1D2MA

Uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
582
structure length
552
Chain Sequence
TFRYRGPSPKGDQPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASVSAIYGLGDPREYRARNLVVREVLLERLLELGYQRNDIDLSPGRFRAKGEVLEIFPAYETEPIRVELGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLYDLEMLRVMGTCPGVENYARYFTGKAPGEPPYTLLDYFPEDFLVFLDESHVTVPQLQGMYRGDYARKKTLVDYGFRLPSALDNRPLRFEEFLERVSQVVFVSATPGPFELAHSGRVVEQIIRPTGLLDPLVRVKPTENQILDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNARGEVWLYADRVSEAMQRAIEETNRRRALQEAYNLEHGITPETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Thermus thermophilus HB8 UvrB protein, a key enzyme of nucleotide excision repair.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords EXCINUCLEASE ABC SUBUNIT B
total genus 190
structure length 552
sequence length 582
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.920.40 Alpha Beta 2-Layer Sandwich Metal Transport, Frataxin; Chain A Metal Transport, Frataxin; Chain A 1d2mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d2mA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d2mA01
5JS7A 2C77A 4BFUA 1NY5A 3GQBA 1XPUA 2OCPA 3CLVA 5CB6A 2X19A 3F3YA 2ODNA 2IYWA 3HR8A 4P31A 5JRZA 4LBYA 2JIZA 4OK5A 1OFTA 1YVDA 5HE9A 3AVPA 4BFXA 3KJHA 2F7SA 4BZPA 2ERXA 2FGKA 3T12A 4KU4A 5KDDA 4PPFA 3AF3A 1ZM9A 3CIOA 4M1OA 1UBFA 3CPHA 3A1WA 3L0PA 4EPYA 4TMWA 3NHAA 3KQNA 1T5LA 1GSIA 2DFNA 3FMFA 2ZRFA 4FXPA 1NSTA 4AG6A 4AG5A 4BGDA 1X3SA 5CYPA 2CCJA 3I3SR 4PANA 4DDUA 2Q9BA 2PCLA 4A82A 3RWMB 4QHTA 4ACBA 5L3QB 3B1ZA 1ZUHA 1W46A 3CKLA 4TLEA 4AD8A 3TK1A 4CEJB 3P27A 3ZIAA 4M1KA 3CBQA 4URWR 2O0KA 4HATA 3L82B 4LC0A 1G41A 1F2TB 1OH5A 2FEOA 4DJTA 1DAIA 3RS0A 5C1BA 1KK3A 2WWGA 4XD7D 2DCUA 1GWNA 1XCMA 2XJ4A 2Z5FA 4Q18A 4FD2A 2L0XA 2ZEJA 4IEEA 3PIRA 3ZVLA 3DOFA 2IBMA 4RSGA 4DUGD 5C4MA 4Q4JA 3AM1A 3AVQA 4E09A 1NKSA 2CE2X 5IDVA 2BMEA 4FMCB 2P6NA 4MKIA 1NIJA 4KLZA 1XBTA 4QC2A 5BN4A 1YZTA 1GNPA 2VA8A 4Q03A 4FWTA 4LSGA 3QI2A 2OM2A 3WYGA 2H92A 5DHAA 1KOFA 4ARZB 4XSGA 5HKKA 1CKEA 1S0UA 4FN5A 1VG1A 1Z6XA 1NVUQ 4FIDA 3SEAA 3U4QA 3R9XA 4JL6A 3TVTA 1P2UA 2SHKA 2BHRA 1ZBDA 4YMWA 2BVNA 2YWHA 4QGFA 5JWRA 2AX4A 1Z5ZA 4Q1EA 4QGGA 4E22A 5EP4A 5EQTA 4TL7A 4B3FX 4LCBA 4Y0AA 2IUTA 2UZ3A 4WZAE 1G3UA 2RGNC 2EVWX 1GM5A 2OV2A 1O3YA 4JLMA 1NF3A 3QPUA 1SKQA 4D4JA 1N6HA 3IPYA 1L4UA 5JEEA 1XFAA 1W4BA 3SYKA 3ICEA 1MOZA 4UJ3A 4BLOA 1ZW6A 2GZDA 3SC3A 3GLGB 4QKQA 3VU9A 2VP4A 5J47A 1E0JA 1CJKC 3IQXA 3N70A 1XX6A 4DEXA 4B43A 5CITA 4W7SA 3ZYCA 1UKZA 1YZGA 3QF4B 4PHHA 1P73A 2WWXA 3HR7A 1VYVA 5IK2A 2QAGA 5DI3B 1WCV1 5B2ZA 2QM8A 1QHSA 4MUBA 4HLDA 2AFHE 3NEJA 4U02A 1ZM2A 4A2PA 4YXWA 2H7VA 3PUYA 2OBNA 4TSFD 1OIWA 3VNVA 2IWRA 4C2UA 3MUFA 1XWIA 1ZD9A 4OQMA 1MO5A 3SYLA 3W5JA 2BCJQ 4KVGA 4G5RA 3U7HB 3HU2A 2ONKA 2WWIA 1L7VC 1NN3A 1ZINA 4IDQA 4IEIA 2DHRA 1D9XA 4JVSB 1P4SA 1JNYA 1Z08A 3P4YA 1OYYA 4YONB 3GJ0A 5K8IA 4MGIR 1TMKA 2QG6A 3EIHA 2ZETA 3OIYA 2ZJ5A 2WMOB 2ORIA 1KI3A 1N5JA 3VHLB 4Z1MD 2Y8EA 4TZ0A 5LB4A 1JPNA 2W6IA 3LDAA 5LD2C 2FF7A 2DFLA 5KNDA 4C3ZA 1VCNA 1QHYA 3FGNA 3FFAA 4DCTA 2I1VB 1BS1A 4P4TA 4D4MA 4BLRA 1Z8FA 4BFYA 2D62A 4NL4H 2QAJA 1FL9A 4G1UC 1E2GA 3VKWA 3GLHB 3P1JA 2ZI9A 4DB2A 1VHLA 2QNRA 2H57A 3W6OA 1XD8A 5FUYA 4KXFB 4BLSA 3TW8B 3MWJA 1UDXA 3WMFA 5J4YA 1TEXA 2OFXA 3RNLA 2FDCA 1OKKD 4EPRA 2JLUA 1D9ZA 1M8PA 1YU9A 5KOYA 1TQ6A 2WSMA 2QRNA 5EXSA 5G3ZA 4XIGS 2QEQA 3IEUA 2ZS9A 4QNRA 1RRGA 2X77A 1YJ5A 2O8DB 1K8RA 3TLXA 2RCNA 1DEKA 4TSFA 3AF2A 1S1CA 2GEUA 4C0AC 5FH9A 1MRSA 4GI7A 2B7CA 2D7DA 3S1AB 1OXUA 4I1OA 4PC7A 4QHYA 3T15A 1T4GA 3B9QA 3SN6A 1EWQA 1AIPA 2QORA 4GSYA 4TT3D 2QM7A 3HU1A 1DBSA 3U3OA 1OJLA 4HUQB 1FMJA 2W2VA 2QE7A 2BKUA 1XD2A 1XTSA 1MRNA 2AHOA 3CWQA 5LBIA 1XXHA 1E1QD 4Q5IA 3WY9A 3GJ6A 5B64A 1YRAA 4GRAA 4PO9A 3QSYA 5DLQC 5CLQA 4RZ2A 3SQWA 4C0BA 1E96A 3EXAA 2IS1A 2PH1A 3SJAA 1G9XA 3TVDA 3A1TA 4CT5A 3IHLA 1U81A 2JCSA 4PSKA 2C8VA 4G5GA 2YWEA 1IY1A 3Q8XB 1QHHA 4Q1DA 4P33A 4GP6A 1R0XA 2JGNA 2KBEA 1G8HA 3SHFA 1P75A 3T61A 2DFTA 3S1AA 3UXMA 3BBPA 4PHTA 4DLZA 3IUYA 1AKYA 5LD2B 4LYJA 4LC1A 1BYUA 1KMHB 2H16A 4JZKA 4WZBE 5EUQB 2O0HA 3B1XA 3U6KA 4OK6A 3A1VA 2R6AA 1NVVQ 2JJ8A 4TYWA 1DG1G 4L9WA 2B6HA 2GEDA 2RAPA 4LZZA 4DLTA 5BXQC 2ZI5A 3B9PA 4KSCA 1H8ED 2H8KA 3RLFA 1VKJA 3OAAA 3RS2A 3VR1A 3B13B 3FPAA 2KJQA 1YZKA 4X8OA 4C4PA 5A0FA 1KKLA 1TQDA 3FWYA 3KFVA 1SHKA 1TF2A 3D8BA 1NVVR 4Q02A 5DE3A 1XNJA 1WXQA 3LVQE 4IXMA 4N0EA 2HJGA 3CH5A 4LJ4A 4QGHA 4JKIA 4KI0A 2CCGA 3KKQA 4K46A 2GJAA 3GLHE 2DR3A 2HDNB 2WPDA 2F9MA 2KE5A 5GJCA 2J3EA 4JBWA 4M22A 5B58C 4O2RA 4BFWA 4V0ME 5CIQA 2FGJA 3I72A 2REXB 1K6MA 4HLUC 1KJWA 3CRMA 1D2EA 1XCGB 2VSOA 2AK3A 3I8SA 1RFLA 2VHJA 4AKGA 1XEFA 3QVVA 2GZAA 1Z6YA 3QF4A 3T5DA 3VAAA 4S2EA 4Q1BA 3C16C 3U3KA 4B34A 2EWVA 3UG6A 3OIUA 1YR8A 5AUQA 5TXGA 1CJVC 3VU9B 4HLUA 3W6PA 2FPLA 2YC2C 4BFTA 3I5XA 1QDEA 3CPEA 2GAOA 1Q0UA 4I1UA 3K70B 1E9DA 2VTKA 4KYUA 2RB4A 1RW4A 2GVDC 4Q4JB 2J1LA 2IC5A 1VYTA 2KBFA 2P0EA 4NYJR 3SZRA 2R9VA 1E2JA 1SULA 1XTRA 1E2HA 1TX4B 2CHVA 5IHPA 3FOZA 2XXAB 4CEHB 2XZPA 1E9SA 2J7PD 2V9PA 3K0CC 2QI9C 4QG7A 5AJXA 3ZZUA 1XD9A 1LS1A 3M1IA 4N0DA 4R71A 4ZI3A 4V0OA 2XB2A 4S35A 3H4MA 4IDHA 2Z4RA 2F9LA 3EZ2A 5DYGA 1OXXK 4ITRC 3ZD6A 2ZVQX 3FVQA 1P7CA 3OEHA 4MYCA 4LBVA 2D2FA 2QENA 3RABA 3AUYA 3X1WA 2Z83A 2IYSA 2FMXA 1WQ1R 3A36A 1ZVQA 4JVLA 3TUJC 3LLUA 4YC7A 3NBXX 3I1FA 5CDFA 3KFXA 2MMGA 3BB3A 3QPVA 2CHQA 4JBYA 1FMLA 1UM8A 3C14C 3K70C 3G0HA 2CLDX 1RIFA 1VCIA 1Z6GA 4LI0A 1SVKA 1EXMA 3A37A 4P0TA 5EE3A 3T5GA 3F0TA 3GCGA 2MMCA 3BFKA 4B6EA 1CXZA 4NMMA 4IDPA 4A0GA 2BEKA 3KKOA 4RD1A 3O8RA 2P67A 4GDFA 4EJSC 1NIPA 4MGZR 4US2R 4QBFA 3Q7PA 2A5FA 3UANA 1ZM7A 4I81A 2LWIA 4KFRA 3UMRA 4MKGA 4KSBA 1CEEA 1CJTC 3F8TA 3A4LA 4DZZA 4LHXA 5EP3A 3C4JA 1OB2A 5DHFA 1IBRA 1NKTA 4MKHA 3AGQA 2MSEB 4PO1A 1HE1C 4Q9JA 3ZZTA 2H18A 1Z6TA 3LFUA 2IXGA 1G4UR 5DNYB 5F2EA 5EJEA 1E9CA 3SBDA 4B33A 1OFUX 1KJYA 1E94E 2ZSEA 2ZE6A 1G19A 4Q9IA 1H65A 1YR9A 1C4OA 2X2EA 1HUQA 4M9SA 421PA 5EP2A 2BOVA 4EKDA 1NRJB 1GFIA 1OH7A 2XEXA 1I2DA 1KDOA 3CRRA 1E79D 1QHHB 3C5CA 4PAQA 2GVZC 3KKNA 1DG3A 2WICA 3BB4A 5KSZA 2FPKA 3CRW1 3WYAA 3U7EB 3LH5A 3H2YA 2X2FA 1IONA 1KDRA 1P2TA 3QPWA 3SBEA 1VG0B 3RSOA 2V1UA 5J4KA 2HUPA 2WOJA 8OHMA 1Z83A 4A0FA 4NCJA 2FH5B 3IQWA 3NDPA 2OSBA 2RGNA 1VCMA 3NIBA 1D5CA 5G53C 1FTSA 2QGNA 1XMJA 3K53A 3T34A 4A6XA 4QM6A 2ZYTX 3W3AA 5KYKA 3FDIA 3UK6A 1U0LA 1P6XA 2HV8A 1UADA 3B8HA 3MFYA 2J9RA 3OIVA 4CW7A 4QJ3A 3NH9A 4QRHA 1LF0A 1ZC4A 4XSHA 1KI6B 4AWXA 2EFEB 3CB4A 1N3BA 3B5JA 4HB4A 1J99A 3IGFA 1KO5A 2BMJA 4MDEA 3A6PC 1ODFA 3IBGA 4A8JC 4GZLA 4D4LA 4NCKA 1UF9A 1TL7C 5JFGA 3R9IA 2AK2A 3BIFA 4OI1A 4ZO4A 4A1FA 1DO0A 3MMPA 1IY0A 4B73A 3U61B 2D06A 2IXEA 2KI5A 2CHGA 2VHCA 5JSZB 2VL7A 1IJFA 1XD2B 1E9RA 1XTKA 3M0EA 1DAFA 2OE2A 3OFNA 1RRCA 2Q21A 2O8EB 4KFUA 2MSDB 4QM7A 2ECKA 4RD2A 2QP3A 2GF9A 3ND8A 5EZ6B 1WMSA 1NLFA 2NZ8A 2VP9A 3CF0A 3TIFA 3JVVA 1G64A 5HCNA 1G7TA 1C9KA 3L0SA 4LBWA 2QP9X 1E2QA 1EESA 3DOEA 1OXTA 1GNQA 3OIWA 4GPTA 3R7WA 3VR4A 1FX0B 2V4ZA 5A4JA 1SGWA 2A5JA 1EGAA 1M7GA 5JJKA 5JS8A 3OEEA 1G8PA 1XF9A 1Z47A 4TT3A 1XZPA 1MO6A 1UBCA 1LS6A 2W2XA 3EWAA 5UKDA 3SDZA 1Z2CA 2QU8A 5JLJA 2JLQA 2O8EA 1TEVA 5FR1A 3G82C 2FJUA 2DWPA 2OBMA 2IEZA 3RC3A 1FZQA 3QEJA 4BLPA 1KYIA 2J45A 2G1JA 5EZ5A 3GLHA 1YKSA 3LO5A 1LVGA 1KDTA 5EP1A 4RCYA 2WOOA 4L8GA 1DADA 4PPGA 4TYNA 1HH4A 1ZM3A 3ETLA 1X1RA 4FW9A 2EW1A 4U7DA 2E1RA 3QKRB 1ZNWA 3R7WB 2D4HA 4OKSA 1Y63A 2YOFA 5DI3A 3TNFA 3ZDQA 2BBWA 1GKUB 1N2CE 3QXSA 721PA 1QG2A 1G7SA 1E2EA 1G3IA 2PX0A 1WF3A 2GJ9A 1VCOA 1LY1A 1OW3B 3VHXA 5F98A 2PMDA 4UNNA 2IUUA 2NIPA 2QQ0A 1WDTA 3K1JA 3EWSA 1DOAA 2WIBA 4C0KA 1R8SA 4IVRA 4B2LA 1RYHA 5EUMA 4RFSB 2GBLC 3CZQA 3VX3A 4DSUA 1HT1E 4H1VA 3ZQ6A 4JYCA 5KO2A 2FG5A 1A2KC 4CT4B 3O8BA 3WXMA 4DSNA 4MUAA 3HWSA 3PV0A 3LNCA 2BJVA 4DEYA 2PBRA 3ZIAD 4Q7JB 2Z4SA 4D0LB 5JEDA 1SVMA 3MJRA 1J90A 3EA0A 3MAAC 2ZU0C 3AP3A 4LPKA 5G41A 3I73A 4C0SA 1FNMA 3IEVA 1W47A 2F3TA 1Z29A 4NDZA 1ZJ6A 1GILA 4JKYA 4V0KA 1WE2A 4TN1A 5TDHA 4GT1A 2ZRHA 1CR1A 5AR1A 1ZMXA 1U9IA 4ZDWA 4DT1B 4ZCLA 5FOSA 4MDFA 1T3HA 2J5XA 1G291 1NLZA 3LWNA 5D3MA 1XP8A 2F1JA 3UWKA 4BFVA 1Q20A 2ZREA 4RZXA 3R9WA 3RWOA 4HZIA 4LYFA 5DSZA 1MABB 2VIIA 3EPHA 3E70C 4TYYA 1OLOA 3FYHA 2QBYA 4POAA 4Q9LA 4OHXA 2GHIA 4UXHA 4MGKR 4CGZA 2ZRPA 4MYHA 3WP1B 4B74A 4OK3A 5DN6A 4EDHA 2XZLA 1AQYA 2ZRIA 1R2QA 1BO6A 4XVUA 4TL6A 1RJ9A 3AF4A 3VR3A 1OE0A 2UVQA 2F6RA 2FV8A 4RZ3A 1T8TA 2O52A 5D3MB 3QUSA 1M6NA 1P61B 4WA7A 4I4LA 4JJZA 4M21A 4PHFA 2O8CA 1XJQA 1J7KA 4ZDJA 3UPUA 2YWGA 3IIMA 3VNUA 3QIAA 4PXAA 4F93B 5CB8A 3K0AA 3QG1A 4LHZA 2CJWA 4E07A 3MCAA 3CUEF 1K5DA 1VYUA 3LBNA 2KB0A 1JR6A 1Q21A 4QBHA 2JA1A 4JLDA 2F55A 4EPXA 3ONWA 1P9NA 2WBLC 4OQXA 1GZSA 1R5OA 1E0KA 3QY0A 1LV7A 3GLIE 5HE8A 3PR1A 4IKEA 1MR3F 4WAUA 3VR5A 2XNSA 4AY2A 2B8TA 1ELOA 4X8MA 4GNKA 1D2MA 1KK1A 2FA9A 1XPRA 4G3XA 2EQBA 1M1YE 4PZZA 4M4SA 1E9FA 1SVSA 2R6DA 1XCPA 2ODEA 1W1WA 5FPYA 5ELXA 2EFCB 3U7FB 4XH9B 1SKYB 3SQXA 4RD3A 4D25A 5L3RA 5CJPA 4F91B 3JVUA 5J40A 2OILA 2I1QA 2WKQA 4EFMA 2FSHA 4WXRA 3QXHA 4YMUA 3ASZA 1N6OA 2NZJA 2OCYC 1OV4A 1R4AA 2E9SA 4RZUA 1BOFA 3TUZC 2FPMA 3B82A 2A7QA 3I4LA 2WV9A 2ZI7A 2YINC 5K8UA 2J0SA 4Z1MA 5FPTA 2Z6VA 5G40A 4C7OA 2VEDA 5B30A 1V5WA 3I32A 4DLUA 3W8RA 1W36D 4ASUA 1ZM4A 2C9CA 4B71A 4HAWA 4ZIRA 3V4FA 1XEXB 1Z0AA 1CR4A 3SS8A 1CJMA 1S2MA 2DWOA 3KXLA 1EK0A 1R10A 1US8B 3WNDA 2NPIA 4W5WA 3A4MA 2GF0A 2ZR7A 1JALA 2NO0A 2GJSA 3KJGA 3BD9A 1CULC 3TR0A 3EIQA 2YHSA 3FKSD 1Z07A 1RKBA 2HLDD 1KI8A 3QOFA 1E0AA 1ESMA 2OLJA 1E79A 3LXXA 1XJ0A 2QROA 4Q4AB 1NBME 1KI7A 5AWFC 2XNDD 2ZU6A 1ZP6A 1IN7A 5CYOA 2N1BA 4BPBA 3UATA 4PPNA 4DLWA 5F9HA 3TE6A 1P5ZB 1RYFA 2C5LA 3OE7D 1VECA 5FOTA 1H8HA 1S1MA 2C9YA 1KO8A 3BORA 3WNBA 2VO1A 1U8AA 2QE7D 1B23P 3VX4A 1Q1BA 4DB4A 1CRQA 3K09A 3REFA 3K9HA 1FQKA 4OHWA 1KJZA 2IT1A 2GCOA 2ZI4A 3PG5A 4OI4A 1NY6A 5GVSA 3FHCB 4AI6A 1XU4A 2IUSA 4UXJA 3BE4A 2AXNA 2ZI3A 4QBGB 4YDHB 4JLVA 3BXZA 4HB2A 4PZYA 1S96A 4MRVA 1I4LD 2OCAA 3PUXA 3QJYA 4NCIA 4LY6A 4RKEA 4M0LA 4TWZA 2TMKA 1KAGA 2YOGA 3IHWA 3TJZA 2RHMA 1M2OB 2HF8A 1W7AA 4R7ZA 4BEBA 1QHNA 5BN3A 4TTPA 2CNWD 3RVBA 4XWKA 1COWD 1XXHB 3OFND 3KDSE 4PSAA 4DBLC 4PQFA 4NHOA 4TQ9A 1OFIA 2ANCA 5C46F 1U8ZA 1ZC3A 3NH6A 1J70A 1X8LA 2G88A 3K0SA 4PHGA 3GLFB 2F43B 3SR0A 3K9NA 3E5HA 5FUVA 1PUJA 3GEHA 2HLDA 3TSOA 5B57C 1E2IA 1VHTA 4P4UA 1BYIA 4TL8A 3KQUA 2RHDA 4WOPA 4CRWB 1W2GA 3PQCA 2DBYA 4KLNA 4IOKA 1C1YA 4NP6A 4HDCA 1VMAA 2Z43A 4QFMA 2IXFA 1QHIA 3LAWA 5JJLA 4GMXA 3HDTA 1QF9A 2W6JD 3TSZA 4QGAA 1VDZA 4DIEA 2FSFA 2IYVA 1R6BX 2ZAMA 2HXYA 2QBYB 1G1MA 1XTIA 1T5IA 3P26A 2K5UA 4HB3A 3OE7A 4TMZA 4IFBA 4Z8XA 2O8CB 1W4RA 4ERNA 1OIXA 1E2FA 1HEIA 3KQKA 3KXIA 3RS7A 1SVWA 2PX3A 3GJ4A 2CDNA 4B32A 2XGJA 3GJ5A 3BOSA 1RVDA 2ZJ8A 4GFDA 4R2HA 1BMFD 4CEJA 1XEWX 2ZUBA 3GJ7A 2UZIR 3O47A 4KO8A 5JMTA 5TVKA 1ZUNB 5L3QA 1A4RA 2OT3B 1YHNA 3DZ8A 5TMPA 3KJIA 3R8CA 4W9MC 1N5KA 5E3HA 2VYFA 3A8TA 3Q5DA 4NPHA 5BWMA 4DHEA 3TQFA 5D3QA 5DIFA 3AUXA 2GCNA 3P20A 3QKSA 1SXJE 1GDDA 3B78A 4LBZA 3LW7A 2A5GA 2DWQA 5AJVB 4B35A 3HPQA 5LPNA 4AURA 3H0KA 4DT1A 5FBVB 5J4HA 1LFDB 3EC2A 1CP2A 1RPZA 5GJBA 3H84A 2R6FA 3VQTA 2XOKD 4LJ7A 2HYDA 1LW7A 4UNRA 3QE0A 4JVNA 1E2LA 1ZNZA 1D2NA 2YZ2A 3DVLA 5KSOA 3WHLA 2AWNA 1GTVA 4HB0A 5FPSA 4B47A 3VKHA 1Z6AA 2WKPA 2GXAA 5H8WA 4Q48A 2Q6TA 4PAMA 4EFLA 2V6JA 2O8BB 4D26A 1DAKA 3AEZA 1X86B 3EA5A 2BEJA 2A5DA 2QY9A 4UNQA 4F4JA 4ZDKA 2FFQA 2G0TA 5KSPA 4D81A 3QKRA 2G83A 1JJ7A 1U2RA 3VMFA 1CF4A 5JHHB 4HAXA 4AIIA 4ZIRB 4GOJA 3RHFA 3T06B 3V00A 4EPTA 4M9ZA 4OHVA 5JJIA 4V0NA 4JYBA 5JWHA 1HTWA 2VSXA 1G5TA 2XXAA 1G4AE 1HYQA 3KQLA 2V3CC 2NOAA 1OHHD 5HZKA 1UKEA 2P65A 3ADDA 4AYXA 3HPRA 1EFHA 2ZJ2A 3NHBA 3VFDA 2BCGY 1EX7A 1XMSA 5GADl 3LBHA 4QXAA 2XSZA 2I4IA 2WTUA 5FOUA 3KTAA 5C2JB 2QAGB 2ZTSA 5DN6D 1R7RA 5IRCD 1J2JA 1K5GA 2ORWA 2PT7A 4EFNA 1VG9B 2YWFA 4Q21A 2B92A 4B76A 2FZ4A 4WXPA 3CPJB 3TAHA 1Z28A 3LVRE 3O8CA 2W58A 2P6RA 1JR3E 1TQ2A 2X1VA 4ESVA 4C0QC 1NP6A 2NQ2C 4PZLA 4ZI2A 2ZYUX 4MKFA 2WIAA 1OB5A 2ORVA 1VTKA 2FEMA 1SXJA 3AVUA 1JI0A 3NBFA 1P72A 1ZUIA 4IJMA 3TAUA 1EFCA 2WSSD 2DB3A 2RGEA 2GK6A 1A5TA 2NG1A 1KHTA 1SVLA 1W0KA 4AC9A 3GMTA 4XD7A 4C30A 1FQJA 4OQFA 4A36A 1Q3TA 3QENA 4F7WA 3PUZA 1NL3A 1G6HA 1AGPA 1N6RA 2RGGA 2YJTD 5FOWA 3B60A 3LBIA 2ZJOA 5H68A 2GAAA 1ZIOA 1RJ9B 1X8KA 3TGPA 5P21A 3PCRB 4Q4HA 4IW3B 2RKOA 4DLSA 3GLFA 2QAGC 2BIFA 5AK0A 5EE5B 4I1SA 4DCNA 3EASA 1DARA 2OXCA 2DPXA 5FUXA 1YQTA 4GL2A 3H1TA 1YZLA 3C8UA 4NE2A 4KODA 3K0AB 1DAGA 2XSZD 1M74A 1XEWY 5F9FA 4CZ2A 2C04A 4IFEA 1W4AA 2OAP1 2DY1A 2C2HA 2NMVA 4DLRA 4LUCA 3PUVA 1P62B 4DDWA 5KPDA 1OPXA 2R2AA 4A4DA 4BRWA 5TARA 5DGXA 1HA3A 1Q12A 2D3WA 4C9BA 3KXKA 4LRWA 2GA8A 2UKDA 3BK7A 3QKUA 2CK3A 4HZUB 1TNDA 3WNCA 2XB4A 4UNPA 2BMFA 2FWRA 4M9QA 1UEJA 2VHTA 4FWIB 1G20E 1N6IA 1S4QA 4RY2A 4L4UA 1KDPA 2FFBA 3OZXA 4I99A 5BW8A 3K8YA 1CR2A 1ZAKA 1DAMA 1W0KD 1KIMA 2JJ1D 3AKYA 3EPLA 3HYTA 4DC9A 3FE2A 2ZE5A 3IDQA 5DH9A 2QTFA 4DCUA 2RH5A 4LHWA 2QPOA 4B3DA 5FBLB 1Z63A 2HT1A 4V02A 4XTRA 5FTMA 3TW4A 2BV3A 1E4YA 3KTAB 3CRVA 4Q01A 1Z0IA 3PUWA 2F1RA 2IF2A 1IXSB 4B48A 3TR5A 2W0MA 4HLQB 3ADCA 3KKMA 2IX3A 1XEXA 2H17A 2OFOA 1MO3A 3FFBA 3LXRA 3OEED 4P4SB 1IM2A 2ZUCA 3QBTA 1E1RA 5HTKA 3UMFA 1UFQA 1AJEA 2VBCA 3L8YA 4WVFA 4HDOB 4D2IA 4KJZA 4KITB 1N5IA 1W49A 3W90A 1N0UA 1AK2A 5EXTA 3AVOA 1G5PA 1UAAA 4RFVA 1E99A 3SI7A 2ZJAA 3SOPA 1EFRA 1KAOA 3RS3A 3HYRA 1TQ4A 4QOSA 1G8FA 2G77B 2YVUA 2BWJA 1PV4A 1F60A 2QZ4A 3Q72A 1FX0A 4LHYA 1X8JA 1R0ZA 3NG1A 3JZMA 2KSQA 3WMGA 1F2TA 3D6TB 1CR0A 4DSOA 3GLIB 2ZSAA 4QHSA 1KI9A 4FCTA 3PXGA 4JS0A 4CYMA 2IWHA 2PZFA 1GRRA 3SFVA 1OH6A 2OO7A 3IPXA 1G7RA 4ABYA 1PUIA 4L9SA 3RRZA 3AKDA 1II8A 2ZIAA 3U3JA 2H5EA 3DL0A 4DDTA 2PJRA 4UJ5A 3THWB 2Q3FA 2BMDA 4L5BA 3D31A 4B6FA 4FMDB 2R44A 4NTZA 1U98A 5HPYB 1HURA 3MRSA 2QQEA 1KSFX 1X6VA 3RSLA 1U9IC 1YR6A 1GP2A 5DISB 1XTJA 4CEIB 2OLKA 5L3SA 3WHKA 3GP8A 2RGXA 2YNMA 5F3WB 3GFTA 3ASYA 4URZR 2ZVPX 2CLSA 3UG7A 2BDTA 3KB2A 4LX0A 2J59A 4ZKEA 1Q57A 3CR7A 1AS2A 4DUGA 4LPSA 3X1YA 2JDID 4EQ6A 1DTSA 1T3LA 4XVRA 4D0NA 4Q1FA 1G21E 1M7HA 1N0WA 2XZOA 3SNHA 2LCFA 4AKIA 2FU5C 2BJWA 1EFRD 4Z8YA 1ONBA 1JJVA 2ZRKA 2WJHA 1CIPA 2IHBA 3BS4A 1CTQA 4B3GA 2PT5A 1A2BA 1UKYA 2QN6A 4FMDF 1F2UB 2PLFA 4C0LA 5KSYA 3X2SA 2CVFA 4II7A 4EJSA 2LKDA 2GZHA 4P32A 2O8FB 3IIJA 4R2IA 2ZQ5A 3QXCA 3VKGA 3GFPA 3RAPR 3I5YA 1P60A 2FZLA 3FTQA 3MGCA 4TLBA 2ZRBA 3QXXA 4NYIR 1KSGA 2J7KA 3SU8A 2GXUA 3ZJYA 5AUNB 4ZDIA 1GL6A 4ZPXA 4HSEA 2J87A 2ZJBA 3CX6A 2V8OA 3AP2A 2GCPA 4LHVA 4LOAA 2ZE8A 2ERYA 3T35A 1GITA 5FBQB 3CRQA 4N1AA 2GNOA 2QT1A 2XTNA 4HUQA 3TUIC 4BECA 4U5XA 2GCOB 2V54A 2PL3A 1KMQA 3I61A 4LK2A 4DLYA 2QMUA 2QMOA 4TYQA 4NYMQ 1E4VA 1XMVA 4IOJA 2VF7A 1YRBA 4LGMA 2JATA 4CF7A 1IQPA 2AWOA 3EZFA 4KVAA 4IXNA 1TF5A 2XTMA 3AF1A 1Q1QA 1XB2A 2VP2A 3ICQB 4G0NA 2Q9AA 1ZU5A 4EAQA 3FB4A 4YDSA 1CS4C 3FKQA 5IK2D 2RGAA 1P2SA 3CF2A 3K70D 4F4CA 3G5UA 2JDIA 4Q7KA 4KAXA 1T0JB 4FI3C 4YXWD 4OHYA 5CM9C 1G16A 3ZGXA 3IILA 2X8AA 1KI2A 4B2PA 1OHHA 3WBJA 2MSCB 3CZPA 2IK8A 2R62A 4RCZA 1T9HA 1PVOA 1IAQA 4BQSA 5CJ2A 1JXOA 1J8MF 3NBZC 2R6GA 5KHOC 4OYHA 2ZYWX 4PSVA 4HAUA 2XTZA 3AKEA 5CIWA 2ZXUA 3QQ5A 1IHUA 5SZHB 5E95A 4BLQA 3WP0A 2W83A 4HAYA 3U7GA 4GOXA 4NONA 1XRJA 4CEIA 4MRPA 4BFSA 4A8JA 4H1UA 121PA 3MG9A 2V6IA 2VHQA 5JI2E 4Q1AA 4URUR 2QT0A 1N0VC 2C9OA 3LY5A 4NYIQ 2PLRA 5GJVC 4TLDA 5JBQA 2OZEA 4UKDA 1AGRA 3CH4B 2ZPTX 3GFOA 2G1KA 4W5JA 4WZ6A 1SKYE 2JAQA 1FP6A 3AP1A 3ZVMA 4Q7MB 2P6UA 1NN1A 2NO7A 4EJSB 1I4DD 3FKSA 2WHXA 1PZNA 3BH6A 4A92A 1RC8A 1U0HC 1E6CA 3LX5A 2IS2A 4FCWA 3GLIA 2WKRA 1HE8B 2J46A 2NO6A 3C7KA 1KY3A 4RJLA 5FPKA 3CR8A 3ZS8A 1QHGA 5A5GA 1U8YA 4KYIB 4KHZA 4B44A 5SZJA 2O0JA 1AM4D 1NI3A 3DMDA 5HCIA 2R6CA 5JSZA 1Z0DA 1II0A 2VP6A 1OF1A 4CEHA 3X1ZA 3SJBA 1SVIA 1NNEA 1G8GA 1JAIA 1H8HD 3EPKA 4CDGA 4R9UC 3MSXA 1ZYUA 1JXMA 3BH7A 2C78A 5SZIA 4EUNA 4LV8B 2Q0HA 2ZRAA 1XJCA 5DO9A 3F5FA 1E9AA 1GAJA 5BN5A 1N6LA 3EG5A 4ILEA 5ANRB 3PJRA 3IBYA 3PVSA 2ZRJA 1F48A 1NVWQ 1IN6A 1NN5A 4M1TA 1JAHA 3X1DA 1S8FA 1FUKA 2LKCA 3PEWA 2HEIA 1E98A 5K8TA 4UXIA 5L3SB 1EX6A 1OIVA 3EIEA 5KTYA 4MRRA 2D2EA 2KWIA 2CEAA 3LQRA 5FTLA 4DLVA 3BJIC 1COWA 1J8YF 2REBA 4JL8A 3WYFA 3THXB 2IF0A 1D6JA 3DMNA 2ZS7A 2WAXA 3NTUA 3MWKA 3K9GA 4IDOA 1RRPA 3U3RA 2BM0A 1SVOA 5CK5A 1GIAA 3EPJA 4TLAA 2YV5A 3KUCA 1G8YA 3K9LA 2QA5A 4ON9A 5G3YA 4Q00A 5KDLA 3OAAD 1FW6A 2PZEA 5EXXA 2FNAA 3CNOA 4NYMR 2N42A 621PA 4TLCA 4MITA 4JLOA 1CRPA 1KZGB 3LV8A 5H70A 4DVGA 3U3MA 2YC4C 3NWJA 2W6JA 1E1RD 3BERA 4QBIA 1UBEA 4ZCIA 2EYQA 4JLAA 3NEYA 4XWAA 1NSFA 2G6BA 3PEYA 1FFHA 1IXZA 1TPZA 2WPDD 3GEEA 1A7JA 4Q66C 1MV5A 1N25A 1LB1B 2OEPA 1KI4A 1A82A 3O8DA 3VR6A 3MD0A 4V0LA 2EFGA 2IW3A 2WZQA 4CIDA 1E32A 4DDVA 3RYTC 2A9KA 2FX3A 3U44B 4LJ9A 5FFMA 2ZR9A 4E5UA 1WB9A 3QNUA 2F43A 4BZQA 1GG2A 4B3BA 3HJNA 4TL9A 2O8DA 1W0JD 3UKDA 1G17A 1CLUA 1ZIPA 1RZ3A 3B6EA 2W0SA 3RC8A 5E4FA 3QEOA 3R8FA 4IVQA 1PLLA 4R98A 1QBKC 1NBMA 4O3MA 1Z22A 2J0QA 4RD0A 3I92A 5CDFE 3MJHA 5AJWA 4X8LA 3IO5A 4HAVA 4DKXA 1S9DA 3JZAA 5JCZA 5HZHA 3ECCA 2F3RA 4O25A 5KPJA 1E2MA 3FMOB 1E69A 2IYUA 1YZUA 1W2HA 3H86A 2ZROA 1NMXA 2Q3HA 3U2QA 3BGWA 1L8QA 2V55B 3AGPA 3CX7A 1MKYA 5DI9A 1WRBA 4URVR 3OEHD 3Q3JB 1NMZA 3P4XA 2RGDA 5KNBA 1N6KA 4P3YA 1KY2A 1NLYA 2C03A 1CBUA 3GJ8A 2IYQA 1FTNA 2CL0X 2DFKB 5JHGB 1WBBA 4A8JB 4TMVA 2RMKA 2H1LA 2BBOA 3L0OA 2IYXA 3AVTA 1L2TA 3TQCA 1B0UA 4TTRA 1EG7A 3AH8A 2P5SA 2OXRA 2QPTA 2ZYVX 2G0NA 2V7QD 2OUKA 4KFTA 4EPWA 3EX7C 3QXJA 4XWOA 2IS4A 4PC3A 4PR0A 2IYTA 4KCGA 2RGBA 1ETUA 1JECA 4JJKA 2NGRA 3T1TA 2F1HA 2JLVA 2JIZD 1KO1A 1F3OA 1EFUA 1ESNA 1IY2A 4MYUA 3VTKA 4EIWA 1UEIA 3Q9LA 4XVQA 2QL6A 1KSJA 2IYZA 3AVXA 4IVPA 2VH5R 2PEYA 4TZ6A 1SXJC 4GZMA 4OJQA 1PLKA 2W2TA 4V0MA 1Q1ZA 1PJRA 1VG8A 2N46A 1NBMD 2ZRMA 4PQYA 3TH5A 4TMKA 1Q44A 2QSYA 3AKCA 4G5SA 4KBGA 5EE9A 5L3VA 1E9BA 4HAZA 3QBVA 4F38A 3DPUA 4UNSA 2QMHA 2HJVA 1ANKA 3DO6A 3SYNA 4DLXA 1XTQA 1M34E 2CMKA 2EWWA 3KZ1E 1R5NA 4NH0A 5JECA 3AB3A 3WBKA 4PAOA 4OJKA 5AUPB 5GJWC 4Z54A 2AFIE 1YZNA 2ZSBA 4QJ5A 2GK7A 1IXRC 1DPFA 4HUTA 4URYR 4GMDA 2OBLA 2A5YB 2YYZA 4C0JA 1WA5A 1GUAA 3SE0A 1DELA 1HQCA 3Q5EA 1AZSC 1W36C 1N5LA 3KJEA 1VPLA 1G7CA 1U94A 1EFTA 4A0HA 3TRFA 4BEJA 1QVRA 2WVJA 4Q9KA 1WBDA 4Y0VA 2C98A 3THXA 3T1OA 3AV0B 1S3SA 2WWHA 4OI2A 4M8NE 2CLCX 3CNLA 1KKMA 2GJ8A 1E0SA 3N2EA 3RDPA 5HKKD 1P3JA 4BLTA 2IL1A 3K09C 4AK9A 2O8BA 3EZ7A 3CNNA 5C18A 4E03A 5FBRB 5SZKB 1U0JA 4U00A 5BYJA 1FUUA 3GD7A 4C0HA 4EPVA 3WRYC 3D7MA 3DKPA 5JRJA 1KK0A 5E7JA 2GESA 3MWYW 4EQ6B 5K8LA 4AYTA 4URXR 1LTQA 4GP7A 1YR7A 3I62A 2AR7A 3L43A 4KFSA 5FUWA 2GILA 1JB1A 3P32A 4YLGA 2JLRA 2HT6A 1KK2A 1YE8A 2PJZA 2Z0MA 1BKDR 1UJ2A 4PC1A 4IHQA 3UIEA 1QHXA 1OXVA 5FOVA 3W5IA 3CW2A 5LB2A 3B85A 1XMIA 1G3RA 1S3GA 4BRUA 2OFWA 2WM9B 1MABA 1KO4A 3A1UA 2JJ1A 3A4NA 3CO5A 5TB5A 2JEOA 5HR5A 2CBZA 1N6PA 2IYLD 4PO8A 1Z3IX 2GEVA 3ADKA 1P9RA 2QSZA 4JMPA 1TADA 1JEEA 2VLIA 1OFHA 3EC1A 1IN5A 3CF6R 3A1SA 1IJEA 2FOLA 1JEDA 1Z2AA 3RRNA 2AD5A 4US1R 2E87A 4N3NA 4M9XA 4FMCF 2CXXA 2CL6X 3W3ZB 2PZGA 4V03A 5EXPA 2QGZA 3NC1C 5FTJA 4J0QA 3THYA 4LJYA 2WJVA 3KB1A 3WMEA 3QF7A 2ATVA 1XZQA 3IKJA 3LX8A 1E2KA 5CK4A 1BH2A 4F92B 4RD4A 3OESA 4YMTA 3KKPA 5FL3A 5TV2A 4KV9A 2ZSDA 2P3SA 1JPJA 1TU3A 2ZUDA 2BM1A 2W00A 3L8ZA 4PC2A 3PEUA 3B1YA 1KZ7B 4D6PA 2G9NA 4DIDA 1JQJC 5FI1B 5FTKA 4YQFA 1T91A 2GXSA 2ZM5A 2BBSA 1SQ5A 4H9GA 1UBGA 3T1QA 4BUJA 2HXSA 4D0GA 3THYB 2ZRCA 5LDDC 1NJGA 3SJZA 2GETA 2AKYA 1DS6A 4MA4A 1S9HA 2HYIC 2IYYA 5FI0B 2VQSA 1W48A 2IHYA 2GBLA 3AVYA 2OG2A 2CVHA 3BAFA 2P5TB 1MH1A 4MQBA 4PFSA 1X1SA 1OYWA 1ZU4A 3KX2A 5FR2A 2WJIA 4M53A 2ODBA 2JLXA 1SZPA 2ODWA 3E1SA 3BFVA 4DWJA 3V9PA 2VHUA 1DE0A 2B7BA 1ZCBA 1TUIA 1RRFA 5FL7D 4C7OB 1KI1A 1NMYA 4X8HA 5DYIA 4BWYA 2AXPA 4C2TA 1OSNA 1UKVY 3SJCA 4HI0E 4NZYA 3QKSB 1Z06A 2QUZA 5E7IA 4JSYA 1GVNB 2WJYA 1XPOA 4JVMA 4GBMA 2WWYA 3KL4A 4LYHA 4MRNA 3ZLJA 3Q7QA 4PPQA 5KUTA 4OHZA 1HQYE 2EU8A 5CM8B 2GKSA 1GKIA 3Q85A 2AN9A 3K0FA 3PFIA 4MRSA 2ZS8A 3EZ9A 2C95A 2CJWB 3QVUA 4D80A 4XOIA 4MGYR 3TKLA 5BYKA 1E2NA 2B8WA 3NBYC 3W6NA 2JLWA 4ACAA 1W4CA 1QG4A 1V43A 4IRUB 3RS5A 821PA 1P9WA 5TY0A 1W0JA 4Q19A 4XJXA 1TTTA 1PLJA 4NCNA 5JZVA 3ADBA 3CM0A 3DM5A 3SFZA 1Z0FA 2ZITA 1ZNXA 1E2DA 2G3YA 2QMEA 3FMPB 3UWOA 2F1IA 4QNMA 1Z0JA 2GDJA 2OAQ1 1NVXQ 1T0HB 2A2ZA 3B1WA 4FCVA 5JI3E 2OESA 1DO2A 3OHMA 5JCPA 3VR2A 3GLGE 3J81k 3BH0A 4BFZA 4K8OA 1YZQA 4JLNA 4DSTA 2ZRNA 5KDOA 4Q1CA 3KUDA 3C15C 2C96A 1H8EA 2OCBA 5JWOA 4Q4HB 2O8FA 4ZKDA 4Q9HA 1U99A 1KTVA 4ARZA 1E9EA 3NC0C 5J5CA 1QRAA 1AQUA 4JLBA 3LD9A 3EW9A 4M1YA 1AN0A 3PEVA 2IYRA 3D3QA 2JLYA 4RD6A 2ZANA 3NVAA 2JJ2A 4PTLA 4DRZA 1R8QA 3B1VA 4ZCMA 1Q1EA 2P2LA 3N2IA 1CJUC 4B2IA 1G3MA 1WP9A 2D74A 2VPPA 4YMVA 4MH0R 1ZRHA 5FPHA 3L2OB 4Q4LA 1KSHA 4QL3A 4JT2A 3NKVA 1AKEA 4HEJA 4GOKA 4TQAA 4YMSA 4G01B 2V7QA 2NPFA 1SXJB 4A2QA 1JR3D 2EFHB 4TYPA 1GOTA 3U5ZB 4AKHA 6Q21A 4JL5A 1II9A 4HYYA 1LNZA 3ND9A 4IOLA 2QTHA 3GJ3A 3RRMA 5L8VA 2ZI6A 3CONA 4RVCA 4K81B 2IA5A 4LV6A 1LF5A 1JBKA 3FHTA 4JSTA 3N5CA 1DAEA 1Q22A 1ZD8A 2RGCA 3DZDA 3THOA 1AA9A 2QPAA 3AVVA 1CU1A 2IS6A 1GRQA 4NYJQ 1ZD1A 5FBWB 3MLEA 1IOZA 4ESHA 4LYAA 3RS4A 4M1MA 4WBSA 3GLFE 1T6NA 2XAUA 3M4YA 4A2WA 2B21A 3QG5A 2R8RA 3DKVA 1HY3A 3TBKA 4ASUD 1T3SA 3HU3A 4AYWA 5KU1A 2AD1A 4W5HA 2HCBA 3KQHA 2XOKA 1Y3AA 2J7PA 1MT0A 3EZ6A 1G18A 2REOA 2JASA 3CWZA 4L16A 4CVNA 1GNRA 1JQLB 1HV8A 2WWWA 4KBFA 521PA 5BQ5A 3PITA 2GXQA 4G5OA 1KO7A 4G5QA 1P2VA 2ATXA 3EAQA 5EE0A 2VF8A 4JLJA 4B75A 2VSFA 2JJ2D 1DAHA 3ZD7A 3LW8A 5CLLA 1AZTA 4B3CA 4L15A 1W36B 3DHWC 3K0CA 1QVAA 2NO1A 4JLPA 2A78A 2QTVB 3DM9B 1I4TD 4IDNA 1MO4A 2EFDB 4BZXA 1FNNA 2HCJB 4HZUA 1OT3A 1VIAA 2WJJA 2FSIA 1IN4A 2XNDA 2BBTA 3A58B 2GWHA 1JR3A 2ZAOA 1AS0A 2O5VA 1T8UA 3FHOA 1SHZA 2WWFA 1AS3A 2BKEA 4LDJA 2ONJA 1W5TA 1OH8A 3IO3A 1D8TA 2PMKA 1KMHA 3FMIA 4PQRA 4Q7LA 4M1WA 1VIYA 1I2MA 3AF0A 4O2LA 3BB1A 221PA 5H1YA 1ZNYA 1IN8A 1XDBA 1FP7A 3GLGA 2EYUA 4I1VA 1R0YA 1E2PA 1UDWA 2W6ID 5FOXA 1U90A 2Q3MA 3DDCA 5C4GB 3WRXC 1Q3HA 2ZRGA 2OHFA 5IF9A 3C5HA 2NTYC 3QKTA 3C41J 4LJAA 2FFAA 1TF7A 4TMTA 3HP1A 2QRZA 5E7MA 1GL9B 1O87A 1SXJD 4JLKA 1EWRA 4OQNA 4B3XA 3AQ4A 3E2IA 4AKEA 3AVWA 4PC6A 3W9YA 3SHWA 2CE7A 4DCSA 2CNWA 1R0WA 4D4KA 4BE7B 3W34A 5KNCA 2WSSA 1OXSC 2ZR0A 3ZVNA 4WW0A 1F2UA 2PEZA 3UMSA 3ZVRA 3B7GA 3LRPA 2JLZA 1QZXA 4TTQA 1G6OA 1OKKA 3EARA 2GTPA 1NG1A 3ZS9A 5J4VA 3U4QB 2D7CA 2FSGA 3NXSA 4O0MA 4QJ4A 2YKGA 3RRYA 2Q9CA 4JIMA 4OI0A 5EE1A 4WIAA 2XJ9A 3X1XA 3BWDD 4NCHA 1NN0A 4NKRA 1ZCAA 4Q47A 1KI6A 2A30A 3TSWA 5M04A 1GKYA 1F6BA 1G5RA 2ANBA 4NU0A 4LV5B 1XXHE 4NBSA 4BASA 4A15A 5FTNA 4A0RA 4ZV4A 1N6NA 3B2EA 2YOHA 5IT5A 3ZQJA 1M7BA 1NJFA 3PENA 1F5NA 3R20A 1II8B 3BC1A 5AJYA 2J41A 3ZZ0A 4DXAA 3U6BA 2GJKA 4LJ5A 2XITA 3ZH9B 3V4RA 1NG9A 5AJZA 1E1QA 2V1XA 1L4YA 2CL7X 1DVRA 2ZSFA 4Z51A 4IOMA 3REGA 3THWA 2DYKA 1FOEB 4M1SA 1BMFA 3LQQA 5AUOB 4RFSA 2ASEA 2HF9A 3T1VA 1R5BA 2FFHA 2CK3D 4XTCS 3LLMA 4Q4AA 1TAGA 2WJGA 3IIKA 2JLSA 2ZRLA 3GPLA 2XX3A 1W5SA 2FN4A 1W44A 5J4LA 1GRNA 2ZE7A 2J0UB 4P4SA 4HLCA 4M2LA 4RKFA 2QP4A 4OQLA 3K0FB 1GL7A 1UPTA 2VRWA 3MWLA 1KNQA 2AKAB 1TU4A 4FMBB 3W8NA 2BC9A 1E3MA 4JBXA 2I3BA 2R65A 3M6AA 3LA6A 1G3QA 1KGDA 4TQUS 4F4IA 3GJXC 2ZRDA 4PX9A 2CCKA 4A6PA 4HDQB 3TMKA 4A9AA 1FPMA 5FL7A 2ZJYA 1HT2E 4OBEA 1A1VA 2VP0A 4FINA 4LJ8A 1Z0KA 2J0VA 3U60B 1RE0A 4DCVA 3L0IB 4LJ6A 3DEFA 2A3RA 3CX8A 1TUEA 1BIFA 3BRWD 1US8A 2ZJZA 3GEIA 3U44A 3RANA 4LWZA 3K0EA 1KNXA 4TMXA 3I8XA 3BFXA 4D82A 2J0UA 4UQOA 4JT4A 5GVRA 2NO9A 2VP5A 3NDBB 2WMNB 4OL0A 2WAYA 4US0R 2AL7A 2IEYA 3OF5A 2GRJA 2FE4A 4MYTA 2PCJA 2C99A
chains in the Genus database with same CATH superfamily
1NZJA 3E22B 1T3ZA 1PJLA 1U9YA 3NHZA 4DHWA 1DHTA 3IUQA 5LMCA 1I0IA 3D6MA 3LQKA 2PN1A 3K32A 2MINA 1RXUA 1SOUA 2Y6VA 3F3YA 4Q16A 5JRZA 1EVYA 2QN3A 2V7UA 2JIZA 2QXYA 3HZRA 4LBYA 4ZVUA 3CY6A 2DJIA 4AMGA 3RFFA 5HE9A 1E3EA 1R6VA 1U1IA 2WDZA 5IKXA 1T3TA 5IVDA 3BUSA 4MJ3A 4IEFB 3CVWA 4HQNA 5B6PA 4PYJA 1RTKA 5F7ZA 2V0NA 3W5VA 1F6DA 2AX3A 5AOAA 4D0RA 4IIDA 4M1OA 1UBFA 4QYSA 4HRVA 4TM7A 3I2HA 4KEAA 3E4CA 1UWVA 4R3UC 1YQQA 3A1WA 4EPYA 4X7MA 1WB9A 2DFNA 4FXPA 4BGDA 1IBKB 3E9YA 1X3SA 4MLCA 3I3SR 5CYPA 1DCTA 5E6SB 1FDWA 2NV6A 2PCLA 3ADPA 2I4TA 3IMGA 3OC0A 1ZESA 2HQOA 4QHTA 1GPKA 4ACBA 4E5PA 1RNLA 1ZUHA 3IVGA 3DXFA 1TQ8A 1X9GA 4U3JB 3TLCA 4PGHA 3WBFA 3PFKA 3ZXXA 2JGJA 1AX9A 2BKLA 4CEJB 4FNOA 3JD4A 3ETHA 1FP4B 2CJYA 3K35A 4URWR 1G20B 5KWSA 1S4MA 2I7DA 4HWOA 1G41A 3T3OA 4DJTA 2Y1FA 1AKNA 2I7CA 1KK3A 4ZI7F 4KNYA 2XJ4A 4Q18A 4IEEA 1K2VN 3I30X 4D57A 5C4MA 3B2NA 5JNTA 2OO5A 4Q4JA 3AVQA 4NNPA 4O63O 1NKSA 4E09A 1ZSNA 1AD2A 1PZGA 1Q6YA 2CE2X 3DMTA 3G8CA 4QPPA 3V8RA 3L6UA 5IVHA 1NIJA 4M89A 1EQAA 3ZE7A 5B37A 5LOVF 4MRMB 4OHUA 4R2KA 1BCRB 1JHXA 1Z4IA 4ZOQI 4FWTA 3ZHZA 3TB6A 2VRCD 5LQDA 1WIWA 5HKKA 3WYGA 1KOFA 4ARZB 1CKEA 1NAIA 3MTGA 1VG1A 1Z6XA 4OF4A 2HU2A 4DC0A 1HXHA 4B9AA 4JL6A 2WW8A 2NXWA 3TVTA 1UZUA 3NRCA 3MAJA 3MCTA 2A1UB 4WVLA 4AXBA 2YWHA 2A0WA 4L74A 5D3ZA 3SSOA 4AZ3B 5JWRA 2AX4A 5D87A 1D03A 2G9VA 1WV1A 5EQTA 1G8SA 2YXBA 1K3FA 2PFGA 4B3FX 3IE1A 2O2YA 5FAXA 2UZ3A 2RGNC 2D1FA 2EVWX 4GU5A 2R5NA 1HYBA 3ZDCA 1N8TA 3TOSA 5ALVA 1LLQA 1O3YA 1HRDA 2DPHA 2HPZA 3O3NB 3QPUA 2VF5X 3G5LA 4YGYA 1TUBB 1NASA 2WWTA 4RTPA 2DULA 1BVRA 2DU8A 4BVAA 5AM1A 2NT3A 3LYAA 2AF3C 3RFXA 1Q0SA 1TZCA 1B93A 2VDUE 4QTZA 4QKQA 1N77A 1FTQA 2VAVA 1G1AA 2VP4A 4ZI7B 1JG4A 1Q1NA 3L8CA 4HY3A 5BT8A 1P3DA 1W75A 4ZYXA 1XX6A 3PGKA 4XSVA 5BQOA 4F3KA 2ONCA 4W7SA 3QF4B 1YL6A 2J9XB 1LSSA 1EVLA 2IHVA 4X1YA 5E38A 5CCEA 5DI3B 5K0FA 5IBRA 1VRWA 4ZK2A 1TAHA 2P4EA 4U02A 2C82A 2R7KA 3PHLA 3VNVA 1OIWA 2YJZA 4C2UA 5EWJB 3K8QA 3MUFA 3KSBC 3FNBA 2HIGA 1JKIA 4YLEA 2X9VA 3KXPA 4OQMA 4AP5A 4YEDA 3SYLA 3W5JA 4I1IA 1JFSA 1W9HA 3HEBA 5DN9A 1CDOA 1L9KA 2VRCA 3HU2A 1AC5A 2ONKA 3AFHA 5DHSA 2YQ5A 1ZINA 4IDQA 5IDWA 1A9ZA 1QO0D 2JFFA 3DUFA 1AUQA 4Q3LA 3HN2A 4ZYTA 5B3JC 2LR0A 4CTJA 1JNYA 4CM4B 2F59A 3P4YA 1UP4A 3DVSX 2WD7B 1CVLA 3F3MA 4YCSA 4BNDA 1LQTA 2QG6A 2RJOA 3EIHA 1SMKA 3OIYA 2BR5A 5DGDA 3TDKA 2ZJ5A 5A04A 2ORIA 1N5JA 2PSDA 2Y8EA 1MIOA 5LB4A 5HKAA 2W6IA 5LD2C 1XWWA 2Z3WA 2FF7A 3PRKE 3IOYA 3CZRA 4A03A 5LNK6 5LR6A 5HNKA 2GM3A 2OGTA 4NARA 2Q5LA 1VCNA 1U3UA 2P9QA 4H7PA 4IQ4A 1ZOIA 2LIPA 1IG3A 6YASA 5EJFA 1DNPA 2E21A 4EEKA 3MK31 3NAMA 1N7IA 4D4MA 2COKA 1VDMA 3OZGA 1Z8FA 1X7ZA 3VR6H 4AY4A 4BFYA 4NL4H 4BLRA 4X91A 1FL9A 5AM2A 5LU9A 2I78A 3KSZO 3P1JA 3KEOA 5K0EA 5GINE 3OCWA 5ALRA 4FX2A 2H57A 5FUYA 1H9AA 3WL7A 4RW0A 1JTEA 1DQSA 3KEFA 3PX3A 1UDXA 2YWJA 2NWQA 2H7XA 4WWHA 1FLDA 2OFXA 4JB0A 3D7KA 4JB3A 5DHTA 3U1TA 2IYEA 5EXSA 2QRNA 5G3ZA 2X8LA 4UUAA 2ZS9A 5IW8A 3CMMA 3TZ6A 4S1VA 1XR3A 4BJ6A 1CE8B 4PRKA 3JS5A 2O8DB 1AUVA 3TMYA 4TSFA 3AL3A 3NAZA 3R0ZA 4MIKA 3I5UA 4C0AC 2B3TA 2NZXA 1W19A 4MS1B 4M49A 3A6EA 4KYTA 2R2GA 2YQZA 4BL5A 3I9NA 3JATA 2HMTA 1DTEA 1T4GA 3HYLA 4KIWA 3IUNA 4MQFB 3KBBA 4GSYA 4QICA 4MS3B 3ZE8A 4B6QA 4W6QA 1DBSA 1JLKA 2E7ZA 3U3OA 1SBQA 4Y2HA 3N3AC 1OJLA 4HUQB 3TQQA 5ABPA 4AN4A 5CLJA 4H15A 7GPBA 4EUSA 3A6HA 1XD2A 4I36A 4JJ6A 1CFZA 2AHOA 4KE6A 2JJYA 2OWEA 1E1QD 5B64A 1FYWA 2CXPA 4J7UA 3C87A 4PO9A 1ZSVA 4YTEA 3TDNA 1I6LA 3AINA 3D6UA 4RPIA 1A3CA 1OA1A 3SQWA 4YA6A 4U3JA 2XF8A 4QDOA 2BAGA 1RJFA 3Q9UA 4TSRA 2I66A 1EX1A 3SJAA 4BP3A 2PUBA 2VJPA 5ICMA 2ENWA 3IHLA 2P3OA 5ED0A 1TQHA 2RK3A 2B4QA 2LIVA 3H65A 1VPTA 1WHSA 3DMPA 4FDLA 5CVDA 1QHHA 1SG0A 2ZUSA 3QPDA 4GNRA 4H27A 5HFJA 2P7HA 3BT7A 3PYXA 4GBJA 5C35A 5DCLA 4L0CA 1G8HA 5LQNA 1S2IA 2F8SA 1O94D 1WM1A 3O8QA 4MP6A 3S1AA 1DT5A 5JR3A 4DLZA 2R8ZA 1E7QA 2FP4A 2GD1O 5LD2B 1K9VF 5BV7A 3PD7A 5JUWA 3K05A 1AGXA 3BMOB 2GD2A 1KMHB 2H16A 5DSTA 5ER6A 3TW0A 4N12A 5B1YA 1CUVA 5EUQB 3IESA 1GTMA 2PKXA 3B1XA 1LPPA 4CN8A 1E6MA 3U6KA 4OU5A 3EEFA 1OU0A 5HJ2A 1KRXA 2R6AA 2JJ8A 4JP3A 3KDAA 4GYYA 2H2IA 4LZZA 4Y2PA 3RVDA 2IEBA 3FLMA 5EMHA 4G8DA 4ZP1A 3VR1A 3ZDAA 1WSAA 2WD8A 1ISSA 3FPAA 2KJQA 1YZKA 3KWMA 1VHQA 3KQYA 1RXWA 1TQDA 4WLVA 4XVCA 2IJGX 3S2ZA 2OCLA 3ZCRA 4B83A 2CKDA 4K6FA 4C89A 5AVKA 2IU4A 3BRWA 5DE3A 1XNJA 3PLRA 1WXQA 3LVQE 1YF3A 1H0SA 2ZSUA 1HKHA 1SJ9A 4PEVA 4L4YA 4QQFA 3DL4A 2NTNA 4QGHA 1ZLYA 4JKIA 1R64A 4MV1A 1FFYA 1UZLA 2DR3A 2NLOA 3JX9A 3NX4A 4NHEA 2PAFA 3ZWCA 4AMYA 1MZPA 2HTEA 1UXOA 1EKGA 2B5WA 4FGLA 4YAFA 4DCOA 3MOIA 2FGJA 2JFUA 5B3KA 2O19A 4HLUC 1KFCB 1J49A 4H7IA 1ZQ1A 2FEWB 2VSOA 3I8SA 3KVYA 2VHJA 2FPPA 4BMDA 1XEFA 3EF1A 3L84A 3V7WA 1ULSA 3E84A 4J0CA 1U9CA 1Q0LA 2I55A 3C16C 3JASA 3LYUA 4UVDA 1YE5A 1T2EA 2X42A 3IULA 2M1XA 3QWBA 4L2IA 4MQMA 4KXMA 2VAMA 2YCBA 3HSSA 1VB5A 3IJPA 4V3CA 5AI9A 3VU9B 4HLUA 4DR2B 3GJQA 2Z98A 3KT8A 3W6PA 4EJ6A 3BHNA 4DQXA 7REQB 1E6LA 1NM5C 5A3SA 3VNRA 1GR1A 1RPJA 4BQEA 4WLOA 5BNIA 1E9DA 5C5IA 4J0IA 5AK3A 3N86A 4ZCPA 4G5XA 1K5HA 1NT2A 3KCNA 4DA0A 5A3QA 1AT1A 1YZFA 2RE8A 4NYJR 1FDVA 2R9VA 4YX9A 5BN1A 4REMA 2FEKA 1XTRA 1X1TA 3D02A 1E2HA 3Q7TA 3TTUA 1TX4B 1EVZA 2CHVA 3SXJA 1WOMA 3NR2A 3OCZA 1VGVA 3CT4A 2CY0A 4JBLA 1SQGA 2J7PD 3C5WP 4DW8A 2QI9C 3VVMA 2YFHA 1XD9A 2JIOA 2Z56A 4CLHA 4EKIA 1N2EA 4MV9A 2Z95A 4EDFA 2X9NA 3C7TA 5NLLA 2JI9A 1YVRA 4DV4B 2F9LA 3EZ2A 3IS3A 4ZV9A 1NBOA 1OXXK 3FPFA 4BKPA 2EZ8A 1N2SA 3WFIA 4IXTA 4QPZA 4YIHA 1VSBA 2ETVA 1JQAA 4LBVA 1SWVA 2GHQA 3KLBA 4X84A 3RABA 1GPLA 2FPUA 2IYSA 4N5LA 4KO2S 4FEYA 4PQGA 3F6YA 1NNI1 1VZ2A 2Y4OA 3TUJC 4FZVA 1YKGA 1Y9DA 4CLRA 3QPVA 3H0CA 5AVSA 4DN6A 2WUVA 3ZI4A 1NOJA 2W8ZA 3E3NA 2BR3A 3L0CA 4JBYA 4PHCA 3HWWA 3I04M 5CTAA 5ALKA 3C70A 4Q3CA 2ZUWA 4UD6A 4G0ZA 5CHYA 3K70C 3LZDA 2XW6A 3F9CA 1VCIA 3Q10A 1CJCA 1EXMA 3A37A 3KQPA 1Q0RA 3PUHA 3F0TA 3SVTA 2H59A 5GONA 1J1UA 2MMCA 3JWJA 3OZTA 1CXZA 1HWYA 4D8TA 4N03A 1P7ZA 1V6CA 2AQIA 4UOEA 3I2FA 2P67A 1WB5A 3D6FA 2ATIA 3UWDA 3V4OA 4GDFA 4EJSC 3IVMA 1NIPA 4US2R 3JAWA 3GAAA 4ADSG 4CL0A 4BVFA 4DR4B 2PUCA 2Q2QA 3ORRA 2A5FA 2P0YA 2P8SA 2GA9A 2LWIA 3QUCA 4FYVA 4KSBA 4H77A 1H2FA 3UANA 4C88A 1ECFA 2IYPA 2XCOA 3A4LA 3CPSA 3LOPA 4BB5A 4QSMA 3FYUB 3U1BA 1EBFA 4HPJB 1IBRA 1IZ9A 1NKTA 1ULBA 3R0QA 3EJ6A 5AXBA 3C43A 1IUNA 4M76B 4PO1A 1HE1C 2C2YA 5KOHB 3NASA 2W6PA 2H18A 3E3AA 4G5FA 4W63A 3DHYA 3ZNNA 5JCZA 3GPBA 3LFUA 1ZJZA 4AY3A 5AVTA 5H5JA 2X0JA 4L27A 3IA7A 4MO2A 5DNYB 1DCKA 2HA4A 1VHDA 2QMYA 3PGXA 4DF3A 1XWFA 4HKTA 2LCQA 1Z17A 2XXJA 2G8LA 4HXGA 4LIPD 1S2NA 1PR0A 1E94E 5LDGA 4RTSA 2Z6UA 2ZE6A 1G19A 3EZYA 3G8AA 4R31A 4Q9IA 1YR9A 4R9NA 4H7HA 1JHRA 3TM4A 3W9SA 5KYNA 3AHEA 1Z33A 1ZH4A 2BOVA 3WYBA 1EX9A 1U2DC 3EVTA 4BV9A 3PS9A 5AVYA 1O7JA 1WABA 3FZEA 1YBFA 4DMGA 4KNVA 3MYRA 4RTJA 4BGUA 4C4RA 1BXGA 1DG3A 1ZUWA 3DD1A 4JU8A 2AYXA 3EVGA 4CL3A 2FPKA 1BDBA 3WYAA 5EMNA 4LZPA 1K7XB 1AGNA 2VPXA 4YFYA 3HB4X 4K9KA 3RSOA 3U7QA 2HUPA 2GQ0A 4MDFA 1MJGA 2C20A 2W6OA 3LMKA 1AXGA 1UMCA 4P4NA 4QVIA 1Z68A 4O2BA 3UPTA 1ISPA 1JUDA 1YMUA 2VEOA 3IQWA 1M9NA 2OSBA 3OPQA 1ZWLA 1VCMA 3H75A 3P2OA 4KB5A 2PV0A 3GC6A 3V1NA 1FTSA 2QGNA 2OQIA 2XMZA 3H1FA 3K53A 4KPUB 1VBKA 4Q15A 1KZHA 3VTZA 3W3AA 4QM6A 4QELA 2Q5FA 2B0JA 3FDIA 5JCOA 3A4IA 1P6XA 2HV8A 1UADA 4CW7A 3KEQA 1TW2A 3OCCA 1ZC4A 4Z9YA 5BRJA 4QUHA 4AWXA 5KNDD 3OHSX 5LXTB 3IOBA 2WSBA 3G9ZA 3S27A 2QTAA 4RHTA 1UZMA 2R6ZA 4TKLA 4IHJA 1P7VA 2J9ZB 3IGFA 3ZNQA 1GRVA 4MDEA 2O2XA 2Z58A 3R6WA 1CVIA 2C2ZA 2P4HX 5LNK1 3A6PC 4XI9A 4O3FA 1Z7BA 4D4LA 5LKRA 5D5HA 5JFGA 2G5PA 2I5PO 2QZPA 3KQOA 1DO8A 4QA9A 4RMHA 1RRVA 4ZOEA 5TT0A 3TOCA 3MMPA 4P53A 2OK8A 1M0WA 3TFWA 4B73A 3S1SA 1NZDA 3QBEA 5IMBA 2IXEA 2KI5A 4R2LA 4TXHA 3DCIA 4RXMA 4RA9A 2OE2A 1CRLA 4WV3A 4Z4HA 3EQ6A 3D0KA 1ISFA 1TCBA 2O2DA 1T4CA 3FR8A 3HCCA 1I36A 4IDCA 2QP3A 3ENKA 3ND8A 3TEFA 1LDYA 1K8YB 3GVHA 3OD1A 5EZ6B 3UWPA 2NZ8A 4DC1A 4EYGA 3V34A 3TINA 5LU8A 1QH8B 1JT9A 2VXBA 1G7TA 1YULA 4PS1A 1I3NA 2XDWA 2XMQA 3AEUA 3QLVC 5DNAA 4ZJYA 3DOEA 1DGQA 4ID3A 1GNQA 4QUAA 4GPTA 3VR4A 2H9YA 2G1UA 4X7PA 2VYQA 2V4ZA 6NULA 4A3SA 1M7GA 5KWVA 5JJKA 3A4TA 4IG9A 1G8PA 2PXHA 1U8UA 4FFRA 4EK9A 4K87A 2W2XA 2I71A 3EWAA 4DWVA 4Y9UA 3HE3A 1CS0B 3GT3A 1J2TA 3N2YA 4YJGB 4P3NA 1FRZA 3BGIA 4KXUA 1XPJA 2IEZA 2CXHA 2BM8A 4PG7A 1UPBA 1KYIA 3ISJA 3M6VA 4N49A 2G1JA 5LZ7A 3A6GA 3GLHA 2FAXA 5A9RA 1VI6A 5EQFA 4OXIA 1RWPA 4WJKB 4WFKA 4L8GA 4X54A 3UK1A 2QUJA 3ZBTA 1DADA 4L08A 4PPGA 4D44A 5KHLB 1LRKA 1SUEA 3ETLA 4FW9A 2EW1A 3Q8KA 2GSDA 4JJ4A 5KVVA 2D4HA 2RHGB 4WK6A 3ZDYB 4L0MA 4OKSA 3QK7A 3UF0A 1L1QA 1Y63A 1Q50A 3TNFA 3HQ4O 3O1LA 2BBWA 1GKUB 2H1CA 3E9DA 1TYZA 3NNNA 3QXSA 721PA 1EE1A 1O94A 3IMEA 3PRHA 1AUOA 2ZB3A 3RRXA 4UTPA 1SOAA 2JGLA 1UINA 1M54A 2DJ5A 2JGFA 4CV1A 1WF3A 4JNCA 4XWGA 2EX4A 1OW3B 1PSDA 3SICE 3VHXA 4W9NA 3LOQA 3FZQA 3L7AA 3TTTA 2SNIE 1WDTA 2YV1A 1K68A 4Q3BA 3K1JA 4I7EA 3ST7A 3N0VA 4F06A 4UVIA 1GT6A 3U4HA 1XTVA 4X20B 1U8XX 2H0AA 3EQ2A 1ZS9A 1HORA 3GEBA 1TM4E 4H1VA 3ZQ6A 4DVJA 4AQ7A 1XHLA 5DCUA 3WXMA 4DSNA 1XLVA 4E2ZA 2JFNA 1ZISA 1E3WA 1GGHA 5IZ4A 2PBRA 1CPYA 5A2QA 3FLEA 3GP3A 4A0QA 1ISMA 5L51A 5F2NA 2D3TA 1PGQA 5T3UA 5KTMA 1ZOLA 3QKIA 3AJDA 4KUEA 4ENSA 2NUPB 2KHZA 2YH2A 3NLLA 3ZWAA 5HM6A 4OCZA 2O05A 3FBTA 3SHTA 5K8JB 2IPAB 1QE0A 2H3HA 4C0SA 1DQRA 1TJPB 3F7MA 1TUGA 1Z29A 3NETA 5C80A 1GR0A 4NWIA 4JKYA 5TDHA 3KV1A 3H7AA 1BEUB 4AWBA 1O5IA 5AM3A 3SYTA 5CDYA 5AR1A 1IEWA 2IRWA 3QU4A 5IABA 5H82A 1LI4A 2GN1A 4ZCLA 3EDOA 4F04A 1NDUA 4RTQA 2GEFA 5D3MA 1NLZA 1MJNA 2FP4B 1WW8A 3BCSA 2OHXA 3RF6A 1V71A 3AFOA 2F9FA 3JRNA 1NF2A 3TLMA 1Q20A 5CPBA 3BA1A 1SHLA 2HB6A 3R5KA 2C5BA 3BICA 4NEQA 1WJGA 4HZIA 3MTJA 2JHGA 4PZ9A 3B48A 4MNTA 5A7FA 4JYPA 3EPHA 1OLOA 1G6Q1 4TYYA 4POAA 4UXHA 5IC4A 4ZHSA 4TVOA 4I55A 1RAIA 1U3VA 2V7XA 1GGNA 2ZRPA 4MYHA 2NU8B 3AXTA 4B74A 4OK3A 5DN6A 5A02A 3ANNA 2XZLA 1XSEA 1AQYA 2ZRIA 3HI4A 1JIUA 4YCLA 1R2QA 1AGYA 5DIZA 4AW9A 4XVUA 1OGYA 4A1OA 8MHTA 3E81A 2C5AA 5B30A 3RS9A 4O2AB 4L6IA 4LZJA 4MR7A 2O52A 4FOSA 4ENQA 3RB8A 3KTOA 2Z1NA 1EP3B 4M21A 4DM4A 4G56A 5H16A 4ZDJA 4QFCA 4MWOA 1JQBA 5DWDA 3ETDA 5J9FA 4ETIA 3G9QA 3HTXA 1WQ3A 1E1CB 4N5HX 1YTUA 3TS1A 1EYZA 3MJSA 4GVXA 1U6KA 4EO9A 1QTRA 4E07A 3MCAA 1W5BA 4M87A 3LBNA 1UL1X 2JA1A 3VOBA 1B42A 4YBZA 4EPXA 4LOLA 3VU8A 6CHYA 1GZSA 3GLIE 4DUZB 2PWPA 1V5IA 1MR3F 4WAUA 2Y93A 1TD1A 1MEJA 1TAQA 1MF7A 2DUMA 2HRZA 2XNSA 2B1QA 1ICEA 2B8TA 3T99A 2QN2A 1TM2A 1KK1A 3LDGA 3LF2A 4RIHA 4UUQA 3ZCTA 3L07A 1SVSA 2NQTA 1UZAA 2IE8A 1B76A 3ZDZB 2DVMA 3DBLA 3WIOA 4ROSA 3U7FB 1L6IA 4XH9B 1WNFA 4DY4A 3SQXA 1UK7A 1OAOA 1PHRA 5K8VA 2X4DA 3PXBA 4GKBA 5CJPA 1GCAA 2VK2A 4MRAA 3FETA 4K26A 4EFMA 4WXRA 1ESDA 2X8JB 3T9AA 4BX0A 1KWKA 3TUZC 4OGWA 1OV4A 4DV1B 3AG5A 1XG5A 3IUSA 2UYGA 4DA7A 1XA0A 3B82A 2A7QA 3BZWA 3HGQA 3FUVA 2ZI7A 3D2LA 3Q7SA 3WDMA 2O50A 3DWGA 4ENWA 4Z1MA 1A8PA 3UMCA 4Q4CA 3R7FA 1BW9B 1MPXA 3Q3CA 4K1XA 3ROEA 4XM0A 1SHTX 1V5WA 4L3WA 4DILA 1RR6A 4J90A 3V4PB 2C9CA 3LUCA 3MYYA 2FWIA 3WO0A 1CQXA 2H0RA 3A25A 3H2SA 4I5DA 1T9GR 3T8YA 3FOWA 5AVOA 3WHIA 2DWOA 1P5JA 2BI7A 3KXLA 4X9XA 2W71A 5F51A 1XZJA 3I76A 4OQEA 1E3DA 1MZVA 1NLUA 3H3FA 2C1ZA 4JQSA 4W5WA 3IVAA 4FN4A 1UMCB 4Y18A 3T5BA 3HCBA 4AWAA 1GXSA 2WJ6A 4G26A 3BD9A 5IJZA 3TR0A 3JWGA 1LQ2A 1Z07A 2HLDD 2G40A 4L72A 1KI8A 5FO1A 3QOFA 4ZVPA 4XPIB 1ESMA 3ZWWA 4Q39A 3WLMA 8LDHA 4R84A 4LF7B 1XK6A 2XZTA 2Y67A 4DS3A 1XJ0A 4U2FA 3SS9X 3PICA 2I6FA 3AI2A 4CL8A 4DJAA 5JMWA 1UJCA 4RM3A 5K3FA 4H7FA 3M6FA 4MLDA 2WSYB 2ZU6A 3R23A 1OWOA 1VKZA 5F77A 4IIFA 4BPBA 1RZVA 3ZUGA 4XUCA 3LQ2A 1AQLA 1ZXLA 4L5YA 1TFRA 4BXOB 1BVHA 1QGOA 4YROA 2PS9A 1P5ZB 4KUHA 5IU6A 1MOPA 3OWXA 1H8HA 2C9YA 1KO8A 3BORA 3D6AA 3WNBA 2VO1A 4URFA 2QE7D 4YJ3B 1NHGA 4BLWA 3GFRA 4O33A 3LT2A 1Q1BA 1GGVA 2YHAA 2YFYA 1WUJS 2WSIA 4Q3OA 3CSUA 1I9CA 3K9FC 5AW2A 3H5IA 2IT1A 5CDTA 4E51A 2E48A 4DM7A 1V8OA 1NPYA 3FHCB 4NU6A 2IUSA 2FPOA 1SC6A 3ESDA 4QBGB 4JCCA 5D5QA 3WGOA 3AY6A 1A5ZA 1TA9A 3BWBA 3BXZA 2I2BA 4MTCA 1P80A 4WNIA 1BA2A 4FHEA 5LM3A 2OCAA 4JUFA 1IH8A 2X5KO 3Q2OA 2O1EA 2FSVC 4MPTA 2I2FA 4BO7A 2CN1A 2C8KA 3O2JA 4QASA 2RHMA 4MQFA 1DCMA 1ZMOA 4BHTA 4C20A 4XGKA 1SBYA 4E6PA 3T0IA 1QHNA 5LXTF 5EKSA 1PK8A 2OXEA 1WXHA 3KDSE 3BE5A 4IF4A 3PKIA 1OFIA 2ANCA 5F1OA 5C46F 4AJPA 1LBSA 2NZWA 4UTNA 1L5OA 1UBNA 5D00A 1WL8A 4QPJC 1ZI6A 3SR0A 3L7BA 1KE1A 3TSOA 4D98A 2HLDA 1VLHA 2GMWA 1E2IA 1OTYA 1O97C 4CXMA 4GQAA 4ZODA 3RUHA 4N8SA 3K15A 5BMOA 2FLWA 1JIXA 5HUQA 3T3JA 3L7CA 3H17A 4P58A 2DBYA 2O2ZA 2OHIA 2YY5A 4IOKA 2ISCA 5GM1A 4UU7A 1S8OA 1CEQA 3OT1B 1QHIA 3LAWA 2JCGA 3VSCA 1DOHA 2FMKA 5JJLA 3ZLTA 1BGVA 3UV3A 1KYVA 1N2ZA 1M6YA 3CURA 4DIEA 5C7YA 2FSFA 3RYCB 2QBYB 1MA3A 1KXJA 2HXYA 3K1TA 4MPPA 5KNDH 1T5IA 2B1IA 3PWZA 4FCCA 1UOPA 3EVBA 2E3JA 3ZLVA 5JXJA 2ZUUA 3OTIA 4IFBA 1W4RA 2ZG6A 3G8BA 3KJQA 2ET6A 3C74A 1WP4A 1Z7GA 4AZSA 3U0BA 3KXIA 3HEMA 1SVWA 2XGJA 3KHKA 4TKVB 4B32A 5AVUA 1FRQA 4GGMX 3PDHA 1EUCB 1KZYC 3AHCA 4GFDA 3IVXA 3T9DA 4KR0A 2WSLA 3IAAA 3F73A 3CH7A 1ND5A 1JDSA 5AK4A 2BM9A 3USZA 5ESXA 3BK1A 4TS1A 3GJ7A 1N2BA 1YHYA 4P38A 2VZ9A 5KKAA 3LBYA 3HCNA 5JMTA 1A4RA 3DWFA 4JX8A 4ZC1A 2A7XA 5C5CA 1MJHA 3SKYA 1YHNA 2HK7A 5TMPA 3WGVA 1GQRA 4NG4A 4LKOA 2WU8A 3FSGA 1UKAA 5JD3A 1YBMA 3GCWA 4QVKA 3GRYA 4F4UA 4NPHA 2PL1A 4BCBA 2HLNA 4DHEA 3G2OA 3QPCA 3PBKA 2EERA 2JAXA 2ZSKA 5BWBA 1QF6A 3AUXA 2Y0PA 2AEEA 2X0RA 3A9UA 3TIXB 3AWIA 1FFCA 5SY6A 4E4YA 1LSJA 3GNSA 3DT9A 2A5GA 2QX4A 3I34X 1XYGA 2EJCA 2P9GA 1K7YA 4LOJA 1G8JA 1BD3A 1P1CA 1Q2XA 2ERCA 1S02A 5LPNA 2PDAA 4IKPA 4JODA 3EC2A 2HN9A 5FBVB 1RPZA 1DIHA 4MQUA 3R3JA 3RVOA 1PGNA 1G5HA 1VKHA 4MEAA 1UXJA 3N2KA 1JPUA 2XOKD 3DE5X 3GDGA 3V2IA 4UNRA 2QAIA 3QE0A 4I5IA 1Y1RA 4JVNA 5IUKC 1XALA 2YZ2A 2I4RA 3U9LA 3BXFA 3I9V6 4HQRA 2QVYX 5KSOA 2AWNA 1QK3A 3K6KA 3OCYA 3G3EA 4EL5A 3VKHA 1TT5B 4PFJA 4Q48A 1H2WA 5G1NA 4EFLA 1NC3A 2OR3A 1CEXA 1I3OA 1NDQA 1RM0A 3SIPA 3EA5A 1WXIA 4UNQA 4F4JA 1KAHA 5BQ3A 3QYAA 4YRBA 3R3WA 1UP6A 4H3KB 5CGQB 4Q3AA 3A04A 3KQTA 1TYAE 4IGEA 4LXYA 1N8SA 3I3OA 1XZHA 3OE1A 3TVYA 2D6FA 3H8JA 2NUTA 1MAWA 1C8LA 3E7WA 4EB3A 1PF7E 4HAXA 3T06B 5JJIA 2HY7A 5I5GA 1VZ3A 2QWXA 4V0NA 3FCXA 2CHEA 2FX5A 4R8MA 4MRRA 3E9RA 2HOQA 1HYQA 1QP8A 4RTLA 3NYIA 1HDIA 2NOAA 1ORRA 3QU7A 3MTEA 1NUPA 2PUEA 3ADDA 3UBMA 4F6RB 1XYYA 3PQDA 3IKLA 3D1JA 5P8WA 1M10A 4IMPA 1TPYA 3VJLA 1EFPB 1KQ3A 5GADl 4QXAA 2VK1A 5CEEA 1FB5A 3H9JA 2I4IA 3DE3X 2WTUA 3MT8A 3ILXA 5DJ5A 2XUOA 2NSYA 3I52A 2PYDA 4KO4S 1R7RA 1HE3A 2FZWA 1J2JA 1K5GA 2ORWA 2PT7A 4EFNA 2JCYA 2P2GA 4EB6A 1XTBA 4Q21A 2B92A 4B76A 4OHYA 4DDKA 2YQ4A 2NTVA 3KD2A 2JH8A 2MHCA 1QFXA 2FFRA 2IZ6A 3CPJB 5JS1A 3LVRE 5A71A 1P0CA 2YMLA 5DBHX 1TFUA 3PVZA 5TC4A 1EBBA 3HVIA 2X1VA 5JCJA 2CNKA 3KVRA 4ESVA 1Z7EA 4C0QC 1NP6A 3KD3A 1QZ3A 3GA5A 1OXBB 1UK9A 3OSUA 1BU5A 4NAUA 1JWBB 1X1QA 1EJ6A 1USIA 3E4DA 1OB5A 1RTTA 3O2SB 1VTKA 1D1TA 4BU0A 4BEWA 3AVUA 3E9QA 3DTVB 3STXA 3G68A 3SYMA 2ROQA 3LUPA 5D86A 1GTL1 4L50A 4UTVA 3JWEA 3GW8A 1ZUIA 2JFZA 5B2FA 3TAUA 2NU9A 2DB3A 1SVLA 2MR6A 5IBQA 3ZI0A 4AC9A 1QVZA 1SUBA 1WR8A 4FYWA 4XD7A 5KVCA 2WYOA 2WF8A 4OQFA 4LZWA 4C30A 4D3SA 3DFKA 5ALHA 4A36A 3W2FA 4UEKA 2HBQA 4YBRA 1G6HA 3OM9A 4F4HA 1I01A 2RGGA 3HCEA 2H2WA 4MUIA 2R0QC 1GZ6A 5BN3B 4DOMA 2ZJOA 5KINB 5ALPA 1ONSA 3DLTA 2WNSA 5LLTA 1IM8A 5IAJA 2I6UA 5DSXA 1SNYA 3SFTA 2GCGA 2FWBA 3QU2A 1RAGA 2BIFA 1MB2A 3PXUA 4YRDA 4Z0TA 5BUSA 5IS2A 3W6ZA 2HW8A 3IAS6 5E6UB 2PMEA 1YQTA 1MDBA 5CT5A 2OLEA 1YZLA 3DCYA 3TTWA 3V8PA 3PIDA 3TTYA 4KODA 4J4BA 3FNHA 3K0AB 5BP7A 4O2BF 2XSZD 3AB7A 4RHYA 1XDSA 4U6NA 1FSZA 2C04A 4DQVA 3UHJA 4E5KA 3TFQA 1G98A 2DY1A 4LUCA 3BFJA 3BGDA 3DBVO 2K7FA 3NHRA 1VOTA 1P62B 3PUVA 4DDWA 4LF6B 2EX1A 2J07A 4UBJA 5IKMA 4JFAA 2BP7A 3A6LA 4LSMA 4P7GA 4D3FA 1OJ7A 1Q12A 3C8MA 4WZAB 4DBLE 1BTOA 3KXKA 2W22A 1NRWA 2HNBA 2VQDA 1C50A 2YXLA 2CK3A 2ZJ4A 3EIXA 3FUXA 3LZCA 4OLJA 3UMGA 3MT7A 3VKVA 5B7GA 2OZLB 4UNPA 5DYTA 3GG2A 3NBQA 5FB3A 1ECJA 2BMFA 3ANMA 2I8LA 3AX6A 4OIFA 5FRDA 4BNMA 4CKEA 4ETNA 2ES4A 3QVOA 4JI0B 4DR6B 2ADMA 4GM4A 3ED1A 4RY2A 3WQQA 4BIIA 4L4UA 4OBWA 3G5MA 4PG5A 4I99A 5BW8A 3OETA 3RARA 2DKFA 1A72A 1H2BA 3VM6A 3MCVA 1O8BA 1Z6ZA 3CB2A 3N0TA 2RH5A 3DJYA 1K4KA 1Z63A 5ECGC 2O3RA 2V6GA 3GGGA 2LVBA 6AT1A 2XCRB 4JXXA 3O0TA 2IYFA 4XTRA 3R5FA 5FTMA 3TW4A 2Z9DA 5I3CA 3KTAB 4PRZA 4IJKA 4IDDA 5KIAA 1WB6A 1VE6A 2P9FA 5GOTA 1BU8A 4X85A 2G28A 3UT0A 4EENA 1Y5IA 2W0MA 1PWZA 3F7TA 3UJ6A 2EFJA 2IX3A 4LVOA 1U1EA 3B3JA 4P4SB 1IM2A 1M2GA 3ABSB 5JW6A 4RGQA 4MV3A 5JPCA 4WA8A 2YZGA 1E3IA 2GN0A 3NHJA 5JZBA 1W49A 1CIJA 3BGOS 3COZA 3W90A 3GWGA 1AK2A 1QB8A 3FOBA 3UT5B 4ONEA 2WUGA 4NEGA 4QIHA 5L7WA 3ICWA 1TC1A 3CLRD 1C1XB 3QNMA 3RS3A 3INYA 4AXXA 4HJXA 2MT9A 3D5QA 2YVUA 2CNLA 2YWRA 4NLLA 5FHQA 3RI3A 3ZW7A 1F60A 3Q72A 1QKIA 3M89A 4PSDA 1QH1A 2OGUA 1TLFA 4WXHA 5BVHA 2QK4A 4RJ2A 1UXHA 3GUVA 4IWNA 1KI9A 1NVEA 3ITNA 2O1SA 4O4JB 4KI7A 3ADOA 5EJ7A 4CYMA 3DOHA 2ZKIA 3Q15C 2YWXA 3SFVA 4HDRB 3W1VA 1G7RA 2AOWA 5A1TA 1SIUA 2Z9BA 1UP7A 4NBNA 1QQBA 4TTTS 4FFLA 2CYAA 4HDMA 4U9UA 4B79A 4BB9A 1NONA 3V1TC 4IILA 3DL0A 1K92A 5EJMA 5DF1A 3MQFA 2BELA 5BV2P 2PJRA 1H5NA 4UJ5A 1GTG1 2A58A 1OX5A 4OXKA 3E0QA 5HG0A 3EQZA 2ADOA 3QFHA 5E9AA 1C3LA 3TOZA 1TTQB 2EGGA 3TDMA 2YVQA 1ZSYA 4OJTA 3OM0A 2FMHA 1KSFX 1L5FA 4AJIA 2BI8A 1L8AA 4IJWA 1U9IC 1KEVA 3H9UA 4WZZA 3MQ4A 3AKZA 2WHRA 1ZGCA 4YQEA 1NGSA 1XKTA 3OIFA 2OLKA 4FDAA 4YCAA 2FWJA 1MDFA 2EP8A 2RGXA 3L9XA 2WAOA 3IKTA 1Z4KA 1UDRA 1N2CB 5AW4A 3G0OA 2PLWA 3HR4A 2YMQA 3KB2A 4LX0A 1JPVA 2O7NA 2WG0A 2J59A 4IGIA 4M8LA 3KYIB 1V9SA 3CR7A 3A9TA 4BO8A 1EHCA 4OHBA 4LI3X 2CUZA 4XYMA 4PF1A 4WKOA 1DTSA 4EQ6A 4XVRA 5M34A 4K6GA 4PBRA 5FYQA 2AXQA 4BNIA 1M7HA 5F35A 4IY1A 5REQA 3DVAB 2WQ7A 2ZT8A 1VMKA 2LCFA 1U0EA 2BJWA 3MBIA 1ONBA 1JJVA 2QMQA 2VJDA 3I37X 1WEKA 3M6MD 5AIBA 1CTQA 1OROA 2HSZA 5KSYA 5AVQA 2JGAA 5AKJA 1J8DA 3G9UA 1W35A 4II7A 2LKDA 4ZXFA 2DQYA 3WWYA 2EJBA 5DP2A 1OREA