1D2NA

D2 domain of n-ethylmaleimide-sensitive fusion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
246
Chain Sequence
EDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN
publication title Crystal structure of the hexamerization domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Hexamerization domain
total genus 82
structure length 246
sequence length 246
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1d2nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d2nA01
4TLCA 1ZIPA 3FYHA 3LBHA 3Q8XB 3WP0A 1IXZA 1VECA 2KBFA 1P9WA 2W0SA 5FTKA 1G16A 1EESA 5JI2E 2QAGC 2ONJA 1GDDA 2YINC 5AUOB 1FPMA 5E7MA 3EXAA 1DELA 1W36B 2QM7A 2IX3A 1TQ2A 4B2PA 3KX2A 4DIDA 2GAAA 3WNDA 4UNSA 1JR3D 3GEEA 4LHWA 4W7SA 4K46A 1C4OA 1JEDA 1YJ5A 1COWD 4Q1BA 1XU4A 4MUAA 4D4LA 3AP1A 1CLUA 4AI6A 3GFOA 4DC9A 5EE0A 3TH5A 1NJFA 3B1VA 2GJSA 3X1WA 4I1OA 4LGMA 5KNCA 2QMHA 4KJZA 2ZJYA 1ZC3A 1W0JD 3GEIA 3NBYC 4AYXA 4BWYA 1KAGA 4KVGA 4QM6A 1S2MA 4D4KA 3L8ZA 2KB0A 1C9KA 1TADA 2IT1A 5EXXA 1FNNA 1JPNA 1VHTA 2P67A 1HT2E 1MRNA 3OEED 4HYYA 3I62A 3QNUA 4ZCLA 3A58B 4A0GA 3F5FA 2C8VA 3IO3A 3AVTA 1E2MA 4O2LA 1X1SA 1YE8A 1KDPA 2AX4A 1LW7A 3TAHA 5J47A 4AKHA 1GNQA 5FTNA 1Q0UA 3FMFA 1WBBA 5F3WB 3B1XA 4NYJQ 2NG1A 1E0AA 3ADBA 4UXHA 1E32A 1T91A 2REOA 1HV8A 1MO5A 4V0KA 3SJCA 3VKWA 3H86A 2GTPA 2OXCA 2WZQA 5AJVB 5EE5B 2IS1A 5JJIA 1XNJA 4HDQB 5CK4A 3GLIB 1S0UA 1JR3A 3OAAD 4PR0A 4BEBA 1AGRA 3P26A 3GLIE 1COWA 1N6OA 2W2XA 1V43A 3QI2A 4Q1DA 2GRJA 2DPXA 3KL4A 2EFCB 2GK7A 1LTQA 2CVHA 3CRRA 3GD7A 5L3QA 2PJRA 3K53A 3BXZA 2F3TA 3NBFA 4DDVA 4N3NA 3AJIB 3AGPA 4HLDA 2GDJA 2YNMA 4ON9A 2ZRCA 4Q19A 4AKEA 1HUQA 1W0JA 4MYCA 1AGPA 2HJGA 1IXRC 3EG5A 3LA6A 4Q03A 3NWJA 3B5JA 2BMDA 4FMCF 4DLTA 3HYTA 3V00A 5A4JA 4OK3A 2P3SA 2W00A 3VR2A 3OEEA 5FBQB 3K09A 1RZ3A 2O8CA 1G7CA 1ZAKA 1XD9A 4UXIA 1IN8A 1ODFA 3MWJA 1IOZA 1X8LA 2C98A 2ZXUA 5KDOA 1AS3A 1YR6A 1VHLA 4WIAA 1OH6A 5B57C 1G291 3IIJA 1WMSA 2C9CA 1G6OA 3PEVA 5G3YA 3KKQA 2AD1A 2O8BB 3L43A 2EFDB 4KO8A 2IA5A 1IM2A 2C99A 1I4LD 2B92A 3H2YA 3CPJB 2ZJOA 4NKRA 3LQQA 3BFVA 4NYIQ 5AJYA 4AK9A 4NBSA 1QRAA 2XXAA 1Z0KA 3T15A 3OAAA 4B3XA 4DEXA 3MFYA 3WNBA 3K09C 1CJMA 3BC1A 1E2QA 4PPFA 4M9ZA 2GEDA 2O0JA 2FE4A 1NJGA 4U00A 5TVKA 2J0QA 4C0HA 1NI3A 1T3LA 2JLRA 3JVUA 5JEDA 2A2ZA 3OF5A 4QBIA 2VP2A 1YQTA 4URXR 2IXEA 5GJBA 4K81B 1T5LA 2FEMA 1TPZA 1U8AA 3BJIC 3LVQE 2AWOA 4QXAA 5EUQB 1GNPA 3M4YA 4TLBA 3VKGA 2Q9CA 4U02A 2JLZA 1J99A 2KSQA 2GHIA 3SYLA 3ZIAD 2FG5A 2QU8A 4EFMA 4Q66C 1ZCAA 4ASUD 2QT1A 1SXJD 4MYHA 3ZVLA 1Q1EA 3FVQA 1D9ZA 4Q4JB 2OESA 1RIFA 3WYAA 4A36A 1E9RA 1RW4A 1CP2A 2J0SA 5DSZA 4BECA 4WZBE 4PQRA 3W8RA 2H16A 2PMDA 3IDQA 1WCV1 3UMRA 4IDPA 4DXAA 4ZI2A 4Q9LA 2CCKA 1I4TD 3SFVA 5IHPA 1GKUB 3LFUA 1OW3B 3MD0A 621PA 1TEVA 2IYVA 1Q22A 2KE5A 3TR0A 1G9XA 2Z83A 1E98A 2YWEA 2BBWA 1JAIA 1G8HA 1Z07A 2A5DA 3FGNA 5HCNA 1GIAA 2HJVA 2ZI4A 1Q1ZA 4OQLA 4B48A 4DJTA 2ZJAA 3PUYA 1G3IA 2MSCB 1TL7C 2QE7A 2ZSBA 2F7SA 1SZPA 4OJQA 1XTKA 3FMPB 3K9HA 4W5WA 1G8GA 1RJ9B 4JYCA 1TF5A 2QL6A 4LHVA 2OLKA 1AM4D 4GITA 1CTQA 3BIFA 3T1VA 2HT6A 1FQKA 2ZQ5A 3B1WA 2W83A 3UG7A 4X8HA 4IEIA 1CXZA 3QG1A 1EFRD 1SHKA 2P2LA 2WBLC 4MGIR 5HE8A 3I5YA 2H17A 3ZIAA 3U7HB 2MMCA 1R7RA 2QP3A 2WKRA 3CR8A 1YZTA 4O0MA 3C8UA 2X2FA 2OV2A 1L7VC 4LPKA 4BFVA 1SXJA 1KI8A 1JXMA 1P75A 2FFQA 3RRZA 2YWHA 4NU0A 4P32A 4IEEA 1G5TA 3NDBB 1N5JA 2KJQA 4NE2A 4Q9KA 4Q1FA 3K0AA 4JVSB 1JNYA 1TF2A 3I5XA 5BYJA 3SHFA 2BBSA 2GCOB 4ABYA 4KV9A 4AC9A 4BFZA 1MV5A 3FFBA 4XWAA 1K5DA 2H8KA 1P61B 1MO3A 4EJSB 2JLUA 4CRWB 4PHTA 5A5GA 2W6JA 5JRZA 1TF7A 5EE1A 2K5UA 3HYRA 2WOJA 1RRGA 1SKYE 4Z1MD 2EFHB 3OESA 1Z47A 4PAMA 1DEKA 1Q3HA 1WA5A 1SXJC 1A1VA 1N6NA 2EU8A 4AYTA 1Z6XA 5KPDA 1U0HC 1UBEA 2GXSA 4QBFA 4LYAA 3U3JA 2AD5A 2EFEB 2IYRA 2VTKA 1TU4A 4A2PA 5CDFE 3KB2A 3NTUA 1W49A 4O2RA 1NKTA 4TMWA 5IRCD 5HE9A 2J5XA 4RZ2A 4KU4A 3UMFA 2QQEA 2H18A 1N2CE 2LCFA 1RVDA 2NO7A 1IN5A 3AKCA 5E3HA 3E2IA 2ZI6A 1P5ZB 3HPRA 3ICQB 3B1YA 3C16C 2FDCA 4C30A 3FKSA 5GJVC 2G1JA 1NLYA 2FSGA 2QI9C 1OFTA 2AL7A 3LX5A 4JVNA 4DSNA 3WHKA 2X19A 3GCGA 4B44A 1M74A 4A2WA 4LCBA 4D0LB 1HQCA 2YHSA 1XEWY 2ZR9A 3P20A 4LJ4A 3ZZUA 4DLVA 1NVMA 1EGAA 1EFCA 4JBYA 4Z51A 2X1VA 3U3OA 3VNVA 3OFND 3QKUA 4NONA 1ZNXA 5FUXA 4Z1MA 1N25A 4OHYA 1P4SA 4PPQA 4YMUA 5EP4A 3EZ6A 1YZGA 4WZ6A 3ZJYA 4LY6A 1TEXA 4ARZB 3MJHA 1QDEA 4PPGA 1SVSA 2NO0A 1MO4A 5L3QB 4NL4H 1BYIA 4HEJA 1G18A 3PFIA 2FH5B 2XTNA 3FPAA 3AKDA 1SVOA 4TYPA 2ZS9A 2XZPA 4WBSA 1IY0A 1LFDB 2XGJA 1G8FA 1OIXA 1R0YA 1SGWA 3GJ5A 5AJZA 4MDFA 3PUWA 4KFSA 4NDZA 4Z8YA 1NVUQ 5DIFA 4QL3A 3D31A 2FPMA 2CJWB 1VCOA 1J7KA 3Q85A 3V4FA 4XIGS 2A7QA 2ZYUX 5DI3A 4HI0E 1XFAA 4TLEA 2BBTA 2C03A 3S1AA 4US0R 1ZNYA 4UXJA 2QRNA 2AK3A 4Q9IA 4P4SB 4R2HA 1MRSA 3TSOA 1XWIA 1WQ1R 1W4CA 1NP6A 4OQFA 3VU9A 1YR7A 3FKQA 3QEJA 2ERXA 2IC5A 1U8YA 3QUSA 1Z63A 3OFNA 1M6NA 1UDWA 3GLGE 1LF0A 2GVZC 4IOLA 4M21A 1QF9A 1XB2A 4LC1A 3EPLA 4FWIB 3E1SA 3FDIA 3FHTA 3LW7A 3UMSA 2XEXA 2QNRA 5J4VA 1BMFD 2WAYA 3FMOB 1NF3A 3GP8A 1KYIA 1FL9A 3DL0A 1S96A 1II0A 4IFEA 2PL3A 4OQMA 4D80A 3EARA 6Q21A 1WRBA 3AF1A 4BFWA 4XVUA 2CK3A 5FTJA 2E9SA 4YLGA 4RD4A 4FCTA 1W36D 4Q7JB 2GA8A 1NLZA 1W0KD 3QBTA 1XXHB 3KDSE 2NQ2C 2D7CA 4A9AA 1II8B 2NTYC 1XXHE 5KUTA 3K0FB 5F9HA 2F1HA 3AVOA 5BN5A 4Q7KA 3LNCA 1W1WA 4L8GA 1OLOA 5BN3A 4TN1A 1VYUA 4DB2A 1KZGB 1OV4A 1XMVA 1E79D 2GESA 1R8SA 4PC6A 4L15A 4R7ZA 1TUEA 5IK2A 4BGDA 4OI0A 4PZLA 3PEYA 2Z4SA 2OLJA 4KVAA 2GXUA 1G3UA 3CPEA 4B33A 2ZUCA 3B8HA 4DVGA 4DT1B 2ZROA 1G7RA 3MRSA 3DM9B 2IUTA 2ZRFA 4P33A 1DPFA 5CLLA 1KI7A 1QHHB 2QP4A 3NG1A 3SEAA 1Y63A 3MAAC 2YOGA 3QENA 2A3RA 2VHCA 5D3QA 2ODNA 4AKGA 5JWHA 4A92A 2A5YB 4Q01A 4L9WA 5B2ZA 4URYR 3DO6A 5LB4A 1HURA 4MKHA 1Z6TA 2VA8A 1Z29A 2GF9A 1G7TA 2X2EA 1KO5A 4G5GA 4BPBA 1H8EA 2ZRMA 1I4DD 5FBLB 3UWOA 3EX7C 2C04A 2BKEA 2WWHA 4BFUA 1W0KA 1YR8A 1AS0A 1NSFA 1GKIA 5KSOA 3VX3A 4XSGA 5DN6D 5FH9A 2L0XA 4GPTA 4Q7MB 1V5WA 2WJGA 4F92B 2WJIA 1E1QD 1ZU5A 2J3EA 3AVXA 3UK6A 3K0AB 3W6PA 1PLKA 2J7PD 3BERA 4RFSA 3T1TA 1E79A 4HB3A 3W90A 5FR1A 2G3YA 1KO4A 2OCBA 4IOJA 4IKEA 3EPHA 5IF9A 2HYDA 1AKEA 1KNQA 3SFZA 2QTVB 3B6EA 1NRJB 1ZM9A 3DZDA 1ZM2A 3RS5A 2OBLA 1G8PA 4CZ2A 2P6UA 1CU1A 1W36C 1MR3F 1SVLA 3ZS9A 5P21A 3A1TA 3VR3A 5K8IA 4JL5A 3GJ0A 3GPLA 2JIZA 1UADA 2ODWA 1P2UA 4JIMA 2ZR0A 1SKQA 5B30A 3GJ7A 1SVWA 3NBZC 5CB8A 2ZREA 1ESNA 2ZUDA 4FMDB 3B13B 1WXQA 3AF2A 5TDHA 4I81A 3CH5A 1XZQA 2ZRDA 4A1FA 4A15A 1E9DA 1ZP6A 2J41A 3NHBA 4PANA 1LNZA 2P6RA 3VFDA 3OIYA 2C77A 3CONA 4OL0A 4Q5IA 3HU1A 4DLSA 2VPPA 2NIPA 3GLIA 1ZUIA 1KDOA 4NYMR 3M0EA 4HZIA 2YV5A 4QM7A 2GBLC 3FHCB 3B78A 2V9PA 4GZLA 5EP2A 1KO7A 1QG4A 2BVNA 3CZQA 5UKDA 5FL3A 4QHTA 1GOTA 4YMSA 2BMFA 2WWIA 3AF4A 2Q21A 1ZM4A 5TMPA 1DO2A 3K70B 1FTNA 3LV8A 2FGKA 2CE7A 4EPRA 2IUSA 4EPTA 3HU2A 1N6HA 4BZXA 1SULA 3UIEA 5HKKD 1Z06A 5FTMA 2H5EA 1KMQA 3H4MA 1SQ5A 1KIMA 1P2TA 3GFTA 2IS6A 4M0LA 3PG5A 1KAOA 3PUXA 4WZAE 3SJZA 3WBKA 2GEVA 2BM1A 4NCIA 4Q9JA 4GP6A 3EIHA 5FPHA 3VLFB 3R7WB 1T3HA 4EUNA 5SZJA 2B7BA 1BS1A 4PC1A 3ZH9B 4N0DA 1DAIA 3A1UA 4DLWA 4G3XA 4XVRA 2QENA 1D2NA 1BKDR 1VG1A 3BRWD 4Q4HB 4XTCS 3VR4A 4OK5A 3THXB 2FA9A 3TVTA 1XBTA 2W2VA 5GJCA 3O8RA 3E70C 4RZUA 2O8BA 4D0GA 4B32A 3ZVNA 3WMFA 5FUYA 4M9QA 1QHGA 1TQ4A 3U4QB 2V4ZA 3FTQA 2PZGA 3H84A 3AGQA 5EP1A 2OO7A 5CLQA 1OH7A 3EWSA 4OKSA 2Q3HA 5LD2B 2GJ9A 1GVNB 4V0ME 1P73A 2R8RA 1Z0AA 5HR5A 5FOUA 2YOHA 1E9FA 2PJZA 4BLTA 2IW3A 2BCGY 5HKKA 2C9YA 3AVPA 1PLLA 3HDTA 4EQ6A 1UKEA 4ZCMA 2F1IA 3SC3A 4M53A 5E7IA 2CHGA 4AYWA 4RFVA 5FUVA 1HEIA 2WVJA 3CW2A 2HXSA 4GOXA 4WVFA 4MYUA 1KJYA 2XITA 4ZCIA 1NG1A 2IYLD 5FBWB 1A4RA 5LPNA 2RGGA 2IL1A 3DMDA 2WWFA 1P2VA 4YMWA 2HCJB 2IYQA 3IEUA 4G5OA 3PVSA 2WM9B 2QAJA 4Q4JA 2ZI5A 1XJCA 5JZVA 3WYFA 5CJ2A 4XVQA 3HR7A 4RY2A 1CJUC 2G77B 3CNLA 3RC3A 1X6VA 4M9SA 4YONB 1NMZA 4TL8A 5HZHA 2VP4A 4TMZA 2Z5FA 3IIMA 3QF7A 4MDEA 2RAPA 4TMXA 5FBRB 1ZINA 1UM8A 5JI3E 1BYUA 3ASZA 3X2SA 4B3DA 3E5HA 4I4LA 1Z22A 4A8JB 3QPVA 2ZRHA 1CR4A 1R10A 5L3SA 4G1UC 3H0KA 4CT5A 4DIEA 1ZUHA 2BEJA 3ZD7A 4IW3B 1XJ0A 4KHZA 3GLHB 1SVKA 1E2IA 1T3SA 3SYNA 1RJ9A 4GOJA 5AUQA 2CE2X 2OUKA 2EYQA 3AH8A 1P6XA 3GLHE 4US1R 3OEHD 1S9DA 2FPKA 4OHVA 4Y0AA 4TMVA 5HCIA 4Q4AB 1JALA 2QP9X 2QROA 1KMHB 2EWWA 4MGYR 4W5JA 1RRCA 3W34A 1NN1A 2WTUA 2V6ZM 4FCWA 3SOPA 3GJ3A 3TRFA 4K8OA 4YDHB 3OE7D 4B75A 4ZDJA 1TNDA 3SE0A 4AY2A 2BKUA 1OT3A 3TKLA 2ZRKA 2ZYVX 4F4IA 2OXRA 4XH9B 4RD2A 1N3BA 2GJ8A 2DWQA 1TAGA 2GCOA 2YWGA 3U2QA 4CEJB 5JWRA 4Q02A 4X8MA 3THYA 4EJSA 2CLSA 2AWNA 3Q9LA 2J7KA 1W2GA 4DLYA 4IVRA 3EA5A 3W5JA 2DFKB 3T34A 4FWTA 3W5IA 1KI6B 4LV6A 3G0HA 4DSUA 1T5IA 2NO1A 2PEZA 3B85A 4RCZA 1QZMA 3IPXA 1FMLA 3TSWA 4C0LA 3HWSA 2CHVA 3VAAA 4C4PA 4GP7A 5CDFA 1Z2AA 1KK1A 3RSOA 3U7EB 2WIBA 4RFSB 2ASEA 3OEHA 1IJFA 4WXPA 1PVOA 3BK7A 1OFHA 1DOAA 1GL9B 3O8BA 4JSTA 3KQUA 4EJSC 1WBDA 1BOFA 4B34A 4KBGA 2VIIA 1LY1A 4PHFA 4YDSA 3CWZA 4BLPA 3OE7A 2QN6A 5CYPA 2O8EB 2J0UA 1QHIA 2ZRGA 2WJHA 4I1UA 3K9NA 3PUVA 2IWHA 1YZLA 5KHOC 1P2SA 1Z6GA 1U0LA 3NKVA 1XTQA 2ZE8A 2ZSDA 4H1UA 4D4JA 3UXMA 2VRWA 2ZAMA 3CF6R 4CGZA 4JLOA 2OBNA 1UF9A 3ZS8A 4HB2A 3A36A 3KJEA 4LV5B 2G9NA 2HT1A 2AK2A 4TZ6A 1UJ2A 2VO1A 4ZV4A 4QNRA 1U94A 4JSYA 1W5SA 1P9NA 1Z0DA 1VYVA 1X86B 2BBOA 4F7WA 1XPUA 2QQ0A 4XD7D 1MOZA 2O5VA 4B35A 3LH5A 4UKDA 4QJ5A 1F5NA 2YJTD 4LV8B 4A3VB 5EP3A 3GLFB 4ARZA 4M1SA 5G3ZA 1KSHA 1OXTA 2ZJZA 3SR0A 2NMVA 1EFHA 2O52A 4XSHA 5H68A 3GLFE 1VMAA 3NEJA 4IJMA 1YR9A 3SHWA 1ZM7A 2RH5A 5FPSA 2EFGA 4C0AC 3R9WA 5KPJA 2GZAA 1E94E 1UPTA 1W47A 2RGBA 5KYKA 2ZSEA 4QGHA 4HAUA 4KBFA 4M1MA 2XB2A 4PQFA 5C1BA 1QZXA 1KI2A 2Q9BA 3IGFA 3TQCA 2PCJA 1K5GA 2CJWA 3KFXA 2YKGA 3NXSA 4OHZA 1CR0A 1N5IA 5EXSA 2GEUA 4KYIB 3FHOA 1XMSA 2MSEB 4HB4A 4NTZA 1VIYA 4UQOA 3RS4A 3ECCA 2DWZB 1OH8A 3A6PC 1EWRA 4B2LA 5JS7A 4CEHB 4B3CA 4P4SA 3AQ4A 2FOLA 1IBRA 1YZUA 1B23P 5K8LA 2QTFA 4I99A 2IK8A 4QBGB 1WF3A 3I4LA 3QE0A 3RS2A 5EE9A 4D0NA 3B1ZA 1MT0A 3DKPA 4XD7A 5AUPB 2V8OA 4FMBB 5DO9A 2NPFA 1ZRHA 4O3MA 1MABB 2DZNB 2QT0A 4OYHA 1R0ZA 1U8ZA 2QE7D 2V1XA 4ZDIA 5KOYA 5C2JB 1E4YA 2WHXA 4JLAA 1GWNA 1L4YA 3TNFA 4QBHA 4BQSA 1E0SA 2RGNA 2VHJA 4A0HA 3LY5A 4IFBA 4QGAA 4KYUA 4CIDA 4TTRA 4EQ6B 1DVRA 1JJ7A 3EZFA 3JVVA 2B21A 1UFQA 5HPYB 2V3CC 2NZ8A 1KGDA 2QSYA 3RNLA 3UWKA 1XXHA 2FNAA 4B2IA 4LJ9A 1UDXA 2ZETA 1II8A 3D3QA 2WMNB 3LO5A 3OIUA 3QY0A 4C0JA 3K0FA 2AKYA 4KLNA 2WKPA 4R71A 2P5TB 2WJJA 4Q1AA 4JJKA 1VG8A 4D4MA 3I1FA 2HYIC 5EJEA 2RGNC 4AWXA 3C7KA 2QORA 4DSTA 1A2KC 3CO5A 4FIDA 1GNRA 3QXJA 4M1WA 2W6JD 1JPJA 4HUQB 1EFUA 2R6CA 4FD2A 4RD1A 5KSYA 4DT1A 1TTTA 3WHLA 4Z8XA 4LZZA 4TYQA 3EC1A 3TSZA 1WB9A 4G5QA 1KDTA 4AIIA 1OXVA 2D06A 1QHHA 3RAPR 4P3YA 5C18A 1DBSA 4GOKA 1XCPA 1NVVR 2ZI9A 3EPKA 1SHZA 2JLWA 1U2RA 3W8NA 3IHLA 2ORVA 5J4YA 1NBME 1UEJA 2PCLA 1G20E 4G5SA 4ILEA 2VEDA 4KFTA 1DO0A 5BWMA 5LDDC 2ATVA 4IDQA 3TGPA 2ZJ5A 2CEAA 1G7SA 2OILA 4B6FA 4V0OA 4GDFA 3AVYA 4LJYA 4AD8A 4DRZA 1M8PA 3VHXA 1EXMA 3RLFA 4LBVA 4DZZA 4MKIA 2W2TA 4JLPA 1OKKD 3LAWA 1Q44A 4LI0A 3T12A 2OM2A 4C2UA 2JEOA 2HCBA 3FKSD 1RRFA 1DG3A 2V7QA 5H70A 1KJWA 2FSHA 4EDHA 4EPWA 3K70D 2VF8A 2EWVA 1NKSA 4IXMA 2BEKA 4RKEA 4MUBA 1L2TA 1S8FA 2JJ2D 3Q3JB 2OBMA 5FUWA 3THYB 1S3SA 2OEPA 1N0VC 1SKYB 1SVIA 1IN6A 4HLCA 1HQYE 4IOMA 4S2EA 5DLQC 4B73A 4B6EA 2VF7A 3THOA 3Q7QA 3GJ4A 4OJKA 4OQNA 3UATA 2WWYA 4LYJA 2P5SA 4B76A 1KKMA 2RB4A 2JAQA 2JLVA 1LS6A 5CB6A 3K0CA 3AEZA 3GJ8A 1ZBDA 1M7HA 2IYTA 4RD3A 3SBEA 2IEZA 3ASYA 3BORA 3N70A 1RRPA 3CB4A 2Y8EA 3JZMA 2WSSA 1E6CA 4Q00A 5DHFA 3RWMB 2J45A 3SU8A 1OXXK 1HTWA 4TQAA 4ZDKA 4V03A 1TQDA 4GFDA 3A4NA 2PT7A 4F91B 4ERNA 1J2JA 1H8HA 2DWOA 2YC4C 3R8FA 2GXQA 1W7AA 2G83A 2H7VA 3CLVA 5KDDA 2J0UB 2JDID 1OJLA 1GRNA 1Z2CA 2EQBA 3K8YA 1S9HA 3L0OA 3T1OA 1OKKA 3TUIC 3U6KA 2JLYA 3BOSA 1AA9A 5D3MB 1JBKA 1NIPA 1X3SA 4EPVA 3A1SA 3CRMA 3KJGA 4A0RA 4ZIRB 5BYKA 3F0TA 2AKAB 1NN3A 5HZKA 3WY9A 3W3AA 5IT5A 2R62A 2JJ2A 5KSPA 1OH5A 4LJ8A 3CWQA 4DCTA 2UZIR 3CRW1 3AVUA 1UAAA 4E09A 4PSAA 1F2UA 2OT3B 1XTSA 2CLCX 4GZMA 4BFXA 3L0IB 5F2EA 4DLZA 1W4BA 5L3SB 4CF7A 1FZQA 5L3VA 5L8VA 3PIRA 4PC3A 2GK6A 3R7WA 2E1RA 3HR8A 4ACBA 1GL7A 4Y0VA 3RRMA 2ZEJA 4GRAA 4F4CA 2EVWX 3W9YA 5JCPA 1KOFA 1GL6A 4Q4HA 2QZ4A 4YQFA 3THXA 2Q3MA 421PA 3K70C 4PQYA 1MH1A 3U6BA 2DCUA 3DPUA 2C5LA 5CITA 1XTJA 4M9XA 2ZU0C 2CK3D 1ZD8A 4JS0A 1OXUA 4RZXA 4TL6A 1T8TA 3N2IA 4NCJA 2BDTA 4PPNA 4AG6A 3U4QA 1C1YA 2JDIA 3CX8A 4V0MA 3KQNA 4HB0A 2NPIA 5E4FA 4D6PA 4ESVA 1D5CA 3RS0A 2ZITA 2AFIE 2V6IA 2KWIA 3B60A 1KI1A 1CF4A 3DMNA 4D26A 1LF5A 1N5LA 3L0SA 4TL7A 4YXWA 4CEIA 2AXNA 4TWZA 5GVRA 4A6XA 1N6KA 2BC9A 5JBQA 5E7JA 1G1MA 3GLGB 3CX7A 1DARA 3IILA 5DH9A 2JJ1D 3QXXA 1T8UA 5IK2D 1XEWX 4BRWA 4LJ6A 3CBQA 2FJUA 1QHYA 3PR1A 1G3MA 3EAQA 2FV8A 2ZS7A 4BEJA 4DKXA 1CBUA 3CF2A 2DVWB 3SN6A 2CMKA 4CT4B 4MYTA 2XJ4A 4KAXA 3QEOA 1E0KA 3PQCA 5LB2A 2ZS8A 3GEHA 8OHMA 5A0FA 3A4MA 2JLXA 3P27A 3EW9A 3ONWA 1M7BA 1S3GA 4TMKA 4TSFA 3D8BA 4NYJR 3ADDA 1EG7A 1N0WA 2GJAA 2QMUA 1KSGA 4XWOA 3QOFA 3LW8A 1IJEA 2N1BA 3ZD6A 1H8ED 3KW6A 2X77A 3SDZA 4P4TA 4D82A 2QPAA 3M6AA 2CHQA 1W4RA 4Q48A 4QC2A 4A8JA 2BMJA 3AB3A 3MHVC 3O8CA 3ZQJA 4DSOA 3ZLJA 1PUIA 3GLHA 3GMTA 2WWXA 4MRRA 4M4SA 1M34E 4KFRA 2GNOA 1CJVC 3ND8A 4DLUA 2F6RA 3HU3A 3PCRB 121PA 1RYFA 1M1YE 2JJ1A 3BB3A 4MA4A 1R4AA 1LV7A 4JYBA 4Q4AA 4TTQA 1KMHA 4GT1A 1ZC4A 1AKYA 2NZJA 1XTRA 2QPOA 1AIPA 2OAQ1 2IF2A 2REXB 2RGDA 2IHYA 1DG1G 3AVWA 1JB1A 4A8JC 5EXTA 5CIWA 2SHKA 2JIZD 3ZVRA 3AP3A 3PITA 4BLOA 3HP1A 1JECA 3NHAA 1E9AA 1YZNA 2J59A 4H1VA 5FPTA 4CEJA 4QHSA 5FL7A 1VKJA 3DVLA 2WWGA 3QPUA 2V55B 1G3RA 1O87A 4IRUB 1VIAA 2ZRIA 4NYIR 4UJ5A 3ETLA 1KDRA 2VHTA 1NNEA 4HAXA 1KI6A 2ZRNA 4XTRA 3QXCA 2ZANA 4BRUA 4GNKA 5FOVA 4C0SA 4QNMA 4QHYA 1ESMA 2VHUA 5TB5A 4KLZA 1CR2A 2BM0A 3ZQ6A 1HE1C 4ZO4A 3HPQA 2A5GA 4JJZA 4NMMA 3EPJA 1PJRA 2B6HA 3UG6A 3BB1A 3LLUA 1O3YA 2QA5A 1VCMA 2ORWA 3PEUA 4DLXA 2PLFA 4DWJA 2LKCA 5DI9A 4M2LA 3U5ZB 2O8EA 3V4RA 1NVWQ 4BLRA 2DFTA 2HV8A 5EZ6B 3GJ6A 5JHGB 3TLXA 1CRPA 1GSIA 5LBIA 1TU3A 3BE4A 4QJ3A 3I8XA 2ZJ8A 4TYYA 5DE3A 1CULC 1JJVA 3N5CA 3AKEA 4S35A 4F93B 2F43A 5JSZB 1CRQA 2OAP1 4B3BA 3QKTA 1P60A 2VH5R 3AF0A 4HLUA 3A37A 1AQYA 1F3OA 3THWB 1RYHA 5K8UA 1N5KA 1TUIA 2O0KA 4JT4A 4HZUB 2XZOA 1PLJA 4B47A 4JLBA 3U7GA 5KSZA 5AK0A 3GLFA 2C2HA 2LWIA 1ZW6A 2XTZA 2W0MA 1XPRA 3L82B 2Q0HA 1A2BA 1KSFX 2GWHA 1E2HA 3LDAA 2BV3A 2QSZA 3F3YA 3QG5A 2OCAA 2DR3A 4JLKA 2F3RA 3NDPA 4Q21A 2FX3A 3O8DA 1D2MA 4HDCA 3U3KA 1F2UB 2RMKA 3KXLA 1P72A 1X8KA 2C96A 2IYXA 4IHQA 4IOKA 4GMDA 2A5FA 2DFLA 3IBGA 5AJXA 1X8JA 4PAOA 2ZSAA 4TTPA 2P6NA 4W5HA 4JKIA 2QY9A 4LRSA 4US2R 3AVVA 5J40A 3TIFA 4CVNA 2Z0MA 4UJ3A 3U60B 2QBYB 1VG9B 4PO9A 5TV2A 4EIWA 1PZNA 3QKRA 3BB4A 4CEHA 2ECKA 2FZLA 2VSFA 5GJWC 1Z08A 4JLNA 4LRWA 2DWPA 4L4UA 4DDUA 3LX8A 1HH4A 1M7GA 2D3WA 1G21E 2BOVA 4M1TA 1OHHA 4UNNA 1R8QA 1SVMA 2IHBA 1QHNA 2FEOA 1OYYA 1MABA 4WAUA 3P4YA 3CNOA 4PSKA 3VR5A 2GVDC 2PLRA 3TAUA 4GI7A 1KNXA 2GF0A 1X1RA 821PA 3A8TA 5FOWA 1L4UA 2H57A 1W5TA 4V02A 2VP9A 2YWFA 4URUR 1VDZA 3UKDA 4CEIB 1YHNA 1NSTA 2Q6TA 1DAMA 1G4UR 3CUEF 3BH0A 2RGAA 4Q9HA 1PV4A 4QG7A 3VHLB 2XSZD 4G01B 2HF8A 4ZKDA 1U98A 5JJKA 2QGZA 4M8NE 1FNMA 2R2AA 4G0NA 2WV9A 1T0HB 5DISB 2EYUA 3IPYA 2PEYA 4RCYA 5CK5A 4JN6A 5TXGA 2GXAA 2UVQA 2FSIA 5EXPA 5BN4A 4FW9A 4DBLC 2PMKA 1BO6A 3FOZA 2V6JA 1AQUA 2ZRPA 4Q7LA 1EFTA 2Q9AA 2ZRJA 2F55A 4BFSA 4JBXA 1P3JA 2ODBA 2PBRA 4XJXA 2AXPA 3GJXC 4HUQA 1U0JA 2H1LA 4FMCB 2WOOA 4RD6A 2WPDD 4LJAA 1WE2A 1Q57A 3AKYA 1GG2A 2HXYA 4HLQB 4NP6A 1NBMA 3G5UA 4PO8A 4ZI3A 4OI1A 5C46F 3SS8A 4AKIA 1IQPA 3MG9A 1Z5ZA 5FR2A 2NOAA 1NMYA 3I73A 3IBYA 3RDPA 1Z0JA 1OB5A 4DLRA 3B2EA 2B7CA 4DHEA 2XSZA 1B0UA 2F9MA 3BWDD 3DOEA 4BUJA 5C4GB 4GL2A 1R0WA 2TMKA 2CL6X 4JL8A 4E5UA 1FUUA 2FGJA 4NCHA 2WJVA 2C9OA 2QPTA 3LRPA 4KSBA 1J90A 4CYMA 4KSCA 2IYSA 4N1AA 3D7MA 2AN9A 2BMEA 2D2EA 2ORIA 3KKMA 5DNYB 1JR6A 5SZIA 1OXSC 2OHFA 2IYUA 4H9GA 1MO6A 1D9XA 2JGNA 1F6BA 2OZEA 2Z43A 4JLMA 2O8FB 4FMDF 4JZKA 1CIPA 4Q1EA 1TX4B 1XD2B 4DUGA 1II9A 3QBVA 4B43A 2ZRAA 2J46A 1GTVA 3JZAA 2X8AA 4HSEA 3NVAA 2IWRA 5GVSA 1A7JA 1CS4C 3MWKA 4D2IA 4W9MC 3A4LA 2ZTSA 4RZ3A 2ZRLA 1JEEA 2R65A 2WPDA 2GCNA 2C78A 1FX0A 2CDNA 3LBIA 5EE3A 4I1SA 1NL3A 4YC7A 3DOFA 3BD9A 3ZYCA 2XNSA 2A9KA 4OI2A 4R9UC 4LBYA 5DGXA 4TQ9A 1RPZA 2EW1A 4MRPA 3RS7A 3SJBA 1PUJA 5F9FA 3U44A 1LS1A 2XTMA 1BH2A 4OI4A 5AUNB 2ZI3A 4GSYA 4KFUA 1F2TB 5JHHB 2FSFA 5FFMA 1IN4A 3KJHA 4A2QA 4C7OA 1KY2A 4P0TA 2IYYA 2CCJA 1CR1A 2FMXA 3C14C 3WYGA 2PZEA 1YKSA 3KXIA 4PAQA 1A5TA 1E2LA 2XX3A 4TT3D 2CCGA 4PC7A 1HE8B 4NPHA 1OIVA 3QF4B 5D3MA 2IS2A 1R5NA 1E3MA 1G5RA 4MRVA 2BJVA 4G5RA 4ZIRA 3TW4A 1NG9A 4LWZA 2IEYA 2F43B 2A78A 5M04A 1IHUA 1E99A 3I72A 2MSDB 2BHRA 221PA 4MKGA 1EWQA 1XRJA 1GRRA 4O25A 3TUJC 4LBWA 1U81A 2IF0A 4MRNA 3KUCA 5FI1B 2MMGA 2XB4A 4MRSA 1DE0A 1ONBA 1F60A 4DDTA 3KTAA 4L16A 1XEXB 1K6MA 1XPOA 3WRYC 4A0FA 4HUTA 1GILA 2OE2A 4ZPXA 1ZD9A 3X1DA 3ZGXA 1E2DA 4WOPA 1FUKA 4PZYA 3GFPA 2CLDX 2KI5A 3QIAA 2I3BA 2OFWA 2G88A 2ZIAA 5J4LA 3V9PA 4EFLA 1Z28A 3TBKA 4TT3A 2RHMA 2HEIA 1XZPA 4YMVA 4GMXA 2XZLA 3I61A 1E2KA 3C5HA 4V0NA 3CNNA 3NH6A 2G0NA 4PC2A 2DY1A 1FQJA 3QKRB 3QKSB 2F1JA 2AHOA 4HAWA 5BXQC 1FP7A 3VQTA 4DB4A 5L3RA 1G64A 1IAQA 3GLGA 3K0SA 3B7GA 3IQWA 1G17A 3KKOA 3P4XA 1VCNA 3Q72A 3CF0A 4A4DA 1JAHA 4FWDA 2QGNA 2QMEA 3VKHA 2LKDA 3KKNA 1KJZA 5AR1A 4JLVA 3KB1A 2QG6A 3T06B 2OCPA 5SZHB 2ZRBA 4UNPA 3ADKA 4AG5A 1KI3A 4FI3C 4PSVA 4LPSA 4LHXA 5J4HA 3Q7PA 3T5GA 3RABA 5FOSA 4POAA 1ANKA 2QTHA 1XDBA 5K8TA 3SNHA 3Q5DA 4LDJA 4E03A 4FN5A 3DHWC 1CKEA 2VP6A 1WP9A 4TZ0A 3IKJA 2JCSA 2VYFA 2FN4A 1GZSA 4HATA 5JLJA 4NCNA 4DCNA 1EK0A 1KY3A 2YC2C 3WXMA 4GBMA 2IXGA 3CR7A 4FWGA 1Q20A 1DAKA 1I2MA 3A1WA 3CIOA 2A30A 3U7FB 4M1YA 2ZR7A 2DYKA 2V1UA 4IDHA 2V7QD 3TE6A 5JS8A 4LJ7A 1Z83A 1US8B 2IUUA 4NZYA 1KSJA 3VX4A 3UANA 1QBKC 2FF7A 4OHWA 4FXPA 4Q1CA 3BBPA 1ZUNB 2ZVQX 2DB3A 4LK2A 3QQ5A 2VBCA 2YZ2A 4LYFA 1JXOA 2ZE5A 5H8WA 4E22A 1G41A 3QPWA 1W44A 1E4VA 1U99A 3CM0A 5KDLA 3TUZC 2RCNA 2CBZA 4A82A 2DFNA 2WSSD 4M1KA 5FOTA 1UEIA 1RC8A 1E69A 4PHHA 1HT1E 1DS6A 2R6DA 4JMPA 3OZXA 4WA7A 3TJZA 4QOSA 1NY5A 4JBWA 4PZZA 5KTYA 1T6NA 1HY3A 2PZFA 2J9RA 1H8HD 4ITRC 1OYWA 4NYMQ 1KK2A 3MSXA 4R98A 2O8DA 4MGKR 2YVUA 3KQLA 3NC1C 3D6TB 2GETA 1E9CA 3QSYA 3T61A 4NCKA 1OB2A 1P62B 2IXFA 1G3QA 1GITA 1E9SA 4MKFA 3R8CA 1XCGB 2Q3FA 4B3GA 1Z0FA 2QAGB 3NIBA 3RYTC 1NIJA 4KI0A 3TK1A 4B3FX 3RRNA 3EIQA 4QJ4A 3QXSA 1F48A 3NH9A 2NGRA 2VSOA 4ASUA 4UNRA 5TY0A 2ANBA 4JKYA 2REBA 3KQHA 1FX0B 4QFMA 3U61B 3OIVA 5FOXA 1W46A 4LSGA 1E2GA 3AUYA 3HJNA 3UPUA 2W6ID 4F38A 5DYGA 1AK2A 2B8WA 2ZYTX 4P4UA 2C95A 4BFTA 3X1YA 4ESHA 3MWLA 3PEWA 3BAFA 3FWYA 3U44B 4BLSA 4LUCA 4TLAA 5JSZA 1I2DA 5DYIA 3BH7A 5C4MA 4TLDA 5CIQA 1TMKA 1KO8A 2WSMA 3THWA 5H1YA 4C7OB 1IONA 3IO5A 4HDOB 1ELOA 1U9IA 5GADl 2I4IA 2QUZA 4HZUA 4LBZA 1VYTA 1K8RA 5FBVB 1CJTC 3K0CC 3AUXA 1QG2A 3AF3A 2JASA 1UBFA 1P9RA 3OIWA 4OQXA 3TVDA 2GCPA 4LOAA 1CJKC 4YXWD 1EFRA 1BIFA 3P32A 5CM8B 4D25A 3ZDQA 1Z6YA 3DM5A 2ANCA 2OFOA 2FU5C 2RHDA 3EC2A 1N6LA 4HAZA 2VSXA 5FTLA 1ZVQA 1U9IC 2WIAA 3K9LA 3EA0A 2W6IA 3KTAB 4D81A 2KBEA 2ZYWX 1VPLA 3DKVA 3B82A 3BH6A 4Z54A 1Q1BA 2QBYA 1T4GA 4EFNA 1A82A 2PH1A 2F9LA 3ZZTA 3EWAA 2J1LA 4TQUS 3VR6A 1OFIA 3P1JA 4TSFD 3MLEA 5EUMA 3LVRE 4ZDWA 3PXGA 3CKLA 1RKBA 2VP0A 4WW0A 521PA 4HAVA 3EZ2A 3NEYA 4BZPA 1Z0IA 3F8TA 3WRXC 2YYZA 3RSLA 2WAXA 1ETUA 1IN7A 1VG0B 2PX0A 1QVAA 1XEFA 3VTKA 5JFGA 1E2PA 3TQFA 1XP8A 2NO6A 1GAJA 1JR3E 4AURA 3REGA 2RGCA 3R9XA 1OIWA 2VP5A 3B9PA 2JLSA 4IDNA 4OK6A 1DAGA 2OCYC 1KHTA 5HTKA 2RKOA 1AZTA 1AJEA 1YRBA 5EZ5A 3RVBA 4CDGA 2OG2A 2D7DA 5IDVA 1W2HA 1R5OA 1JI0A 2XAUA 4C9BA 4DCVA 1GM5A 1RE0A 1Z6AA 4JL6A 1FMJA 1MKYA 2IYZA 1ZNZA 2G6BA 1TQ6A 2A5JA 2O8CB 3EIEA 4PHGA 4B74A 3PENA 2XNDD 3CRQA 3EZ7A 1E9BA 1Q12A 2IS4A 5LD2C 3K0EA 2BWJA 1KI9A 3I8SA 4F4JA 3LXRA 4CW7A 1Q3TA 1E9EA 4FCVA 4EAQA 3MGCA 3FE2A 2HDNB 3WMGA 1XD8A 2QM8A 3IUYA 5JCZA 1QHSA 1IY1A 1GFIA 4BFYA 5FL7D 4N0EA 5JRJA 2V54A 3VMFA 3K1JA 2D4HA 2I1QA 2XXAB 2FWRA 3ICEA 1LB1B 1NN5A 1KK0A 3DZ8A 4JVMA 4TMTA 3MWYW 4LHZA 3WNCA 4X8LA 2BJWA 3SJAA 1DAFA 2AFHE 1XF9A 3LWNA 2Z6VA 3IIKA 2ZJBA 1R5BA 1D6JA 1J70A 1J8MF 4E07A 3GQBA 3CRVA 3QVUA 5ANRB 3RWOA 4IVPA 1E2EA 2BCJQ 1GP2A 3CZPA 1UBCA 2VQSA 4Q47A 4BZQA 5KNBA 4NHOA 1KO1A 2I1VB 1WDTA 4J0QA 5AJWA 4P31A 3TMKA 1X37A 2PT5A 2XNDA 1CEEA 4DDWA 2CL0X 2D74A 2GZDA 2QEQA 3SQWA 2FFBA 1DADA 1VCIA 2RGXA 1ZJ6A 2ZJ2A 3KFVA 1JQLB 2ZE6A 3Q5EA 3SQXA 2G1KA 3TR5A 2KRKA 3QJYA 1EX7A 4HAYA 2O8FA 5BQ5A 2ZE7A 4C0QC 5JEEA 4DCUA 1XD2A 1Z8FA 3WBJA 4URVR 2PX3A 3QXHA 1D2EA 1EX6A 2P0EA 1IY2A 4BE7B 2VLIA 3CH4B 3KJIA 4QRHA 4II7A 3FMIA 1ZU4A 1R0XA 3SBDA 3W6NA 5FI0B 4RVCA 2O8DB 2ZU6A 3BFXA 1P7CA 2B8TA 2GILA 4MGZR 2GJKA 1E2FA 2ZVPX 1BMFA 3A1VA 3IHWA 4KXFB 4LYHA 3RS3A 3KZ1E 3N2EA 1E2JA 1G5PA 1XMIA 4TYWA 4QGGA 1N0UA 2H92A 1S1MA 4B71A 3KUDA 3EASA 4JLJA 3WP1B 2OSBA 2W58A 2CNWD 5JMTA 1OSNA 3ZZ0A 2XOKD 3BFKA 3X1XA 1F2TA 5SZKB 3W3ZB 1N6IA 2ZPTX 2GZHA 1SXJB 1AS2A 4BASA 1DAEA 1SXJE 1R6BX 2ZI7A 2RGEA 1G6HA 3RC8A 3RHFA 3QF4A 2HUPA 1OFUX 4QKQA 1E2NA 3KKPA 1LVGA 2N46A 4PO1A 4KCGA 3O47A 3QVVA 3AVQA 3CX6A 4EKDA 1XJQA 2JATA 4RSGA 3T1QA 3SI7A 4RJLA 2JLQA 1NVXQ 5CM9C 1E0JA 3R9IA 3RANA 1W4AA 3SYKA 5EQTA 1OHHD 2OFXA 2DZOB 1HYQA 1FW6A 2P65A 2GBLA 4KODA 1ZCBA 1G8YA 4I1VA 1NN0A 4LRTA 2NO9A 2ONKA 1FFHA 4QGFA 1S4QA 4XOIA 2JA1A 1T0JB 3IQXA 1UBGA 1AZSC 2HLDD 3C15C 5B58C 1KKLA 2JJ8A 4C0BA 3IEVA 1XEXA 1YZKA 3K9GA 5J5CA 4FINA 4MQBA 2FZ4A 3MUFA 2CNWA 2WJYA 2XOKA 4LX0A 3I3SR 1FOEB 2UZ3A 5JECA 4C3ZA 4HLUC 1FTSA 3L8YA 5G53C 5DN6A 3C5CA 1N6PA 2N42A 4L5BA 5CYOA 1E1QA 4JT2A 1XTIA 3BS4A 1Z3IX 4TL9A 2WKQA 4LC0A 1OPXA 5G40A 1VTKA 2IBMA 2J7PA 4IDOA 1E96A 4V0LA 1U90A 2WMOB 4R2IA 5BW8A 1S1CA 4EPXA 3L2OB 1UKZA 1YRAA 3CPHA 3QKSA 4JVLA 4MH0R 2J87A 3LBNA 1KZ7B 2HF9A 1D8TA 4ACAA 3OHMA 1YVDA 1NY6A 3T35A 1ZMXA 1L8QA 2E87A 4Q18A 5AWFC 1NLFA 1KTVA 2HLDA 4IVQA 3MMPA 3ND9A 1UKVY 1AN0A 1NVVQ 4UNQA 1C1KA 3M1IA 2R6FA 3NC0C 1NBMD 1OE0A 3X1ZA 2ODEA 3MCAA 5ELXA 3VNUA 3AM1A 1YZQA 5KO2A 2GKSA 4LHYA 1NMXA 3ADCA 3U3RA 2D2FA 1ZD1A 1N6RA 3LQRA 3LLMA 3PUZA 2R6AA 2FFAA 4BLQA 4A6PA 2CVFA 1G19A 5DI3B 1HA3A 1J8YF 2BIFA 4IXNA 1KK3A 1M2OB 1YU9A 4PFSA 2UKDA 2ZAOA 3S1AB 4YMTA 1T9HA 4DCSA 5B64A 1GUAA 1E1RD 4PTLA 1ZNWA 1ZYUA 2VHQA 5FPYA 4DUGD 3RRYA 3G82C 2CL7X 3R20A 1US8A 1DTSA 4Q4LA 3VU9B 3W6OA 5KNDA 2O0HA 3KXKA 3ZVMA 3LD9A 3I92A 1G4AE 3I32A 1ZM3A 4RKFA 1XMJA 4X8OA 2ZSFA 2AR7A 5TARA 2D62A 2Z4RA 2R6GA 1UKYA 2ATXA 1Q21A 3KQKA 1XCMA 1JQJC 3LXXA 3WMEA 2QMOA 3REFA 3L0PA 2CXXA 4M1OA 4LJ5A 4U5XA 2DHRA 1QHXA 2WICA 3AP2A 3SZRA 4XWKA 3FB4A 2ZM5A 4C2TA 5JWOA 1GKYA 4DEYA 3NBXX 4FWHA 1DAHA 5F98A 3MJRA 4WXRA 2XJ9A 2G0TA 3PV0A 2WWWA 4NH0A 2R44A 4PX9A 1R2QA 3EZ9A 1IXSB 5CJPA 1RFLA 2DBYA 2QRZA 4L9SA 4URZR 2GAOA 3H1TA 1Q1QA 2ZUBA 721PA 5KU1A 4OHXA 4OBEA 1XX6A 4TYNA 1Y3AA 2FFHA 5JJLA 3TW8B 3DDCA 3C4JA 5FPKA 3B9QA 1KI4A 3DEFA 3PJRA 3J81k 4M22A 1E1RA 4KITB 2QAGA 4U7DA 5G41A 3BGWA 1FP6A 2VL7A 2IYWA 2F1RA 2J0VA 4URWR 2ERYA 3FFAA 1H65A 4ZKEA 4JLDA 5E95A 4PXAA 4C0KA 1ZIOA 3VR1A 3T5DA 3C41J 1GRQA 4MITA 1W48A 5DHAA 1OF1A 5J4KA 3U3MA 3AV0B 1QVRA 2YOFA 4EPYA 2R9VA 4RD0A 2FPLA
chains in the Genus database with same CATH superfamily
4UEQA 1XNGA 2ZYSA 3GZTB 4D3YA 3NAMA 1FPMA 1FLNA 1A96A 4DYVA 3UV7A 5ER9A 1DRKA 3RVMA 4DR1B 4MB2A 2V98A 5D1NA 3QVXA 2DWUA 3X1WA 3PUIA 5KNCA 3LQKA 4KJZA 1XRMA 1H23A 3GT0A 4ZCLA 2XPCA 4PZUA 3ZNNA 3IO3A 3MK6A 1WBJB 2EKPA 3VV3A 3D9QX 1I1NA 3B1XA 4L9AA 4DV6B 1E32A 4QEKA 2JZ0A 3DFMA 4X41A 3U7QA 2P3OA 2VUHB 3GLIB 4RY9A 7MDHA 4I6JA 3N0TA 3E9MA 2DPXA 3C7CB 4DDVA 2EP7A 2HNAA 4CM4A 1MX3A 1AO3A 4FMCF 2OV6A 1XL1A 4MRMA 1SUEA 3ICCA 3KYIB 4TM8A 5KDOA 3UAYA 1YZ3A 3HJUA 4OSPA 2C99A 2X86A 2YFQA 1AKMA 5IN5A 3GV0A 3KJQA 5TGTA 5TRTA 1UP4A 3KOYE 2WYIA 1SVNA 2J3QA 3EWIA 3AM3A 2C5SA 4EEZA 1T5LA 5C53B 1PTKA 5EUQB 3LLVA 4U02A 3FMGA 4WESA 4EY3A 2CT8A 3I1IA 1Y4DE 3ZVLA 3ZDEA 1EP9A 2J0SA 5C8ZA 4BB0A 1RYYA 3M8KA 4HMQA 3WYEA 4B4KA 1TEVA 2Q1SA 2YWEA 1L5SA 2HA5A 4OQLA 5L3SB 1O6ZA 3PUYA 5TQJA 4BU0A 4JYCA 1EZ4A 4MR8B 4NFYA 1SHKA 4K9LA 1IL0A 2H17A 3IUSA 2KX7A 1KMCA 2VF2A 2WKRA 3WNZA 2A7XA 3UH0A 4LPKA 1R9GA 2OV8A 4A26A 2FFQA 3IXLA 2OL4A 1R6XA 1DRUA 4PYJA 4WX2B 2ASVA 4RNDB 2KJQA 2Z5VA 1SCIA 1B6RA 5CU7A 2BBSA 2DWMA 1MB0A 4AC9A 4YEDA 2XXJA 2IDKA 2ERCA 3W8EA 4M0CA 1U04A 2V9ZA 3OESA 5EA2A 5IASA 4AYTA 4RH3A 1TKRA 4ANFA 5HRCA 4RKRA 4GBED 2IYRA 3AJAA 4A7PA 3V4VB 3UMFA 2EKKA 2LCFA 3F9CA 5HSGA 2XUKA 2JAOA 1TZBA 1EJ0A 4X7MA 3WK7A 4ZPJA 3IEIA 1FP4A 4Q3AA 4CLDA 1K27A 3LKDA 3R0ZA 1M74A 3JAWB 4LCBA 2BM9A 2X7XA 2YHSA 2I6XA 2FY8A 4MMYB 1HWYA 1JFFB 2V4MA 3FSJX 3ZUPA 3PFIA 3T41A 1IY0A 1N9GB 1U8UA 1YOVA 3O21A 3ZE9A 4EELA 4CKWA 5HTOA 3PRJA 2BYTA 1BGXT 1GLNA 1MRSA 3I6QA 1GTMA 2G1PA 3MAGA 1U8YA 1T5BA 3GLSA 3H8VA 4LC1A 3R3VA 1QV7A 2WG0A 2WAYA 3H5TA 1KYIA 1YS1X 1FDSA 1EDDA 4XVUA 1V1MB 2E9SA 4FCTA 3PFGA 1WZIA 1IXSA 1II8B 1QTIA 1MZVA 3I9FA 4Y6OA 4XPZA 4K88A 1CEQA 5ESRA 2KM1A 3P4UA 3F6EX 2DF8A 5DEOA 3TOSA 1YI1A 1LFAA 3OU6A 1JLMA 1JJBA 1RD4A 2IUTA 1X42A 5COBA 2C7RA 3DR3A 3QENA 4FFMA 5HK8A 2A5YB 2C3UA 3H5AA 4MKHA 2I55A 1L7EA 1SCJA 1KO5A 2K4MA 4O33A 1NW5A 2JIQA 3KP1A 3W4IA 3RJZA 4P7FA 5DN6D 1EAYA 2HU7A 5HEKA 1TLTA 5IHXA 2QLBA 1I9GA 1YE9A 3T1TA 3LGSA 1GZ7A 3NHZA 3ZGLA 4GLOA 2P2GA 4J1NA 3BCHA 3LUHA 2XKJE 1MR3F 4NCAA 1IVNA 2XMZA 3VR3A 3UPTA 4JL5A 5LQMA 1P6UA 1DBPA 4NF2A 3X1JA 2P0YA 2VRCA 4HQNA 4D97A 5A4AA 2HA4A 5E4TA 1E5TA 2J41A 2JZCA 1Q3BA 3OJOA 1DGFA 3MHTA 4Q5IA 3PE6A 4I2NA 4XUDA 4DA9A 1C81A 4B6OA 2BMFA 1M76A 2A1UB 1U7TA 2BN4A 3L8EA 1P2GA 4ZEWA 1A5SB 1X80B 3DKRA 2N9UA 1SUPA 2N3ZA 5C8YA 2PUTA 5LXTB 5FP0A 4PC1A 1Y1LA 2E5LB 2R96A 2DKFA 1SC1A 4ZVRA 2Q5CA 4QQKA 2V4UA 2O20A 4YXFA 3CTMA 3FTQA 3AGQA 5CLQA 2H9IA 5LUBA 3VPGA 2JH3A 1Z0AA 5AJHA 3I42A 1K0UA 1YR3A 3K92A 3MGAA 5LU9A 4M1EA 3IRVA 4RSMA 4D3FA 5FA6A 4Q4JA 2W2NA 1Z4IA 1RJEA 1SCBA 2YXEA 3ML1A 2Z5FA 4YAKA 2RH8A 1WG8A 1J00A 5FBRB 4G81A 3AHCA 1RM0A 3H8WA 2DBQA 4TOIA 1SD5A 3QFRA 2EAUA 4IW3B 1XJ0A 3SR3A 5J9FA 2FEPA 4DIUA 4KXMA 2QMZA 2H1HA 2I3GA 4GPD1 5KTOA 1H2BA 1BMDA 4FGJA 3SAWA 1SBIA 3PLNA 2X49A 4U9IS 4MA0A 3EVDA 2C4UA 4ZEOA 5I6DA 5B6JA 2G5PA 5HRAA 2Y2VA 2OD9A 2CW5A 3ROKA 1OAIA 4BNDB 2ASEA 3OEHA 2H4ZA 3F6YA 4ALNA 4EJSC 2QZJA 4N6GA 3ROQA 1LY1A 4PHFA 4YDSA 2N0SA 4DLAA 3HDGA 4PU0A 4RWZA 1M2GA 3EH1A 4D4JA 1YACA 1T4MA 1Z4KA 2BW0A 1V9SA 3SPXA 2QX8A 3KQMA 3OQOA 3U3DA 3FETA 1QFXA 3SHWA 2TMYA 1NAHA 2FPRA 4CM8B 2QTRA 1PJIA 3HSKA 2WA1A 5MN5A 3LHFA 1FCJA 4UUAA 2QN7A 3BCRA 3JARB 3B8EA 4DCMA 4RMIA 1ATZA 3FI9A 1UFVA 5AUPB 2V8OA 2G07A 2QT0A 3VPCA 3N59A 4KPUB 4YN3A 5FQNA 2CNNA 1MN6A 5JSYA 2J9FA 4QGAA 2DECA 4GXTA 1DBRA 3QXGA 1XZKA 4MHTA 3WGOA 3JQ7B 4FFDA 1SOUA 4DAEA 4D4MA 3QWFA 3IPLA 3G23A 2QORA 2QW8A 1JPJA 3W5UA 1ZIYA 1KDTA 5G1OA 5M29A 4FFPA 3JAKB 1HXHA 4GOKA 2PKRA 1DKRA 1QZZA 3IQDB 4WJZA 1G7SA 1Q2UA 3IQIX 3R6LA 3UAGA 1FP2A 1B0PA 2R6ZA 5FXMA 5HF8A 4C2UA 3SXUB 3RK1A 1EUYA 1PWEA 4RTRA 4KIUA 3K70D 1NKSA 4MGIE 2OEPA 4B73A 2VF7A 3ZCPA 5IF3A 1C1DA 4V0SA 4LYJA 5CB6A 5K8VA 4J3JA 1M7HA 4PRYA 3F6PA 2Z58A 3ASYA 1RAAA 3DAYA 2WSSA 1X1QA 2CHEA 3I2YX 5K8JB 4ZVOA 4F91B 5HDQA 5C8YF 2HX1A 3WGYA 1E20A 2I4RA 4AJEA 3IUEA 2JLYA 2IE8A 3ANNA 4L8FA 2PGJA 2QVGA 4WKNA 3VPXA 5IT5A 3RGGA 4LJ8A 3QPBA 1F7UA 4KXYA 1TCUA 4CF7A 1Y7LA 1WVIA 1BRMA 2PNJA 1TECE 2H4YA 1F0KA 5TSDA 2DCUA 4N0QA 4B17A 4JBNA 3GCWA 3L92A 4RPKA 3ROFA 3GMIA 4MWOA 3DMNA 4CG0A 1YTUA 3E8SA 3MCVA 3ZD8A 3OQMA 4UULA 5KPRA 4BRWA 4LJ6A 1B8NA 3RWBA 1VHDA 2IY8A 3FWKA 4FC7A 3P27A 3JAMA 2JVKA 2QMUA 4R4JA 2GZ2A 1U63A 5LMNB 3VSAA 4Q9NA 1M34B 4BNGA 4TUYB 3SKXA 1PUIA 4IYJA 4JGGA 2OR3A 3HU3A 4MI6A 3LI2A 4TTQA 3ZHCA 4CU5A 3FOBA 2FZ5A 2NZJA 2BE7A 5B55A 2IBTA 1VJRA 4F9FA 1JB1A 5CIWA 4TUWA 3B3FA 1KWGA 1JECA 1DZ3A 2YY7A 1I5OA 1H1LB 3KOZE 1KDRA 1GTJ1 3PIIA 4AN4A 4BMNA 3IIIA 4IJFA 4WADA 4XJSA 2VHUA 2Q6VA 5EJ2A 4NMMA 4O1IA 1ZQ1A 3JQBA 4KRFA 4L5AA 4MVYA 1SG9A 2O8EA 1ISJA 2BUCA 1NF9A 2IHTA 5FV4A 4B3BA 1PR0A 5T3YA 4GDMA 1TUIA 2HHJA 4QJBA 3FX2A 4G6ZA 4I5EA 3BM5A 4TMYA 2ZYRA 2SKCA 4KO3S 2RMKA 3K5IA 2TS1A 4IOKA 1AKWA 2DFLA 1UJBA 1IZ8A 2YFYA 1ZMVA 4E7PA 5C1OA 1V5IA 3CUSA 1SVMA 3B51X 4GYJA 4NOJA 3WX0A 1QHNA 1MABA 4PG5A 2VFAA 1RJGA 4LF8B 1NDQA 4QG7A 3S81A 2JAPA 1GXSB 4C7VA 4W8HA 3PR3A 3BHJA 3IPYA 4MIKA 2XD9A 1NJ6A 1G4HA 4AM8A 2UVQA 1UMDA 3ZY4A 1X7HA 3LP6A 5KNBH 3QLUC 4JBXA 2C82A 4YECA 2C42A 1M9NA 4EY5A 4Y30A 2DSTA 3KSUA 4Z53A 1ZWLA 2Q29A 2NYUA 1IQPA 3I73A 4DLRA 1H2YA 1VI6A 1MBZA 3MWEB 2OO5A 4GL2A 4QDOA 5K6AA 2QPTA 3LRPA 5H37D 4DJFC 2IYSA 2D1TA 2E18A 2L42A 1Z4JA 1MO6A 2OZEA 3QWLA 2GBGA 4Q1EA 2ZP1A 3P8ZA 4KIWA 3JQFA 5HW0A 3NDJA 4CR7A 4ETMA 4W9MC 4ENRA 4MPRA 1NOKA 3SXJA 1N75A 1XA4A 5EAIA 4MRPA 4QOHA 4YT8A 3SJBA 5JH7B 2JCGA 2Y9PB 1JG2A 4KFUA 1RPJA 3KKEA 1GZUA 4TT3D 4PZDA 4PC7A 4NPHA 1P7ZA 2QUIA 4CG1A 4CFSA 2PANA 5I7OA 5JY1A 1RBMA 2AFRA 1HETA 1QTRA 2F43B 3A6KA 4DWOA 1XRNA 4RVGA 1MHPA 3NKLA 1QG6A 4R31A 3USZA 2VH2A 1IXKA 3O8QA 4ZU3A 3QIAA 1ODCA 5CFLA 4EFLA 3E3OA 4CMKA 1GZ3A 2SCUB 2XZLA 4ENWA 3DL7A 4YX9A 1MJ5A 1UFRA 5BRAA 1IAQA 1Y48E 3V3KA 5DHSA 3ONDA 1T9ZA 2QGNA 2QMEA 5C80A 2GR9A 2YIJA 4H3SA 1KBQA 2X8JB 2WF5A 1LDEA 3N2NA 4FI3C 3TWMA 5J4HA 5KNDH 1FXSA 1M0SA 2CKDA 1FU4A 1Y98A 3DBHA 2VYFA 3PDHA 4H0NA 5BR8B 3WXMA 3W8DA 4YAWA 1Z74A 1DRWA 4MP6A 1G9TA 3ZEAA 4JU9A 3NYWA 1PJSA 3VX4A 4LY9A 3N0RA 3UANA 5LWHA 3M9XA 2CRUA 5C3MA 2YN2A 2CBZA 3EF3A 1UR5A 1UEIA 1DS6A 1AGXA 4AF8A 1T6NA 1TC2A 1UXGA 4R98A 3O4JA 3KQYA 2GETA 4AY4A 2PRIA 1Z0FA 1REQB 1DWPA 3E2PA 4PXYA 1MEEA 5AW3A 1YCFA 3GZJA 4CMAA 2WDZA 8GPBA 3EMDA 5BVGA 3ZE7A 3FWYA 3U6MA 1FQWA 3U44B 4NCBA 3THWA 3GRVA 2X0RA 1RE1A 1JB9A 3FPKA 1VYTA 5B5SA 3E84A 3S99A 2YWDA 3AONB 1GR0A 1APBA 4ND8A 2VQ3A 2ANCA 3PGVA 1QLWA 4YFVA 4LE0A 4HAZA 5HMMA 1XFDA 5FTLA 1OI3A 2AS0A 1FJXA 1XN1A 3RSHA 4JB3A 1C7YA 4J6FA 2JIPA 4S1OA 2AG8A 5GIPE 1OVGA 1VM6A 2BEVB 2WTMA 5BPVA 2G7ZA 3WADA 2F5NA 5G0UA 3QX3A 1KPGA 4OQEA 2FDRA 4DV1M 1OIWA 2YYSA 1J0XO 1JAZA 3OT5A 3M9WA 2X0EA 4RHFA 4PZAA 4HFRA 3HTXA 4FIZA 4WKOA 1OAAA 1GO5A 4RHCA 5JCZA 5JRJA 4UREA 5FUBA 2I1QA 1KK0A 1PQ4A 4X20B 4EEKA 1ZK1A 2Y4NA 3DEYX 4QGSA 1CETA 2A3NA 5BY2A 1Q0TA 1PQWA 4G0XA 1VG5A 2VUUA 4H35A 1ODTC 3M83A 1UH5A 1DADA 3H4VA 3KOOA 5IBQA 2NADA 5IARA 3E4RA 3CGWA 4C0QC 1Z8FA 5K0TA 1XTZA 1RCTE 5K09A 1P0MA 3E7DA 3FYDA 3HCOA 3E9CA 4BO0A 4GICA 3BFXA 3BSSA 2ZWMA 1XMQM 2P8SA 2VYNA 3KPWA 1EJ2A 1LK0A 5BV1A 5KX5B 3E3LA 1CUXA 2NUTA 5H3LA 2EKFA 5LU8A 4BPRA 2WF9A 4I9FA 3CX6A 3CRNA 3K8OE 4NBLA 3CX3A 2DZOB 1G8YA 4H1TA 1NN0A 5ALSA 2FEAA 1S4QA 4BQRA 1P4GA 3DP9A 1IOVA 1YZKA 4RENA 3K9BA 1N7HA 3ADOA 2CY0A 3SHGB 2EG9A 1N6PA 5D1HA 5KCZA 3R3SA 1L1ZA 1S1CA 4G4QA 3QYJA 3SLRA 4ZJPA 5G4KA 4MH0R 4AJ4A 1IUKA 2XY4A 5LFAA 1NLFA 4CIZA 3TCKA 1NVKA 3NC0C 4AW9A 2WSIA 3BD6A 5C8DA 4F2WA 4DMGA 1NMXA 3NWBA 5KYUA 2JRLA 3LLMA 4MEJA 5IFKA 4IIVA 2PBZA 2XUGA 3CVOA 4LRQA 1V41E 3RRYA 1KU6A 1ZGZA 4MA5A 4B9AA 4HNAA 1ZM3A 2VATA 4RA9B 2I91A 2AJBA 3IS3A 1MLDA 2X5JO 1K97A 3VZCA 5TARA 4IBCA 5JLAA 4XASA 2QL7A 2A0KA 4OGFA 1YJAA 3SZRA 2ZM5A 1WSAA 1J5EB 4XKJA 1T4DA 3DTVD 1OLUB 5IPFA 2JA2A 3MJRA 3DL2A 4EVQA 3K9PA 5CJPA 3N05A 2Y27A 3TW8B 4L9RA 2CFRA 3UCEA 2KLHA 3DEFA 3I9KA 5JYBA 4U7DA 1UBNA 5K0SA 3AI2A 1E63A 4S0ZA 3WYCA 4L4YA 3D5TA 5DHAA 2IU6A 1BEEA 2CD9A 4L5YA 4Q9AA 3EUFA 3FYHA 4QEZA 1GQSA 2C5HA 2W0SA 4JI2M 2X6RA 3HLTA 2LH0A 3U48A 2G72A 4AQYB 3UH1A 4Z2YA 1ZRMA 1VEJA 4MUKA 4M9CA 2QF7A 4H4DA 1WUYA 4HMPA 3R7AA 3C43A 3I9JA 3AVTA 3MMXA 1G2PA 1F1JA 1YE8A 3TAHA 1LW7A 1AQJA 1WBBA 1E5VA 4RM2A 4D9BA 4ZOEA 4ER7A 5DNAA 3I5MA 3ADBA 4FXOA 4V0KA 2OHGA 2OXCA 2WABA 4LWPA 2Z98A 3WTBA 3P26A 1N6OA 3G7UA 2W4MA 2PJRA 2Q8QA 3G9UA 3U81A 1Y3BE 3AR3A 3BG5A 3L27A 4I66A 1IXRC 5B3JC 1IRIA 4KPFC 2BMDA 3S2YA 3VR2A 1V71A 4HDMA 4NOOB 1QV9A 1XD9A 2XIJA 3SVTA 2O1WA 2XMRA 3QKIA 1Q6ZA 3OQVA 3L43A 3O2JA 1CX9B 2XXAA 2AFHA 5KO3A 4TVSA 4ZZ1A 3EVFA 5A7HA 1W19A 4C0HA 3JZFA 4OQQA 3OF5A 1YQTA 4N5HX 2EQAA 2JLZA 3ZIAD 3SYLA 3ICOA 4IJ6A 4Q66C 5FULA 1GFSA 3WYAA 5BNTA 5JQWA 4WZBE 3KLBA 2AMFA 5KVSA 3J7AC 3JYQA 3W6ZA 1OW3B 4EHJA 4GYKA 4FYHA 1FLVA 1JAIA 1G8HA 4R7TA 3ZUGA 3OPMA 3HFJA 3FMPB 1QDRA 1NNLA 3K9HA 2CXPA 1O0BA 2HT6A 1WY5A 2FUG1 2P2LA 1XTBA 4BFVA 3TSAA 5KYNA 4U2FA 3LLSA 4O2AB 1P17A 3R23A 1VYHA 5H4GA 1MDFA 3KSDO 1TF2A 2DNAA 4CKCB 3LU1A 1DC4A 1MO3A 1GQRA 4Y2HA 5DM0A 1WABA 3ZEIA 2R25B 2W8BB 4DV2B 3D0OA 5BWCA 1L7OA 1P6QA 1KVQA 1NKTA 4K8RB 5DN9A 3QX7A 3H3JA 5C7OO 1IN5A 1ZR2A 3HPRA 2IYFA 2R1ZA 1OUMA 3PBKA 1QIDA 4JI6B 5HGXA 4D8WA 4QT4A 2XYPA 4JVNA 5BW6B 3L7KA 1V8ZA 3DR5A 1OZFA 1SKUA 3DKIA 2QL9A 1QDEA 3TCNA 4GP9A 2JY5A 3VOTA 1GDHA 3CTPA 3F5DA 1P4AA 5GINE 3M6XA 1SU4A 5AJZA 2IW1A 3PUWA 4KFSA 1SC4A 2R7NA 5DI3A 4JB8A 4CU2A 1RR6A 3HDQA 2CN1A 1DGBA 2QYOA 2ERXA 1NUPA 5JZBA 4RFLA 2YZMA 4FWIB 2B82A 2PXXA 1AMUA 3UUFA 2M6RA 2VBIA 3FMOB 4WFJA 3EH2A 5ALIA 2PL3A 1O97C 3AF1A 5CUQA 4HF7A 1NYRA 1W36D 1W0KD 3QBTA 4N82A 1A1SA 3K15A 1XVUA 4JFRA 2C4VA 5BN5A 2PGAA 2BGGA 1RQPA 5AM3A 4FD3A 4HFJA 3PRHA 4RV9A 1L9XA 2FCAA 4DVGA 3K3PA 1G7RA 2VUTA 3RIGA 3R5KA 4TXHA 4YP6A 5H5JA 2VA8A 3IUQA 3TE7A 1LTMA 5E8RA 1SBYA 3F1LA 3CN9A 1JG1A 4XSGA 2EATA 4IJUA 1V5WA 2WJIA 3AVXA 5KC8A 1Z7WA 4INPA 2DHYA 2I22A 4RFSA 1WW8A 1KNQA 2QTVB 2NW6A 5ALTA 4Y2GA 2JC3A 1Z68A 5K0BA 1JG4A 4X0EA 5KHAA 4YP9A 2E7ZA 3A26A 5F3WA 5F23A 2ZRDA 3I9LA 4RVOA 3ITNA 4DLSA 4MYSA 1R88A 3H6GA 4QM7A 3CE6A 2WRZA 4P84A 2VOEA 3K70B 2CE7A 4XGKA 2KQUA 1KVTA 5HKKD 3EIXA 1ORTA 5NULA 2Q5LA 3WBKA 2BEWA 4NCIA 4GP6A 2HO4A 5K4AA 3W0LB 2R4QA 4N0DA 3VR4A 3BRWD 4G89A 2FA9A 1RWQA 2CHFA 2G82A 5BNFA 1XBTA 4Y2XA 5IZCC 4BLVA 2VJCA 5ILQA 1ODSA 2A33A 2R8RA 4JD5A 4B4VA 1GZ6A 4EHIA 4ZHQB 3SVLA 2C9YA 5COAA 2VJBA 4AYWA 2VDOB 4MYUA 5D87A 4OXIA 5DOZA 2I7DA 2C2BA 1CZNA 3NP9A 3F6BX 1IIRA 3IODA 3ZWBA 1ZINA 1UM8A 3H3XA 4RHXA 3EDQA 4JH0A 3ON5A 4C6RA 1VLHA 5BYAA 3OLXA 1E2IA 1RJ9A 2VAMA 5JG7A 1VFPA 1E62A 4HGNA 4ZDJA 4MSUA 3ESBA 1X92A 4I4NA 2ZCJA 4K9DA 3ONEA 4WT7A 3C3CA 1PV2A 3THYA 2CLSA 1XP5A 5C4IA 4KYTA 2J7KA 4DLYA 4LFBB 3LL7A 1E3QA 1RLUA 5JJ5A 1R5JA 2PXCA 1T5IA 2DBRA 2RK4A 2YVQA 5H4HA 4OA8A 2IVFA 4ZOAA 5GZ6A 4OH7A 2NVUB 5JFOA 5U9CA 2O3QA 3ZGYA 3A32A 1WBDA 1BJRE 3FPBA 4OHMA 2XD4A 2EKZA 4N7JA 1PZMA 2MROB 2OBBA 4X24A 4H1UA 1C7EA 4CGZA 4IR7A 3A36A 3KYBA 3LKBA 4GLFA 1U94A 1LWNA 1X86B 1NZFA 4ANRA 1XNHA 2YJTD 2VRNA 5G3ZA 1NVAA 5CDGA 3OQIA 1GPAA 4OB7A 2ZSIA 4ZC8A 1V7CA 3UJDA 1ZM7A 1T36A 2GZAA 2F8LA 2M6SA 2DLCX 5F7OA 5TQ0A 3N3AC 4K1XA 4M1MA 1BCSA 3NXSA 2ETVA 1N8TA 3NOXA 4DWWA 2VJYA 1KYTA 5JS7A 3INNA 3N3BC 1NVGA 4B8ZA 3CZ4A 5FPPA 3OE4A 4Q12A 5DO9A 2BRUC 4OYHA 5EIBC 1Y4ZA 3A3KA 5HM8A 1ODIA 2EKBA 1P1JA 3KEGA 3MIZA 5KVCA 3RAFC 3R3WA 4JWTA 4E4YA 4B2IA 1E89A 3QY0A 4AS1A 3K0FA 4FLEA 2DFVA 4ZODA 3TB6A 3I1FA 2JFGA 2PO7A 4IHKA 5AW1A 1C7ZA 3WHLA 1BQEA 3EC1A 1NQAO 4ZXPA 4C4RA 1J0DA 4EYSA 4A27A 3MGKA 3NATA 3ROEA 3HFRA 1SPXA 2PQMA 3IKMB 3E7PA 4X64B 4B45A 3EEFA 1M1NB 2JGAA 1T2CA 3L40A 3SC4A 5EI5A 5EGSA 2XIQA 5C3UA 4RADA 1ZZGA 3Q8GA 1P5HA 1IM5A 2E0IA 2BAGA 1OZHA 2QZPA 2O25A 1RRPA 2PWPA 2J45A 4FZRA 3PD1A 4V03A 1A4IA 4GS5A 4BFLA 3PNLA 3ZBTA 1GRNA 1D7OA 3RFWA 1NIPA 1RM3A 6ABPA 1Z8HA 3LQYA 3W3AA 4CBVA 3PPYA 1QP8A 4O29A 4AY3A 4BFXA 1RQRA 2GNPA 3GVXA 2AT1A 1K6XA 3JRWA 1MC1A 3HABA 4AJNA 3TGWA 4ZZ0A 3GQ5A 421PA 3RYIB 4YLEA 3N2IA 4YRKA 1C1YA 5L9AA 4Y67A 5I01A 3X0DA 1G5QA 4PR3A 1XEWX 4PF1A 2DXIA 1TE2A 3EGVA 4WLNA 1QDLB 1VE7A 3N07A 2ODQA 2P2YA 4EUFA 2BFMA 4YRTA 3DT9A 2ZJ3A 3GF4A 1D6NA 3BFJA 1Z33A 5JO0A 2I9KA 4I55A 2QAIA 4E88A 5SY9A 3V1MA 3GLHA 3F9IA 2WAMA 3K8QA 4FE7A 4M4SA 4WY5A 1PQUA 4KFRA 3LBFA 4DLUA 1RYFA 4MA4A 5DTRA 3ZWAA 3W68A 1E6UA 4QE3A 2QSFX 3L6EA 4HH4A 1ZEMA 1GPLA 3EFEA 3DEHA 2JIZD 4MVJA 4GHWA 1WUJS 1C0LA 3U13A 4G1MB 4H27A 5ITTA 4AUKA 4CEJA 5ALOA 5ARCA 1XC8A 3PGA1 2VHTA 4DIOA 4ZQCB 5JCJD 1BXGB 1NUQA 3S1LA 5A03A 5E6UB 3LO8A 3DBRB 1U2EA 1DBWA 5EUCA 2LKCA 3U5ZB 3C6ZA 4BS9A 2P11A 1CRPA 3NEAA 1T9GR 4I5SA 3K0HA 4WK0B 3ZC7B 1OAOA 3QKTA 1HF3A 1CJSA 3T7RA 1EFPB 1LDMA 2GVNA 1PLJA 1ZZEA 4Y6SA 2VN8A 3WGHA 3E22A 1EDEA 3U3KA 3O8DA 2FCRA 4TTAA 2ATIA 1X8KA 2Q4RA 2GN4A 3V1KA 5AJXA 5A7FA 4BQEA 5ECDA 1JIUA 1NMEA 3U60B 5TV2A 3T3GA 4HNGA 1G21B 3LX8A 4H7KA 3FUCA 2D0PB 3HHPA 1JIJA 5CNKA 1GAEO 2PLRA 1P19A 5C32A 2FYTA 1GUFA 5EJAA 5AKYA 1DJMA 3ENKA 3GWGA 4R1TA 1Z35A 2C07A 2Y20A 1P1HA 1DFIA 4E0BA 4C4YA 1EFTA 4OQPA 3X43A 5FLEX 4RTMA 1IWPB 1NHGA 5SY4A 2PIDA 1X94A 2HQSA 4IZHA 3S2ZA 4W1QA 3LQ2A 3B89A 2V6GA 1G20A 2XGMA 4RL4A 2PU7A 1Z5ZA 1RZVA 2Q3DA 4Q3DA 2KHHA 4XCXA 4DHEA 4MQ6A 4RVNA 4TXNA 4BUJA 3VA7A 2NT4A 1STOA 1MW9X 2UXBM 2H1FA 3UMGA 3DT8A 1VDLA 3RRXA 4P1ZA 3L5OA 3QBVA 3LPLA 3CXUA 4KGDA 3VK7A 3H05A 3IBFA 3QNWA 1QO0D 3ZC3A 3Q87B 2I80A 3IRUA 1I0ZA 1ESCA 3HP7A 2IV3A 2E4YA 1I7QB 2XTMA 1DNPA 1VJDA 1SM4A 1F2TB 2B35A 1B93A 4C7OA 1K92A 4DIFA 5CLJA 4RACA 1MVNA 1N7GA 5JQGA 1BGWA 2PL1A 1G5RA 4L74A 2WT9A 1KEEB 4GZ5A 3TDKA 1OFUA 4LBWA 4LRTB 2XKAA 5LJLA 3KZOA 2PVSA 3CF6E 2VQEB 3VVMA 4PZYA 1HYHA 4MS4A 2I1LA 3V9PA 4CQMD 4HGZA 2C4HA 3EUWA 4NESA 1PT8A 1E3LA 1OC4A 1AQIA 5E1OA 3GLGA 3W2IA 4PX2A 3IQWA 3Q72A 1DOHA 3RV3A 4FWDA 2XVZA 2W6PA 2ZBGA 3JQGA 4I55F 5ARDA 1W88B 1ZN7A 3ED1A 5BYBA 2PFGA 3T3MB 6ADHA 1W75A 1YE5A 4TZKA 4HOYA 4HXYA 1Z5BA 5E4YA 1R4NB 3CJTA 4J0IA 4IO0A 2ARKA 2VP6A 4K0KM 1RHQA 1WZCA 1NUUA 3QTTA 4J9UE 4MVJF 3NBIA 3A1WA 4QYSA 1KY5A 2D7EA 1KSJA 4LCEA 1CZRA 4M9RA 1QIFA 2PFKA 4AZ3B 2CMFA 4D5GA 2BHSA 1N2SA 1O54A 3PXAA 5KTYA 4U39A 1ZMWA 1U1FA 4MGKR 3K6SA 1WDLA 2F8SA 3UK2A 1DGQA 1L4LA 3PHBE 2JFNA 3AESB 1GITA 1XCGB 2FPIB 2QAGB 3G9QA 4HDRB 4XARA 4HFNA 5JAHA 1I3NA 4YNBA 1Y1PA 2ANBA 2R6R1 5CX1B 1ST2A 2FR0A 5KQLA 3TR6A 5DYGA 1M8FA 3A1CA 2GCIA 5BVHA 4NX2A 3VISA 3DTVB 3UK0A 1R0LA 4JX8A 5C4MA 3HB9A 3IAM1 4KNVA 5GADl 3TKYA 4PX5A 1E3WA 3S0JA 3DLAA 4ZANA 4LZNA 3WJ2A 1D1PA 1TA4A 1XHLA 5TGZA 4B7CA 4BJ1A 4C22A 3EW7A 1LH0A 3VUEA 4UM8B 4WRRA 5E3JA 1H69A 3ZXIA 2JJYA 4XWTA 2GM5A 1RQGA 4LRXA 3F8TA 5IAOA 1IN7A 1WR1B 3E53A 1JR3E 2RGCA 2VP5A 3B9PA 1AJEA 1Q1NA 3MAJA 1WF6A 4UU8A 1ZNZA 4N7BA 5CM2Z 5T8KA 2GN9A 2QR3A 3LXRA 4YCMA 3QLJA 2DUJA 4IZIA 1ZL0A 4PSDA 4B4UA 3TWOA 2AOTA 1CUVA 1GP2A 2VQSA 2HPAA 1CEEA 3BE6A 4ZU1X 1OZ0A 4QPZA 4DARA 2WZJA 2HRBA 1USGA 1FVXA 4AZFA 1I4OA 4EI2A 1BWQA 2EHJA 2Y76A 5JQGF 3IEXA 4M1QA 1QANA 3EASA 3FROA 3TPFA 3ZV4A 3VC7A 4ZMSA 2XOKD 4KI7A 4QYWA 2LHCA 2CXQA 4MGZE 4L2IA 4UDNA 1GGFA 4IQ4A 2OC4A 1SY7A 3D3EA 2MCFA 3QVVA 3ORHA 3NTRA 2ZOSA 2DVMA 1LPBB 5BOSA 1M8GA 3JX9A 1E0JA 2R3SA 4O0LA 1NKVA 3VJLA 5E1BA 2R97A 2ZAYA 3I4VA 2WLTA 5B58C 1KKLA 3CW9A 4WBNB 2WJYA 4QXPA 4LX0A 2PBLA 3RC1A 4XIJA 4L5BA 1E1QA 1PK7A 1SWVA 2L2DA 1Z3IX 4TL9A 4JOQA 4H7EA 4NATA 4L08A 3QKSA 3VNAA 3OUUA 4BNVA 1UK7A 2FR8A 1SOAA 4YJDA 5JAQA 2HLDA 3DAPA 5CDSA 3JV7A 1WKCA 4LEIA 2EWMA 1IJBA 3N8GA 1HFWA 4AULA 4CLOA 3W1WA 4UD6A 2Z6QA 4JLUA 1NNJA 4BFCA 4PFSA 2R6JA 3BAZA 5G4LA 3IBTA 1NVEA 3JD4A 4LWQA 3LD9A 2X6TA 3LY8A 2UXDB 1LCIA 5EKUA 2M6LA 4KQCA 4C2TA 4YRPA 5JWOA 4DEYA 3HK2A 2DHCA 4Z4GA 2Y1CA 2G0TA 4BGVA 3KEFA 5ED0A 4CGYA 4B83A 4FUTA 1P1BA 3C4JA 2UV8A 3TNLA 3J81k 4KITB 3ROXA 4CG2A 2EIHA 3DO8A 4URWR 2IOFK 1E4EA 2OO5C 1E61A 1W48A 5K6AC 3DEZA 4RYDA 1BWSA 1POWA 4TLCA 3LBHA 1IXZA 3EJ6A 1NPTO 1SCNE 2Q0QA 1W36B 2UVDA 4BO8A 1R6TA 3GEEA 3M6IA 4PV7A 3OOSA 1OU4A 4K46A 1JEDA 3F5SA 4S04A 4FVMA 3TH5A 2J5QA 4TRNA 5DRYA 5K7SA 5FFFA 4CKZA 3L18A 3CGGA 3CMCO 4H17A 5KWIA 1OLSA 4QM6A 4IQGA 4K26A 2W6ZA 3A58B 3DQZA 1IC6A 3A25A 5IKOA 1CJCA 2WM3A 3H86A 2BFBA 5CK4A 2VZEA 4XX0A 4X95A 3RHSA 3M70A 1W5BA 3T4XA 3EG5A 3R3ZA 4FQ8A 3OBIA 2OZLB 3UYLA 2V97A 1ODFA 2PZLA 4OOFA 4YRZA 2FH0A 2OOBA 2WVAA 3OZVA 2B1QA 3KKQA 2DH6A 3LL4A 1Y1QA 1RI4A 2OGZA 3CVJA 3OAAA 2IVZA 3V42A 2ISSD 4GLBA 2OORA 4U00A 1Y0BA 1YASA 1H2XA 4R1UA 1UINA 4TLBA 3G8AA 1QCYA 4P2BA 3C70A 1QC5A 5KJ1A 3HCAA 4MYHA 1Q1EA 5A62A 3S4YA 2PMDA 1ULHA 5IHPA 3SICE 1GZVA 3I9V6 1BMQA 3R9KA 2CWWA 2HJVA 2HRRA 2ZJAA 5IN4A 1TL7C 3F6SA 4AZVA 3BUSA 1A9OA 3ELBA 5CT8A 3FTCA 1FQKA 2HA6A 3UG7A 4X8HA 2LVOC 4IEIA 1R0BA 1ISRA 1LQUA 5JYEA 2X2FA 3ZXSA 1SXJA 1P75A 4NU0A 4ITQA 2QVZX 4Q3OA 2WF7A 2OXFA 3ADPA 4HL6A 4LFAB 5BYJA 2VPXA 3I4FA 3HCCA 1WNTA 4C76A 1H4TA 1RDFA 2K5UA 4R2MA 4QXOA 3HMQA 4MO9A 1K63A 3F97A 2OCIA 4GQIA 1MQSA 1Z6XA 4V1CA 1GYPA 1Y5IA 4DUYM 5HKOA 3DNMA 2YVKA 3R7FA 4NDNE 5DLYA 4OAQA 2XMDA 3LZ6A 3GCGA 1Z6ZA 4CIWA 5ALHA 4DG5A 4EW3A 1PGYA 2BFCB 3EG9A 2G9RA 1N25A 1UZLA 4W1SA 2VNSA 4OV6B 3U9LA 2CUKA 5B7PA 3OOJA 2FH5B 4AICA 1LXCA 1H0SA 4MDFA 4B7AA 3H9BA 4QL3A 2FSVC 3VYRB 1Q83A 1E58A 2C03A 4XB1A 4US0R 2NU7B 4HGOA 1M6NA 5LIRA 2V0CA 5C5EA 3II6X 2W2LA 3TBFA 3HHYA 2VJPA 4UHBA 3PHGA 3AR5A 3E1KA 4IFEA 1XRPA 4M87A 1OX4B 2OLEA 2QRHA 2GPAA 3EXEA 1J0BA 5FO1A 1V47A 4GG1A 1QS0A 2E4ZA 1R2ZA 5JZSA 1A9SA 3TRIA 2Z4SA 3TQHA 1G3UA 5HJ5A 3B8HA 1EFUB 2OQIA 3G1TA 1W8DA 2F62A 3ONNA 2E5FA 1KH3A 5CLLA 4HRVA 4Z4CA 3V6LA 1PGNA 1F6DA 4Q01A 1BW9A 3H1AA 5C8XA 2WSLA 3LUFA 3KIPA 1FDOA 1H8EA 3UWOA 3MTGA 4RO0A 1HDOA 7MHTA 4L6V6 3UK6A 1L2CA 4YR9A 3Q3GE 4J6EA 5FR1A 1CS0B 1PAUA 3B6EA 2C2WA 4L76A 1MPXA 4WKBA 3LT4A 2P6UA 1JIVA 2EX4A 1A8QA 3GJ7A 2FOXA 3WB9A 4NARA 3AG6A 4Q34A 3HU1A 2R48A 2DPYA 4NYMR 2JZ1A