1D2ZA

Three-dimensional structure of a complex between the death domains of pelle and tube
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
102
structure length
102
Chain Sequence
LDNTMAIRLLPLPVRAQLCAHLDALDVWQQLATAVKLYPDQVEQISSQKQRGRSASNEFLNIWGGQYNHTVQTLFALFKKLKLHNAMRLIKDYVSEDLHKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a complex between the death domains of Pelle and Tube.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Apoptosis
molecule keywords DEATH DOMAIN OF PELLE
total genus 38
structure length 102
sequence length 102
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1999-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1d2zA00
1ICHA 3MOPK 4N1KA 2L6AA 2A9IA 4UZ0A 2P1HA 4O7QA 3LQRA 2KM6A 4E9MA 2VGQA 2G7RA 2B1WA 1UCPA 2D96A 1N3KA 2DBDA 3KATA 4M9SA 2N7ZA 4M9XA 4IZ5E 2N00A 1FADA 1DGNA 4DWNA 4M9ZA 4D8OA 4LWDA 4P4HA 1A1ZA 2MN4A 1WXPA 2NAQA 2YU0A 1NGRA 1E41A 1A1WA 2DO9A 2L9MA 1D2ZA 4P4HI 4JQWA 4N1LA 2KN6A 1C15A 2GF5A 2N80A 1DDFA 4I16A 1E3YA 2DBGA 4N1JA 3J63A 3EZQA 2LWDA 2MB9A 3YGSC 3MOPA 2BBZA 3LQQA 2F1SA 3MOPG 1YGOA 3CRDA 2MS8A 2MPCA 3T6PA 4IZ7B 2MS7A 1WMGA 2OF5H 3J6JA 2LS7A 2IB1A 2OF5A 1WH4A 4RHWE 1CWWA 4A2WA 4FH0A 1PN5A 2YVIA 2DBHA 3YGSP 1D2ZB 2NZ7A 1CY5A 4JUPA 2DBFA 2HM2Q 4QOBA 2N1FA 3EZQB 2YQFA 2M5VA 4F44A 2NSNA 3CL3A 1Z6TA 4NQKA 4ZBWA 4A2QA 2BBRA 2LWEA 2N97A 4O9LA 4EWIA 4O6XA 2YGSA 3QF2A 2N83A 4IZAB 4O9FA 4RHWA 2A5YB 4F42A 2O71A
chains in the Genus database with same CATH superfamily
1ICHA 3MOPK 4N1KA 2L6AA 2A9IA 4UZ0A 2P1HA 4O7QA 3LQRA 2KM6A 4E9MA 2VGQA 2G7RA 2B1WA 1UCPA 2D96A 1N3KA 2XV9A 2DBDA 3KATA 4M9SA 2N7ZA 4M9XA 4IZ5E 2N00A 1FADA 1DGNA 4DWNA 4M9ZA 4D8OA 4LWDA 4P4HA 1A1ZA 2MN4A 1WXPA 2NAQA 2YU0A 1NGRA 1E41A 1A1WA 2DO9A 2L9MA 1D2ZA 4P4HI 4JQWA 4N1LA 2KN6A 1C15A 2GF5A 2N80A 1DDFA 4I16A 1E3YA 2DBGA 4N1JA 3J63A 3EZQA 2LWDA 2MB9A 3YGSC 3MOPA 2BBZA 3LQQA 2F1SA 3MOPG 1YGOA 3CRDA 2MS8A 2MPCA 3T6PA 4IZ7B 2MS7A 1WMGA 2OF5H 3J6JA 2LS7A 2IB1A 2OF5A 1WH4A 4RHWE 1CWWA 4A2WA 4FH0A 1PN5A 2YVIA 2DBHA 3YGSP 1D2ZB 2NZ7A 1CY5A 4JUPA 2DBFA 2HM2Q 4QOBA 2N1FA 3EZQB 2YQFA 2M5VA 2MJMA 4F44A 2NSNA 3CL3A 1Z6TA 4NQKA 4ZBWA 4A2QA 2BBRA 2LWEA 2N97A 4O9LA 4EWIA 4O6XA 2YGSA 3QF2A 2N83A 4IZAB 4O9FA 4RHWA 2A5YB 4F42A 2O71A
chains in the Genus database with same CATH topology
1ICHA 3MOPK 4N1KA 2L6AA 2A9IA 4UZ0A 2P1HA 4O7QA 3LQRA 2KM6A 4E9MA 2VGQA 2G7RA 2B1WA 1UCPA 2D96A 1N3KA 2XV9A 2DBDA 3KATA 4M9SA 2N7ZA 4M9XA 4IZ5E 2N00A 1FADA 1DGNA 4DWNA 4M9ZA 4D8OA 4LWDA 4P4HA 1A1ZA 2MN4A 1WXPA 2NAQA 2YU0A 1NGRA 1E41A 1A1WA 2DO9A 2L9MA 1D2ZA 4P4HI 4JQWA 4N1LA 2KN6A 1C15A 2GF5A 2N80A 1DDFA 4I16A 1E3YA 2DBGA 4N1JA 3J63A 3EZQA 2LWDA 2MB9A 3YGSC 3MOPA 2BBZA 3LQQA 2F1SA 3MOPG 1YGOA 3CRDA 2MS8A 2MPCA 3T6PA 4IZ7B 2MS7A 1WMGA 2OF5H 3J6JA 2LS7A 2IB1A 2OF5A 1WH4A 4RHWE 1CWWA 4A2WA 4FH0A 1PN5A 2YVIA 2DBHA 3YGSP 1D2ZB 2NZ7A 1CY5A 4JUPA 2DBFA 2HM2Q 4QOBA 2N1FA 3EZQB 2YQFA 2M5VA 2MJMA 4F44A 2NSNA 3CL3A 1Z6TA 4NQKA 4ZBWA 4A2QA 2BBRA 2LWEA 2N97A 4O9LA 4EWIA 4O6XA 2YGSA 3QF2A 2N83A 4IZAB 4O9FA 4RHWA 2A5YB 4F42A 2O71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICH A;  3MOP K;  4N1K A;  2L6A A;  2A9I A;  4UZ0 A;  2P1H A;  4O7Q A;  3LQR A;  2KM6 A;  4E9M A;  2VGQ A;  2G7R A;  2B1W A;  1UCP A;  2D96 A;  1N3K A;  2DBD A;  3KAT A;  4M9S A;  2N7Z A;  4M9X A;  4IZ5 E;  2N00 A;  1FAD A;  1DGN A;  4DWN A;  4M9Z A;  4D8O A;  4LWD A;  4P4H A;  1A1Z A;  2MN4 A;  1WXP A;  2NAQ A;  2YU0 A;  1NGR A;  1E41 A;  1A1W A;  2DO9 A;  2L9M A;  1D2Z A;  4P4H I;  4JQW A;  4N1L A;  2KN6 A;  1C15 A;  2GF5 A;  2N80 A;  1DDF A;  4I16 A;  1E3Y A;  2DBG A;  4N1J A;  3J63 A;  3EZQ A;  2LWD A;  2MB9 A;  3YGS C;  3MOP A;  2BBZ A;  3LQQ A;  2F1S A;  3MOP G;  1YGO A;  3CRD A;  2MS8 A;  2MPC A;  3T6P A;  4IZ7 B;  2MS7 A;  1WMG A;  2OF5 H;  3J6J A;  2LS7 A;  2IB1 A;  2OF5 A;  1WH4 A;  4RHW E;  1CWW A;  4A2W A;  4FH0 A;  1PN5 A;  2YVI A;  2DBH A;  3YGS P;  1D2Z B;  2NZ7 A;  1CY5 A;  4JUP A;  2DBF A;  2HM2 Q;  4QOB A;  2N1F A;  3EZQ B;  2YQF A;  2M5V A;  4F44 A;  2NSN A;  3CL3 A;  1Z6T A;  4NQK A;  4ZBW A;  4A2Q A;  2BBR A;  2LWE A;  2N97 A;  4O9L A;  4EWI A;  4O6X A;  2YGS A;  3QF2 A;  2N83 A;  4IZA B;  4O9F A;  4RHW A;  2A5Y B;  4F42 A;  2O71 A; 
#chains in the Genus database with same CATH topology
 1ICH A;  3MOP K;  4N1K A;  2L6A A;  2A9I A;  4UZ0 A;  2P1H A;  4O7Q A;  3LQR A;  2KM6 A;  4E9M A;  2VGQ A;  2G7R A;  2B1W A;  1UCP A;  2D96 A;  1N3K A;  2XV9 A;  2DBD A;  3KAT A;  4M9S A;  2N7Z A;  4M9X A;  4IZ5 E;  2N00 A;  1FAD A;  1DGN A;  4DWN A;  4M9Z A;  4D8O A;  4LWD A;  4P4H A;  1A1Z A;  2MN4 A;  1WXP A;  2NAQ A;  2YU0 A;  1NGR A;  1E41 A;  1A1W A;  2DO9 A;  2L9M A;  1D2Z A;  4P4H I;  4JQW A;  4N1L A;  2KN6 A;  1C15 A;  2GF5 A;  2N80 A;  1DDF A;  4I16 A;  1E3Y A;  2DBG A;  4N1J A;  3J63 A;  3EZQ A;  2LWD A;  2MB9 A;  3YGS C;  3MOP A;  2BBZ A;  3LQQ A;  2F1S A;  3MOP G;  1YGO A;  3CRD A;  2MS8 A;  2MPC A;  3T6P A;  4IZ7 B;  2MS7 A;  1WMG A;  2OF5 H;  3J6J A;  2LS7 A;  2IB1 A;  2OF5 A;  1WH4 A;  4RHW E;  1CWW A;  4A2W A;  4FH0 A;  1PN5 A;  2YVI A;  2DBH A;  3YGS P;  1D2Z B;  2NZ7 A;  1CY5 A;  4JUP A;  2DBF A;  2HM2 Q;  4QOB A;  2N1F A;  3EZQ B;  2YQF A;  2M5V A;  2MJM A;  4F44 A;  2NSN A;  3CL3 A;  1Z6T A;  4NQK A;  4ZBW A;  4A2Q A;  2BBR A;  2LWE A;  2N97 A;  4O9L A;  4EWI A;  4O6X A;  2YGS A;  3QF2 A;  2N83 A;  4IZA B;  4O9F A;  4RHW A;  2A5Y B;  4F42 A;  2O71 A; 
#chains in the Genus database with same CATH homology
 1ICH A;  3MOP K;  4N1K A;  2L6A A;  2A9I A;  4UZ0 A;  2P1H A;  4O7Q A;  3LQR A;  2KM6 A;  4E9M A;  2VGQ A;  2G7R A;  2B1W A;  1UCP A;  2D96 A;  1N3K A;  2XV9 A;  2DBD A;  3KAT A;  4M9S A;  2N7Z A;  4M9X A;  4IZ5 E;  2N00 A;  1FAD A;  1DGN A;  4DWN A;  4M9Z A;  4D8O A;  4LWD A;  4P4H A;  1A1Z A;  2MN4 A;  1WXP A;  2NAQ A;  2YU0 A;  1NGR A;  1E41 A;  1A1W A;  2DO9 A;  2L9M A;  1D2Z A;  4P4H I;  4JQW A;  4N1L A;  2KN6 A;  1C15 A;  2GF5 A;  2N80 A;  1DDF A;  4I16 A;  1E3Y A;  2DBG A;  4N1J A;  3J63 A;  3EZQ A;  2LWD A;  2MB9 A;  3YGS C;  3MOP A;  2BBZ A;  3LQQ A;  2F1S A;  3MOP G;  1YGO A;  3CRD A;  2MS8 A;  2MPC A;  3T6P A;  4IZ7 B;  2MS7 A;  1WMG A;  2OF5 H;  3J6J A;  2LS7 A;  2IB1 A;  2OF5 A;  1WH4 A;  4RHW E;  1CWW A;  4A2W A;  4FH0 A;  1PN5 A;  2YVI A;  2DBH A;  3YGS P;  1D2Z B;  2NZ7 A;  1CY5 A;  4JUP A;  2DBF A;  2HM2 Q;  4QOB A;  2N1F A;  3EZQ B;  2YQF A;  2M5V A;  2MJM A;  4F44 A;  2NSN A;  3CL3 A;  1Z6T A;  4NQK A;  4ZBW A;  4A2Q A;  2BBR A;  2LWE A;  2N97 A;  4O9L A;  4EWI A;  4O6X A;  2YGS A;  3QF2 A;  2N83 A;  4IZA B;  4O9F A;  4RHW A;  2A5Y B;  4F42 A;  2O71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...