The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
190
|
sequence length |
582
|
structure length |
552
|
Chain Sequence |
TFRYRGPSPKGDQPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASVSAIYGLGDPREYRARNLVVREVLLERLLELGYQRNDIDLSPGRFRAKGEVLEIFPAYETEPIRVELGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLYDLEMLRVMGTCPGVENYARYFTGKAPGEPPYTLLDYFPEDFLVFLDESHVTVPQLQGMYRGDYARKKTLVDYGFRLPSALDNRPLRFEEFLERVSQVVFVSATPGPFELAHSGRVVEQIIRPTGLLDPLVRVKPTENQILDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNARGEVWLYADRVSEAMQRAIEETNRRRALQEAYNLEHGITPETV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of Thermus thermophilus HB8 UvrB protein, a key enzyme of nucleotide excision repair.
pubmed rcsb |
molecule keywords |
EXCINUCLEASE ABC SUBUNIT B
|
molecule tags |
Hydrolase
|
source organism |
Thermus thermophilus
|
total genus |
190
|
structure length |
552
|
sequence length |
582
|
ec nomenclature | |
pdb deposition date | 1999-09-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00271 | Helicase_C | Helicase conserved C-terminal domain |
A | PF02151 | UVR | UvrB/uvrC motif |
A | PF04851 | ResIII | Type III restriction enzyme, res subunit |
A | PF12344 | UvrB | Ultra-violet resistance protein B |
A | PF17757 | UvrB_inter | UvrB interaction domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Metal Transport, Frataxin; Chain A | Metal Transport, Frataxin; Chain A | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |