3GUHA 4WZBA 2NU9B 3TZCA 1ESMA 2IUYA 4KQ1A 1T3LA 3OF3A 3ORSA 1MP0A 1G8GA 4UARA 5JWOA 2FJPA 3MWDB 5BWMA 3RSCA 1CQIA 4DLKA 2EERA 4O3FA 3S28A 5DM2A 1DBVO 2RGRA 1PR5A 3L7BA 5TF0A 2I80A 1SKYE 3IILA 1JAZA 4HRYA 5JMWA 4TYWA 5IKOA 4UTOA 3UG6A 2PRIA 2A9QA 3I3OA 5EKXA 3WY9A 2VCEA 2JCVA 4EEZA 3KOZA 3DVAA 4LY0A 1QONA 3VSEA 1GZHB 3IE1A 1XZQA 1L1RA 3AW8A 2G77B 4DCOA 3A4NA 1YI0A 1XALA 3VR5D 2YDXA 4Z4IA 1HGXA 2NO7A 2OQ2A 1L8OA 1PV2A 4BN0A 4YN3A 1FJGB 1PW7A 5JD3A 1IY1A 1SVNA 2V97A 2W8BB 4C03A 1E4OA 3PDWA 1VHTA 3UPUA 2PAFA 2QENA 3B1ZA 3M6UA 5K6AA 2HHAA 3RJMA 3D1LA 1Z07A 3HZOA 2RGBA 3K70D 1T5OA 3CSDA 2OCXA 2PY6A 2KLHA 4HZGA 4QLBA 3HXTA 1FJHA 1FU4A 3GJ4A 5HGXA 1MZPA 1Q17A 1XKXA 2X3YA 2FW1A 2ZETA 2NU7B 2GCEA 3ILVA 4LSZA 1M5RA 2CLLB 3GIWA 5EGNA 3AM5A 2P9GA 4OI2A 4D43A 2A35A 1U7UA 3HM2A 4DSUA 3OFVA 4ROTA 2CXQA 2G5TA 2VHUA 1Z33A 1XB2A 3IEPA 1LDNA 4IIGA 3RTCA 1FP7A 3RYFB 4YRJA 3TPCA 1ZAYA 3TH5A 1XKTA 3LVQE 2FZKA 2A86A 2ZR8A 3FWNA 4XQCA 4YAUA 1DBIA 2XIJA 2W2KB 2H1CA 2H54A 4NRDA 4KAJA 2Z30A 3HHEA 3GC6A 2OORA 1JTFA 4OK6A 5LYJA 3UAVA 3FOAA 5A04A 1SQ6A 2QZ9A 4GMFA 4M36A 4L5JA 1E32A 3TCXB 3LHDA 3H2IA 2CD7A 2DULA 1CR1A 1SHUX 1MJGA 1ZISA 4RK5A 5E0OA 4B6SA 5BNZA 4ZCPA 2RD2A 4EECA 4JKIA 1M8FA 5JWHA 2ZE6A 2WSMA 4JJ7A 1T1IA 3BXHA 3QYPA 5BNWA 2ZYDA 5G4KB 5TMPA 1N1EA 1TJNA 3W5HA 3RUEA 3VX4A 2JH9A 1Y1LA 2D59A 3LUCA 3WZLA 2DP4E 2ONYA 1P9NA 1DIAA 4I4TA 4OH1A 2B25A 3TVDA 5LL6P 3O4HA 3CO5A 1NAIA 1ZZEA 3R3WA 5KI6A 4KXFB 4MUFA 1WKCA 3MZ0A 3RFFA 2PMDA 4OSOA 2R2AA 1DIHA 2CHUA 5EC8A 2QQEA 5EVJA 2IWRA 4Y6PA 1OH6A 5LQDA 1G21E 1MTZA 2DRIA 2WIFA 4KMMA 5SZIA 3MHTA 4FHDA 1IRXA 2XW6A 4ZEVA 3AESB 2V6MA 3K72B 1XZLA 2BZ1A 2IYQA 4P3OA 4CTNA 4EJSB 4X1KB 3B1VA 1ECJA 3PHBE 3A04A 4U2FA 4CETA 4BU0A 5JNVA 1KZHA 2PYDA 4JK3A 4K0RA 1PHRA 3A1EA 3Q9NA 4F4IA 1XDSA 1ZI8A 2WDPA 2Q0QA 1P1RA 5J5AA 4F72A 1E5QA 5CX1A 4LHYA 4CKWA 1YS6A 1ZH2A 3IAAA 4D9GA 2CCJA 3KYCA 5A4FS 4QICA 1QHGA 1RP1A 1YZKA 1WV0A 4YAKA 2OK8A 1M1XB 3MB8A 1R5JA 3U6KA 4Q7EA 4G5SA 4LE2A 4OLHA 5FBKA 2N0SA 4P8RA 4DLRA 5K6AC 4FFWA 1VJ1A 1XTTA 2QRLA 3PI6A 3Q85A 4RZUA 5ADHA 2I91A 1JPNA 2NZVG 2R84A 3JVIA 3QOWA 4EW1A 1L5NA 5KDOA 2XVYA 3SWWA 3DKKA 5KNBD 4MLZA 5I7HA 4RMJA 4ZCSA 3KYJB 3TTTA 2NZ8A 1EK1A 2QD2A 4JBYA 5BUZA 5IULC 3QNUA 4HDNB 4HOYA 3GZJA 4Z3DA 1M6EX 3CX8A 4C2BA 4MZDA 3BS4A 2ZRHA 3CLHA 2ZTVA 5DIFA 2FVYA 5BO5A 4DSOA 1T1EA 1W93A 2JJQA 2XXBA 4C76A 3LNCA 3L8YA 4X90A 1TT5B 4ZZ0A 1G8FA 2B8TA 3OZBA 4O4JF 4DE5A 4Q12A 1L9XA 5ECYA 5FI5A 3GLHB 4QUKA 3RS4A 3EOZA 2O1EA 3G0CA 1Q0HA 1B6GA 2PR7A 5B1SA 5TX7A 4OP1A 2ZTSA 221PA 2PLNA 3ZHVA 4JYPA 5ED0A 2F64A 2ZCUA 2IXFA 1I2CA 2IHUA 1BEUB 2KM1A 4M1YA 4RK0A 1X77A 3NBKA 5HG0A 3B3QA 4D56A 4Q9KA 1E3JA 2HJ9A 2PUJA 2YN2A 2FH5B 4DV5B 1BXZA 1J8FA 1K8ZB 3DXXA 4DV6B 3RVPA 4MYTA 5REQA 1ODKA 3MUFA 3RRYA 4IL5A 3KPVA 1VPVA 1E9FA 5FFFA 3KKLA 4Q3KA 2AQHA 3ZWCA 2QE7D 3D8BA 5KU7A 1MAHA 4RF5A 4S1NA 3OQIA 1Y9EA 4PPYA 3OZEA 1FYEA 3MMSA 5LLTA 4AYXA 4YJ2A 1F8YA 3D0RA 4RZXA 2PSSA 3EBPA 4WGFA 1FDTA 3MJHA 4EJ0A 1CD5A 1XTZA 2EYQA 4RA9A 4XX0B 5CA1F 1XT6A 2GAIA 2X9GA 2YQZA 3KQVA 4LNHA 2ZIXA 5D5QA 2O57A 4WERA 5IRCD 2IXEA 2V5UA 4B3CA 1OSNA 4TKUB 3KL2A 1IM8A 3RU2A 4BO9A 2FN4A 2PNFA 3SQWA 1L5ZA 2PBFA 3H5IA 3LU1A 2GN0A 3WRWA 3QVGA 1FLDA 4EL0A 2QTVB 3W8DA 1C7ZA 3R9XB 5C34B 3WBFA 4F60A 4DMFA 1XK6A 1U2EA 3EGXB 3GRYA 1XNHA 4GYYA 3T1TA 3FUVA 3EUWA 3Q41A 3ZDAA 2VJLA 2Z6AA 3JAKB 5F64A 3Q9UA 1FFBA 3P0HA 3IDOA 4HFNA 4TRRA 5GM2A 1KQNA 2QRVA 3ZIAA 3NRCA 1VHDA 3K4PA 3OPXA 2P5YA 4IM7A 1G1AA 2RI6A 2TS1A 5EGSA 1JFTA 4Y6QA 4EW3A 2MINA 2WU8A 4JOCA 5CNIA 1JG4A 3IXQA 3LUHA 1U1DA 2O1SA 3VVCA 4X63A 4YY3B 3AVQA 2JGDB 1SKQA 4QPJC 3HJFA 2A5FA 4TSKA 1Y8QA 5IWCA 5LP6B 2GH1A 2OAQ1 2YV5A 2P62A 4UMVA 2QUIA 4ZCTA 3VPDA 4YCJA 1U99A 4A6DA 2FMIA 5JH7A 4DR2B 1ZVVA 1GG8A 3T9DA 4XD2A 1U0JA 1WUYA 2JAHA 2IU3A 2ZSFA 3IXMA 1Z5PA 2ERCA 1RWOA 3C16C 3MTBA 3ND8A 4DCTA 5D5PA 1EDBA 3F2IA 3FRJA 4HAIA 4F97A 3O4JA 2O8FA 3KOXA 4TQGA 4DHWA 1BNCA 4K26A 1K8QA 1QGAA 4S04A 1Z37A 2ASEA 2ZSIA 2IYXA 1E79A 5AD1A 5IXYA 4BDSA 1E0JA 2OHFA 3B38A 3W8FA 1RJDA 4L0CA 2G17A 5FL3A 1KEPA 3NT2A 1HPLA 4MKGA 5H3CA 1W30A 4E1VA 2QZ4A 2BMAA 3I04M 5E38A 5L3SA 1G3RA 2P65A 5LOVF 5KJ6A 3THYA 3DM9B 4OQFA 4JAVC 2NT3A 1UMCA 2JIZA 2NXJA 4P7GA 4LYJA 1S3IA 1X1AA 3F3MA 3KOOA 3RS8A 4QFCA 4JXJA 1XEXB 4XLZA 5TJHA 5C18A 1T10A 3HACA 4FYYA 3OEHA 3CW9A 1GKIA 3QUQA 4H9GA 4UNPA 1XZBA 1Z68A 2FG6C 4M9ZA 5TB5A 1Z7WA 2GZRA 1N2CA 2GM3A 2ADOA 4MUYA 2ZB2A 3BMXA 4PICA 4UAVA 4C6SA 5IJ0A 3H11B 3EPLA 2BGUA 3PD0A 3D3WA 4FGLA 1IAVA 3AJAA 1GZ4A 4IEFB 4RJ2A 3TD2A 1P4GA 1Y5NA 2GXUA 2N3ZA 2MR6A 1ZD2P 1G20A 1HNWB 1Z63A 5EWLB 3EISA 3S29A 1X6VA 3QVOA 3VPAA 2FCRA 4H2DA 1V48A 1SVMA 2X77A 2UUAB 3EMDA 3QENA 2ZUSA 4WINA 3SP1A 4EKIA 3BGVA 2D1TA 1LPOA 5JSZB 2YV2A 1E61A 2FRVA 4MAFA 2GKSA 3KB8A 3O8OB 3T5BA 4DPLA 2NQ2C 4RGVA 1JLHA 1NDHA 4B6OA 4B4KA 1W0KA 1O77A 2AOXA 4QGFA 3GWZA 4KO2S 3CE6A 3IMGA 1V9CA 3SEAA 4Z4FA 1E4EA 2QG9A 2XD9A 4BTLA 3E9RA 4X3CA 1J0XO 2O54A 1XCGB 1Z2OX 1SD2A 3EOAI 4G07A 2IV3A 4BWFB 1PNVA 1EFLA 2JVKA 4N9WA 2XQGA 1UXIA 3OE7A 4YT5A 2ZWIA 2C5HA 5LQCA 3KCQA 3S1AB 4ETWA 4O8CA 5AJXA 4UBOA 1DBRA 3M6XA 1HI9A 1DTEA 2FF7A 1AS0A 3KWJA 1C4OA 1VLQA 3HYTA 4M2LA 5HF6A 1YO6A 3KLPX 2BR4A 1IBCA 1TAQA 1E4YA 2FFQA 3NCHA 3T4EA 1IAQA 3LK6A 3SVZA 2PM8A 2XCTB 1XDDA 1WG8A 4WA7A 4CKEB 2J6CA 3JWHA 3AVXA 2KBEA 2NZJA 4ZPXA 3WNQA 3G8YA 4PYQA 2H08A 1OLXB 3VH2A 3VR2D 1E9DA 2PT7A 3H84A 1ANKA 3O8NA 2GZSA 1VMAA 1ODFA 2QTTA 3GR6A 3HVHA 1RJWA 1QQTA 2QIOA 3BRWD 4HK4A 4N3NA 3OM0A 3W9SA 1UKAA 2J45A 3P9CA 5JJKA 1TIKA 2F3QA 4QHTA 5B37A 1QRSA 2QI9C 3RUHA 4Q4CA 3OG9A 4KRXA 2VYND 1CIPA 1RKQA 3QRWA 1X3SA 2B3TA 4ZVSA 4A26A 4ALMA 2F1RA 5KPJA 2QIPA 1E0KA 3OT1B 3SC2B 5HRUA 1V8DA 2HQ1A 2WJYA 2XB2A 1KP9A 2P2LA 4R0MA 4AURA 1G17A 1M2NA 1RZVA 1UBFA 3R5SA 1AZSC 1RC1A 4KO3S 4Z8XA 3QKWA 5HJ2A 1UJ5A 2QRHA 2QVCA 2W2NA 4CCYB 3HS3A 1RLOA 4JJGA 3GLIE 3FDJA 3IESA 5FUMA 2H31A 5KOIA 1DWQA 2YVAA 2R2GA 3AZOA 1BWRA 4KLZA 4M0DA 1IWPB 2PSDA 4GE3A 4I55F 4RAQA 5INTA 1XNGA 4W5HA 1E1MA 2XVMA 2ZI3A 3OTGA 2ZJ1A 4QQKA 3MG9A 5KO2A 5CNMA 4ZEWA 3KLOA 1HV8A 4BNHA 4YJ3A 2JFBA 2PGNA 4RTMA 2GZHA 1UJ2A 3BXGA 3ZDCA 4KGVA 1AT1A 2OV8A 4AJOA 4HNVA 4RF4A 1IZYA 2D5LA 4O02B 2K7FA 2BFOA 1V1MA 4TV8B 1TYBE 4UAJA 3RFVA 3LW7A 2PCLA 2VAVA 2VTEA 3KJHA 4L08A 1JHUA 2A0YA 4NDNE 4WGGA 3U80A 2R8EA 2ROQA 4Z54A 3LH5A 1Z0DA 5BQFA 4IV8A 4DT1A 3MIIA 4MA4A 4KV7A 4CMJA 2ZT5A 2P30A 3LO5A 3NZEA 3TLGA 1OBVA 4QT4A 1U7TA 1ZONA 3G2JA 2XT0A 4FYIA 3FA2A 1RXVA 5KYXA 2J48A 4E7OA 1DOHA 1D2GA 3UO8B 4XCQA 1WAMA 4WEOA 1IATA 3SF8A 4RQAA 2CYBA 3U9SA 1NQVA 3QVJA 4K9PA 5FBLB 4RKEA 1JYSA 1Y98A 3F8WA 5JCPA 4PFSA 2NTEA 4QKQA 2VNSA 3DMDA 4TXHA 1WB6A 2IEZA 1FZTA 1H2YA 3JQ6A 1TFRA 2EKDA 5EY5B 3SZGA 4QO8A 1M66A 4KN9S 3CLRD 1W5FA 2P9YA 3FAKA 5FQOA 1RC8A 1OUMA 2UVPB 2ZPUA 5LBUA 1H8HD 2XUZA 2VOEA 1DFGA 3LFTA 3ODGA 3OZAA 4HWGA 4LDJA 4DLBA 1EXDA 4YBZA 1IFXA 3UJCA 4DV1B 5DGIA 1JA9A 4TS3A 2RHWA 2R1UA 4QXAA 4KQHA 3U40A 4GGPA 1CFJA 2OHGA 1VLHA 3LL7A 1AF4A 3K09A 4JR0A 1REQA 3C41J 4HVTA 2X6QA 3HGQA 3OT5A 4UAGA 5DULA 2JI8A 2WNHA 3R8XA 4ZCIA 1EHYA 1L7QA 3OCWA 4H7HA 4UHEA 1K9SA 1DFHA 1ID1A 1Y1TA 2QY9A 2GSWA 3AOEA 2JFXA 4WL0A 1HT0A 1GL9B 1T3TA 1MAVA 2EP7A 4P4UA 3ORFA 4FFLA 4E21A 1ENPA 5ERGB 4CMBA 1GHTA 4DN6A 2R7LA 3EZGA 2WKQA 4UOEA 3JYQA 3ELWA 3UHJA 3K1AB 2WK1A 4ITRC 3K1ZA 4N12A 2VXYA 1ONSA 3JXEA 4R7ZA 5AW9A 2REBA 1ELOA 1W2HA 2CYAA 2HMAA 3HCWA 5DXFA 5EAIA 1FJ2A 2HDNB 3QXGA 5IX8A 2Q2NA 4PHHA 1QNLA 2RHMA 5C0OE 1CJVC 4L7VA 4MQMA 2C7PA 2B37A 4MUAA 1RQRA 3DHVA 4DMLA 2DVMA 2CL6X 2BJVA 3OOYA 1VHWA 1ZOOA 3KT8A 1F1JA 1JKIA 3MINA 4QJ5A 3HO1A 4NICA 2QW1A 1TUBA 1ZOLA 2CSUA 1NYRA 1N2ZA 2J6IA 1NJ2A 3QU5A 2DZDA 3F5MA 4HZUB 4ZO8A 5DSTA 1HO3A 3GVPA 4YRDA 5EUMA 1JVNA 1RJ9B 2CHQA 1MKYA 4DILA 3EG9A 3FM9A 5JI2E 2WTMA 3I9V6 1SEVA 4BQOA 2WRZA 2JFPA 2P69A 3CLSD 3DW3X 1CUSA 1KS9A 2JBHA 3GOHA 4M3NA 5I4BA 4QTZA 3LUBA 1G3QA 4H3VA 1VZ2A 4DMCA 1MRZA 4HNAB 4WBNF 1XEWX 3L2OB 1JEYB 3VHXA 1WX1A 2B5VA 2PX4A 4XQEA 4CTOA 2UXDB 1OX5A 1G9XA 3DG9A 2CN1A 3NYRA 4N3BA 3FCSB 4RETA 3WLMA 5F21A 5IH7A 1A9PA 1I4EB 1LH0A 3N5CA 2FW6A 3NDBB 3ZD8A 2FZCA 3FH0A 2CT8A 4TXMA 3FJ1A 3MK31 4OUDB 1VPEA 1R8QA 1I4LD 1CY4A 1IL0A 1OCEA 4KO1S 2XA1A 3GGGA 2Q4RA 2CNDA 1M2HA 4O4HB 3DZFA 1RR6A 1WQ4A 5HZHA 3JQGA 1DHTA 2VPWA 3Q8XB 3MT9A 2BFFB 2OHVA 5JHHB 2OO7A 1F06A 3K1TA 3P97A 2YZKA 4NYIQ 3FZYA 5FTWA 3V9AA 2V3CC 3RVBA 5EFZA 5ALSA 1CVIA 2NZUG 2BONA 1VB5A 3RC7A 3TSWA 4EX6A 4QGBA 4GOLD 2YMPA 3HBNA 3LKBA 2D7DA 4UCQA 2PXAA 2VDRB 3M5PA 3SS8A 1XWFA 4NBSA 5KMGA 4RYLA 1Z4LA 2V0GA 5FFNA 5JJIA 2IXDA 3K09C 2QNBA 3UWPA 1WHTA 1KPIA 3DMHA 2VF8A 3AEQB 5F7ZA 4J3NA 2Q28A 5F2OA 2ZTHA 1KK0A 1M2FA 3IIKA 3PDIA 4FMDF 4LJ5A 3EPRA 3DBHA 3T12A 3AOEC 3I42A 4R6XA 2IP2A 3RRBA 4MIKA 2UZ3A 1K3UB 1AZLA 3EK2A 4EDHA 5JEDA 5F2KA 3U44B 2A9KA 2G36A 2P6PA 2YHUA 3I4CA 1UJBA 1POWA 3NTOA 2P6RA 3T9BA 5CXXA 5B64A 1E6CA 1X86B 2OLEA 2GJ4A 2RHDA 3LBHA 4I1IA 3L8GA 2X58A 4G0NA 3VR4A 1L4NA 2HBZA 5JIBA 5JPIA 3V4RA 3HUFA 3AIOA 1DC8A 2I3GA 3WYFA 1R6XA 1G0NA 3PPXA 3GAZA 4LZLA 3HDGA 1W73A 4HD8A 2C95A 5DX0A 5JPCA 2Y6VA 2J7PA 1R4NB 1KSHA 3H2JA 3KHSA 3ZHSA 2XZLA 3ZTWA 1HDXA 3DOJA 1NYTA 2YZ7A 1V1RA 1NX9A 4PHGA 3LXXA 3VSAA 2VAMA 1R74A 1SBNE 2WV7A 4NSNA 3TRJA 1W76A 4HVAA 1GPUA 1MG5A 4XWGA 4EB6A 4LKOA 1T3GA 3HBAA 2OO3A 4QATA 1GU0A 3ABOB 3HVUA 4IOKA 1ILWA 4RTLA 4A82A 1QTQA 4QNRA 2ZYAA 4ZZIA 5BPHA 5BT8A 4QLOA 1YACA 2FPSA 3KAPA 4C2AA 3KPUA 2V7UA 1TQHA 3LGXA 2CFRA 2R8PA 3TUIC 4FCTA 2JLUA 3WWCA 4DA9A 1A9ZA 1SC3A 2VFAA 3I83A 4XTRA 2WFMA 1D1PA 3OOWA 4O1MA 1UIMA 3UH0A 1K9VF 2BVNA 2HU2A 3H0CA 4KQ2A 2JFNA 4PAWA 1QQBA 3ZY2A 3ESZA 2C3PA 2PR2A 4X1YB 1BA2A 1Q16A 1G21A 2WJVA 4FZVA 5NULA 1N2EA 4PXAA 4RVCA 4DREA 5CYFA 1NRIA 2HSZA 3WMRA 4RMGA 1P39A 4CMIB 2WM3A 2H3HA 3LIPA 3MLAA 5C5EA 2DCMA 3C1AA 3I9OA 3REGA 1EUDA 4LG1A 4RE5A 1SCUA 3FBTA 1YU6A 3PUIA 4Y2TA 4XM0A 5C9ZA 2BH2A 4JLPA 2R4TA 3NFYA 2JLQA 4O4LB 4DSTA 2NTYC 1N6KA 1AXGA 3CZRA 2CZGA 2BTQB 3IPLA 3RU9A 4IYRA 4KKXB 2WWHA 3E7WA 3LA8A 2AZTA 1PEDA 2O3SA 4LSWA 2Q0HA 5EINA 4NLLA 5JDCA 3V3KA 5CB8A 3O8DA 1IXYA 2CUNA 2AE2A 4EENA 5FWYA 1OY1A 3AF5A 1ZU4A 3MFQA 4GX2A 5KNCD 2Q4DA 1EKXA 4IP0A 2E18A 2ORYA 1UT8A 5AM3A 1JBQA 2FQQA 2F4NA 3GGOA 3QEMB