1D2NA

D2 domain of n-ethylmaleimide-sensitive fusion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
246
Chain Sequence
EDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the hexamerization domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Hexamerization domain
molecule keywords N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN
total genus 82
structure length 246
sequence length 246
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1d2nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d2nA01
4IDOA 4IFEA 4XSHA 4FI3C 1WA5A 3IGFA 3RSOA 4JSYA 1JJVA 1P2VA 2XJ9A 5AK0A 4LJ4A 3DM9B 4M9SA 4ZCLA 1IAQA 1NG1A 4NYJR 3VTKA 1TX4B 3W9YA 4QM7A 4GDFA 2ZITA 5JCPA 4TYPA 1E2HA 1B23P 3AB3A 5EXSA 5SZIA 1QF9A 5FR1A 3CR8A 4UXJA 4HAWA 4HAUA 2PT7A 3FTQA 3VAAA 2FZ4A 4MGZR 1XU4A 3U3OA 1KI6A 5GJCA 1COWD 4Q1CA 4L15A 4NPHA 4GFDA 1E2NA 1G7RA 1GNRA 3CF2A 1DO2A 4DUGA 5KNCA 3FMOB 3WRYC 2Q9AA 3BXZA 3NDPA 3IHWA 3K9NA 4RZXA 5J4VA 3AGQA 3K0CC 3RHFA 3K53A 3PEUA 4M1SA 4M53A 2AK2A 3RS5A 3AUXA 1L4YA 2QY9A 4HB2A 3O8RA 1ESNA 1S96A 1SVOA 3ZQ6A 4O2LA 2O8CA 2H17A 3AUYA 2B7CA 2KRKA 3UKDA 4LJ7A 4PC7A 3PXGA 3TAHA 1RYFA 2QPOA 4TMXA 5ANRB 5FUVA 3SFVA 3A4MA 5SZJA 5TVKA 1OYWA 5JSZA 1CR4A 3P20A 4LDJA 3TK1A 4ZPXA 4HUQB 2MSDB 1K6MA 1E0AA 2DWZB 1W1WA 2JJ2A 3HU2A 4FWTA 3D7MA 4DB4A 4Q9HA 4ON9A 3B78A 1NVXQ 1YZQA 2FPMA 3VR1A 4LRSA 1NLFA 4TN1A 1Z22A 2OFWA 1JEDA 3VR2A 3KQUA 2ZR7A 3AKCA 4KO8A 3PQCA 5KDDA 1Q1BA 2J1LA 2F9LA 3AKYA 4IVRA 4Q5IA 4DSNA 4WZBE 2P5SA 1OLOA 3RYTC 1HQCA 3DOEA 1OIVA 1QBKC 4Q4AB 3L8YA 3W3ZB 4YMTA 1MO4A 2ZS8A 2ZSAA 2AWNA 2I3BA 4MKIA 2A3RA 5KSPA 1JR3E 2ZAOA 4OK6A 2IEYA 5E95A 3THYB 4L5BA 4IRUB 4RY2A 4RD1A 3W6NA 4F92B 2CMKA 2F9MA 4KSBA 3WBKA 3U6KA 1DAEA 3UIEA 1DG3A 2ZI5A 1RVDA 3W6PA 2BBOA 1RJ9A 1P9NA 1W2GA 2F43A 3GLGB 1XTQA 4NCJA 1DADA 2PBRA 5D3QA 4MKHA 2IYUA 3PIRA 5HCIA 3P26A 1SHKA 2Z43A 1G21E 2A2ZA 3TSZA 4LPKA 5L3SB 3TGPA 4MRRA 2QTVB 3PEYA 2EFGA 5H70A 3UG6A 3PUYA 1AKYA 4KFTA 1L8QA 3WMEA 1QHXA 3BB4A 4A1FA 1T3LA 3TVDA 1EFCA 4WA7A 2I4IA 3RNLA 3U3MA 3X1YA 4KITB 1MRNA 4G1UC 2RGEA 3H1TA 4KBGA 4XH9B 4BFWA 1ZRHA 2CJWB 5DHFA 1HY3A 4O3MA 1GZSA 3KJGA 1R5BA 2B7BA 2ZYTX 2C77A 3KJEA 4YC7A 1XXHE 3I72A 4PSVA 2KBFA 4PC1A 4CDGA 5B57C 4X8OA 4A2QA 3NBXX 2ERYA 4PC3A 5JHGB 3SE0A 1KNXA 4JLAA 4I1UA 1GKIA 4EJSA 2WWIA 3ONWA 4DLRA 1AS2A 3KQKA 4BE7B 1E9SA 2ZJZA 3B1YA 3EWAA 2XSZA 1CS4C 1ZC3A 4X8LA 2W0MA 2ZI7A 2WKQA 3O8DA 1SKQA 2O52A 2P5TB 4GBMA 4H1UA 4S2EA 1XRJA 3AKEA 3B1XA 5E7MA 2TMKA 1NNEA 4YXWA 4FMCB 1GDDA 1PV4A 1VCMA 1OF1A 2PCJA 2WIBA 4OKSA 3CUEF 3F8TA 4JT2A 2YINC 5HKKA 1E0JA 3QUSA 3TKLA 3RAPR 1DAMA 2WPDD 1LNZA 3B1VA 2AD5A 4JLVA 5HKKD 2O8EA 4JS0A 1IXSB 2ZRBA 1ZM9A 2IUSA 1EFRD 1XD9A 1XCMA 4TWZA 3D3QA 2QPAA 4LOAA 3EG5A 2ZRLA 1DPFA 3TMKA 3B2EA 4EPWA 4CZ2A 3PJRA 4D0LB 4LI0A 1J70A 5FI0B 3OAAA 2ZJ8A 5KO2A 3D31A 4HZUA 3SYKA 1OHHD 1HQYE 2WOOA 2J9RA 4IEEA 5FUXA 3I32A 2Q3FA 2REOA 2AXPA 1N0WA 5CYOA 2QGZA 2PX0A 4C0JA 3IUYA 3THWA 2EYUA 721PA 5JS7A 3GQBA 1G1MA 1L2TA 3OF5A 4M0LA 4FWGA 4ARZA 2JATA 5CIQA 1W4CA 5DHAA 2PEYA 3C5CA 1E2FA 1KMQA 2F7SA 4DRZA 1WCV1 3ADCA 1JR6A 2FA9A 1OHHA 2IT1A 4B75A 1XPUA 4QKQA 2G0NA 1ZIPA 1N6PA 4LV6A 2RMKA 3QKSB 2VP0A 1HA3A 2CE7A 4Q9LA 2G0TA 4DLYA 1AIPA 1G18A 1NL3A 5B64A 5CDFE 1VECA 3TVTA 1FMJA 5EE0A 1T3SA 2AX4A 4C0BA 5DN6D 2BM1A 4RFVA 3VHXA 4KFUA 1E2IA 2GBLC 2OZEA 1COWA 1ZUNB 4IDPA 4LYHA 4QBIA 4RCZA 2BCJQ 2QORA 5LBIA 4C3ZA 2BIFA 2QTHA 2J41A 5LD2B 4DCTA 2FSHA 3FKSD 2QRZA 2FN4A 1N3BA 4CEJA 4DBLC 2XTMA 2QM7A 3LFUA 2YOFA 5HTKA 1G20E 3FHTA 3NKVA 3U4QB 2QMUA 1OJLA 4KSCA 4EFMA 2OE2A 5KSZA 4PPGA 4WBSA 1QHYA 3CONA 3VR4A 3X1WA 1OW3B 3RANA 4N0EA 3WXMA 5FL7A 3CB4A 5EXTA 4DWJA 1Z6YA 3TSOA 1NY5A 4PO9A 4TMZA 4EFNA 1E0KA 3SHWA 1W2HA 1R0YA 1G9XA 4GMDA 4ESVA 1US8A 4JLDA 4XD7D 1S0UA 2BJWA 4NU0A 2GETA 4B2LA 5FPSA 4IJMA 1KSGA 2IWHA 2GCPA 1OT3A 4QGHA 2HXSA 4TSFD 5FPTA 1JJ7A 3W3AA 4LJ5A 1OFHA 1UBGA 4LBVA 4GITA 3SJBA 5KOYA 2IYVA 2A7QA 4Z8XA 4W5HA 1OXXK 1Z06A 4C30A 2CCGA 2ODWA 2C04A 4XWOA 4B48A 2RCNA 3WP0A 3K09A 2IS6A 1P9WA 1ZU5A 3KJIA 2GEUA 1DELA 2NPIA 3ZH9B 2QZ4A 121PA 1XXHA 1RIFA 2IYXA 4BFYA 3QG5A 3TUJC 2QT0A 1WBBA 2QSYA 4OQNA 1LB1B 2O8FA 1W0KA 4OK3A 1D9XA 3QG1A 421PA 4GOJA 4NCHA 3SYLA 1F48A 3I73A 2JDID 4TQAA 1RZ3A 2GRJA 1E69A 3QENA 1VCOA 5CIWA 1QHHB 3MAAC 2ONJA 4KFSA 3OIYA 3AVVA 1ANKA 1TQ6A 2GXSA 2G9NA 2ZE7A 1OYYA 2DVWB 3U7GA 3WYAA 3TR0A 3V00A 2VEDA 1XD2B 3I3SR 5J4LA 4XVUA 1R0ZA 4CIDA 2IS4A 1XF9A 4IXMA 4JLJA 4ACAA 1CRQA 1XWIA 1N5IA 1FL9A 4JMPA 4KI0A 3OEED 1Q57A 2PH1A 4S35A 4CW7A 5IDVA 5EJEA 2ZJ5A 2WM9B 1VG1A 3EZ2A 3GJ7A 3IDQA 4NCIA 5JRZA 4YDSA 1GVNB 3LLUA 1N6LA 4HSEA 2WJIA 3P4XA 2JJ2D 3NEYA 4PHGA 5EE3A 2V3CC 3I1FA 3SJAA 2FFHA 1WMSA 1Q0UA 2LKCA 3SU8A 1XZQA 1GL6A 1N5LA 2AHOA 2A9KA 4OJQA 3WMFA 2XTZA 4D25A 2ZVQX 3R9IA 2ZRNA 2ZRDA 4ZKEA 4AYWA 5TMPA 5KPDA 4QHSA 1CBUA 1BYUA 1P61B 1KSFX 5C4GB 5KNBA 3LXXA 1IN5A 1GRNA 3QI2A 4ZIRA 4UQOA 2IS1A 2R65A 3OIVA 3QPVA 3T61A 2A30A 1DBSA 5E7IA 3CO5A 4RKFA 3HPRA 4E03A 3L0PA 1P75A 2J3EA 5JJIA 4AKHA 1Z3IX 1QDEA 3OE7D 1JI0A 2RGGA 4NH0A 1YRBA 4LV5B 5H68A 2F1IA 1R5NA 2WPDA 4U7DA 4JYBA 2ANCA 1ELOA 1KOFA 4UNQA 3JVVA 2GDJA 4V0MA 5L3QB 4G5GA 3K70D 2V9PA 2QMHA 4ITRC 4Q02A 1UADA 2HCJB 4U00A 4D0NA 1G3QA 2G1KA 2OLJA 3VX4A 2CHQA 3RS7A 3PV0A 2VTKA 2CLSA 3OZXA 1NMZA 1CJMA 1Z6GA 4MA4A 4A0GA 1GP2A 5TARA 3BB1A 3GJ6A 3BAFA 4Q1DA 2DWPA 1HT2E 1XFAA 1IBRA 3DOFA 4DDWA 4YMSA 3WY9A 2DFTA 2ZRAA 5FBRB 2ZJ2A 1AZSC 3CRQA 3S1AA 1GKUB 2BEKA 3K0SA 2ATXA 4Q48A 3UXMA 5KYKA 4BLPA 4PHFA 3P4YA 2DFKB 3B85A 3QVUA 3CPEA 2XAUA 3TUZC 3GP8A 4LYJA 3I5XA 3GEEA 2ZS7A 3I5YA 4MYTA 2OCAA 4MUAA 1E1QA 3K0AA 3ZIAA 2NO6A 1MKYA 5BYKA 1KI1A 2X8AA 1DAIA 3PITA 3CLVA 2A5GA 3ZLJA 3ZIAD 4G5SA 5DO9A 3W90A 1N6IA 2KJQA 2XOKA 2YWHA 4Z54A 1I4DD 4F38A 3U7EB 4GP7A 3LBIA 3P32A 2Z83A 1Z83A 1KHTA 2IBMA 1D2EA 4AYXA 2QL6A 3K9GA 2PJZA 2I1VB 2WIAA 1FUKA 4LZZA 4B3GA 3FHCB 1SVSA 4CEIB 1RE0A 1DOAA 3EZ9A 1HH4A 4JJKA 2IK8A 1SZPA 2FJUA 3TQFA 1TQ2A 2OAQ1 4MYHA 4UXHA 2GJ9A 1B0UA 2OEPA 4KBFA 3U60B 1PUJA 3VMFA 3SEAA 4A6XA 1CLUA 1GTVA 3VQTA 3EX7C 3NG1A 3U7HB 2E87A 4CVNA 3NBYC 5DISB 2RGBA 4FWHA 2GJKA 5JECA 2WWHA 5CLLA 2IF2A 1G291 4IXNA 3ICEA 2ZSDA 1II0A 2G6BA 4K46A 2VQSA 4JN6A 4NL4H 4Q7LA 5FBWB 1M8PA 3QEOA 2CK3A 5CM9C 4IHQA 2EU8A 5A4JA 3U5ZB 1E1RA 4HLCA 5FFMA 3SOPA 4URYR 4RFSA 5BWMA 621PA 1YZNA 3NDBB 1CJKC 1UBEA 3HR8A 3EW9A 4IVPA 2IWRA 2RGXA 3CWQA 2ZRMA 3AF0A 4JL5A 2HYIC 1HT1E 2WWYA 4UNSA 4KCGA 2ZI9A 3GJ8A 5LB2A 4B3FX 4IDQA 3O8CA 4D6PA 1P2SA 4WZAE 3LBNA 2R8RA 3AVQA 2QN6A 5FUYA 3T1VA 5KTYA 4DKXA 5C2JB 4TMKA 4O25A 2PZEA 2REBA 3K0FA 1VIYA 1XPOA 1NN1A 2AK3A 4EAQA 2R9VA 4NCKA 4BFXA 1G7CA 2QROA 4FMDB 4FMDF 5G40A 4ACBA 1KDPA 4M9XA 1IN6A 1H65A 4EPXA 4AC9A 3V9PA 5KSOA 2VSFA 2HJVA 5FBVB 3EIEA 1E3MA 1XD2A 3EC1A 1ZCBA 1MABA 3GLIA 3N2IA 2IC5A 2GJAA 3I8SA 1JAHA 1XJQA 1EX7A 4Q4HA 3FVQA 4Q4JA 4G01B 4UNNA 4A2WA 3OESA 1Z2CA 3JZAA 1QG2A 2H18A 1FOEB 5F98A 2CCKA 2YJTD 2V7QD 4TZ6A 4TMVA 3N5CA 1ZCAA 4EIWA 4URUR 4W5JA 1NLYA 1FTNA 1KKLA 1XMJA 2G83A 4J0QA 2NOAA 4HZUB 3UWOA 1IN4A 3A1SA 4RD0A 1YE8A 4C2UA 2D7DA 1AN0A 2V1UA 3OIWA 2G3YA 3CWZA 1VYVA 4DJTA 1KI3A 2BV3A 3SN6A 1E9FA 4M9QA 2D4HA 1S9DA 1E79D 2IS2A 2D2EA 4WOPA 1IXRC 1CJTC 2J45A 1KMHB 2OSBA 1KDRA 1CIPA 3X1ZA 1A1VA 4URVR 1S8FA 3ND9A 3PVSA 2R44A 4MYUA 4LPSA 5EP3A 1Z5ZA 2JJ1A 4NYMR 4TSFA 3L82B 1SKYE 3AVTA 4IOKA 3GFOA 2ZREA 2Q6TA 1K5DA 4JL6A 2MSEB 1NVUQ 1E9EA 2RGAA 4OYHA 1RYHA 1S9HA 5LPNA 2J7PD 4WAUA 3OEHA 5F9FA 2VBCA 1VYUA 1E32A 5FOVA 3TH5A 3KJHA 2Z6VA 2ORIA 3UWKA 3K0FB 4B33A 4JVSB 2OBLA 2CE2X 1LTQA 4XVRA 3BH7A 1JXMA 3KDSE 3KB2A 1ZM3A 4JLMA 4V0OA 1NVVQ 1Z0KA 2GEDA 1Z29A 2HT6A 1A4RA 1GWNA 3T12A 2ODEA 4Q7KA 4ZDIA 1FNMA 3AF4A 1CR0A 1E2DA 2O8CB 2J0SA 4DVGA 1D2NA 4NE2A 3CR7A 3GLIE 1AJEA 1QHGA 1T3HA 3O47A 2QP9X 4W9MC 1BKDR 2KE5A 2BCGY 3IIJA 2DZOB 1VDZA 1E99A 2FZLA 3KXIA 1N6RA 1KJYA 4HLDA 4CT4B 5JFGA 4EKDA 1NY6A 3AM1A 2ZM5A 2WAXA 4KODA 5IT5A 1X8KA 1W46A 4H9GA 3BFKA 5DIFA 4P4SB 4QJ4A 1XJCA 1VPLA 1R4AA 2VHUA 4DEYA 5L3VA 3IBYA 3IO5A 2PX3A 5FPKA 2OILA 3BRWD 5FPHA 4HLUA 2YZ2A 2J0UA 2B8WA 1II8B 2CL7X 2WJGA 2DY1A 3QOFA 1CULC 3TIFA 2WTUA 2AKYA 4FWDA 1EFRA 4GOXA 1QHIA 2ZRPA 3U7FB 1OH6A 5CK5A 4Q00A 4NP6A 4GP6A 1SXJD 2VHCA 3LVQE 3ZZ0A 1UEIA 1AGRA 1H8HD 2J7PA 2NO1A 4P4TA 1MOZA 1MRSA 2DBYA 2CL6X 1F2UA 2R6GA 4I1OA 4BFVA 4Q4JB 2NIPA 3TE6A 2YOHA 4JSTA 4LJYA 2LWIA 2ASEA 3GLFB 4U5XA 2RHDA 2F55A 1CJVC 1SVIA 3A6PC 3EIHA 2NO0A 3EPJA 2O8BA 3T34A 1AS0A 4HZIA 3HWSA 2UZIR 1G5TA 4B74A 1NF3A 1QVRA 4C0LA 2QE7D 2QBYA 2VF8A 3E1SA 1PUIA 2ZRHA 4QC2A 3HYRA 1XP8A 1KO5A 3W8NA 1SVWA 4B6FA 1FZQA 1W0JD 3KQLA 3QXXA 1CR2A 4G0NA 4JLNA 1E79A 1HV8A 3AKDA 1W4RA 4LHZA 1JPJA 3GFTA 4JBWA 3UATA 2P3SA 2FDCA 5F9HA 2AN9A 3KTAB 1ODFA 4RFSB 3I62A 2OHFA 3L0IB 2ERXA 3CX8A 3DMDA 2YYZA 1IHUA 4UNRA 1OKKD 1W0KD 1YZUA 3GEIA 3RS3A 4EUNA 1OIWA 1AGPA 1KNQA 2CVFA 2FWRA 2F3TA 2FMXA 5FBQB 4OI2A 4AK9A 4C4PA 1E2QA 4Q1AA 4NBSA 3U6BA 2QUZA 2WMOB 2X19A 4B6EA 3THYA 2FG5A 1TF2A 2KWIA 5DI9A 4QGFA 2JLWA 2OBNA 1AA9A 3CF6R 4GOKA 2PCLA 2XEXA 2FGJA 4WXPA 1XTKA 2GXUA 2BBWA 5CB6A 1TL7C 4JVMA 3TRFA 2R6FA 4CGZA 3F3YA 5DN6A 2MMCA 5JEDA 1MABB 3B7GA 3QSYA 1EFTA 1JEEA 1LW7A 2GILA 4BLQA 2WKRA 3M1IA 1LF0A 1G64A 2GXQA 5JWHA 2BVNA 5AUQA 5DSZA 4Q7MB 5JSZB 3FWYA 1DS6A 1EGAA 5K8LA 1MH1A 1JBKA 1KK2A 3B60A 4JZKA 2OXCA 1EK0A 2XB4A 4GRAA 3VLFB 5C1BA 5DLQC 1KY3A 4D2IA 2D74A 2QGNA 1RPZA 1P6XA 1XDBA 3G5UA 4LBYA 1ZINA 2OT3B 4MYCA 2F1RA 2DZNB 3BD9A 1I2MA 4RKEA 2PMKA 1XCPA 3LV8A 1SVLA 1Q3TA 1CJUC 2FSGA 3NEJA 2JCSA 1VG9B 4MGIR 3C14C 2EFEB 4Q18A 4RVCA 4DB2A 2GCOA 4TT3A 5JLJA 2QBYB 4HUQA 4OI4A 1T4GA 1GOTA 1TNDA 4URWR 1F2UB 3K0AB 3VHLB 1VHTA 2KBEA 4H1VA 4C7OA 4M1WA 3U3KA 3FFAA 1GIAA 3NHBA 4MRNA 1U0JA 8OHMA 1WP9A 3GJ4A 4JYCA 1GL9B 1Z28A 3CPHA 3L2OB 3AF1A 1VIAA 4D81A 4M1TA 4YQFA 2GJ8A 5H8WA 3DDCA 2W00A 4YXWD 2YHSA 4TZ0A 1S3SA 4FCTA 2ONKA 2NG1A 4UNPA 4BEJA 3KFXA 5M04A 1P72A 1CU1A 4UJ5A 5B30A 1NMXA 4E09A 1G5RA 1II8A 5KNDA 1C1YA 4Q03A 3ZD6A 4Q1EA 5JZVA 1F6BA 4I4LA 1KDTA 3AF2A 4C0HA 1BYIA 3H4MA 5EE5B 4ABYA 1DARA 2JLUA 5EP2A 4G5OA 4IVQA 2Z4SA 3CH4B 5CDFA 1A2KC 2HUPA 1GM5A 1ZUIA 1UBCA 1XCGB 2HV8A 1E4VA 1Z2AA 1ZD9A 5AR1A 1GSIA 4Q19A 1DE0A 2A5JA 3TSWA 1TMKA 1PZNA 1TQ4A 3NXSA 1OKKA 5HE9A 3F0TA 4B2IA 3GLIB 1ZC4A 1TEVA 3A1UA 3IEVA 2F3RA 2ZXUA 3GPLA 2HEIA 5JRJA 3F5FA 4O0MA 3BH6A 3REGA 1U2RA 2Y8EA 4GSYA 5FPYA 4GL2A 2ZSFA 4LYAA 1AK2A 2JGNA 4FXPA 1KAGA 4BEBA 2DR3A 3EZFA 1ETUA 3CZPA 3RWMB 1LVGA 1U8AA 2Z0MA 1XNJA 1UKYA 4OQMA 2VIIA 4A6PA 1TEXA 3AV0B 3D6TB 4JLPA 3ZS9A 4A82A 1G3UA 4L4UA 4ZDKA 3V4RA 2FX3A 2ZIAA 5IHPA 3KQHA 3VKHA 4FW9A 3RVBA 1XTSA 1MO5A 3IBGA 3ADBA 4L9SA 1DAFA 3WYFA 1E1QD 2IYSA 1ZM7A 3T1TA 4HDQB 5EE1A 4JL8A 2N1BA 2C99A 4GNKA 4PANA 3HYTA 4A15A 3E5HA 1AS3A 2PL3A 1U98A 3PCRB 3AGPA 4ASUD 1AQUA 3OE7A 3T1QA 1TU3A 1W0JA 3FHOA 1G5PA 1NVMA 4XTRA 5FOTA 2J59A 3AP3A 3EASA 3DM5A 3THWB 1T9HA 5CITA 1NRJB 4BFTA 3VX3A 2QE7A 1FMLA 2JEOA 4M9ZA 4IOMA 1XXHB 4RD2A 1EX6A 2GF0A 3SBEA 3BOSA 1D8TA 1LFDB 4M22A 3BGWA 2QA5A 3AVOA 2EFHB 1TUEA 2VA8A 3PG5A 3A36A 4OK5A 3HPQA 2OO7A 3EPHA 3MWLA 4P4SA 1VKJA 4D0GA 2QAGC 1X6VA 3BS4A 5H1YA 3W8RA 4M8NE 4MH0R 1FP7A 4F4CA 2JASA 4NKRA 5JWOA 1N6NA 3UK6A 3LVRE 4DLVA 3A1VA 1OH7A 2GZAA 1LF5A 3QPWA 4II7A 2BDTA 2OESA 3AJIB 1HTWA 4CEJB 1II9A 4Q47A 3RC8A 2ZYUX 1CKEA 1XD8A 4EJSC 2GZHA 2QSZA 4OHWA 4N0DA 2ZYWX 2JLQA 3R20A 1J8YF 5TY0A 5DYIA 4DC9A 5J4KA 5EP1A 4TYWA 1M74A 1UKVY 3VKGA 1E2GA 2IYRA 5GJVC 5KU1A 3GLFA 3NBZC 1S4QA 3GFPA 4ZDWA 2PJRA 4EJSB 3WHLA 2O8DA 4EPTA 4ZV4A 3CRW1 1JR3A 4TL9A 3ADDA 1NP6A 1JXOA 1BIFA 4B47A 1Q21A 4DCNA 5FR2A 3Q8XB 4LJ9A 1YJ5A 4P31A 1ZVQA 2EVWX 5G3YA 2UKDA 5TXGA 2N46A 3U4QA 4XJXA 1GUAA 1HURA 1NMYA 2FPKA 3RRYA 2VO1A 4DSTA 4MRSA 1KZGB 5FTNA 1D5CA 2YVUA 4IOLA 2P67A 1U9IC 4X8MA 2IUUA 4OQFA 3QBVA 4EFLA 1VCIA 4R2IA 3OIUA 1NN5A 5HZHA 3WYGA 2CJWA 1W36C 3ADKA 2F1JA 4KFRA 2HXYA 2PLFA 1J2JA 2R6CA 4P32A 3C4JA 2QMOA 4WZ6A 3H84A 1GILA 1ZNWA 4B2PA 1DVRA 1W47A 1Z08A 3CX6A 3LAWA 4PTLA 2ZSEA 1OFUX 3G82C 4IOJA 4Q9KA 3R8CA 3L0SA 3FYHA 1PLLA 5DE3A 1C1KA 4KLNA 2OBMA 3A4NA 3I61A 2JLXA 5ELXA 2ZR0A 1KI2A 1ZJ6A 3RS0A 1SHZA 2WICA 4BLOA 3L8ZA 4QM6A 3DHWC 1T8TA 4R7ZA 5JMTA 4RJLA 2IW3A 3A8TA 5CYPA 3GLGA 4LJAA 1ZW6A 4XD7A 1KK0A 3VR3A 5FH9A 2ZSBA 5TDHA 1HYQA 4WW0A 5KHOC 5AJZA 1JALA 2ZRFA 5J4HA 1L7VC 2W6JA 3KFVA 1FQKA 2VP4A 2BWJA 1ZD8A 1E2LA 1EWRA 1NN0A 4IDHA 4M21A 2W6ID 4I1VA 4MDEA 4XSGA 4TYQA 1KTVA 3RLFA 2FF7A 5TB5A 3SHFA 4PPFA 1UF9A 1Z0IA 1OH8A 1ZIOA 3FMIA 1PJRA 3PEVA 3R7WA 4IDNA 3DPUA 4PR0A 1TU4A 4F7WA 2GBLA 3RRNA 3OFNA 4CEHA 2C5LA 5SZHB 3K8YA 4A8JC 4M1MA 2UZ3A 4LRWA 2YWEA 2ZETA 4OHXA 2H5EA 4Q1FA 3ZZTA 3BBPA 4MGKR 1UKEA 1GKYA 2GK6A 4XIGS 2R6DA 5P21A 4BGDA 1NJGA 3EARA 5B58C 1OXSC 2ORVA 5JI2E 1IONA 3MFYA 2R6AA 4QOSA 1Z0FA 4P4UA 2QENA 1T5IA 2FEOA 5IF9A 3FOZA 1W4AA 2BC9A 3IPYA 5A5GA 4DLXA 2CL0X 3Q9LA 4DLWA 2JLZA 3MJRA 1XBTA 3LA6A 5DI3A 2MSCB 5G53C 3AVPA 2IYWA 4BUJA 2HF9A 1QRAA 2YWFA 3ETLA 1YKSA 3LWNA 1LS1A 4HB4A 2PZGA 1FQJA 5TV2A 4OHZA 4DZZA 2ZE5A 4UJ3A 1VTKA 1XEWY 1HEIA 3UPUA 5BN5A 4MGYR 5CK4A 3C8UA 5AJXA 4LC0A 1TF5A 2JIZA 1DTSA 2B92A 4K8OA 5LB4A 2C8VA 4G3XA 1R6BX 1RRFA 5HR5A 1Y63A 2N42A 3E70C 3SI7A 1S2MA 1X3SA 3RWOA 2QTFA 3I4LA 2XJ4A 3QVVA 3L43A 4BECA 2FGKA 2REXB 1QZMA 2AKAB 5KPJA 1DO0A 1S1CA 2XB2A 4RZ3A 4QJ3A 1KO1A 4P0TA 1BOFA 1C9KA 1T0HB 4NONA 4KV9A 5EXPA 4E07A 4M1YA 1ZMXA 4US1R 3RDPA 1GITA 1Q3HA 2HCBA 1YR7A 3PENA 2QAJA 3CIOA 4XOIA 1N25A 4LK2A 5FOUA 3FB4A 3T06B 2P0EA 1LY1A 2DFLA 2O5VA 1G41A 2QAGA 1VMAA 2QEQA 3DZDA 1OIXA 1M6NA 4TL8A 5FTLA 4LUCA 2G77B 5D3MA 3U3RA 3HDTA 5DGXA 1DEKA 1IM2A 4PC6A 1GG2A 4V0NA 4D4MA 4CEHB 4QNMA 1DAKA 4B3BA 2IA5A 4MKFA 1E2PA 2D3WA 3C16C 5EUQB 1FX0B 4US0R 2IHBA 2OXRA 4PFSA 2H57A 1OXUA 1WB9A 1XPRA 4HLUC 3PUXA 1V43A 1M2OB 2C2HA 4G5RA 4HYYA 4Q9IA 2WOJA 1XMVA 4ZCIA 1R5OA 3EA0A 4F91B 4LHVA 4HI0E 1WXQA 3TBKA 1M7HA 1G8PA 1WQ1R 2C78A 2GHIA 1XB2A 4ZO4A 1VG8A 2GWHA 4E5UA 1KMHA 3CRMA 1BH2A 3Q72A 4OL0A 2C9OA 2W6JD 1N6OA 5GJBA 2XSZD 3EIQA 4OI1A 2IYYA 1G8YA 3K9HA 2BMFA 4TLDA 5FUWA 1YZKA 2K5UA 3QE0A 2VP5A 1Z0JA 5JJKA 3ZZUA 3LW8A 1Q22A 2DWOA 1JECA 3QF7A 4KJZA 1GRRA 1YZLA 2OFOA 3A1WA 4ARZB 2H8KA 3EWSA 3WHKA 3T35A 3RRMA 1P60A 1R7RA 5HCNA 4DIEA 5CJPA 2RAPA 4BQSA 1SULA 4A3VB 4FMBB 5J40A 5E7JA 1OFIA 4QGGA 3X1XA 3GJXC 1M7BA 1W36D 4JLOA 4BRUA 3CBQA 3LX5A 4PSAA 3TUIC 1R0XA 4RD6A 2VHTA 4GT1A 4BRWA 2VH5R 5HPYB 4AKGA 2JAQA 3M0EA 1FUUA 1H8EA 2V54A 2B8TA 1Y3AA 4HDCA 4B3XA 1Q12A 2QU8A 3QBTA 3O8BA 3IIMA 2WSSD 3WNDA 2PMDA 2IX3A 1TAGA 2IYQA 5EXXA 3QKUA 4LSGA 4GZMA 1E98A 2W58A 4HEJA 2F6RA 3MLEA 2O0HA 4URXR 2V55B 2X2FA 2F1HA 4P33A 3ZVRA 3AP1A 4A0RA 5C46F 4CYMA 2A5DA 2DWQA 4JKIA 1PVOA 2H1LA 4XTCS 1EFHA 3KKPA 2ORWA 3A1TA 2B6HA 1XTIA 2EQBA 3BORA 2VF7A 2RH5A 4GMXA 3DMNA 1KI4A 2J0UB 3ASZA 1G7SA 2HYDA 2IYTA 2ZRKA 2ZE6A 2DYKA 1VG0B 1HE1C 4TTPA 1V5WA 2P6NA 1KK1A 3CNLA 4UXIA 4GZLA 2NGRA 3UMSA 2V6ZM 3PUZA 2ZANA 2VPPA 4LBZA 2BMEA 4JKYA 4FCWA 4LBWA 3QQ5A 2IYLD 5DNYB 2ZJBA 2G88A 2ZI4A 3CX7A 4KVAA 5LDDC 1Z63A 4D26A 2V4ZA 1IY0A 4AURA 2WWXA 1OB2A 1U81A 3BC1A 4PO1A 3R7WB 2JDIA 4OI0A 3VNUA 4Y0VA 2C98A 1H8ED 5FOXA 1TUIA 5CLQA 5CJ2A 2WZQA 3NH9A 1R2QA 2VP2A 3BK7A 2AL7A 1GL7A 1QHHA 4GPTA 4C2TA 2CNWD 1C4OA 1ZUHA 3IKJA 3OEEA 2QAGB 4R71A 3NC0C 3AVXA 1GAJA 2P2LA 4BFUA 3IQXA 1JB1A 1CTQA 2AD1A 2BMDA 3E2IA 4RZUA 4BFZA 2HT1A 3SQXA 1M34E 4DSUA 1Z6TA 2GJSA 3QNUA 3FMFA 5GVSA 3RS4A 4PPNA 4N3NA 5L3QA 2XXAA 4CEIA 2IHYA 4NDZA 1SVMA 1XEXA 2WHXA 3W6OA 1NG9A 2YC4C 4LJ6A 3SC3A 1R8SA 5EUMA 4ZCMA 3MHVC 1JNYA 2BKEA 4HAVA 1YQTA 5FI1B 1Z6AA 2XITA 4LJ8A 4YLGA 3Q7QA 221PA 2R62A 4RD4A 4NTZA 2J0VA 3LRPA 3DEFA 4ZIRB 2VRWA 3VU9B 2GA8A 3B1ZA 1F5NA 1KIMA 2QNRA 2GNOA 2VHJA 3EZ6A 4BZXA 1NIPA 2JA1A 1G3MA 1US8B 4LHWA 2FFQA 2ZRCA 2JJ8A 4B35A 4ZDJA 5BYJA 1NIJA 2FOLA 3W34A 4DDVA 3U2QA 4Q9JA 2EFDB 2J0QA 1SVKA 3NWJA 4WIAA 4ESHA 1SKYB 1UDWA 3LQQA 4V02A 6Q21A 1XZPA 3CKLA 4PSKA 1ZNYA 4AD8A 1PLKA 2ZU0C 1KSJA 2CLCX 4QXAA 4OQXA 4TMTA 3REFA 3EC2A 4LGMA 2W2XA 2FNAA 1NKSA 2EYQA 1R10A 3BFXA 4LY6A 2FE4A 3KXLA 4DIDA 2V7QA 1FX0A 1DAGA 1KY2A 4KXFB 2GVDC 3CNNA 3NIBA 4PHHA 3M4YA 3KQNA 4TL7A 5K8UA 1W7AA 1G17A 3Q5DA 2CDNA 3IIKA 4QG7A 2E1RA 2Q9BA 1K5GA 4Q66C 1WRBA 1OH5A 4KYIB 4WXRA 1ZP6A 3IQWA 3LD9A 2O8FB 1OFTA 3NHAA 3MSXA 1UAAA 2AFHE 2JLSA 3BE4A 1UDXA 3FKQA 3C7KA 3TLXA 3B9PA 1S1MA 2QQ0A 4EQ6B 1T5LA 3MUFA 4Q21A 2QQEA 2KB0A 1YRAA 3WNCA 2J5XA 1LV7A 2Q21A 4V0ME 3AVUA 2DB3A 2W83A 2DHRA 3SJZA 1EWQA 1J90A 1G19A 4DLTA 3OHMA 2RGCA 1DG1G 4Z1MA 5JCZA 1D6JA 1G8FA 2ZI3A 3MGCA 3CF0A 1W48A 3ZD7A 3EPLA 2VLIA 3I92A 2XNDA 2ZJYA 2GXAA 4YMWA 4G5QA 1W36B 4QRHA 3ZS8A 4L9WA 1U90A 1AQYA 5J5CA 1F3OA 2GAOA 2GKSA 2XNDD 3KXKA 4R2HA 1SQ5A 5IK2A 2VSXA 4TYNA 1KZ7B 1J99A 1Z0DA 3KKQA 4I99A 4Z1MD 3LW7A 5JEEA 1NJFA 2WWWA 1ZNXA 1G8HA 3MMPA 2BKUA 3BJIC 1KO8A 5FL3A 4TLAA 3KTAA 2RGNA 1KSHA 1Z8FA 3HR7A 3KKMA 2BEJA 4HDOB 3U61B 3VFDA 1A82A 1X86B 1OV4A 3C5HA 1OE0A 4E22A 3AP2A 3RRZA 4B32A 5BQ5A 2BM0A 2BBSA 3QY0A 1KI8A 1N0VC 5G41A 4LC1A 2G1JA 1XMIA 1YZGA 1E1RD 2OUKA 4OJKA 821PA 1IOZA 1OPXA 5FTKA 3B5JA 2CK3D 2NMVA 1N0UA 3P1JA 3RSLA 4PZZA 4TYYA 1NBMD 3T1OA 1FTSA 3HU3A 1IQPA 2W0SA 2AFIE 4HB3A 4BPBA 5K8IA 1NSFA 3NVAA 1EXMA 2XZLA 4PO8A 4B43A 3PEWA 4DT1B 5B2ZA 3LQRA 2YWGA 4IKEA 4MKGA 5JI3E 3UMFA 1QVAA 4TQUS 1XTRA 2BBTA 1KJZA 3CZQA 4KU4A 4CT5A 4W5WA 4C0KA 4KVGA 3R9XA 4Q01A 3SBDA 2A5FA 2WMNB 1U0HC 1P4SA 4EPVA 1UKZA 1E2KA 2WWGA 3KZ1E 3SS8A 4N1AA 3KB1A 1FPMA 2IUTA 3QF4A 3K70C 4QFMA 1BMFA 3IO3A 2C9CA 4NZYA 2VYFA 1UFQA 3C15C 4QBHA 3K1JA 4QGAA 5F3WB 5HZKA 4LHXA 1BO6A 1NSTA 4BZQA 4TL6A 1KJWA 1SXJC 2J46A 3AQ4A 3THOA 4U02A 4ILEA 3CM0A 4QBGB 2QRNA 4Q4AA 4NYIQ 4F93B 5K8TA 5JJLA 4PQYA 3DO6A 3MJHA 3QXSA 1KO7A 2OLKA 4F4IA 2JLYA 2IL1A 3D8BA 4NYJQ 5AJYA 3ZJYA 3QXCA 2Q9CA 5FTJA 521PA 4P3YA 4BLSA 4PQFA 1CP2A 2P6RA 1FP6A 3ZVMA 4D4LA 1P62B 2X77A 1X1RA 4B44A 3EXAA 4V0LA 2OAP1 1LS6A 3K0CA 1AZTA 1T91A 3QEJA 4PZLA 2VP6A 4B34A 2VHQA 3N2EA 4NMMA 2FH5B 5AUOB 1ZD1A 1YR9A 3JVUA 1CF4A 3EPKA 2WSMA 4B71A 2DCUA 2O8DB 2O8EB 3B13B 4RCYA 3W5JA 2QMEA 3T15A 1E2JA 1FW6A 3IPXA 2Q3HA 1MR3F 3X2SA 1SXJA 3BERA 1TQDA 4M2LA 3TR5A 5CM8B 2O8BB 2ZQ5A 2H92A 1XTJA 1W49A 2HDNB 1I4TD 4HB0A 4HAZA 3DL0A 5KUTA 1T8UA 2BMJA 3QXHA 5BN3A 1E9AA 2A78A 4FIDA 1WDTA 3K09C 1RRPA 2ZYVX 4Q1BA 2ZRGA 4ERNA 2JIZD 3VU9A 4A8JA 2XTNA 2NQ2C 3B9QA 4XVQA 1KK3A 3K70B 1F2TB 3U44A 3S1AB 3NTUA 4QHTA 1W5TA 1NN3A 3NBFA 4TT3D 4C0AC 5DH9A 2GCNA 4TLBA 3ICQB 1Q1QA 3KKOA 4IEIA 2FFBA 5KDOA 3SFZA 3GJ3A 4LRTA 3GJ5A 3MWKA 3RS2A 4JLKA 1SGWA 4LCBA 4M1KA 3EAQA 2FPLA 3PR1A 1TTTA 1XEFA 1JQJC 3QKTA 4XWAA 5KSYA 5D3MB 5L3SA 1RFLA 2YKGA 1QHNA 3DVLA 3H2YA 4AYTA 2PZFA 1G4AE 2CLDX 4PHTA 1CR1A 3HP1A 2P65A 4LX0A 4D82A 4TTQA 1FNNA 2JLVA 3B6EA 3UG7A 4FD2A 2QT1A 1IJEA 2OCBA 2J87A 2LKDA 4AWXA 1GNQA 1I4LD 4NYMQ 4A36A 1A2BA 3GEHA 4KHZA 5BN4A 3C41J 4ZI3A 2ZPTX 4M1OA 4EQ6A 1MT0A 3SYNA 4DUGD 3MWJA 1YR6A 2HLDA 2ZJOA 3I8XA 4QHYA 4V0KA 3VKWA 1XX6A 3T5DA 2RGNC 3CRVA 3BFVA 3OFND 2WWFA 3FFBA 4RZ2A 4A92A 1J7KA 2QI9C 4YMVA 3LO5A 3CRRA 4DLSA 4W7SA 2V6IA 2HJGA 5JHHB 1N6HA 3ASYA 2NZJA 1N2CE 1VYTA 5C4MA 4KAXA 4WVFA 2EWWA 2IXEA 3QJYA 2BJVA 1M7GA 4JVLA 2OCPA 3X1DA 3VNVA 4LYFA 3BWDD 2R2AA 2I1QA 3KL4A 1X37A 2JJ1D 2ODBA 2OM2A 4JT4A 5EZ6B 1N5JA 2FEMA 3G0HA 2WJHA 2C9YA 2CVHA 5LD2C 1RC8A 4FMCF 3PUWA 3TNFA 4F4JA 4LWZA 2KI5A 1P73A 4OBEA 3IILA 2GCOB 2GESA 2OV2A 3GCGA 3WBJA 2XNSA 2NTYC 4EPRA 4PQRA 2Z5FA 1KI6B 2ODNA 3CH5A 1Z0AA 5F2EA 3SNHA 2GAAA 2GF9A 5GVRA 1EFUA 4A8JB 2WBLC 3TW8B 1IY2A 4EPYA 4D4KA 5IRCD 2P6UA 4DXAA 2V6JA 2CCJA 5SZKB 2X2EA 1W4BA 1WF3A 1IJFA 4DCSA 3ECCA 2ZJAA 1E9CA 5AUNB 1CEEA 3BB3A 1G3RA 2PLRA 3KUDA 1YU9A 2YV5A 4MRVA 1ZBDA 2YC2C 1Q1ZA 3ZQJA 3MG9A 3AH8A 1U8ZA 2CXXA 2IXGA 5C18A 3Q7PA 1S3GA 1JR3D 3QXJA 2H7VA 1OXTA 5FL7D 4B76A 2RB4A 2L0XA 2D62A 1MO6A 1NVWQ 3FKSA 3RC3A 4QJ5A 4L16A 4DSOA 3BH0A 2WKPA 4KLZA 5L8VA 1AM4D 1OXVA 4JJZA 3WRXC 1IN8A 1Z47A 2D7CA 2QP4A 2ZUDA 2C96A 4TLEA 1E6CA 1ZAKA 1P7CA 4URZR 1YVDA 4XWKA 2NO9A 3QF4B 4LHYA 2AR7A 2ZROA 2QM8A 1EESA 1E0SA 2XXAB 1NKTA 3LLMA 3NH6A 3RABA 3QPUA 1E94E 2W2TA 3ZGXA 3THXB 3P27A 5BW8A 1EG7A 1KI9A 1VHLA 3SR0A 4A9AA 2Q3MA 2VL7A 1O87A 2IXFA 3PUVA 2E9SA 2WSSA 2GTPA 4A2PA 2X1VA 1SXJE 4AKEA 1X8LA 1P2TA 2HF8A 4PAOA 1Q1EA 2ZI6A 3AEZA 5DI3B 2CHVA 1U9IA 1RRCA 1E4YA 2YOGA 3ND8A 1XMSA 4FINA 4IFBA 2B21A 1IN7A 5L3RA 1HE8B 1R8QA 1NLZA 5JBQA 1HUQA 4CRWB 3HJNA 2ZUCA 4DT1A 1N6KA 3TQCA 4ASUA 4JIMA 4B73A 4JBXA 3OAAD 3GD7A 3FDIA 2FSFA 4DDTA 3CPJB 1VCNA 4A0FA 1SXJB 2NZ8A 2VP9A 3ZYCA 2ZVPX 2RGDA 3HU1A 4PPQA 1P2UA 1P3JA 1K8RA 1XEXB 1QHSA 3MRSA 2ZS9A 1ZM4A 3FMPB 3OEHD 4TQ9A 3VR5A 1D9ZA 3R8FA 1Z6XA 2KSQA 1KI7A 4NYIR 2W2VA 2LCFA 2FFAA 3WP1B 4AY2A 2XZPA 1KDOA 4PAMA 1WBDA 1BMFD 3Q5EA 1UM8A 4A0HA 3VR6A 2WJYA 5EZ5A 4I81A 1IY1A 3R9WA 2RKOA 1ONBA 2ZTSA 2JLRA 3A4LA 3B8HA 3GLHA 5FTMA 3FE2A 1ZNZA 4TMWA 4FWIB 5GJWC 5AUPB 1JQLB 1W5SA 2O0KA 4DEXA 1J8MF 4DDUA 3SDZA 1ESMA 2CHGA 3N70A 4HUTA 3A37A 1GRQA 2FV8A 3KX2A 4HATA 3ZVLA 4ZKDA 5J4YA 4QL3A 4L8GA 2WJJA 1FFHA 4FN5A 2XGJA 2D06A 3BIFA 1QZXA 2BHRA 4PXAA 4PZYA 3WNBA 4AG6A 4RSGA 1IXZA 2ZEJA 1U0LA 1DAHA 3TJZA 1UBFA 1UPTA 5A0FA 1O3YA 5GADl 4C7OB 3KUCA 3DKPA 4DCVA 5E3HA 4EDHA 1G6OA 3AVWA 3IHLA 4Q7JB 3SQWA 1F60A 1E2MA 2NPFA 1G3IA 3GMTA 3LDAA 3QKRB 3U44B 5JWRA 3EA5A 2O0JA 1CXZA 1WE2A 3A58B 4QBFA 3WMGA 4US2R 5DYGA 1QG4A 2ZR9A 4MUBA 1CRPA 4D4JA 1NVVR 2GZDA 1OSNA 1TADA 4BZPA 3PFIA 1A7JA 1RKBA 2IF0A 3ZVNA 1GNPA 1TPZA 1G16A 2RHMA 4BLTA 2UVQA 1RW4A 1KO4A 4AI6A 1XEWX 1KYIA 1NI3A 2ATVA 2C03A 1KKMA 1H8HA 1N5KA 3DKVA 1RJ9B 1X8JA 2F43B 2ZRIA 3KKNA 4MITA 4AKIA 3FGNA 4B3CA 4OHVA 1MO3A 4PC2A 4FCVA 4BFSA 4TLCA 2Q0HA 1W44A 1NBMA 1E9RA 5IK2D 2H16A 2OFXA 5KDLA 1YHNA 4M4SA 3GLGE 1G7TA 3K0EA 1TF7A 4BWYA 3B82A 4JLBA 4JVNA 4YMUA 2IEZA 5AJVB 1ZU4A 2J7KA 1P5ZB 1Q44A 4AIIA 4ZI2A 1UEJA 3K9LA 5FOWA 2WVJA 4C9BA 3LBHA 4NHOA 2QP3A 2ZRJA 4LV8B 5G3ZA 5EQTA 2WJVA 1E2EA 4PX9A 1MV5A 3EZ7A 3CNOA 1A5TA 5E4FA 2SHKA 3KW6A 1Q20A 5J47A 1U99A 2ZUBA 3LX8A 1R0WA 2FU5C 2FSIA 4Y0AA 4DLZA 1KAOA 1KGDA 2V8OA 4CF7A 2ZU6A 4D80A 4V03A 1ZM2A 2XX3A 2IYZA 4TTRA 2Z4RA 3JZMA 3GJ0A 3UMRA 1Z07A 3H86A 1T0JB 3Q3JB 3T5GA 3MCAA 3MD0A 2XZOA 3J81k 3W5IA 4C0SA 1JAIA 4Z8YA 1G8GA 3L0OA 1YZTA 1M1YE 3LH5A 3Q85A 4OHYA 2EWVA 3V4FA 4BASA 4Q4LA 2GEVA 1UJ2A 2GVZC 4MQBA 2C95A 3CW2A 4DCUA 1F2TA 3MWYW 5EP4A 4QNRA 1D2MA 2DPXA 3U3JA 2WV9A 2YNMA 4POAA 1G6HA 4K81B 3QIAA 2VSOA 4YDHB 5AWFC 2QPTA 2BOVA 1NBME 3SZRA 4B3DA 3H0KA 3FPAA 4DLUA 3LY5A 4GI7A 4Z51A 4KYUA 2QG6A 2ANBA 1I2DA 3LXRA 2EFCB 3AVYA 1BS1A 1E9DA 3QKRA 2PT5A 4R98A 1GFIA 2PEZA 4MDFA 4IW3B 3QKSA 4HLQB 5EE9A 5BXQC 5FOSA 5CB8A 1YR8A 4JBYA 1U8YA 1PLJA 4I1SA 1RRGA 1U94A 2EW1A 2XOKD 3UANA 2CBZA 5JS8A 1P9RA 1AKEA 2D2FA 4C0QC 2OG2A 5UKDA 1T6NA 4RD3A 3TW4A 2NO7A 4R9UC 4HAXA 1OB5A 4MRPA 2A5YB 4HAYA 2MMGA 3GLFE 4YONB 4A4DA 3THXA 1XJ0A 1E9BA 3SJCA 5AJWA 5FBLB 3ZDQA 1G4UR 4O2RA 4BLRA 1L4UA 1ZYUA 2AXNA 2W6IA 2ZAMA 3NC1C 4NCNA 3AF3A 2AWOA 3GLHB 5HE8A 4OQLA 4UKDA 2ZE8A 3B1WA 3IEUA 2WAYA 3LNCA 2V1XA 4DHEA 3M6AA 2DFNA 2CEAA 4AG5A 2CNWA 2ECKA 2OCYC 2GK7A 2HLDD 3DZ8A 1JPNA 4X8HA 3TAUA 4Q4HB 4PAQA 1E96A 1X1SA 3GLHE
chains in the Genus database with same CATH superfamily
3OJFA 2D2XA 4IDOA 3ZX5A 1P81A 4Q3KA 1AG9A 1NOKA 1WA5A 2OB1A 1CNEA 3BDAA 1P2VA 1QV6A 2H9AA 5D7BA 5KX5F 4M9SA 3EXEA 3Q7SA 4PN3A 1E6MA 1IAQA 5K0NA 5ADWA 2RH8A 1ULTA 3VTKA 4P92A 3JQBA 5CBPB 4MZDA 1B23P 5EXSA 5FX2A 1WVIA 1KDYA 1VLHA 1Z74A 1BH6A 3WYEA 5AIBA 4H6PA 2KEBA 4DV3B 4O08A 1HNWM 4RJKA 3FI9A 2PT7A 4PONA 1YB7A 2BTQB 4KZKA 4MGZR 5HRAA 4IZ6A 1A0OA 5GJCA 1CD5A 3ZX4A 2DR2A 1V96A 1E2NA 1T1JA 4JXXA 3G5TA 3EOZA 1G7RA 3ZWOA 3OPYB 1U3DA 1DO2A 4D96A 3KOYA 2PFGA 3E8SA 3FMOB 5KYUB 2CF6A 3BXZA 4MW9A 2Y9MB 1YDEA 3AGQA 4K2HA 3K0CC 3GGDA 4JOCA 4M1SA 4M53A 4TRMA 3OA2A 1XA0A 2AK2A 3EZYA 5DCYA 5EPUA 1XZJA 2QY9A 2C5GA 3L46A 1Y81A 4HB2A 1ESNA 1SVOA 3GUZA 3T94A 3WIOA 4WFIA 3CINA 4O2LA 2H17A 2IHKA 2B7CA 5I9SA 5ARCA 4X6XA 1WHTA 3SFVA 5ANRB 5FUVA 4RKYA 1ZESA 5JSZA 5F5XA 1CR4A 5ALKA 2WHEA 1N7JA 1P7VA 4CKXA 5BRNA 1QO9A 1S8AA 1XL1A 1RWVA 2JJ2A 1GPBA 4MWCA 2JNHA 5KPTA 1GLGA 2FX5A 3FVWA 4DJJA 1RAFA 2W6NA 5JSFA 2AQIA 3ED5A 3KTDA 3OUTA 4ON9A 3B78A 1NVXQ 4YJ3A 4FD3A 3OTQA 1NLFA 2AW3A 2JFUA 2OFWA 1TEHA 3MTAA 4HUJA 1Z4JA 3BKWA 3VR2A 5A06A 4RTSA 3PQCA 2DJ5A 2YIJA 3NHRA 1C9YA 1QVZA 2HV9A 2BLNA 4GBGA 1Q1BA 2J1LA 5EQJB 1B8UA 1P9OA 4WZBE 1ZGJA 4Y2VA 1YBMA 2Z9BA 1MQ9A 4GQAA 3RYTC 4KPUA 1VLLA 4RE5A 4P36A 5FWXA 3W3ZB 5F21A 4YMTA 2VUSA 2HL7A 2ZS8A 2ZSAA 2GK3A 3N7TA 4HGNA 4MKIA 4XCVA 5ALIA 4ZXFA 3L4KA 1JKMA 2B3TA 1GNLA 2IEYA 3DYBA 4FHZA 4UD6A 1V2HE 3THYB 3MFQA 4ECAA 3D8TA 4I9UA 4HDNA 1TM7E 2IX9A 2HU2A 2YY6A 5DEOA 5EYPB 3ZI0A 5T3UA 1T6ZA 3DGFC 2BGMA 1J9ZA 5LWHA 1DAEA 3U6KA 3QV1A 1DG3A 3ETNA 5JQWA 2ZI5A 3W6PA 1YK0A 1RJ9A 1P9NA 2F43A 1Z8DA 2VEOA 3HCDA 4IGFA 2VUIB 4NCJA 5D3QA 4IIVA 3PIRA 1FMTA 2OD9A 1U0EA 2DPMA 3EDQA 1SHKA 3QYAA 1VMIA 1YJCA 4HQNA 2Z43A 1G21E 4N9QA 5AT1A 4D9HA 3LY8A 1O95C 3WB1A 1UZAA 3U6CA 2ID7A 2OO5C 2QTVB 3IVXA 3MVEA 2EFGA 1Z7WA 4OJTA 1HZZA 3GQ5A 1YB2A 1Z5CA 4OJNA 4TKUB 4KFTA 2KZSA 1J5EM 4QRIA 1PW7A 3VH4A 3ZW7A 2CWBA 1FLAA 1QHXA 1KZ9A 1VHWA 3P0FA 2GK4A 4ZI7B 3RNLA 2MT9A 3HACA 2Q0QA 4G1UC 1PT5A 2RGEA 2QUJA 3W5HA 1G2PA 1ZRHA 2CHUA 4O3MA 1Y3IA 1GAXA 1NP7A 2WVAA 1IHDA 4TKZA 2DPGA 3QA3E 2FXIA 3KJEA 3TQHA 1XXHE 4GWKA 4B0OA 4AKSA 2FK7A 1CY2A 5M29A 4PC1A 4JU8A 1FTQA 4KIJA 5ALTA 1N5RA 4B4VA 4A2QA 4CDGA 3OZWA 4B2YA 3CUWA 1VFPA 4LTMA 2QTCA 2X58A 4UU7A 2C9DA 4QBTA 4WKNA 2P35A 4WCFB 4CFSA 4DE5A 4EJSA 5A1JA 2IY8A 4LI3X 3F3SA 2R4UA 3D4PA 1AS2A 4ZV9A 4N18A 5E2IA 4OLBA 1I9CA 1ZWLA 2CLIB 3L41A 1FW8A 5KKAA 4A6EA 1CS4C 1P4AA 2FZ5A 3EBPA 1MC5A 4JELA 5DNVA 1GSAA 1M6VA 2ZI7A 4L8WB 5DTRA 5H9VA 5IAKA 1SKQA 2APJA 1FNSA 3ZJUA 3P0IA 2P5TB 2KXEA 2VHXA 4ES6A 1H9CA 1EJBA 1W34A 2C2MA 1ZA1A 4H1UA 1GPMA 1YS9A 3MK6A 1XRJA 1SJ9A 3AKEA 1O5TA 4FYJA 4S2EA 2TMKA 4FDUA 5E7MA 4FMCB 4PU0A 5EGNA 4YXWA 1NNEA 3PCTA 1PJAA 2JUJA 3DZKA 3RJTA 5KX5A 4GKBA 4L27A 3Q40A 3TKLA 3QUSA 3KHTA 1LNZA 3B1VA 1UPAA 5AW8A 1VE6A 4B5KA 5HKKD 2EV9A 5FAKA 2CP8A 5BN4B 2RHRA 2O8EA 3OLZA 3NHUA 2IUSA 4H3HB 3CW9A 4BVJA 5BR8M 1M2VB 4AO7A 4NXMM 1ECBA 3HJTA 4J4HA 4LOAA 3B2EA 3MQ2A 3J80S 5EIBC 1TJ4A 1MH9A 4X20A 4D0LB 2ZIFA 4LI0A 1J70A 5FI0B 4OX9M 1QE3A 3OAAA 5IJXA 3VZQA 4PGGA 1HFJA 4HZUA 1OHHD 3U1TA 1HQYE 2J9RA 3I32A 3B5IA 4DR3B 4X20B 3GEBA 2CD9A 1TUBA 2EYUA 3V2UA 3PC8C 1P45A 3OM1A 2YXBA 4QQRA 6ABPA 4U6QA 4FWGA 3GJQA 3NYWA 4H7PA 4ARZA 4DR2B 3PXUA 3L0DA 5CIQA 4IHKA 3C5CA 3ZK7A 3NUGA 1AK1A 1K6XA 2KNAA 2PX6A 3CLUC 1GDTA 1WCV1 1Y8AA 3LDGA 4FHGA 1OHHA 1M72A 1GCAA 1RQNA 3VTZA 3QRWA 8MHTA 1U5BA 1ZIPA 3QHAA 2QVYX 4HG2A 4UVGA 4ANFA 4EA6A 1GQOA 3FYTA 4LRQA 1FP2A 3REQA 2AOUB 2G0TA 3T5PA 1XU7A 2QVGA 4WZAA 4FT2A 5GP1A 2YV2A 1FFCA 1LNSA 2PKXA 4GLLA 5EE0A 3UN1A 4C0BA 3WNQA 4B3MB 1QAOA 5G02A 4EMBA 1Y9EA 3DFMA 4ZTUB 3VHXA 4LYHA 1XL0A 4IDPA 2OZEA 1COWA 3GQVA 5HKKA 1AZLA 2BISA 3OZDA 2FZEA 4UULA 1VSTA 2WHQA 3V4OA 5LD2B 5ECWA 4DCTA 4IBDA 1CZUA 4UCXA 3FKSD 3K4QA 4FNAA 2QRZA 3WLHA 3WLNA 3UBTA 1FK8A 2XTMA 1SG0A 2QM7A 5IDXA 3I2FA 1I94B 3CXUA 5A3RA 2PMFA 2QRLA 1A9RA 4P3KA 1G20E 4JI2M 4LYEA 4O4IA 3FHTA 4IS2A 1TAQA 1OJLA 2Z9CA 5BWLA 1MB3A 5E6SB 2XODA 1CDZA 5ILGA 5KSZA 1XNQM 5SYAA 2NZUG 3WX0A 4Z7OB 5I9LA 5WRFA 5KKCA 1KEVA 4YRLA 1ZGHA 4RK4A 3ABRB 3LDHA 2PLAA 5TQJA 3NRCA 4PO9A 1S3FA 2PSSA 1E0KA 3EZXA 1U8UA 4YRJA 1Z5PA 1YMUA 4K6OA 3SHWA 3HH8A 4AW4A 2NZWA 4ESVA 1MV8A 1US8A 3L1VA 4B2LA 3D6UA 2EO2A 3FYUA 5HQJA 2IWHA 3Q4GA 2QMQA 1XHBA 1EX1A 1JJ7A 5I6DA 5L53A 1T9AA 1SBHA 1EIWA 5JZ9A 1FS4A 1GPDG 4FWBA 2WZCA 4LBVA 4GITA 3KSZO 5ALVA 4X84A 3TSAA 2AC2A 4Z8XA 3ASUA 3AR9A 2Q3EA 4DJ5X 4C30A 3EXHA 3EEBA 3ZJTA 2CDAA 2PGLA 4B48A 3DE1X 3K7EA 2NUTA 4KQ2A 1P9WA 3DS8A 2ZTVA 1TQHA 2IZ1A 4LRSB 3CBGA 1GPYA 4BZWA 4CMEC 2XB8A 4YBZA 5BNTA 3K9FC 4BDSA 3IAS1 2IYXA 5GGYA 1N0HA 5FUBA 3TUJC 2QT0A 4BL5A 2QSYA 1AF7A 2YUIA 2XBUA 1HNZM 4OQNA 3W79A 4YRBA 1BEEA 1P17A 1XRNA 3JYHA 2HR1A 2FQWA 421PA 5SV2A 4FZJA 2QS9A 2DX7A 4R2XA 4UPEA 1NJ5A 3EVTA 2YDYA 3GA5A 3IP5A 3OTHA 3L7AA 4X1YB 2EKDA 4HVAA 3Q7RA 2RGHA 1RZ3A 2OGUA 2GRJA 1JEJA 2LWXA 1CWUA 2LRHA 1E69A 3LT1A 4IDBA 1VCOA 2HMUA 3R0QA 3OU6A 4QUJA 1RYMA 1XO1A 3OIYA 2YWCA 3BWYA 4L4SA 4ZI7F 1TQ6A 4RMNA 4Y9DA 4TTIA 2GXSA 3E7DA 3FPHA 5FLXA 5JARA 1JXAA 3JTMA 1RT9A 2Q6IA 1D7AA 1ORRA 4HRAA 3ECAA 5KYYB 2JCBA 1YOVA 3BCUA 3V00A 2E49A 5THXA 2VEDA 3SMQA 1V48A 2VDBB 3DV0B 1TJ5A 2P0AA 1LJUA 1O96A 5ALZA 5E8JA 5A3VA 4M36A 2QR5A 5BQOA 4CL0A 1XA4A 2QLJA 4ACAA 4ZZIA 1XR3A 1CRQA 4EVSA 3JYNA 4KI0A 4C7JA 1RQRA 5K1ZA 2Q8NA 5IDVA 3K16A 2ZJ5A 3IDQA 4NCIA 4YCAA 4ZT5A 3OTGA 2F4NA 1AKVA 3KQSA 3ZY3A 4ZMRA 5LUAA 4PYOA 4YDSA 4E1BA 2YYSA 4PQEA 4PFJA 1U9YA 2VK1A 4DVGA 2JJ2D 1JUDA 2ATIA 1PR2A 4PHGA 5EE3A 2NLOA 4O4HB 3WK9A 1JEOA 5IMBA 3DP7A 5BYAA 1CY6A 2R1VB 4U39A 5I7OA 1XZQA 3WFIA 1Y33E 3H9GA 4GMKA 1L5VA 2AHOA 4N76A 2A9KA 1XFDA 2PUDA 1Z5BA 3MXTA 1A9ZA 4CLHA 5DLEA 3F90A 2WJPA 3DUFB 2Q2EB 3HJRA 3NYIA 4Q9NA 4LGYA 5FYQA 3R9IA 3KVWA 5TMPA 4NHEA 7YASA 2DY0A 5KPDA 2IVFA 4WD3A 1BYUA 1EP9A 3KQVA 5KNBA 1JFRA 4B0PA 3R76A 2PWAA 3UAVA 2PKQP 1SCJA 4OF4A 1TYZA 3LWZA 5ALYA 5L51A 2IS1A 4L4YA 3OIVA 4ZRMA 4BO8A 1B74A 4C08A 2OV6A 3ET5A 3HPRA 4EL5A 2LGJA 5GKNA 1TKBA 4IQGA 4CKCA 5HIKA 3JAKA 1P75A 3OWOA 4GXRA 4IR7A 1DGQA 4CETA 3VPSA 5EYPA 3WYBA 3ZI7A 1QDEA 3OE7D 1JI0A 1P29A 5LOVA 1YRBA 2EZ9A 4YTEA 1WDLA 4XPZA 4B46A 1YTUA 4MCIA 1EP2B 1RJFA 2QQ8A 3BK1A 3A1DA 5L4LA 2GDJA 3MGKA 2WUEA 3A9SA 5I47A 1SA0A 3K70D 4OPMA 1OQYA 3WSTA 1PJ3A 1Y1KE 4ZT2A 1O97D 1UADA 2ABWA 2HCJB 4K9PA 4RLQA 5I7FA 4WLFA 3VX4A 3UHPA 3RS7A 2MINA 2X86A 1ZN7A 2VTKA 2Y99A 3FSJX 4YV1A 1CJMA 1LLFA 1Q2UA 2HRQA 2NWQA 3FWPA 3LKZA 1Y4UA 4NZPA 5TARA 3H9BA 2JLUA 3ENWA 3ESRA 4N39A 4YP0A 3GJ6A 3X2EA 4ETNA 3DOFA 4PG7A 2O9JA 4YJKA 4DR1M 1OA1A 3WY9A 5LJLA 3T3PB 1DKQA 1OLUB 4HOYA 3MF4A 2W2OA 4IMIB 4NVRA 1AZSC 2IV2X 3S1AA 2I1LA 2RHJA 3DMHA 2FFJA 3HYCA 1QTNA 3P9CA 4BLPA 4PHFA 3F4LA 4MEJA 1E3LA 3I45A 5EWJA 3CPEA 2QD1A 2FN3A 3WGLA 3TUZC 2R66A 2D1RA 1IK4A 3CX3A 1CEQA 2JZCA 2OD7A 1I7PA 1RC1A 2AFVA 3KOXA 3MLBA 1WHTB 2RK3A 2SKCA 3TCKA 3I5YA 4MUAA 4IBEA 1E1QA 3CLSD 1XSEA 3I9KA 1NQTA 1DP4A 4DGQA 2GVNA 3RBAA 4IZHA 2CLKB 2A5GA 2JXNA 1XWFA 1RXCA 1X7HA 3P8ZA 4Y6PA 2LVAA 2ZIVB 2QW1A 3ZLJA 4M87A 5A9SA 3P0EA 3QWIA 3SICE 4RTKA 1N6IA 2KJQA 3OD1A 4I19A 4GSLA 1I4DD 3IP9A 2Y1XA 3U7EB 4AMBA 5KKNB 1W29A 5BR7A 3NVKI 2Z83A 3NYQA 1ZUNA 1Z83A 4UU0A 1CQZA 1D2CA 4AYXA 3GFFA 2RK4A 1R27A 2YJ4A 2R8OA 2A7XA 2YQZA 1XVIA 1NATA 4HEOA 4LZZA 1H69A 1O7JA 1OZGA 2F8MA 3I6BA 3PNBA 5LA6A 4DJEC 1KYTA 5H9WA 3AZOA 2ADOA 3A6FA 3EZ9A 2NNLD 4JJKA 1YE5A 4BB0A 1SZPA 2WK1A 4EP1A 3EIFA 2B0CA 1MXFA 1OXMA 1DUVG 1SC6A 4CHTA 3A4YA 3D6HA 4GL4A 2VATA 4M60A 5DK6A 4NIMA 4RABA 3B70A 4MR9B 4FTWA 3AHCA 1Z13A 3KB8A 4A8TA 1GYRA 3FLMA 3F92A 3PXBA 1F0YA 1CLUA 2IEIA 3TLKA 3DHYA 4GPEA 5CT6A 2G28A 4PNPA 3EX7C 3QX3A 2F3QA 3CY6A 5G4KA 4BLVA 2X42A 2KA6B 1O97C 4CVNA 2VJNA 4LTDA 4WJZA 4F96A 4D02A 1IHYA 2DQ4A 3JD2A 4H0NA 4LVUA 3BMQB 4OHUA 4WESA 4FWHA 2GJKA 2C20A 3A28A 4D98A 4IBKA 4CIZA 1G291 1IEVA 4H7JA 3ICEA 3CZCA 2JZ1A 3LT2A 2WJ3A 1PNRA 1WZUA 3F9IA 3VR2D 4WKOA 2EU8A 3UJ3X 3ZUPA 4F7DA 2JIMA 5AW4A 1T5BA 1E1RA 1W30A 3PJFA 1DIBA 4HLCA 3SOPA 4CM3A 5KWSA 4WZBA 3TG2A 3PL1A 4BVEA 4TXJA 4JXKA 2OYCA 1YZNA 5CLJA 1CJKC 2BGWA 2OCXA 2REQB 3EW9A 1JWLA 4IVPA 5LQJA 3B52X 1Y1QA 3C7DB 2IWRA 1Q16A 2RGXA 4RA6B 3CWQA 1A9PA 2LHGA 3D7RA 1JKFA 1ZI6A 2ZRMA 4JL5A 1TIBA 3AERA 4J1NA 4CR8A 5AVTA 2WD7B 2WWYA 5LB2A 5JVDB 4LXXA 5L7YA 2QTAA 2R8RA 4TKVA 2X7XA 1FYVA 4XX0A 1ZK3A 3LT5A 4H7HA 1DIGA 2JFZA 3AERB 4MPDA 1N8TA 4O25A 5FPPA 5H5JA 1QIHA 4TXLA 2PKWA 2WIFA 3OZVA 4CQMD 4U8GA 1D1TA 2AK3A 2R9VA 2XDWA 1FZTA 1L7PA 1UUFA 1X2BA 4BFXA 1TO6A 1J9EA 1G7CA 3KBBA 5G40A 4ACBA 4EUHA 4Z9XA 4CR7A 3LQYA 4M9XA 2PIDA 4RTOA 4JI3B 5EWMB 1LA2A 2BHTA 5ICFA 3R6LA 3NHWA 4J16A 4S1TA 4EGCB 5IU6A 1XD2A 4HYTA 4LZAA 2PUHA 4O4LA 3S0JA 2BGGA 3EC1A 1P7PA 1UT6A 2AFRA 3CSSA 2GLTA 3M6MD 3DO5A 2GJAA 5ALLA 4M1QA 1XJQA 5A71A 4J7CA 1QQ5A 4DUZM 3K30A 1CDOA 3QHPA 2I3GA 3OESA 4BFCA 4DV1B 3BXHA 1QG2A 5DP1A 2H18A 3OQIB 5EFZA 3NNDA 3ZYZA 1H6BA 2CCKA 2V7QD 3SM9A 4LNHA 4GGMX 4KSYA 2OOBA 4QT4A 3DEIA 2BFNA 4HZUB 1UC5B 5CUQA 3A1SA 4RD0A 2DWMA 2XQVA 3UAOA 4F2HA 2D7DA 2NAFA 1GPNA 1KFKB 4XGQA 1DUSA 1AK9A 1W25A 3F7OA 1IUPA 2AS0A 3KKLA 3PTZA 2IUFA 1FDRA 4H77A 4ZT3A 2NADA 4BIIA 1GQRA 1VA5A 3SN6A 2EKPA 3EVGA 3S2FA 2XQJA 3CVVA 1S9DA 1XVLA 3I04A 1KEEB 1L5QA 2DPLA 4QAJA 2WPNA 1O9GA 2J45A 1T4BA 4IF6A 3HEBA 2R8XA 1ACJA 6GPBA 1KDRA 3DCNA 1LK7A 1S8FA 1G8JA 3FX2A 3G2QA 3OM8A 3TTSA 1PJLA 1SAYA 2PUJA 2QXUA 3LHDA 4WDQA 5EP3A 1Z5ZA 4L22A 1SXQA 3PYLA 2JJ1A 4UZFA 5GONF 4TSFA 3WMXA 2EKFA 4CFYA 3COJA 3AVTA 2PS0A 4AZ3B 3HHYA 2HLNA 4D9GA 2XFTA 4MWBA 1PZMA 3TWLA 3I23A 3IT2A 3B3GA 3GG2A 1ZI8A 2BHLA 1GDHA 4IUCS 2MSEB 2Z95A 3DV0A 2NU7A 4G0PA 2YFQA 3S5JA 4DV6B 2I0FA 2RGAA 2ODQA 4ZODA 1S9HA 1HRDA 1G9TA 1XTBA 4MV1A 1P3DA 1A2OA 1JTVA 2Y05A 3OEHA 5JDIA 1ZNQO 5F9FA 2VBCA 1UFZA 2L69A 1VYUA 1FFBA 3JQAB 4J7AA 1F9AA 1C3XA 5BWOA 5AMXA 1IG3A 1SOUA 3MM4A 3ZWQA 3V32A 4XQGA 2OK8A 1USIA 4LJKA 2CE2X 2X0DA 1J2UA 1SOVA 4XVRA 1JXMA 3H5VA 4HPWA 1XZCA 2QUHA 5I9NA 4V0OA 1NQOA 3V55A 4RMHA 1Z0KA 3R0IA 5LP6B 2QF7A 4DV5B 2C7OA 1JWBB 1W93A 1Z29A 2IKQA 3DBHB 1ADBA 1F4PA 2CMFA 4OTZA 4RO0A 3T12A 1ZSNA 2IH5A 4TXNA 1UPCA 5BURA 3OPMA 4B6PA 2YNMC 4GS5A 4LE2A 4X7BA 2AB0A 2KNZA 1HLDA 1LC3A 2VZEA 1L8LA 4Z1OA 5IULC 5LNK1 2J0SA 4S1PA 4MQFB 3DOUA 4IIJF 3FDZA 4QXRA 1EVIA 3H2IA 1XRLA 1QFZA 5A5DA 4MV0A 4BC0A 2HNAA 2ZIWB 1CEYA 3AIOA 3KXIA 1KJYA 3INGA 2H2IA 3L04A 3PD0A 4HLDA 2HWKA 4N6OA 1SMKA 5E1OA 3R7FA 3PC2A 1NY6A 3FWNA 2VTBA 2ZM5A 1XDDA 3Q9UA 2G76A 4RHXA 4FFBA 3I9OA 1BVRA 1WNTA 3OKAA 1VPLA 1KMMA 2IY7A 3N75A 3FPKA 1NVFA 3LQ4A 1EVZA 3IO5A 2WSLA 4HYEA 4A03A 4E1AA 3VJRA 2HK6A 1ZUWA 2OILA 3BRWD 3EBLA 2ZB2A 3ODPA 3SR4A 1PFYA 3T7TA 4GOOD 4C7MA 4K5QA 2A1TS 3MW8A 1E1CA 2WTUA 3U13A 1L7QA 1YIOA 2P1RA 4P0PB 3VVMA 2XBMA 2G1AA 1NOJA 2I7PA 5IAGA 2PAAA 2KM1A 2O48X 1G42A 1SXJD 4QPDA 1FS6A 1K6IA 1JHXA 1PSDA 2J7PA 2NO1A 4BGIA 2CL6X 1F2UA 4I1OA 4BFVA 4Q4JB 1GABA 3K2LA 1XZIA 3DVAA 4DR6M 1MCZA 2YJ5A 3H3XA 4JSTA 1CX9B 1QAMA 3QUAA 1LQTA 1TC1A 1BDIA 1LRKA 1F7VA 1PJJA 2E5WA 4RH3A 3A6PC 2O8BA 3KP1E 2YIMA 4LKOA 3SFTA 4P3OA 4U7WA 3IUSA 5EZSA 1QS0A 2JH9A 3AL0C 3DCJA 4NNJA 1F0NA 2CNNA 3E1SA 5EESA 2NUBA 5EXDA 2FPXA 2XRMA 4IJFA 1FZQA 4WV3A 1J1UA 3AB8A 4JLNA 5EJ7A 1HV8A 2WINI 1LBHA 2EJVA 4LHZA 2XUOA 3KUUA 3PGVA 5JH7A 2F5QA 5D2CA 2HDHA 3KCNA 5GOTA 4DA7A 5MHTA 3I52A 3CX8A 2BWEA 4QLAA 4R31A 4G4JA 3DMDA 3J7AC 5B12A 4ZQFA 1E7MA 2YYZA 2O7RA 2OO5A 1FFWA 1IHUA 3LIPA 2X9VA 2B1GA 1L5HA 3UNXA 1SO8A 3GEIA 4F2WA 4ZYXA 3LUFA 3V9AA 7MHTA 1OIWA 1AGPA 3T0GA 1O9BA 3ROGA 1D03A 2F3TA 1H2HA 4TS1A 5FBQB 5G1OA 2HGSA 4MMXB 5EMKA 4R05A 2BFFB 1SCBA 1WPQA 4UEQA 3IA7A 4KIGA 4DARA 1G5HA 2WC1A 3F8SA 3D0OA 3NM6B 4NBSA 3I5MA 1QIMA 2YN0A 3T95A 1WGNA 4E12A 3THYA 5CX4A 1TCVA 3BICA 1W581 3GYBA 4OFZA 2XHZA 5DI9A 1GGEA 2P2CA 3RAEC 4JYAB 2YNMD 3VU3A 2JGEA 1JDPA 3CF6R 3L6BA 5AVUA 1SCNE 2J30A 5HRUA 1VKHA 4Z0PA 1L7RA 2GXUA 5T6MA 1DRWA 2BBWA 5BO5A 2JY8A 2G4CA 3FPCA 5AXCA 4MGZE 4I4TA 3FGPA 4TS4A 3TRFA 3U4MA 3GVCA 3L4JA 2VR1A 4CGZA 2VOJA 3LC2O 4FSDA 5DN6A 1BW9A 3IHKA 5E38A 1GPWB 5BV1A 5JS1A 2Y1FA 5F3DA 1JEEA 3ANXA 2GILA 4BLQA 1X13A 1NNSA 4GKVA 2GM4A 1CUHA 2BVNA 5J1SB 3FUVA 2GCGA 4F12A 2A58A 3FWYA 1MRZA 2NVUB 2O6LA 3PKZA 3WADA 1LWOA 1TI7A 1ZS9A 2C92A 2VQ3A 1LTMA 3DR3A 4QWMA 1KK2A 3GFSA 2D7EA 3GT0A 4XYEA 3HS3A 3VLFB 4LA4A 3UHFA 4DQ0A 1NBAA 3X2FA 3ZHOA 3PGMA 3TI9A 1RPZA 1P6XA 3EXIB 4MYCA 4NMLA 5IAJA 4NCAA 1K27A 1QZEA 2DZNB 3NALA 5DNWA 3W1EA 2L82A 2K2WA 3H9JA 4IBJA 3QGMA 4OQZA 1A2QA 4RPIA 4DLAA 5B2FA 4BGUA 1ZA2A 4KQEA 4X65M 1DGHA 3Q0TA 4N5LA 1O9HA 2GN6A 3HJQA 5E2AA 5EJ2A 5DTMA 1M5UA 1VG9B 4ZO9A 5FUMA 1TKCA 1BVSA 1NR5A 3C14C 3E5NA 2EFEB 1YRWA 2HMVA 4WHMA 4TT3A 2QBYB 1T4GA 4X0EA 1TNDA 2C4WA 4IJ6A 1GPUA 3C8MA 1VBKA 2YJNA 3FJ1A 4FGUA 4C7XA 2V03A 1T1SA 2QE6A 2J3HA 3NHBA 4B3RM 4MRNA 4LF9B 1PO7A 3TLMA 3GJ4A 5AW2A 2DCMA 1Z28A 3LBYA 4WVLA 1VIAA 4D81A 3LZCA 3V1YA 2ZSJA 3GO4A 3DDCA 2CNLA 3L25A 3B7PA 4TZ0A 1S3SA 4FCTA 4LOHA 3D6AA 2ONKA 2WJ6A 4UN2B 3OQJA 1YKFA 3UW3A 4LTNA 5JFGA 1GNSA 1ACLA 4II2A 5LQCA 4HNRA 4P3NA 1SRRA 1K3XA 1NMXA 1ZL2A 3PPVA 1G5RA 4R9SA 4R9VA 4YRCA 1C1YA 2HPZA 3NKLA 4TWIA 4HR7A 4MIOA 5DHUA 2A57A 3RI3A 2D5AA 4XPIA 3RC7A 4C0HA 4J03A 1RHKA 4ABYA 1DARA 3PQEA 1JHZA 1QVVA 6ADHA 1WMFA 1W19A 1IH8A 3CH4B 5BV2P 4DMLA 4BTVA 2NU8B 2IOFK 4B6OA 3V8RA 4I50F 3ZEIA 2ZWAA 1RYNA 3ACCA 4R1UA 4YJHA 5AR1A 4QVIA 4KHPB 3T1YM 1P2FA 1M0EA 4S1OA 1T36B 2MR6A 1T1GA 3WJAA 1TQ4A 5BORA 3I2YX 4YRTA 3IEVA 1SQ6A 3O1HB 4D5GA 3IOYA 5CLHA 2FRDA 2SCUA 2ZVDA 5A05A 4F06A 3IVCA 3PUHA 2HDOA 4QODA 3PHLA 4CIAA 2HEIA 2D59A 1FE8A 4WCVA 1XVVA 3EIOA 3F5FA 1U2RA 3X1MA 4GSYA 4GAEA 5C1PA 4I08A 4GD3Q 4PBTA 4O5OA 4UUAA 5AKEA 1IFYA 3HL0A 1QF6A 2JGNA 3CZRA 3MEQA 3HO8A 4ZV7A 2YL2A 4EW2A 4LCJA 1SUPA 1ETUA 1XZKA 3BSFA 4OBBA 5JSUA 1VKNA 1C2YA 1MVLA 2Z0MA 1UT5A 1VHJA 2O2GA 3G8YA 3QV2A 3JQQA 2VJDA 3LY7A 3OOWA 4UW9A 2VF2A 2VWGA 4B8YA 1J07A 1R3UA 4E11A 1VXRA 2FG6C 4A6PA 1TEXA 3D6TB 3TFQA 1B3RA 4A82A 3TM5A 4KQFA 3PXCX 4GGPA 1TVMA 3N0TA 4KW7A 5C1IA 1V71A 3WSVA 3C3WA 3TTVA 5IHPA 4JDUA 1JFSA 3UTCA 5CA1A 1I4EB 2C31A 4FW9A 1EBFA 3IIEA 1MO5A 1H85A 1MX5A 2WB4A 3PYXA 2HRBA 1DAFA 3SZOA 3PHIA 1E1QD 1HFWA 4OG2A 3WYFA 5IYZF 4EY7A 2FVXA 2PNJA 1NNI1 4RW0A 3QEKA 4JL8A 4RVNA 3UOWA 2N1BA 3VR5D 1NQWA 4GNKA 3VZRA 1SK9A 4F1WA 5IANA 5K0SA 3PX3A 4H7FA 3BBZA 4UPVA 2PL3A 1RMTA 1U98A 5FKJA 4A15A 1W0JA 4YBRA 4K87A 1G5PA 5ITUA 3ENKA 2P9EA 1D6NA 3VR6H 2NUTB 1TTHA 3KZKA 3DM5A 4H17A 1QQ6A 4RX1A 3RU9A 1V92A 5CITA 4GYJA 3THWB 1NUUA 2QE7A 3FDZB 2PSJA 4FONA 4BO2A 1DJPA 3G9ZA 3WRXA 3EAGA 2VDPB 1Z17A 3AR7A 4CUJA 4DDHA 3SBEA 2YY5A 3NDRA 4IG9A 1LVUA 3NPMA 3H13A 4JUDX 2LVNC 3I9V1 3AVOA 3O31A 2C4TA 5BV7A 2VA8A 3PG5A 4OK5A 5J2TB 3HPQA 3EVDA 3EPHA 3G6WA 2VHVA 4NXNB 4AMGA 1VKJA 3QZUA 1Z18A 2JH3A 2I2BA 3BS4A 4KXMA 3QK7A 3HY3A 1RI5A 3CVUA 5AHWA 1FP7A 1BX0A 2HHLA 2RHTA 2RE8A 2JASA 3E2MA 4LFBM 4IHJB 1YQUA 2R25B 4OLFA 3ZHBA 4EELA 4A3SA 1DFGA 2W4IA 4EA8A 1DV1A 1MD9A 4JP8A 1WCXA 2CFOA 2I6XA 4PSUA 4ZQIA 1VIMA 2SNIE 3L7CA 3V7FA 3AU8A 5F1PA 1SBNE 1DQSA 5C4IA 2BKAA 3ORYA 4OH1A 2GZAA 1I6MA 3PPYA 3GGJA 3G2OA 2HHHB 3VA7A 3AJIB 1HTWA 4UFNA 3O8OB 2F67A 4COKA 2GFIA 1UEXC 3HEMA 4AP6A 1ISFA 1Y0BA 1WB4A 1KFJB 4OHWA 3FOFC 1XNRB 1TUGA 4NZNA 5DYIA 3X44A 1HWYA 1TTEA 3VKGA 1EHCA 1E2GA 1UKVY 5GJVC 5MDHA 5COAA 2QMZA 3C39A 3NBZC 3BWCA 4ZDWA 1EXWA 2YYYA 4WCFA 5KAPA 4EJSB 3QTTA 3BXFA 2ZBPA 2O8DA 4FYWA 4ZV4A 2QHXA 3AUAA 3VOBA 4EABA 4ILKA 4ESOA 3BPSA 3OCUA 3CVJA 3ET4A 4HTAA 4ZICA 4JI0B 2AN3A 5BSVA 1IUKA 1GUDA 5FR2A 1JG7A 2RGRA 4YRPA 1V3TA 1H9AA 1ZVQA 2HFKA 3JALA 5G3YA 4Y6LA 1E7SA 1Y8QB 3HKEA 3CLRC 5IBCA 1HURA 4HNAA 3RRYA 4HQ0A 3VNVA 4UTRA 4DSTA 2I65A 2PL1A 1KZGB 1D5CA 4FFSA 4N49A 2PJUA 4QU8A 3W5VA 1VLQA 2P2GA 4IOLA 2R11A 5IVIA 1JLLA 4RK6A 4BLCA 3QBVA 4EFLA 1V95A 1VCIA 1NN5A 3WGTA 3NOOA 1BWPA 1M34A 4FUQA 3CRNA 4XOUA 5CT5A 2HSEA 3LPNA 1W36C 4PN7A 2F1JA 2IYNA 2HXYA 3RODA 1J2JA 1SFRA 1KEWA 3AHFA 2QMOA 3H84A 1AQLA 3AHIA 1DBPA 3P2OA 1TJ3A 1RWMA 2OG1A 1W47A 4IL5A 3LAWA 1ODSA 2CVOA 5HP4A 1OFUX 1AQIA 1R8JA 2P1ZA 3WIUA 1O94A 5BVHB 1Z4PX 1T6OA 1C1KA 3A4NA 1GJTA 3CTMA 4JT8A 5FF9A 2QV7A 1ZSYA 2ZB8A 5ELXA 3HB4X 5FV4A 1JBEA 1H1DA 1T5TA 3PHGA 4DJDC 3M5PA 3DHWC 1T8TA 4S1NA 1FJ2A 1YRLA 2J5RA 3OX2A 2BTEA 5BW5A 2PZLA 2IW3A 2Z4TA 3A8TA 5CYPA 3IX7A 3W05A 3IV7A 1ZW6A 5L40A 3TGWA 4I4TF 3G7UA 2HJ9A 4PFQA 4MOWA 4YT4A 5EJMA 1O0BA 1JEQB 1T9KA 3D8SA 1A9TA 1TA4A 3C0KA 3IFSA 3RYIA 4PGMA 2PZBA 2M1XA 2V58A 4FFNA 5I9BA 4JUFA 1R4GA 2YJGA 4I8IA 1X74A 2PXAA 4IDHA 3U3MA 4I1VA 4KQCA 4YRSA 3DEZA 5FT9A 2I2AA 4MDEA 3U6SA 3EMDA 3NGLA 4J0HA 4N8EA 1A50B 2JCYA 4ZC8A 3RLFA 2FF7A 4K8RB 4FK8A 2GUGA 4M0KA 1OWLA 2F2TA 4HDMA 3A06A 1ZIOA 1PJRA 5GY7A 4IJKA 3UEOA 4CKWA 4EG0A 1IRXA 4XX0B 3H87A 5B5SA 2ZBGA 4ZFNA 1TU4A 1U3TA 3A45A 3FKJA 1MW8X 1QK3A 4P4GA 3A27A 1Z4QA 5GM1A 2GI4A 2W2KB 4PLTA 2HWUA 5BMVF 3FD9A 4O4JA 9MHTA 5B53A 3IUEA 2ZETA 4OHXA 4Y9UA 4JBGA 3BBPA 3G49A 4E4RA 1JFFA 4MGKR 2GK6A 4UCWA 4P8RA 2VDNB 3OFSA 5P21A 4BGDA 1KE2A 4DBLE 2HA7A 1T6BY 4CMBA 4RGVA 5JI2E 3EGDB 4EDFA 4JFAA 4QOSA 4AMVA 2XEPA 3PQ7A 2DLDA 4ZEOA 3VOTA 4Z4EA 1HDZA 1NE2A 1HDXA 1F0KA 3J27B 5EUCA 5JSKA 3U7RA 3E22B 3PNMA 3Q9LA 2HNBA 4Z53A 2WU3A 3HDHA 4Q7JA 3KSBC 4RGYA 3LA6A 3U5TA 2MSCB 3LUJA 4BZZA 4UAJA 3E0QA 4YVFA 5ERYA 1E58A 5FBKA 4YRFA 3IUMA 1UM9A 1YKSA 3LWNA 4PTZA 3PUJA 1U7PA 1NRWA 2PWBA 5TV2A 3WWOA 1A98A 4HFJA 5ULLA 5JZBA 3J7BA 1TH3A 1PTKA 1XEWY 2E4XA 2VJBA 1HEIA 4HNGA 4YP6A 3STYA 2V74B 5JSQA 3DVQX 3FZEA 4E2YA 1KYQA 4LC0A 3M7GA 1JE0A 3CN9A 1RLIA 2QCUA 4OKNA 1LX6A 2B92A 1XV5A 3EH1A 5AIAA 1SWVA 1Y9AA 4ZVKA 4G3XA 1X77A 3VNAA 4KR7A 5G4KB 4J3NA 4HBZA 1R6BX 4L5YA 2V7TA 2WIDA 1IZ0A 2J4CA 2XZDA 3SI7A 1ONOA 1S2MA 3AI7A 2PBFA 3N7UA 3I4LA 1N5OX 2N35A 2REXB 2AKAB 3CJTA 5EMHA 1FQOA 4QJ3A 4GX1A 3A0RB 4D57A 3AONB 1BOFA 1C9KA