1D2NA

D2 domain of n-ethylmaleimide-sensitive fusion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
246
Chain Sequence
EDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN
publication title Crystal structure of the hexamerization domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Hexamerization domain
total genus 82
structure length 246
sequence length 246
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1d2nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d2nA01
2YWGA 5A0FA 1NLFA 2BOVA 3IBYA 2V6IA 1P60A 4DDWA 1C4OA 1ZNXA 4HZUA 2X1VA 3PUWA 4MGYR 3TIFA 2W2VA 3PUZA 2GXAA 1W0JA 1HQCA 1X1RA 2IXGA 4TMXA 3X1YA 3IQXA 5UKDA 4M21A 1C1YA 4JVNA 3DEFA 3QE0A 1MR3F 4RFSA 1U0LA 1Z3IX 2O5VA 4HAXA 1S1CA 3L43A 4PHTA 4CT5A 1K8RA 1QHGA 2ERXA 1S3GA 3W6OA 1A2KC 2D06A 3RS0A 1X8KA 5K8TA 1DARA 1N6IA 1OYWA 5TV2A 1YHNA 2J7PA 2KI5A 4JBWA 4L9SA 5FFMA 5FBRB 2XEXA 4KFRA 4OYHA 3AF3A 1NVXQ 1JBKA 3I3SR 2BKUA 2QT1A 2FN4A 2IS2A 2VSXA 4JKYA 5KSZA 3HYTA 2JLSA 2R9VA 2QROA 4C30A 4NYJR 4AKIA 2IT1A 5AJWA 6Q21A 2QRNA 5D3QA 5JI3E 5FI0B 3MWLA 2XOKA 2GZDA 1GIAA 3A58B 1UF9A 3OIUA 4DDVA 3M0EA 3CR7A 4BZPA 3I8XA 5KUTA 4UNNA 4F38A 1KSJA 3FOZA 1ETUA 3B5JA 4B34A 5HR5A 2C77A 4WBSA 4RD2A 1XD8A 2QM7A 3PITA 2HF9A 2WWHA 3EWSA 4KJZA 3H1TA 1CBUA 4M2LA 4NCNA 3AVYA 1M74A 4WZAE 2AD5A 4P4UA 2ZJAA 1OYYA 1XU4A 4HDOB 2AWOA 4HZIA 4V0OA 3QKTA 1OIWA 1N5LA 2HJVA 1UKVY 3PV0A 1G3RA 1ZVQA 4G5GA 4QJ5A 1R2QA 2GRJA 3EASA 2X77A 3KKNA 4CEIA 1U99A 4KV9A 3I61A 1AKEA 2JIZA 1YR6A 2JIZD 3CO5A 4LYHA 3CNLA 1FP6A 3NVAA 2WJYA 3Q9LA 4G5QA 2YKGA 2L0XA 3KTAA 2NZJA 5KNBA 4F91B 4BLQA 1ZRHA 1MABB 3Q7PA 4V0KA 2N46A 3QXSA 3CM0A 4DB2A 2J1LA 3ND8A 1EG7A 1G8FA 4P4SB 1P72A 1YQTA 1G3UA 2WIAA 4PTLA 1XRJA 4QRHA 2PCJA 1KI9A 2HDNB 4L9WA 1N0VC 1AKYA 1U90A 2NPIA 3RYTC 3UMFA 2RGNC 4JT2A 4Q5IA 1FTSA 1UADA 2JAQA 1YZUA 1Z0FA 3B6EA 3MRSA 4DLUA 4KBGA 3IBGA 4Q4HB 4PANA 4Q4AB 2LCFA 5G41A 5JFGA 2YINC 2RGAA 1M1YE 3CR8A 4HUQA 3B2EA 2OV2A 1G7TA 4G1UC 2FJUA 1W4RA 1E9SA 1TF2A 5HE8A 2ZRDA 1ZP6A 2IEYA 1SVWA 3UK6A 3HJNA 1KDOA 4HB4A 2ZRCA 2FEOA 1US8B 3T61A 2KBEA 4V0LA 4RD4A 3RS7A 5JMTA 4LWZA 1GL7A 5DN6A 5EE1A 5FPTA 5DN6D 5HKKD 5KOYA 2JLUA 4PQFA 2GK6A 1R0XA 2EVWX 2GJ9A 2GJSA 5DYGA 2KB0A 3AM1A 1PUIA 1NY6A 1GP2A 1C1KA 2P6NA 2YOHA 1X86B 3LBNA 1G4AE 2UVQA 3UMSA 4FCVA 3ZQ6A 3U3JA 3BH0A 3CZPA 1SVMA 2WWIA 1KO5A 1TQ2A 2JJ1A 3BAFA 1DO0A 2J0VA 3THOA 3UATA 3O8DA 3Q5EA 2O0HA 4N1AA 1KO1A 2QPTA 1Q0UA 1KSHA 4B33A 4LZZA 1Z2CA 4HB0A 3EIEA 2F43A 5E7IA 4CF7A 4TL9A 3DOFA 3A4MA 4LBYA 1W5SA 3TSWA 3H0KA 1J7KA 1E2DA 1H8ED 4Q1CA 1OFHA 2C78A 2Q3HA 5DI9A 3T06B 3B13B 4QC2A 4TQAA 2PH1A 4AC9A 1IM2A 2XNDA 2XNDD 4L5BA 3K70D 3LWNA 2YV5A 4G5RA 1DAFA 2ZYUX 1QG4A 2CCGA 1YZLA 3HU3A 1E0JA 4DB4A 8OHMA 5CK4A 2DPXA 5KDLA 1EFRD 1BMFD 4TYNA 3QBTA 1FOEB 5KYKA 1N0WA 2KJQA 4JLAA 3C16C 4QHSA 3ZYCA 3L0OA 1S4QA 1X3SA 5EXTA 4ZI2A 1P5ZB 4TMTA 3PJRA 1TNDA 2ORWA 1CLUA 2NMVA 4FCWA 3K0CC 4PHFA 3W9YA 2GJAA 4POAA 1S9HA 1FUUA 5TARA 4GZMA 2AR7A 2J3EA 2R6AA 3K9NA 4U00A 4M1SA 5HTKA 4D6PA 1QHIA 1GVNB 1SULA 3NBZC 2FV8A 2GXQA 4M9XA 3CRVA 4WVFA 4TLCA 4AYTA 4TSFA 1OW3B 3GMTA 4TSFD 4XH9B 4M9SA 3A37A 4XSHA 1Y63A 2VHQA 3VKGA 3KZ1E 2R44A 2OE2A 3TVTA 4BASA 1NMYA 2GF9A 2GESA 4A36A 3CX8A 4Q7JB 2FG5A 4HLCA 3J81k 5DGXA 3OFND 1KK0A 3ICQB 1PLJA 2ZI6A 2ZTSA 1COWA 4A15A 2BEJA 3AJIB 2WWWA 1HQYE 3AVPA 3QVUA 4Q1FA 1ZUHA 3ZIAD 2PLFA 4ON9A 3UWOA 5D3MB 1OFUX 1W0KA 1ZD8A 4GOKA 3B78A 2CK3D 2X2EA 1ZIPA 1LNZA 4NE2A 3THXA 2ZETA 1JAIA 1U81A 4B3CA 1XTIA 5GADl 4B74A 1TPZA 2XZOA 4R98A 2DFLA 1KAOA 4A0HA 1E2IA 3FVQA 1SXJA 1SXJD 1FW6A 1JQJC 2J5XA 2DYKA 2XJ9A 2IWRA 4FWTA 3EW9A 4RY2A 1XEFA 3QF7A 4EKDA 1U2RA 1N6LA 1E2FA 1Z6AA 1BKDR 2PZFA 3U6BA 2ZRIA 3I8SA 3GLFE 2F6RA 3VR4A 1WBDA 1RPZA 1DAHA 2BM0A 4O2LA 2WJIA 4QBGB 2DCUA 2O8CB 4UNRA 3EC2A 4HLDA 3IIKA 3C41J 1JR3A 1JR3D 1TEVA 4ARZA 1DVRA 3CH4B 4EPYA 4NONA 2C9OA 1IY2A 2EW1A 4QNRA 3GLHA 1DEKA 1EFHA 2MMCA 4DEYA 3CX7A 2JLRA 1EFCA 4AWXA 1W36D 4QFMA 1LTQA 3SNHA 2JLWA 3IEUA 3TGPA 4XTRA 1N6NA 3FHTA 2XSZA 4TYQA 4UXHA 2CL0X 2O0KA 5CIQA 4CIDA 3LO5A 4M4SA 2RGGA 3A8TA 4B3GA 2CHQA 1CEEA 4QGHA 1UEIA 2GJ8A 3K0SA 1NG1A 2GHIA 2CNWD 4LHYA 4C0JA 4PFSA 3AP3A 3ADDA 5FH9A 5HCIA 2YC2C 2G6BA 2YJTD 4B6FA 3U3RA 2AN9A 5C4MA 3A6PC 2QAGB 3C7KA 2AX4A 2G77B 1TUIA 4KLNA 2IYSA 3LRPA 4KI0A 1XEXB 2R6DA 1IY1A 5EUMA 5FPSA 4C0AC 3CBQA 1OF1A 2A9KA 4ZIRB 1NMXA 2MSCB 1G8PA 4IKEA 3ZQJA 1G7RA 3BE4A 1VHTA 5BN5A 1OXVA 1Z0IA 4KVAA 3SU8A 1NL3A 4C0BA 1KJWA 3TSOA 1E3MA 1Z06A 3E5HA 3ZJYA 4IDNA 5IF9A 1JPJA 2H18A 3QIAA 5DI3A 1PLKA 4TTPA 3AUXA 2GBLC 3QXHA 1OXXK 2QMHA 4AKEA 4B76A 1HV8A 3VTKA 3EA0A 4BUJA 4D26A 3LVQE 1RIFA 3G82C 3P4XA 1KDPA 3LQRA 3Q5DA 3W8NA 5FBQB 4L16A 5G53C 1S2MA 4TL6A 2FH5B 5EUQB 3AVXA 1G21E 2YZ2A 1HH4A 1NN1A 5J40A 2OCPA 3R20A 4IXMA 4BECA 4EUNA 5LD2B 1GZSA 1OH5A 3EPHA 2YWEA 3KL4A 1F2UA 3FB4A 4C7OB 4D25A 4LV8B 3IIMA 1HTWA 2WIBA 2PX3A 1ODFA 2CHGA 2OM2A 3LBIA 4O2RA 3E70C 1R8QA 2QQEA 4TLAA 4D2IA 4LJ7A 1II8B 3DKPA 2GTPA 2WWGA 3AUYA 1GTVA 3Q85A 5EXXA 1KNQA 5JRZA 2OLKA 2QT0A 2WTUA 3AKYA 3GLIE 4WAUA 5JRJA 1HUQA 1U94A 3X1DA 2GAAA 1JEDA 2QU8A 1PV4A 4CRWB 4BLPA 2JLXA 4DCTA 4DT1B 2XB4A 5G3ZA 4DIDA 1QZXA 4IVRA 2GDJA 4TYYA 4IFBA 2O8BB 3SR0A 1ZUIA 1I4DD 1CULC 4KVGA 2XITA 4NCJA 1E2EA 4ZCLA 3SQXA 4NL4H 3OESA 1P7CA 1WQ1R 4JVLA 3THWB 2WWYA 4WOPA 1G5RA 2A30A 3D6TB 3LV8A 2O8FB 1TU3A 1IQPA 1RW4A 4QGAA 3PUVA 1XB2A 3QG5A 1UBFA 3AKDA 1KAGA 2KE5A 1F60A 4QJ3A 2WJJA 5FL7A 5FL7D 2WVJA 5F2EA 4DBLC 3WYGA 1IN7A 1JALA 3Q8XB 2Z0MA 3D8BA 1VTKA 1S8FA 5H1YA 2EYQA 3GEEA 1KDTA 2ZRLA 2N1BA 1XJCA 2XJ4A 3KDSE 1W44A 4JSYA 5JZVA 2JLYA 3EPKA 1ZM3A 3A36A 1Q57A 2WPDA 2BMJA 2WPDD 2VP6A 3AF1A 1AGPA 4OKSA 2D7DA 4HYYA 4O3MA 4JYCA 1E2MA 3O47A 5FTKA 1ZW6A 4JLBA 4C2UA 4JVMA 3K9HA 4PR0A 1N5KA 2FU5C 3AKEA 3AV0B 4RCYA 2EWWA 5KHOC 4EDHA 1DOAA 2REXB 1E4YA 3IDQA 5TXGA 4IHQA 4AG6A 3CRMA 5GJCA 2IXFA 1KGDA 5C1BA 3CB4A 1RRFA 4HB3A 1E2JA 2XTZA 2LWIA 1FQKA 4DDTA 2A3RA 1BS1A 4JMPA 3LVRE 3ZLJA 4DWJA 1T5IA 1WP9A 4NU0A 1XCMA 2ZJ5A 4C0SA 3N2IA 2BV3A 4B3BA 4AURA 1AK2A 1E0AA 2C04A 4LHXA 1T6NA 4K46A 1R7RA 1LVGA 2JASA 4NYIQ 2QE7A 2WJVA 1YVDA 3ND9A 4GP6A 3QKUA 4OK5A 2CLDX 3C14C 4P31A 1IN8A 2VHCA 2PMDA 2ZI9A 3W5IA 3VU9B 4QHYA 4C0HA 3GJ3A 5JEEA 1AA9A 2ZXUA 4URZR 4PQYA 2O8DB 1NVVQ 3DOEA 4IEIA 4D4KA 3QY0A 3JZMA 4TMVA 1KY2A 1OHHD 1W48A 2AKYA 1KZGB 5EP2A 3TSZA 4CT4B 3F5FA 2B21A 4DSNA 2ZS8A 1SHKA 4MH0R 2ZREA 1FP7A 3NC1C 3W34A 1XPUA 2QSZA 3TUZC 4LI0A 1T5LA 1NKSA 2ZQ5A 4UNSA 3MMPA 3MLEA 1QHYA 3GJ0A 2CXXA 5EZ6B 3WBJA 4D0NA 4ZCMA 1YJ5A 2PT7A 4RKFA 2GF0A 3U44B 1X6VA 3DO6A 3WNCA 3NHAA 1P73A 2P2LA 5BQ5A 1E9BA 5EE5B 2FZLA 4KXFB 1E1RD 2ZJYA 3VLFB 4ACBA 5SZIA 1XXHB 2ZR9A 5FPHA 2ANCA 1KMQA 4A82A 2WSSD 4Q02A 3NBFA 4DLVA 1N5JA 4TTRA 1IOZA 1ZM9A 2Q9BA 2O0JA 3LW8A 4B47A 4IVQA 3I5YA 2OFWA 4LY6A 4V02A 3X2SA 4GSYA 4GZLA 4JLVA 5GVRA 3SHWA 5FTNA 1UDWA 4KAXA 4BE7B 2QAJA 5CYOA 4CYMA 2O8EB 2WMOB 2GXSA 3MAAC 2VHJA 4Q9HA 3Q3JB 1BO6A 3LA6A 2QTFA 2GZAA 1XWIA 1LY1A 2WKPA 1Z0KA 5DHFA 3MFYA 4BPBA 2OBMA 2G1KA 3WNBA 2W6JD 5HZHA 3K0FB 4I81A 2B8TA 4KFTA 3SBEA 2WMNB 1S9DA 4R71A 4NCKA 3SJCA 3B7GA 2CCJA 5TDHA 3SJAA 1L2TA 2GILA 2J0UB 2OZEA 2ZE8A 4UNPA 4Q9LA 1IXRC 4JLJA 3FHOA 3L82B 4M1MA 2ZRMA 4TMWA 4W9MC 2XXAB 2GWHA 2HXYA 1IXZA 4NCHA 3DPUA 2VP2A 1G7SA 2OSBA 2CE2X 3FFBA 4KYUA 1CXZA 3L0SA 1DG3A 1UKEA 1GKYA 3R9XA 4MRSA 4V03A 1P9NA 3ZZTA 4BFSA 5H70A 2ZYTX 4OQMA 5EE0A 1XPRA 3ZS8A 2F1HA 2AFHE 4IDQA 4F7WA 4M8NE 1BYUA 5CB8A 1UDXA 3JVVA 2IF0A 3EZFA 3U4QA 2Q9CA 5EJEA 4FIDA 5JJKA 2QGZA 1W49A 4LPSA 3UG6A 2RAPA 1U8AA 3GLHE 4JSTA 1JEEA 4RZ2A 1G8HA 2ZSEA 4NZYA 2P6UA 2HCJB 2ZM5A 2QAGC 3LX8A 1CR4A 4G5OA 1TX4B 5EE3A 4K8OA 4JBXA 4RZ3A 5J4VA 1NVWQ 3B1VA 3IHLA 2OESA 3CRW1 1KO4A 4DXAA 1TU4A 1KMHA 4HB2A 3PXGA 1NMZA 2YOFA 5AUPB 2IL1A 3VQTA 3VKHA 3NH6A 2RHDA 3OEED 4OL0A 3H86A 1W7AA 2HV8A 1JQLB 2E9SA 2AXPA 2D74A 4IDOA 1GKUB 1OKKA 3VNUA 4Q47A 3B82A 2R6GA 3L0PA 4FWDA 3RNLA 4AKGA 4FWIB 1G9XA 3DMDA 4DCSA 4MGIR 1FMLA 1P9RA 1X8JA 2BEKA 4C2TA 5EP3A 1YRBA 2EFCB 1FZQA 1E9DA 4IXNA 3VX4A 4B32A 1W0JD 2XTNA 3UKDA 4G0NA 1DAMA 1NY5A 1J90A 4R2IA 3W8RA 3ADKA 5LD2C 1FNMA 2ZRKA 1Z28A 3GJ5A 3PEYA 2C03A 3SYNA 1GILA 5EQTA 1L4YA 5CITA 4LPKA 4PAMA 4CEIB 4XWKA 3SYLA 3LX5A 1RJ9A 1FMJA 2ASEA 3K53A 3R7WA 2H57A 2J7PD 1QHNA 2JJ2D 2JJ2A 3FMFA 5FOTA 4JKIA 1KI2A 3WYAA 4ABYA 3LW7A 2EU8A 3C4JA 3ZD6A 2IBMA 2B8WA 4E07A 2D3WA 3P1JA 3CPJB 2JCSA 1VYVA 1QZMA 1LF5A 3KXKA 4HSEA 1ELOA 4NCIA 4KCGA 4YONB 3K09C 1JB1A 4CEJA 2ZRFA 5AUQA 3KQKA 2J0SA 4PSKA 2XOKD 5JLJA 5FTMA 1DELA 1Z8FA 1EX6A 3CWZA 1DG1G 1ZNZA 1RFLA 1F2TB 3TUIC 3TW4A 4ZKEA 1GNRA 721PA 2ZRGA 3K0AB 1ZNWA 3QKSB 4HDCA 5AR1A 5A4JA 3GLIA 5L8VA 3O8CA 1UBGA 2WJHA 4QHTA 3VHLB 4LJYA 1F3OA 2VP5A 2Z83A 3F3YA 1I2MA 4PC3A 3QI2A 3GJ8A 3S1AA 2DR3A 4OBEA 2O52A 3BRWD 1X37A 2BC9A 1N6OA 1OB2A 2KSQA 1QHHB 2QRZA 4DJTA 4XWOA 1XTRA 3TNFA 2AL7A 3IQWA 3D3QA 5L3QB 4FN5A 5TB5A 1OE0A 3CLVA 2DWOA 3CRQA 1WRBA 2W2XA 4GPTA 2Q3FA 1VIYA 2QL6A 3BORA 4II7A 4CW7A 1SQ5A 1T3HA 5BYKA 1ZINA 3IGFA 5J5CA 1XFAA 2ZUBA 3BIFA 3SYKA 1SKYB 4UJ3A 3LXXA 4HATA 4EJSB 3ZVRA 2IS1A 3LLUA 3OEHA 3C15C 4WZ6A 3AGPA 3MCAA 3NHBA 5C46F 1KNXA 3RHFA 5K8IA 2VSOA 4UNQA 4C0QC 1QG2A 4M1TA 2XZLA 1W1WA 1IHUA 3GFTA 1X8LA 1G291 4MDFA 2FX3A 2HCBA 1IJFA 1GSIA 1XJQA 2GK7A 4PO1A 4LBZA 1CR1A 2V6JA 2G1JA 2HT6A 3NWJA 1QRAA 4TLBA 4US0R 3I4LA 4QKQA 1OH8A 3HWSA 1E9AA 4MRPA 1GL6A 3K70B 4NMMA 4X8OA 3OIVA 5FI1B 2A5YB 3QQ5A 2ZRNA 4D81A 4PHHA 1NLZA 3AVQA 3QPUA 4HAVA 4URVR 4UQOA 1EWRA 2C96A 2YOGA 1HE8B 4Q4JB 4C0KA 3BBPA 4FCTA 4H1UA 3T35A 1E2NA 3KUCA 4DC9A 3B1XA 3AVWA 2GBLA 1E9EA 4OI4A 1E0SA 4Q1AA 4Q9KA 4XVQA 4Z54A 5L3SB 2IWHA 3A4LA 1NF3A 3SHFA 3WMFA 1KI7A 2FPKA 3NTUA 2CHVA 3CX6A 3W90A 5P21A 3UPUA 2GJKA 5CYPA 4IFEA 2XZPA 1N6RA 3CF6R 5TVKA 121PA 2QZ4A 1G16A 1XMVA 2JJ1D 4OJQA 4D4JA 1EWQA 1LB1B 2OAQ1 4ILEA 4PZZA 5KSOA 2CCKA 4I99A 3WY9A 1ANKA 1D9ZA 3KX2A 2CJWB 1ZM7A 2A2ZA 3W5JA 3BC1A 1G18A 3C5CA 5DIFA 4YQFA 4E22A 3P32A 1OIVA 1ZM4A 2TMKA 1KOFA 2QGNA 1NBME 4EPRA 1OFTA 3KKPA 1Z29A 2FE4A 4Q01A 1MABA 1D2EA 3U3OA 3KFVA 4Q03A 3I32A 4RD3A 1ZYUA 4P4SA 3LDAA 4LBWA 3AEZA 1WBBA 1FX0A 2ZUCA 3KXLA 3I62A 1JPNA 4Q00A 3DMNA 1PLLA 2D2FA 4ZDJA 4WIAA 4Q4HA 2MSDB 4Q4AA 3A4NA 2WM9B 3G5UA 4WA7A 4JN6A 3A1VA 2J0QA 3X1WA 1Z08A 1V43A 1P4SA 3VKWA 1KTVA 4I4LA 5IRCD 1Z47A 5BYJA 2P3SA 3CRRA 2KBFA 3KUDA 1Q1EA 1NRJB 1US8A 1B23P 3BGWA 1P6XA 1E69A 1Z6TA 5E7JA 3V4RA 1GITA 4NYJQ 3BERA 3R9IA 1T0HB 1YR8A 2OXRA 3O8BA 5JHHB 5G3YA 4Z8YA 3G0HA 1JR6A 1IAQA 3AF0A 3SDZA 4MKFA 2NO6A 2P5TB 4QJ4A 1W36B 4JIMA 3MUFA 5EXSA 1COWD 3GLGB 1G5TA 2VH5R 2ZROA 2HYIC 1LFDB 1KSFX 2OFOA 2PZGA 4GNKA 4AY2A 3EXAA 3QEOA 1CJMA 4UJ5A 3EG5A 2FSFA 1M34E 4A0FA 2FPLA 5LBIA 1NLYA 3D7MA 1W0KD 1RVDA 2DFKB 3OZXA 4LYFA 5JCPA 2OAP1 1VG0B 1OT3A 4ZPXA 4XWAA 4LOAA 1KI6B 4EQ6B 2H92A 1VIAA 3UG7A 4OHXA 4TQUS 4BFYA 2ZI7A 4IOLA 2BJVA 3SFZA 4Y0VA 1E9RA 2C2HA 4OQLA 3RWMB 1UFQA 3AH8A 3F8TA 4GT1A 5DYIA 1E0KA 1K6MA 2PBRA 2GZHA 3U7FB 4M9ZA 1U8ZA 3EZ6A 2GCPA 3KKQA 4BQSA 1CRPA 2ZU6A 2ZAOA 1SVKA 2W00A 4W5HA 3IHWA 4XIGS 1YZTA 2BBWA 1WB9A 1RRPA 4Q9JA 1E2KA 4OI1A 2QI9C 3GJ7A 4JLMA 5FBVB 4R2HA 2VO1A 3OAAA 2ZI4A 1S3SA 2NPFA 4A0GA 5CJPA 2CMKA 1RYFA 2BBTA 2Z4RA 1G3MA 2ZRHA 1XXHE 1Q12A 5DH9A 2JA1A 3KJGA 2MSEB 1E9CA 3BH6A 4RCZA 3GFPA 2A5FA 1Q1ZA 1YZKA 4BZXA 2GXUA 3NKVA 4LJ9A 1TTTA 3AP2A 5JSZB 5FL3A 3M1IA 4JL5A 5HE9A 4ACAA 1CKEA 4QM6A 2RH5A 3ETLA 1L8QA 2XSZD 1YZQA 2Z6VA 2ZIAA 2ZJOA 1NSFA 5EE9A 3RS5A 3CUEF 4URXR 1L7VC 4JLNA 2FFBA 1R6BX 4R9UC 1DAGA 1PJRA 4AD8A 2ZSDA 2QG6A 3WMEA 1MO4A 2DWZB 2ZSBA 3BXZA 4QG7A 1N3BA 2PZEA 3FKQA 1OFIA 4EFLA 4ASUA 4ASUD 1XTKA 4A3VB 2ZRPA 2G88A 4M9QA 2F7SA 2EWVA 4PO8A 1VPLA 2IYWA 3IPXA 4R7ZA 2OCBA 2ZYVX 4PAQA 3SC3A 521PA 4RFVA 4CEHB 1KSGA 3X1ZA 5D3MA 1E79A 1P9WA 2ZJBA 5KDDA 3L8ZA 5SZJA 2BJWA 1P2VA 1VCNA 4RZXA 4DEXA 2ATVA 4ZV4A 2FOLA 1XP8A 3N5CA 1XMSA 4YDSA 1R0WA 1JAHA 3GEHA 4MRRA 4BGDA 1I2DA 5K8LA 2Q21A 5H68A 2NZ8A 4MRNA 1ZC3A 3WMGA 2V6ZM 1KK2A 2ONKA 1XJ0A 4PC1A 5IDVA 4B3XA 5CK5A 1ZIOA 4F92B 2OXCA 2RCNA 3H84A 3N70A 1QDEA 2IHBA 1FFHA 1G4UR 1HA3A 2CL6X 2WSMA 4WXPA 2GCOA 1DE0A 5IK2A 1W46A 2NQ2C 1FNNA 4KO8A 3LFUA 1QHXA 5FPKA 2IYYA 3MHVC 2H8KA 1R5NA 5EXPA 4JLKA 4TYWA 1ZNYA 2J9RA 2ZE7A 1U0JA 4M0LA 1OJLA 3TKLA 3TR5A 2O8CA 1MOZA 2XX3A 4W7SA 4Z1MA 3VNVA 1T0JB 1PUJA 3RRMA 3THYB 2JEOA 2OLJA 1AN0A 3QXXA 1U9IC 4BLOA 3W3AA 4H9GA 1D6JA 3MGCA 3X1XA 4KITB 1CS4C 3DZDA 4BZQA 1CF4A 5H8WA 3EZ9A 2GAOA 1P2SA 2H5EA 4AK9A 3HPRA 4MKHA 1XD2B 2XAUA 3E2IA 3RS4A 2GEDA 4EJSC 4MUBA 2GCNA 1D9XA 2OUKA 4OI0A 1XCGB 1VECA 4KYIB 2QTVB 1F6BA 3LLMA 4RSGA 2ZVPX 3DM5A 2ZR0A 4A0RA 4IRUB 2F9LA 1KI1A 1G64A 5BWMA 4Q7LA 5KU1A 1NI3A 4Q1DA 2HUPA 2JDIA 2QAGA 3AB3A 4IJMA 2AKAB 4OHVA 1XMIA 3B9QA 4EPTA 4GRAA 2VHUA 5LPNA 2QQ0A 5DSZA 1IN5A 2QBYB 1XEXA 2J7KA 2ZSFA 4JZKA 4DLTA 4JLOA 4DHEA 2XGJA 1J8YF 2HYDA 1ONBA 3GJXC 4QL3A 1MO6A 1DAEA 4ZIRA 5IHPA 4JYBA 1HYQA 2AK3A 3TQCA 5K8UA 4QOSA 2ANBA 2ZJ2A 4NBSA 1BH2A 4AG5A 4FW9A 3TH5A 4RZUA 4I1UA 1N5IA 3M4YA 4GL2A 3MG9A 1TAGA 1W4CA 3MWJA 1XEWX 2VQSA 3B9PA 1E2LA 4EFMA 1RKBA 3REFA 2CLCX 3VMFA 4NKRA 1NN5A 1D8TA 1OXSC 2AXNA 2V54A 5JS8A 3ZVNA 3RDPA 4NTZA 1BOFA 2D7CA 3AGQA 3C5HA 4PSAA 1KHTA 2P67A 2V7QA 1GL9B 1XPOA 4EAQA 4M22A 3I72A 3WRXC 1YKSA 5ANRB 5TMPA 2PEZA 3OIWA 4A2QA 1Z07A 1Q3TA 2C9CA 5E7MA 2CVHA 1Z0DA 1UM8A 4FI3C 4Q66C 2PT5A 4C7OA 1DADA 4B2LA 4DLRA 3GJ4A 3AP1A 3VHXA 4L4UA 1WMSA 1Z5ZA 3AF4A 5JJIA 1EXMA 3CNNA 2X2FA 3K9LA 5BN4A 1II8A 2FGKA 2PEYA 4MRVA 4WZBE 2R65A 4NYMR 3PFIA 3AF2A 2CLSA 4LHVA 1AM4D 3PUXA 4IOKA 4IVPA 3FMOB 3QKRB 2QE7D 4GP7A 4Q1EA 3VR2A 1KK3A 3GPLA 4LJ5A 2EFDB 4DT1A 4MITA 3SOPA 4A2PA 1RRCA 1Q22A 1R0YA 2O8BA 3HU2A 3K09A 3T1QA 1HY3A 4IOJA 5EZ5A 1I4TD 3PUYA 2WKQA 4M53A 1E96A 1Z0JA 2NIPA 3LNCA 2P0EA 1D2NA 2JATA 1VG1A 3FFAA 5DO9A 1OB5A 3CONA 3THWA 4FWGA 2IYUA 3RS3A 3ZZUA 4KLZA 1ZD1A 2VBCA 2VP4A 4DUGA 2O8FA 4TL7A 4LRSA 1XTSA 1SKYE 2AFIE 4B71A 4EFNA 3TUJC 5CDFE 4KHZA 1NBMA 1ESNA 3RWOA 3QPWA 4XD7A 3GQBA 1QBKC 3KB2A 1MT0A 4RKEA 4RJLA 1YZGA 1V5WA 2JGNA 4QBIA 3RABA 5FUYA 1CRQA 4W5JA 1IJEA 1LS6A 3N2EA 4HAUA 1E2PA 4D0GA 3Q72A 4LV6A 1Z63A 4IDPA 1M8PA 3KKMA 4GOJA 1OH6A 2IUSA 2CBZA 5B2ZA 5AJZA 1WDTA 2G0NA 4HI0E 1JJ7A 3Q7QA 2WICA 4YXWA 4YXWD 5GVSA 1HT2E 1XNJA 3QF4B 3D31A 2V55B 2QN6A 4TT3A 5AWFC 5HZKA 4E5UA 3GLFB 4TYPA 5E4FA 2VPPA 4D4MA 4LCBA 5C2JB 4A8JB 1RE0A 2VA8A 4ZKDA 1G3QA 5CM9C 1E2GA 2A7QA 3ZGXA 5JWOA 1P2TA 4B73A 3NBXX 4PAOA 1Z6XA 2J41A 3PENA 1MRSA 2ZITA 1YU9A 3SBDA 3P26A 5F9FA 2J45A 4LDJA 3QENA 1LS1A 3PCRB 3LD9A 4HEJA 4D0LB 4JLPA 1S1MA 2IX3A 4OHWA 1R5BA 1UBCA 4KU4A 4QBHA 2IYXA 3CF0A 1CIPA 2QMOA 4MQBA 1AJEA 3DZ8A 1SKQA 1E99A 1A7JA 1MH1A 1EESA 4PZLA 1PVOA 5B30A 1CJVC 5DNYB 3CH5A 2OBNA 4N3NA 1GRQA 3VU9A 1AQYA 3LXRA 2R6CA 2O8DA 2HF8A 1LV7A 1N6PA 3OF5A 1MKYA 4US1R 3DHWC 2ZVQX 2HLDA 4B3FX 2CEAA 3T1VA 3B85A 1J99A 3M6AA 2WV9A 5AJVB 2I4IA 4C9BA 1TUEA 3NH9A 2F9MA 5J4HA 4GMDA 2ZRAA 1GM5A 4UXIA 1RZ3A 2WOJA 3EARA 1FUKA 4MYTA 3FE2A 1G41A 3UWKA 4YMUA 1SVSA 2X19A 3KB1A 2F55A 3U44A 2UKDA 1A4RA 4HZUB 3QJYA 4PHGA 4QGGA 1E1QA 1E1QD 2EFEB 4I1SA 3UMRA 3U2QA 4AKHA 4QM7A 4CZ2A 2PCLA 2NO0A 2OO7A 3KJEA 1XXHA 2VIIA 4RFSB 5C4GB 1T8UA 4TN1A 4HAWA 1QVRA 3TAUA 1GKIA 4OQNA 1PZNA 2Z5FA 2ZR7A 2KRKA 3AQ4A 3QNUA 1L4UA 1CR0A 4B44A 4BEBA 5E95A 1DTSA 1P61B 3BFKA 3RRZA 3TQFA 3T1OA 1G7CA 1E6CA 2G3YA 4B35A 3QOFA 1JI0A 4CGZA 3CPHA 4XOIA 1Q1BA 1NIJA 1E98A 3OHMA 1AIPA 1AQUA 1TMKA 2O8EA 1XF9A 3MJHA 2B7CA 4ZI3A 3O8RA 1KK1A 4LHZA 2A5JA 1RYHA 2D4HA 1U8YA 4YMSA 2OEPA 3VR5A 1OKKD 1QHSA 3B8HA 3GLGE 1Y3AA 2H16A 2OILA 2UZ3A 3C8UA 4Q18A 4PC7A 1NKTA 3CZQA 3MSXA 1Q1QA 3ZZ0A 3K0FA 2LKCA 2DHRA 3RC8A 2PJRA 1IBRA 2NGRA 4O25A 4LRTA 1IY0A 1AGRA 1S96A 5AK0A 2J0UA 1Q3HA 2YWHA 3JVUA 2IK8A 2FA9A 1Z83A 4MKIA 4DLZA 2DB3A 4DSTA 2XXAA 2G83A 2QPOA 1EFUA 1XTQA 5CIWA 2GVZC 4JJKA 5KNCA 1KO7A 3UANA 1W4BA 5FOXA 4BLTA 3CNOA 5CJ2A 4YDHB 4A92A 1S0UA 3A1TA 2DZOB 2YHSA 5FPYA 5HCNA 3VAAA 1KZ7B 1AS2A 2IEZA 2VLIA 3KFXA 4V0ME 1F48A 3QG1A 1R5OA 2QSYA 4P32A 2ZI5A 1HE1C 4D82A 3KTAB 3RLFA 1Z0AA 1SVLA 2ERYA 4KFUA 1SHZA 2H7VA 3CKLA 1EGAA 3RRNA 2BDTA 2NO9A 1ZAKA 3BB4A 5KTYA 3HDTA 4URWR 3VR1A 4J0QA 4DRZA 2FSIA 1R10A 2BCGY 2W2TA 5DHAA 5TY0A 4YLGA 2R8RA 3BS4A 1M2OB 4FMCF 3W6PA 3EPLA 1OIXA 1P3JA 4JBYA 3MWYW 1NN3A 1VG8A 1GWNA 1KKMA 2NOAA 4HUQB 2VHTA 2R6FA 4JS0A 2C98A 1G6OA 5FUVA 2DVWB 4DCNA 4YC7A 3EIQA 4PO9A 1NNEA 5JWRA 2OCYC 2V3CC 1Q44A 1OLOA 4XJXA 3NC0C 3KW6A 1NSTA 1K5GA 4DZZA 4BFZA 1QF9A 2QTHA 4FMDF 1BYIA 2XNSA 1G1MA 1MV5A 2C9YA 3BK7A 2FMXA 3FPAA 5JI2E 3IIJA 1DPFA 2UZIR 1NP6A 4U5XA 3NEYA 1JXOA 1VCOA 5J4LA 4ESHA 1N6HA 3KXIA 2ODWA 5LB4A 4MA4A 5GJVC 3OEHD 4JL8A 3PIRA 4UXJA 4PPGA 3DKVA 4FMCB 5IT5A 2P6RA 2H1LA 4OK3A 1A1VA 2Q3MA 2F43B 2BVNA 4L8GA 4BRWA 2F1RA 3OIYA 5LB2A 4KSBA 1LW7A 3AKCA 5J4YA 5F3WB 4QGFA 2KWIA 2ZJZA 1I4LD 4AI6A 3QBVA 4DSOA 2XB2A 1LF0A 3WNDA 3EPJA 4TMKA 1WCV1 1ZU4A 4LJ4A 2ODNA 2VF8A 2YC4C 3AVOA 1QVAA 1IXSB 2DZNB 4FMDB 4HLUA 3BB3A 2WKRA 3ADCA 3B1YA 4G01B 4A1FA 2IHYA 2VYFA 3L2OB 1UAAA 3NDBB 2I1VB 4Z8XA 4Q1BA 1X1SA 1FX0B 3VR3A 5CLLA 4MDEA 1YRAA 3EZ7A 3LBHA 4MKGA 2IYQA 5A5GA 1F2TA 1G3IA 4JLDA 3BFXA 1G20E 1GG2A 2QY9A 4LRWA 4WW0A 3K0AA 3QKSA 3U5ZB 4O0MA 4Q7KA 1YZNA 3AVTA 1KDRA 1VCIA 2FFQA 3HR8A 5G40A 2LKDA 2BWJA 3GP8A 4LC0A 1T9HA 1HEIA 2ODEA 3TE6A 2ORVA 1U9IA 4X8MA 1ZMXA 2DFTA 1QHHA 4TTQA 3QEJA 3TBKA 4ERNA 4ZCIA 1UKYA 1W47A 3RANA 2W0SA 4CDGA 1UEJA 1XBTA 4JVSB 5HKKA 5L3QA 1G6HA 421PA 2Q6TA 2ZUDA 3W6NA 2QMEA 4LJ6A 2I3BA 4PSVA 2IYVA 2VF7A 5CDFA 4EJSA 4V0NA 4W5WA 2JJ8A 2EFGA 4DKXA 1CJUC 4LYJA 3REGA 5F98A 4A8JC 2IUUA 3QSYA 4N0DA 2F3RA 1TL7C 4MUAA 4A6XA 4AYXA 2EYUA 2ZRJA 2WAXA 3THXB 3ZH9B 2ORIA 5SZKB 4PQRA 2J46A 2B7BA 2V8OA 5FOWA 4M1WA 4KODA 1H8EA 1FL9A 4US2R 4G5SA 1OH7A 5JWHA 1JJVA 3BJIC 5JCZA 2AWNA 1SXJB 1R4AA 1KIMA 2RGCA 2ZEJA 3TVDA 1CJKC 2V1UA 1ZUNB 1JNYA 1TQDA 1M6NA 5J47A 2BBOA 5FBWB 4DSUA 4G3XA 2NTYC 5FOVA 4BFWA 1UPTA 3H4MA 2P65A 3L0IB 4H1VA 5B58C 1N6KA 3LAWA 2GEUA 3B1ZA 1EFRA 2HT1A 1BMFA 1ZD9A 2FF7A 1M7BA 4Q4JA 2JLZA 1ZC4A 2WAYA 4ARZB 3KQHA 2YYZA 4BFTA 1NJFA 1TQ6A 2K5UA 2GKSA 5L3SA 2FPMA 3R8CA 4FWHA 4M1OA 3BWDD 3GLHB 4Y0AA 4LC1A 2F3TA 3EWAA 1NVMA 3GFOA 4UKDA 3A1UA 3WBKA 4OK6A 4GDFA 1JXMA 4OQFA 5B57C 4P4TA 2REOA 4D80A 4RD1A 1E32A 2FNAA 3L8YA 3RRYA 4EIWA 4BEJA 4DLYA 2BBSA 2W0MA 5AJYA 1BIFA 1ZCAA 2ZSAA 2CDNA 5HPYB 1M7GA 2CJWA 4QBFA 3TLXA 2RHMA 3EZ2A 3KJHA 2WWFA 3OFNA 1CP2A 3BFVA 4N0EA 3QVVA 2WBLC 1P2UA 1Z6GA 1ZJ6A 2AK2A 3W3ZB 4C0LA 1DAIA 3ZIAA 2C95A 5FBLB 1XTJA 2W6ID 2W6IA 3KKOA 3T12A 1NVUQ 1OPXA 2CK3A 3PG5A 5CLQA 2HEIA 2BMFA 2ZAMA 2RGXA 1GNQA 3BD9A 3OAAD 1DBSA 3A1SA 3NBYC 1D5CA 4MYUA 1RC8A 2ATXA 2IA5A 3RC3A 4ESVA 4P33A 3K1JA 3LH5A 3IEVA 1FPMA 3QPVA 2VL7A 2B6HA 3BB1A 1XZPA 2V4ZA 3BH7A 5DI3B 4MGZR 2GETA 4XVUA 2GCOB 1VG9B 2NO1A 5JHGB 3SFVA 3DDCA 5J4KA 2G0TA 2FSGA 4NDZA 1NN0A 1IN6A 4HAZA 4BRUA 1XCPA 1T8TA 2J87A 3SS8A 1WE2A 2C5LA 3ASYA 3ASZA 2EQBA 3NXSA 2FWRA 3EA5A 3K8YA 2PMKA 4B43A 3WRYC 4URYR 2VP9A 4HLQB 1F2UB 1O3YA 4CVNA 3EAQA 2PL3A 3GLGA 2RGEA 4NYIR 2VTKA 2DWQA 1J8MF 5FR1A 3IPYA 3SI7A 3DM9B 3U7HB 1HURA 1HT1E 1E79D 4NHOA 5JEDA 5GJWC 4QXAA 1K5DA 2YNMA 1IN4A 1KI3A 2QP4A 1G5PA 2VSFA 3EX7C 4A6PA 4ZDWA 3AVUA 1KY3A 2C99A 4PC2A 4TLEA 4HDQB 4B75A 4Z51A 1KI6A 1NVVR 1TQ4A 1UBEA 2QEQA 1N2CE 2A78A 5KSPA 4HLUC 4EQ6A 4TL8A 3KQLA 2IS6A 3CF2A 3QXJA 5LDDC 1DS6A 2CNWA 1SGWA 4B6EA 1A5TA 2ZRBA 4IDHA 2C8VA 2GNOA 1VMAA 5DLQC 4YMTA 4TWZA 5IK2D 2ZJ8A 4DVGA 5L3VA 2FEMA 2YVUA 3NG1A 4KFSA 2OHFA 2QMUA 4V0MA 3U61B 2Z4SA 4LHWA 2BMDA 2IC5A 3CIOA 3DL0A 1GAJA 3K0EA 2JLQA 4NP6A 4ZDIA 4DDUA 1VYUA 1E9FA 4JT4A 3GEIA 4BFUA 2HXSA 4Z1MD 5DISB 3V4FA 4OJKA 3WHLA 1MRNA 3R9WA 4PC6A 1SZPA 4IEEA 1A2BA 3TAHA 1T3LA 2P5SA 4TMZA 1WA5A 2E87A 3SN6A 4LSGA 4DCVA 1Q20A 2QM8A 1NG9A 3WYFA 5AJXA 821PA 4WXRA 3ZVLA 4DIEA 2W83A 3NEJA 4HAYA 5JSZA 3B60A 5KO2A 4AYWA 4I1VA 1VHLA 2RGDA 1W4AA 1YR9A 4EPVA 4EPXA 1FQJA 2ZE6A 3PVSA 3V00A 1P62B 4MGKR 1AS3A 4RD6A 3RAPR 3NDPA 4GMXA 1DO2A 1Z22A 2QENA 2W58A 3CW2A 3TW8B 2QP3A 5KPJA 3KQUA 5SZHB 1E2QA 3FHCB 2ZU0C 2PJZA 3CPEA 2QNRA 2CL7X 2OG2A 2IYTA 3MD0A 1Q21A 2ZI3A 1G19A 2ZYWX 2WWXA 2NG1A 1XMJA 1TF7A 2GVDC 2JDID 4CEHA 5GJBA 1UJ2A 2ZPTX 3ZS9A 1R8SA 3FDIA 4NPHA 2DWPA 1OSNA 3E1SA 3PEWA 2ONJA 4GI7A 2VRWA 2ZS7A 3GD7A 4DCUA 3I92A 2A5DA 3K70C 3UXMA 3HP1A 4XSGA 4ZDKA 3WHKA 1N0UA 5BN3A 4E09A 2BKEA 4IW3B 1J2JA 4Q7MB 4F4CA 1KYIA 4DLSA 4FD2A 1FTNA 4LK2A 2FSHA 5CM8B 1C9KA 2IW3A 2PX0A 2CVFA 3TK1A 1CJTC 2V7QD 1A82A 1G17A 1SVIA 4S35A 3TJZA 4GOXA 5AUNB 3AVVA 3HYRA 3KQNA 3FWYA 1UKZA 4Q48A 5BW8A 4P3YA 1H65A 2ZANA 3K9GA 3THYA 1OXUA 5KPDA 3U7GA 4L15A 2FFHA 4BWYA 5FOUA 4EPWA 5M04A 4S2EA 3CWQA 2ZS9A 2OT3B 4PX9A 4PPQA 3RVBA 3U7EB 2D62A 3TRFA 4BLRA 1M7HA 4B48A 1GRRA 2WOOA 3TR0A 1XD2A 3GJ6A 3JZAA 3U60B 3T5GA 1OXTA 4LV5B 1CU1A 1CR2A 2I1QA 5L3RA 4LYAA 4GITA 4X8HA 3A1WA 3OE7A 1XDBA 3OE7D 4Q4LA 2J59A 2IYRA 1T3SA 3PR1A 5JS7A 3FYHA 1II9A 1TADA 4F4JA 2RKOA 1GOTA 1VYTA 4D4LA 1ZCBA 4HUTA 1SXJC 1O87A 2QBYA 1F5NA 1H8HA 1H8HD 1GFIA 2R2AA 4PPFA 4DUGD 5ELXA 3ZD7A 2BMEA 3IO3A 4C4PA 4TZ0A 1YR7A 1GRNA 2REBA 3WP1B 1GNPA 2Z43A 2Y8EA 1NBMD 2AHOA 1TF5A 4Q21A 4XD7D 4FINA 2DBYA 4XVRA 5EP4A 1D2MA 2DY1A 2OCAA 2Q9AA 4YMWA 3H2YA 3FGNA 3SJBA 4OQXA 2V1XA 3I73A 1GUAA 4E03A 2WHXA 1B0UA 2IYZA 4M1YA 3UIEA 1OHHA 1MO5A 4U02A 4LGMA 4GFDA 4PZYA 5EP1A 2E1RA 4PXAA 1T91A 5DE3A 1TEXA 4KBFA 3SE0A 2V9PA 1KJZA 2HJGA 1W36C 1KKLA 1VKJA 221PA 4TT3D 4ZO4A 3F0TA 3P20A 3V9PA 2XTMA 3HR7A 3PEUA 4A9AA 2OBLA 3ONWA 2QA5A 4DLWA 5KSYA 3QXCA 2SHKA 4Q19A 3KJIA 4BFVA 5B64A 2H17A 2IS4A 4F4IA 1XZQA 3VFDA 4PPNA 4OHYA 2ZE5A 5C18A 1SVOA 4X8LA 3GCGA 4B3DA 4F93B 1E1RA 3U4QB 3PEVA 3BOSA 3RSLA 2GEVA 3LY5A 1AZTA 2B92A 3VR6A 1T4GA 5FTLA 3FKSA 2QPAA 3FKSD 3ZVMA 2WSSA 2G9NA 4MYHA 2BIFA 3QKRA 2BCJQ 4MYCA 4LJ8A 2QP9X 2IUTA 3NIBA 1E94E 1VCMA 2A5GA 2MMGA 3VX3A 4BFXA 2WZQA 2QORA 2PLRA 2VEDA 4A2WA 3HPQA 4OHZA 4I1OA 3R8FA 3DVLA 1G8GA 1GDDA 1KMHB 2EFHB 2YWFA 621PA 5KNDA 1ZU5A 2FDCA 4A4DA 2IXEA 3U6KA 1EK0A 1WF3A 2RGNA 1W5TA 2F1IA 1XX6A 4ITRC 2FZ4A 5E3HA 1VDZA 2HLDD 1U0HC 1ESMA 4LJAA 4K81B 3TMKA 2VP0A 2CE7A 1AS0A 3IKJA 3MWKA 4B2PA 4YMVA 3ECCA 3FMIA 5CB6A 1U98A 5FUXA 3SZRA 2W6JA 1KO8A 3T1TA 4JL6A 2BM1A 4GBMA 2BHRA 2FFAA 4IOMA 1XEWY 4JJZA 4P0TA 5F9HA 3I5XA 1OV4A 2RMKA 5AUOB 5BXQC 3WXMA 1ZBDA 1ZM2A 1N25A 1Z6YA 4C3ZA 2IYLD 3ADBA 1SXJE 1DAKA 1KJYA 1W2HA 2GA8A 2JLVA 1AZSC 3P27A 2OFXA 5FUWA 3T15A 3PQCA 3QF4A 2IF2A 4KSCA 3RS2A 1W2GA 2AD1A 3HU1A 3ICEA 1R0ZA 3GLFA 2FGJA 1G8YA 4A8JA 1EX7A 4FXPA 1KI4A 4Q9IA 1RJ9B 4TLDA 3B1WA 1CTQA 2RB4A 3R7WB 1J70A 3EC1A 4M1KA 3WP0A 4RVCA 2DFNA 5JBQA 4NH0A 1JR3E 2R62A 2QUZA 2ODBA 1Z2AA 1RRGA 1MO3A 2F1JA 4OI2A 3SJZA 3T5DA 1YE8A 3U3MA 4B2IA 5FR2A 4CEJB 3IUYA 1WXQA 3SQWA 2NO7A 3EIHA 5FTJA 2RGBA 4XTCS 4LBVA 4URUR 4LUCA 4DLXA 2ECKA 2Q0HA 3I1FA 4NYMQ 4TQ9A 3IILA 1JECA 4LX0A 3U3KA 5FOSA 3FMPB 3T34A 4QNMA 1EFTA 3SEAA 3ZDQA 3IO5A 3GLIB 1XD9A 1E2HA 3LQQA 4BLSA 3FTQA 4RD0A 4AIIA 5JJLA 3OEEA 3S1AB 4TZ6A 1NJGA 2N42A 2X8AA 3RSOA 5JECA 1IONA 1NIPA 1KI8A 3K0CA 5KDOA 2WJGA 3MJRA 4FMBB 3QUSA 1II0A 1P75A 3P4YA 1E4VA 4U7DA 2D2EA
chains in the Genus database with same CATH superfamily
3H1BA 4XQ9A 3CCBA 3ZE8A 2CWBA 4CQMA 4BNGA 3L1KA 1RYNA 1NNJA 4WKCA 1JDSA 3IPLA 4X7RA 1T4CA 3RIGA 1YHNA 4MP6A 4XGKA 2BKUA 2PQMA 3SDSA 1AMNA 3M0EA 4UUMA 2HWYA 3BXOA 3L6EA 4NCNA 3WSWA 2OYSA 3BRWA 4B6OA 1NVAA 2WB4A 5BWOA 1Z4MA 3D0OA 1AKEA 2YKGA 1MABB 3QXSA 5J2TA 4CMIB 4RY0A 1G3UA 1SN7A 1KI9A 4TXHA 4EO7A 1VBFA 2CXQA 2HSGA 1K9VF 2ZYAA 2RC5A 4R2WA 3B2EA 1UPCA 2X6RA 4I8IA 2QN9A 4LXIA 4ZHQA 5EE1A 4WCFA 5I8ZA 3O3MB 2GJ9A 1YONA 1YLAA 2REQA 1PUIA 1GP2A 3LLCA 3B1KA 4RZSA 3ZDCA 1UC4B 3A28A 1J7KA 2OZLA 3W2FA 3QUAA 2XNDD 1EVQA 4DB4A 1ADYA 4UNIA 1XG5A 4Z6YA 5EI5A 4JB0A 4JU9A 4DGQA 3P9YA 1R8XA 4IIXA 1JFVA 2PFGA 1P4JA 4LGCA 1R66A 2GXQA 2R1VA 5EIAA 3VKGA 4UZSA 3TVTA 2G9RA 2GF9A 1PTKA 1VSTA 2W5UA 4ZI5A 4X62M 3ZIAD 2PLFA 3T41A 5E0KB 2C94A 1WZNA 1Y81A 9LDTA 1K1EA 5T4EA 2V6BA 2Y1KA 1P17A 5AM2A 1JQJC 4RKRA 3RVKA 5AHXA 4QDTA 4TWIA 2ZRIA 1JEAA 1FNCA 4FT2A 2BY4A 4ED9A 4NI5A 1XCLA 1Y1KE 2PZMA 3E15A 1JR3D 3UGJA 3E7WA 5C7YA 3S2EA 2EW1A 4NE7A 3FLBA 2O7RA 3FIJA 5A0TA 2V9ZA 3IEUA 1PGPA 2CL0X 1V6AA 1UWKA 4CIDA 4MQUA 1R9MA 3A10A 4PQGA 4L5AA 2L42A 3SQDA 2JIOA 5DX0A 2E55A 4IXWA 5C4MA 2G77B 1TDZA 4KI0A 4C0AC 1I0IA 1QU3A 1E9VA 4QDJA 2NSDA 1D0VA 4FYHA 1JPJA 3N8HA 4NOLA 2GBLC 3QXHA 2JLBA 1RWWA 4LXGA 4Y2GA 1XHBA 3D5TA 1SWVA 1DOHA 1BH6A 1XL1A 4D25A 2HFKA 3SHQA 2XWPA 3M4XA 3DOJA 5JRZA 5GOZA 2QT0A 1QAOA 3MFQA 4DT1B 2J30A 2YUTA 1Z36A 1E2EA 4MW2A 4CKYA 3KB8A 1RMTA 2Y9PB 1ODLA 3T9BA 3SQOA 2YHBA 4JYZA 1Y8GA 4HOYA 4JLSA 3WX0A 5L8RF 2HJ9A 1KAGA 4WUTA 4DBLC 4MCAA 4QEDA 4X65M 4OP3A 2O05A 2F3SA 3RGSA 1PT5A 1UOEA 2BMJA 1B43A 4WFKA 3OD5A 3R3UA 2VNSA 1ZOSA 4MVWA 1DGHA 3RVSA 1DQSA 3JQQA 1FJGB 1V9CA 1NVEA 4HB3A 4NU0A 4S24A 4ZYWA 4BL5A 2JASA 3FW1A 1ID1A 4D8TA 3QKUA 4D6XA 1OC4A 1DC3A 5MFPA 4C0HA 3HJCA 1JRLA 4PQYA 2ZYHA 1B6GA 4TMVA 2KS6A 3OLZA 3NAMA 3DAOA 1XMQM 5EIXA 3KLBA 3DO6A 3B6ZA 2GAJA 4KXFB 4RBNA 3UT6A 1MLDA 2B1GA 4ZMSA 1RQ2A 3VR6D 3NBKA 1A9PA 1R74A 3A4VA 4RVNA 3WB2A 3G59A 2C2KA 1YRWA 1ZM9A 4DBLE 2OFWA 4B4UA 3ST7A 1Z0KA 4PX3A 4BPBA 4L0DA 3D7LA 4ALKA 4P6VF 2O7SA 1MOSA 2B8TA 1S9DA 4MH0E 1U6IA 4D3YA 1N2OA 1CY0A 3FLEA 1AT1A 1H4TA 2GUGA 3KQQA 4LXQA 2HDHA 3BL5A 2P40A 1DBRA 3RRJA 3H6GA 2XOEA 1PGJA 3WXBA 3JQ7A 2I65A 3E0XA 3OOHA 3NMUF 2C8JA 1UDXA 4EARA 3K9WA 4NCXA 5HS4A 4E7PA 3HYSA 2CN1A 2GD6A 2Z8ZA 3T7TA 2LPMA 1P33A 3OEED 2HV8A 5JAQA 1OKKA 3FJ1A 5I9SA 3VNUA 3HWWA 4HGQA 1WPRA 4NZPA 5CFPA 3OTHA 3VJKA 2WW8A 1X0VA 4R2IA 2V59A 3K6KA 3E48A 3QYEA 2HHAA 3S2YA 1ITZA 4MDYA 2ZSUA 2YWRA 1GILA 1L4YA 5IJ0B 1B73A 1RD4A 1TZJA 3FE3A 2YHIA 1MCZA 3R7WA 4M0MA 2JH8A 2EIHA 1I10A 2PPVA 2DBZA 5AUQA 3BTUA 4MA5A 3I09A 1GNRA 3MCUA 3SIXA 5HZMA 5CVDA 1IAVA 4KQHA 1UWCA 1R4ZA 2DR3A 4MMXB 1G6KA 4DIMA 3CEHA 3AL0C 2R25B 1NASA 2Q28A 1C9JA 1KNXA 2FZVA 3O90A 3SKYA 4X71A 2XZLA 3R3XA 3CLUD 2OO9A 5ITXE 4PSCA 2ZBGA 1P1RA 4MB2A 1XKLA 4GZ3A 4L22A 4YJFB 2L7IA 4W5OA 3ESXA 5IS2A 3KFLA 1UOQA 4Z54A 4QVKA 3AZQA 1YQGA 4PLTA 2PX8A 1FLAA 4IFEA 5CYPA 3O4JA 3CF6R 3NHLA 1XMVA 3ZLVA 5KSOA 5LFAA 4RH3A 1EDBA 1XZNA 5DBFA 1XF1A 1Q1NA 4KWEA 4YMIA 4E1BA 1ECCA 5C34B 5FLYA 1OFTA 3KKPA 5AJTA 3OETA 1MABA 5IZ4A 4PCZA 3I34X 3U3OA 3I32A 4G3OA 1AE1A 4QBTA 4QNNA 2ZT5A 1LX6A 3DR5A 4BVAA 4J0DA 3ZY4A 4IM7A 1X7DA 3BGWA 1P6XA 1SXPA 3T54A 1S89A 3OHSX 3L77A 3W1WA 3B52X 4YV7A 3WRXA 4UHFA 1E1MA 1PDOA 1C50A 3S28A 3LJKA 3KJQA 4DM7A 1O96A 3S27A 1W5BA 3GW8A 2NWQA 1GZ5A 4AJNA 2CEKA 4OHXA 1EM8B 4INZA 2GZHA 1VGVA 4BQSA 5HKBA 2IYEA 3M4JA 3GNSA 4XK8F 2VO1A 2IW1A 3U37A 4MICA 3C5VA 3OJFA 3ENQA 4ND6A 1Y6GA 3ZWMA 1QPGA 1Y34E 5TF4A 4Y6QA 5JSZB 4HAOA 3I58A 5DTQA 2CJXA 2IU0A 2BSXA 4RMHA 4BNLA 5LMNB 4UCWA 4UE3S 2DFVA 5SZJA 3B89A 2D0OB 3N5CA 5NLLA 1TQHA 4UQLA 1ZIOA 4U2EA 1TYBE 1E3IA 3MHVC 2G9ZA 2IHVA 3Q2KA 1ZNYA 3D8LA 3PYMA 3SXJA 3RTEA 3C5WP 2JEOA 5GGYA 3RSGA 3WHPA 4FYKA 1YSCA 3X1XA 4WVLA 5CFNA 4E0BA 3R3SA 3T3NA 1U2DA 1PJBA 5JS6A 3DG9A 1N1EA 3G23A 1Z59A 4Q1DA 3N28A 4ZZ1A 3K35A 2CDRA 2CWDA 2HYDA 1GZ4A 4AZFA 2LDXA 3MJ4A 5K8UA 1CJSA 3BE6A 3DGFC 3TH5A 2TSYB 2DQ4A 3FZGA 3R7FA 3K72B 4JA0A 3H83A 2K6GA 5DHPA 2ODQA 5HF6A 1RYDA 1RXYA 4RELA 1QYVA 4AQ7A 4Z9YA 2CVHA 3OOSA 4FFVA 3VI3B 4BZZA 4LXTA 2PYIA 2I4MA 1T4MA 3QKRB 1QG0A 4NLLA 4DT1A 2PO5A 1Q22A 3QU5A 4LF9B 2JATA 3MERA 4FWGA 3KP0E 5EJMA 2WSIA 4DUGA 4Y9UA 2P3OA 5BMVF 1LDNA 2VDVE 2F59A 3BBLA 1Q11A 1T4BA 2IUSA 2DFPA 3N53A 3MWEB 4S04A 4EFKA 1OLUB 3GPBA 3D31A 1ACMA 1HYBA 1C9EA 3OKAA 5BPHA 5CM9C 4LECA 2CXRA 2DP4E 2ZITA 4NMHA 2QLJA 3DD1A 3UOAB 5D87A 1S1MA 3L07A 2HF7A 4DLBA 4YCAA 3HVRA 4X1YB 1WDKA 5I9NA 1PVOA 2GK3A 5BNIA 4YR7A 4E88A 3OF5A 1MKYA 1ZFNA 3NNDA 1XHEA 4O3FA 1NP7A 3D3NA 3W3AH 3KLPX 1F8YA 3P9QA 4HZUB 3QTTA 4CKBB 2F8SA 1E1QD 4I1SA 3HJQA 1MQ8B 5LOVA 1L2CA 3NPAA 2I1WA 2QM0A 2Q4DA 2ZR7A 3WYNA 1SC6A 4B44A 1SD1A 5E95A 2EHDA 4IMIB 1Y98A 1G7CA 3KWMA 3GFSA 1L1RA 4UBLA 1TC1A 3OE5A 3VPFA 2A9OA 4JX9A 2OBXA 1FZTA 1BSVA 2QJFA 1QAMA 2IK8A 2RHWA 5G0UA 4GUAA 2FG7C 3IMKA 2D1TA 4X61A 4A92A 3RQIA 4ND2A 4IZ6A 5DLYA 4Z4EA 2MYNA 1MAAA 4KZKA 4FE7A 1SHZA 1EGAA 3ACBA 3U7JA 1SHLA 3ZWAA 1PJIA 4FDAA 2YWXA 3MJCA 1GWNA 4RK0A 5C9ZA 4KUHA 4BFZA 2H8GA 2HJSA 1MB9A 3CLTC 3DZGA 5LB4A 4BLUA 1E5DA 5DM2A 5EJCA 4Y2PA 1RT9A 3SKXA 5C80A 3JZDA 4DMRA 2NV2B 3TMYA 5IJ0A 3PR3A 4IKOA 1KYXA 5JV5A 3BB3A 2TMGA 1PW5A 2IHYA 4QUAA 4ALJA 2AC4A 5B6JA 1LSSA 3JARB 2BFOA 5JVDB 5A5GA 3MTIA 5KNDH 1F4PA 4MV5A 1GG2A 3GJZA 1I4OA 4RIFA 1C3EA 3V8EA 4EEZA 4GH5A 2PX2A 4IQ8A 3C3YA 2A84A 4CDGA 2I8CA 1LTKA 2PG3A 1G6HA 2BRUA 2QMEA 1RM4A 4LJ6A 4NK4A 4PSVA 3C0KA 4DKXA 4C4SA 5K3FB 2H1IA 2Q9UA 2X6QA 2C1XA 1SXJB 4YJFA 3RT9A 3PC4A 5DGCA 3V46A 1BMFA 3ITKA 3MPUA 4PCVA 2CT8A 4CMHA 2A0WA 4EJ6A 4QTYA 3GUCA 3DNMA 3QA9A 4L78A 1I6LA 1Z39A 2EGGA 2P2DA 4P1ZA 2FNAA 3IVAA 3U62A 4C7KA 4QPPA 2ZDQA 3EGIA 4AECA 3CT6A 4UOEA 4PLFA 3VAZA 3EZ2A 4NXNM 3QVVA 2VDPB 4G0ZA 2W6ID 3T12A 3IJ5A 3M49A 2CWWA 2NNLD 1IUNA 5CLQA 1HI9A 2HEIA 2AOUA 1JH9A 1EBFA 4H27A 1H1LB 3IAM1 4P33A 3GZTB 3RPEA 3O8OB 4L08A 2VXYA 1MNQA 2IYAA 1YFJA 3WZ2A 4BRUA 1Z68A 3SS8A 3DDUA 3I2JA 3D2AA 3NXSA 4LYDA 2VNAA 3ROZA 4KTTE 1NAHA 4S2UA 3MLBA 3EAQA 1ZWLA 3CLSD 3HMQA 1ILEA 2EGHA 1HURA 4F56A 3RRFA 4NHOA 2XQFA 1K5DA 1VJGA 3G88A 5DB4A 2HX1A 3IV7A 2IH4A 4E4YA 2NXNA 1YQQA 2VHYA 1EM8A 5LUBA 3FNQA 2BGRA 3G02A 4X20B 5BQFA 1VMAA 1AMOA 3MEQA 3CIOA 4MVJH 1E9FA 3E8XA 4BFUA 3LVBA 3DFMA 3WK5A 5KJ1A 1GT91 3HXKA 2FQWA 4YCNA 4A03A 1T6OA 4MUKA 1SOWA 2OXIA 1Y6JA 4DIEA 2W83A 5JSZA 1D4AA 4Q37A 5F9MA 2FE8A 4RV4A 4F8EA 1SR8A 1NW7A 1DT5A 3E2MA 4LZPA 4E5VA 4P4NA 4WJKB 2AN5A 4A23A 1CUZA 3JQ8B 3LFTA 2ONJA 2VRWA 1COZA 4LMAA 3KZKA 4CDMA 1MQAA 4LJLA 4XSGA 3CW9A 1ZSYA 4F4CA 1JLMA 2UVPB 3AK4A 5BPFA 1G17A 4S35A 3FWYA 2HTFA 4X95A 4J91A 3Q7RA 4KQXA 1R0KA 2QD1A 2HADA 4J0GA 1V7CA 2IU3A 2D62A 4RLFA 3HI4A 3IIIA 1Y7IA 4B08A 1QQ5A 4JR0A 4AY4A 3KKKA 4OP2A 4Q4LA 1XDBA 1XZEA 4E51A 4RIIA 4WK0B 1BHJA 4NV0A 4BO5A 3IP7A 4ZMBA 4C4PA 1UQRA 2WR8A 2FN8A 2AHOA 4CFYA 1WB5A 5ALEA 2HWXA 4W9RA 4DQ0A 3ZK9A 4GXTA 2C31A 3RVPA 1W36C 2VDBB 1YACA 2YHUA 3IE2A 1ZLYA 3M83A 3KWFA 5IM4A 4OHYA 2GZRA 5KWSA 1PTJC 2JEZA 3FKSA 3BCSA 3DPSA 3EVZA 3QKRA 4B8ZA 5J1SB 1NQXA 3ZCUA 4MIOA 1ZU5A 2IRWA 4ITRC 1VGRA 1UMKA 4K81B 5TR9A 4LFCB 4P0TA 2PKXA 4B6GA 2RSLA 1N25A 2YIVX 4C3ZA 3MWEA 1DAKA 1OLUA 5DNCA 3QSGA 3W4KA 2FGJA 3TEJA 1VZ2A 3EXHB 1KIFA 4MVJP 3COZA 2C5AA 1EVEA 5H3CA 2WYUA 4FCCA 2NO7A 4X1YA 1HE5A 3T5CA 2IEGA 1QLHA 4TQ9A 3IILA 3E58A 3SEAA 3ONVA 1X42A 3SPXA 5HG0A 3RADC 3SGLA 1MVLA 4W6QA 1QZTA 4X93A 1H9CA 3COYA 4K7JA 1NF2A 2POQX 1C4OA 4HZUA 4CKBA 3PUWA 4JI7M 4NOMA 3AU8A 1X1RA 3UHJA 4M21A 4AW4A 2XTJA 4YLEA 1HPLA 3L43A 4TWAA 1E89A 3A42A 2IZOA 3L84A 1V7QA 3M2PA 3PT5A 3W79A 1L5ZA 4XR4A 2NT4A 4YJ2F 4C03A 3PTLA 2DU8A 3LDGA 5GIOE 3R7BA 1IEXA 2DR2A 4P80A 5F35A 3S40A 2JFOA 3ZIUA 1ZR2A 2ZJAA 5A5EA 1ZVQA 3B6IA 3V55A 2M5ZA 3I61A 3GD5A 2P9EA 1NLMA 1WD7A 3QPCA 1S2GA 2IDKA 3C4VA 4PFQA 4GDMA 2N46A 1PR3A 3HZHA 4N8DA 4LF5B 2PR7A 4HGPA 2PCJA 3RYTC 2I5PO 5KJEA 2CXNA 4PGMA 1OFGA 1P2BA 1FFBA 3NT4A 5L40A 2RGAA 3MMSA 4G1UC 4NBUA 3EGOA 1W4RA 1MBZA 2G1PA 2NTVA 1KDOA 3V1LA 1OI3A 3OI7A 4IRXA 4PQFA 2EKBA 1DKLA 5DYGA 1G4AE 4B7GA 4XAQA 3CZPA 4DR2B 2CZCA 3L49A 5D5HA 4CBVA 4TS3A 4DIUA 3PEFA 3ZNPA 1G98A 2Q3HA 4HWPA 1OXKB 3B13B 4TQAA 2YIMA 1QFJA 3L0OA 3JARA 1S4QA 5JVDA 5F7XA 5B6IA 1ZVVA 2GJAA 3RUPA 3DMYA 4GZMA 5I4CA 3QFCA 4PW0A 1LSJA 4XH9B 4M9SA 3NBUA 3MTAA 3KEQA 2PZAA 3AJIB 5K3FA 3PBKA 2CK3D 4B3CA 5F2OA 4FHFA 2PGDA 5GADl 4D9JA 4B74A 2R3SA 2XI4A 4CIVA 1SXJA 4H0NA 1V92A 3DE6X 3NATA 3RIXA 1G8KA 4KLCA 3VR4A 3ZXUB 4PGAA 5L6LB 5FT9A 4OKNA 3LM8A 4LOJA 3ZE2B 1XA3A 4MUFA 1DRJA 3X44A 1SBNE 2ERCA 5CCXA 1OX6A 5AI6A 2HW8A 2FQYA 1XRRA 4N76A 2CNWD 4A6EA 4CM5A 2C3MA 4F86A 3HFRA 4O4IB 4DLPA 4F4FA 3GVCA 1G8PA 1Z0IA 3BA1A 1ZJ4A 5DULA 2OY0A 1QWOA 3BL8A 5EJ5A 3O8OA 3OJWA 2CV2A 1TTPB 3LE8A 1RIFA 2GCIA 3P4XA 1QE3A 2BE9A 4E5KA 3K1TA 3K9FC 3SASA 4XX1A 2ACKA 3FB1A 3IIMA 1ODFA 1C8BA 5BN4B 5CVTA 1V0JA 1JSCA 2QU8A 4GKVA 3DTYA 3UMVA 2JLXA 4NE9A 5D5QA 4EY3A 4X20A 3MNFA 1C7YA 4ZQCB 3OESA 3QVMA 4PQEA 1WQ1R 3LUPA 2A30A 5D1HA 1N33M 1U6JA 3VO2A 5KOIA 1OGIA 2PWBA 1YL6A 2FSPA 3KDSE 3MVEA 2M6SA 2XLBA 4M8IA 4R4JA 2FU5C 3AV0B 2WUVA 3WYDA 4XDGA 5C1BA 1NZJA 3UHFA 2XTZA 2A3RA 4J9VA 1T5IA 3N2IA 1BVRA 3AYZB 2WUGA 5CUQA 3JQ8A 4G37A 3WLHA 4K46A 1R7RA 1XVTA 2HOQA 3SZOA 2AH5A 5LJLA 4KQIA 4YUWA 2O8DB 1SU7A 1GV0A 1CF9A 3QY0A 2HKIA 1K66A 3BGVA 2UVPA 4N7JA 3ENVA 1SHKA 3MTQA 3T5AA 2QSZA 3O91A 3MLEA 3ILVA 1LC0A 2EZ9A 2BN4A 2DOKA 5SZIA 4OBXA 4AS3A 2W22A 3DBLB 1U9CA 2J6IA 3KYBA 4Q02A 4JB2A 1RPNA 1J00A 3O0DA 1QBGA 1XYYA 3TSAA 3MAAC 1V1JA 1IMOA 5CDGA 1U9ZA 1O97D 2VZLA 4M86A 4M3NA 5D85A 4I81A 3CBGA 3SBEA 3ZG6A 1X2BA 4FUTA 4W9MC 1HG0A 1C41A 3DPUA 2CE2X 3BRCA 3QEBZ 1GKYA 5HWSA 4B3MB 5I7AA 4IDQA 4L4XA 5EJEA 4NBVA 2QGZA 5F5LA 3U4CA 2B4YA 2AMJA 1Y5IA 3B1VA 3RV4A 1GTSA 5IEJA 4WI1A 2I6GA 4GVLA 3SLGA 2AXPA 2D74A 3WE7A 1EB9A 1K7XB 4I6JA 4YECA 1ISRA 3T94A 1H42A 4NAVA 3P97A 1P9RA 3G2PA 4PYMA 4RDHA 5IREB 1DAMA 3Q3VA 1O5TA 3ADKA 3GJ5A 3KYDB 1RDFA 3EXHA 1U0SY 4NZ9A 7GPBA 2I2WA 4GOND 3LW5F 3ZD6A 3K0HA 1S7CA 2IBMA 2D3WA 3P1JA 1LF5A 4FGSA 1RLIA 3I5UA 4U9UA 2J0SA 3VDNB 2FX2A 2GM3A 1K06A 3UH1A 3DXFA 2G80A 2YJZA 2O52A 4KSYA 2KSQA 1N8SA 4KNWA 3PXCX 4OOEA 4O2AF 3QYJA 1QNLA 2REQB 3SICE 3SXUB 3SYKA 3AB7A 3C15C 5CU7A 4BUZA 3GOQA 4EZBA 3TIIA 1Q84A 3NGXA 3A25A 5KWVA 4MTCA 2P62A 3NWJA 2DWMA 2PL5A 3WLOA 2V0GA 1YJ8A 4JEHA 3K70B 3L04A 5L7WA 1CUBA 1IUPA 4R8MA 1EWRA 2JI8A 4CE6A 2P0AA 4XVQA 1WUKS 3SHFA 3DWEX 3OT4A 1EBUA 5F3DA 5DBHX 4EG8A 1IFXA 2B3TA 4W4TA 2DY0A 2VLBA 3NETA 2CJWB 2DG2A 3G2MA 4DUYM 1FFSA 2EIXA 1N34M 1UIRA 2ZGVA 2DECA 4Q01A 2CDCA 2C4NA 1DX4A 3SQLA 1OILA 5B1YA 1S2IA 3IUBA 4RHXA 3CJTA 4OU7A 2Q3JA 5HXAA 1HFWA 1H5NA 1H6UA 2O59A 1P4RA 1PT7A 2MH8A 4D8WA 1H6AA 4HEQA 4BNKA 3G0HA 4P5EA 4YQZA 2NO6A 4QJ4A 4UARA 2A0UA 4XVHA 3VKUA 1P3DA 2VH5R 1M8KA 1ADJA 2OTCA 1Z4NA 2Q8NA 2FPLA 2GAFA 4WNAB 3WHIA 4PCUA 1OT3A 1DKNA 2H92A 2XWJI 4BFYA 3B5EA 3VV2A 4Y0VA 3F8TA 1K4MA 4M9ZA 2QOEA 4FGWA 2QDXA 4FYYA 4ID9A 3K9PA 1QX4A 2BBWA 5C53B 4G9GA 3V1YA 3OAAA 2NPFA 2PMWB 4PTZA 2JA1A 1JLHA 1F06A 1XVLA 4OX9M 3VNQA 3OX4A 4JL5A 5ALZA 3G9TA 4R6WA 2ZIAA 4ML3A 1FYDA 1WKVA 2FFBA 4BMZA 4R9UC 2OK7A 4QULA 2GTHA 3U9TA 3ITEA 2B94A 3MQ4A 4Z6KA 2KPOA 3IDSA 1E79A 1M5RA 1TAUA 3PCTA 1CUIA 1TI7A 2HLPA 4CQNA 2PFSA 4BNFA 2I91A 1Y7HA 1WHSB 2FTKE 1NF8A 1IB0A 4KXMA 4W1QA 3HR4A 3L01A 4WXPA 2GCOA 3PE4A 2NQ2C 2R6R1 3K20A 3VTZA 3ROPA 3WI7A 4DNOA 5F1KA 4QFBA 4DA0A 4HVTA 3QLVC 1BC5A 1CF4A 2POCA 3LPCA 4X45A 4YNBA 1PJTA 1BZYA 1FMFA 2RAVA 4BX9A 5F1OA 2OV4A 4PG5A 4BP9A 1V5IA 5KCZA 1FU7A 2QNIA 3NANA 4O4IA 2AKAB 1XMIA 3ZNQA 1RM0A 1UMBB 5CVUA 3QLJA 4I1UA 5LQMA 3R7NA 3S44A 1OAOC 1HK7A 4YY3M 1E8NA 1W4LA 4EHKA 3DZJA 3EUAA 4KE9A 2AF4C 4QLOA 3V48A 3URKA 2OGZA 2SNIE 4LRXA 2PT5A 1S2OA 4WY2A 3V8RA 5BN4A 3C8DA 3NV7A 3PFIA 2FLKA 3LVWA 4GP7A 1XL0A 1PQ4A 3ADPA 5EZ5A 1JJBA 4YRGA 2NVBA 3NAZA 3FFAA 1SMKA 4ESEA 1L1ZA 1OBVA 4EFNA 1GTMA 1ESNA 1EKXA 5HF9A 5AVZA 4KXNA 3H8JA 2GPSA 4RTOA 3I01A 2GNPA 5JXIA 2GA9A 1T26A 3NBAA 3AV0A 5JJCA 3GLFB 4AO7A 4M9CA 4D4MA 3OH8A 3CEMA 2A7QA 5B12A 2JARA 1YU9A 5B3KA 5JZOA 5B7PA 4L3WA 2FSVA 4RXTA 5JNTA 2VPIA 3OMLA 2JY8A 1HNZM 1KVUA 1MGOA 1B76A 1H2HA 3IAS1 1FSGA 5KYXB 2O8DA 3A1EA 5H3HA 3F1KA 3S8MA 1KEZA 1UC5B 4Z0TA 2WE7A 4AKHA 2X7JA 2X1MA 4NRVA 1QVRA 1YRYE 2IYPA 3DBLA 3ZE6A 4DMGA 2Z5FA 1CR0A 1YA8A 5E2BA 1QCCA 4CGZA 3NOQA 3JQAB 2E0IA 1KKUA 1YD7A 1GO2A 2OEPA 4LTMA 2V6GA 3HBMA 2OILA 4Q0MA 1NKTA 1HEUA 3SQNA 3V7WA 2O8NA 1Z5BA 1IY0A 2WRZA 1FXWA 2QAIA 4YH1A 3UANA 3ZTWA 1SK8A 2EARA 4F5DA 1B3RA 4GS5A 3V4PB 4XM2A 4LGYA 4WLVA 1O7JA 4JUAA 3WGGA 2IEIA 1QB7A 3DT8A 3VSDA 5FO1A 2VQEM 1H2BA 5H82A 2LXEA 1P19A 3NHSA 4OAPA 2OVFA 3QTLA 4UHKA 4CR7A 3V76A 4H1WA 3W6PA 3ZY2A 4D0RA 4KGDA 4CR8A 4V38A 5LVAA 4BB5A 4DCNA 5FUVA 1GLNA 4HNHA 4CM3A 1M2GA 4U2GA 1YZHA 4XCQA 4EITA 1QF9A 4DMLA 2LTUA 3DYBA 1PWEA 1LBSA 2I4OA 3KG2A 2JGRA 3BK7A 2FMXA 3IIJA 5LBUA 1A9YA 5H9WA 3B1FA 3P0EA 4Y2XA 3LC2O 3DULA 1UK9A 4UXJA 1ADGA 5IASA 2TYSB 4L8GA 3KYDA 1ZMBA 1YC5A 3U7QB 5A3RA 3T7IA 5J5AA 1MX9A 3HCOA 3ORSA 1N9KA 4HLUA 4WBNB 1N4DA 3NDBB 4Z8XA 4Z0HO 3BICA 4MW7A 4I5SA 2C1ZA 1G20E 4LRWA 3SVTA 4G81A 4NQRA 3VZBA 4RM2A 4PZCA 3TQTA 3KT8A 2WTXA 1MJGA 1W47A 3L8DA 4ZT2A 3VU0A 5E4JA 2VDMB 1IXKA 1B1AA 5BSMA 3T6KA 2P9QA 1WUYA 3SXUA 5CDFA 4V0NA 1PNQA 4BLWA 1O96B 1KEVA 5DW3A 1Q83A 5EHQA 4CODB 5C5DA 1J2YA 2AWNA 1R4AA 3VR5H 3EOAI 5J47A 3LK6A 3WZLA 1K6JA 2VOJA 4MV0A 1N6KA 1VBKA 3M6VA 1DCTA 1TUBB 1FPQA 1WUJS 2GKSA 2EDAA 3FPGA 4C5AA 2JIMA 2X49A 4D41A 3EQ7A 3STWA 3TDNA 1BKSB 3KKEA 2XCIA 4JGIA 2CDNA 2CJWA 4ZOEA 3TLXA 1E3EA 4RDCA 1NBWB 2ZB7A 3DLCA 4BB0A 1TMGE 4OFBA 3KHKA 2RGXA 1BEUB 1SXHA 3WQHA 5MF6A 1DBSA 3KOYE 1MENA 4ZVNA 4UFOA 5CFZA 4Z86A 5B3JC 1GV1A 2AJBA 1LPNA 1T8TA 2SKDA 4DMUB 3FETA 3WC4A 3WWOA 4M0DA 2IV2X 1O3YA 2VWGA 4CVNA 4DCJA 1SCNE 4QELA 3HX3A 3A3PA 2I2DA 4TKZA 4WNAA 3CLHA 3F3SA 3V4OA 3V4SA 4QARA 2Y3IA 4HDQB 2RGRA 5IT9A 1DS6A 4HC4A 4L8RC 5T4FA 2HBYA 3IJRA 1PEAA 4IDHA 3IAM6 4EG3A 2P4SA 1M8FA 3DXXA 4JT4A 1VJCA 1TYAE 3G2QA 4NFLA 1UH5A 1YOVB 2QX4A 4YP1A 4NU8X 4BDSA 4MGKR 3GRVA 1K0UA 2GX6A 3LFHA 2OG2A 4MARA 1PK8A 1ZXLA 1J42A 2D1FA 2IY9A 3BWEA 4Q3CA 1TJNA 2ZS7A 2JD1A 2GHRA 3TTVA 1EYZA 3TMAA 3HP1A 2ZB3A 1JP7A 1WHSA 2ILVA 3HJFA 1ZBQA 3IRVA 3KXEC 3I9LA 3ROMA 1H2ZA 5LXTF 5JAPA 1EJ6A 3ZZNA 1P5HA 1AF7A 5KPDA 3OC0A 2CXOA 1V2GA 4HGNA 4Q12A 1DC7A 2WSEF 3H5VA 1GRRA 1CU1A 3N9IA 4PLGA 1HDXA 2DLDA 3L93A 4TV9B 4F4JA 4KJXA 1GOTA 1VYTA 4HUTA 4KAFA 1H8HD 4Z4QA 2Z56A 4KNVA 1DSSG 2QLLA 2UXCB 1UMBA 1X3LA 3BT7A 1TM5E 1N2SA 2Q8PA 4Z7NB 3OMWA 2MSLA 2ODTX 4Q82A 4LGMA 2KMLA 4GFDA 5DLEA 3G1TA 4XWWA 4ZQIA 1YHYA 1NM5A 3DE7X 3K8OE 5GOTA 4A9AA 2C0PA 2HBZA 5FRDA 4U8GA 4GWGA 1TIPA 5LOVB 4PX5A 4TXNA 3Q1LA 1P81A 4MIYA 2Z5GA 2G9NA 4G4QA 4HQ0A 2HMTA 3R2JA 4BFXA 5SV2A 4DR6M 4I1OA 3RF7A 1UIMA 3DLHA 1F1JA 3H0EA 1GQRA 1ZGGA 2JRLA 4M0PA 1W5TA 2QWXA 3M3HA 2G36A 3IBCA 1JQAA 3EGVA 4DR5B 3MWKA 1EQUA 2QRMA 2OCGA 1T9GR 1Y4SA 2DZLA 1QZEA 5D8DA 4KI7A 4H6WA 5EKXA 3ADBA 1AZSC 5EFOA 3GLFA 1FIUA 2C4VA 5MGNA 2G76A 3P94A 4TLDA 2XNKA 4NRWA 1UMCB 2DFNA 4NH0A 4FGUA 1QTRA 2WT8A 4WLEA 3U3MA 4XTCS 4LZWA 3EWNA 2ECKA 5IMSA 1EFTA 2HR1A 5JYEA 4HP8A 1PR4A 4XGIA 4BLSA 1DFHA 2OG1A 5KYXA 1VI6A 3GLKA 4XRGA 1UP7A 4ZU3A 2Q7DA 4PSUA 3L46A 3P4YA 3GH3A 3PNQA 3BD6A 4AN4A 4AJLA 1P60A 4UVEA 1N8NA 2QRKA 3R0ZA 3K2BA 4CT5A 4G0OA 1U5BB 5AOVA 4IPTA 3AESB 3IV9A 4G84A 2VJBA 2KI5A 2V7XA 2BJHA 2IHJA 3SM9A 3JQAA 3IB3A 3QV2A 2FN4A 2IS2A 4ZAZA 3PNVA 4IAOA 1A9RA 3U6EA 4L28A 2OSVA 3EIXA 4RVGA 1RTKA 1SA0B 1KVRA 1R1DA 3H99A 1UKCA 2HMAA 4RGQA 2WWHA 1E0AA 5CT8A 1GZ7A 1M5TA 4Y2HA 1R2QA 3H4VA 5IBCA 1HFEL 4ZODA 4D02A 4MWTA 1DFGA 2HIMA 3VR6H 2FUG1 3CO5A 2QIPA 2NZJA 2OCLA 5KNBA 4UTOA 4C4RA 2QZZA 3ELBA 4ZYUA 1VB5A 2XMCA 2WC1A 1E3QA 4Z0PA 3MJ5A 1N0VC 2A33A 3H11B 4GECA 3OZEA 1L3CA 4BNXA 1FU4A 2JAUA 5DMHA 1BQ4A 1I1NA 4CU5A 1JLSA 1SVWA 1L4LA 2IEAA 2VQFM 1Q1AA 1IBKB 1ECFA 4BQRA 4DILA 1IC6A 2I8AA 2OCXA 4MCHA 5B6PA 3IHKA 1EFLA 3U3JA 2IIPA 2WWIA 5BPVA 3O8DA 4B4WA 1G9TA 2ZAYA 5CNIA 1KSHA 4CF7A 1PJ2A 4LBYA 1E2DA 1ENPA 1H8ED 2DPLA 3K4HA 1PGQA 3U7QA 3LT5A 3MYRA 3T06B 1VJDA 1T3GA 2LTAA 2PH1A 4YUZA 1XK7A 4FZJA 4K6HA 3IXLA 2NXCA 8OHMA 2AOUB 5KSWB 4WBNA 5DHSA 1Z4IA 1LQ2A 2XUKA 1GPDG 1G5IA 3ABQB 1U4SA 2RGWA 3PDIB 1MDBA 2JPDA 2XZTA 4BKQA 1KK0A 1COWA 3PGMA 1UQTA 4QYIB 4C2AA 1WR8A 5GTDA 2OLEA 3GL9A 3O2JA 2AEMA 2JWSA 2GPAA 2PIAA 1E2IA 3SLRA 1PNVA 4G4NA 3ZEIA 3E3AA 2KW0A 4MRMB 4X66B 3I8SA 3QM1A 1FNBA 4OXYA 2CLOB 2J9ZB 1TUBA 1TEVA 4B81A 3CR3C 3RVQA 3MXTA 3SNHA 4JYMA 2NO5A 2A4MA 2XSZA 1HR0M 2VYVA 4B3GA 1UEIA 2ZPUA 4C0JA 4QECA 2QD5A 2A4KA 2RG7A 3ICOA 1SUDA 5G4KB 5IVKA 1IY1A 5HUQA 3Q8GA 3AI2A 2JGDB 3ZQJA 4CMKA 4M38A 3DJYA 1E3MA 5JSQA 3L79A 2MROB 2H54A 4BVBA 1NQTA 4G24A 2QMHA 3EA0A 5IF3A 4CQJA 4DMMA 5G53C 2AFVA 1BGWA 3WL3A 4EHAA 4EUNA 3PHIA 3BILA 4D9HA 4A26A 1II8B 1PS9A 3V8NA 1TJ3A 1VC2A 4QUDA 3ZDDA 1T9AA 1SQFA 3PC7A 4DCTA 4D9EA 5CB4A 1KPGA 3PRJA 3R0QA 4KVGA 1VFNA 2PJUA 4X7MA 3O5AA 3D6TB 1RW4A 4QGAA 1IOWA 3K8QA 2KE5A 4MUJA 1IN7A 4EENA 2Z0MA 5H1YA 2JZ0A 1NXTA 3A3OA 1ZM3A 1ZJ5A 1AGPA 4HYYA 3AR4A 4JYCA 1YOVA 4JLBA 4E5SA 5E6UB 3ZI7A 2VZ8A 3ASVA 4GAEA 1E4YA 3GT3A 4RK5A 4OD0A 4MIEA 4HBZA 4UQPA 4JMPA 2G07A 1Z5OA 2XGGA 3ESYA 1PEKE 3RAJA 4JGGA 4N8EA 1E6MA 2B3DA 1QX3A 4LZJA 2ZS8A 3HSYA 2H0AA 3FCEA 4XGNA 4D0NA 4MR7B 4I14A 4FR2A 4Z7JA 3WGOA 3WNCA 3EFHA 5JG7A 4H7KA 1CERA 1XXHB 1VPEA 2WSSD 1JN0A 4CCAA 3GFBA 2VCEA 2F8MA 3P9ZA 4TV9A 3DV9A 2J3KA 5BOSB 2C7GA 4OHRA 3PGLA 4WWHA 4RWZA 2Z3ZA 1VI2A 4FJ0A 1R15A 5A2GA 3KAQA 3K7EA 2BHTA 3SYRA 4EMSA 3TZBA 2OZEA 5DM70 3L82B 2ZRMA 4KUGA 4WURA 4NCHA 4KC0A 4OW0A 4NSOB 1KZ9A 2AW5A 4NBWA 3C3CA 2J3IA 4J7CA 9ATCA 2F1KA 1BDMA 1P6UA 2XLJA 3WADA 4YRFA 3JVVA 1GPYA 5M2QA 3A11A 1U8AA 5G0WA 1CNFA 3AJEA 3IP9A 3LX8A 2VAWA 2CB0A 4K8OA 2C2GA 1D4ZA