1D2ZB

Three-dimensional structure of a complex between the death domains of pelle and tube
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
150
structure length
150
Chain Sequence
LSSKYSRNTELRRVEDNDIYRLAKILDENSCWRKLMSIIPKGMDVQACSGAGCLNFPAEIKKGFKYTAQDVFQIDEAANRLPPDQSKSQMMIDEWKTSGKLNERPTVGVLLQLLVQAELFSAADFVALDFLNESTPARPVDGPGALISLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a complex between the death domains of Pelle and Tube.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Apoptosis
molecule keywords DEATH DOMAIN OF PELLE
total genus 48
structure length 150
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14786 Death_2 Tube Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1d2zB00
4A2WA 2M5VA 4O6XA 2LWEA 1ICHA 4A2QA 3MOPA 2A9IA 2DBHA 2MS7A 4FH0A 4D8OA 2BBZA 4M9ZA 4RHWE 2B1WA 2GF5A 1DDFA 4N1LA 2IB1A 1YGOA 4E9MA 2L9MA 4M9SA 4O7QA 2MS8A 4I16A 4IZAB 4JUPA 2VGQA 4M9XA 1D2ZA 2N80A 4P4HI 3MOPK 1Z6TA 2YU0A 3YGSP 2N00A 2F1SA 1N3KA 3J63A 4N1JA 2KN6A 1E41A 4N1KA 4O9FA 4NQKA 4F44A 4O9LA 2G7RA 2P1HA 4QOBA 4DWNA 1WMGA 3KATA 2N83A 4EWIA 4F42A 1A1ZA 4JQWA 1D2ZB 2DBDA 4LWDA 1UCPA 2A5YB 3J6JA 1CY5A 3EZQB 1A1WA 2N7ZA 4UZ0A 2NAQA 3T6PA 1C15A 2N1FA 4IZ5E 2L6AA 2DO9A 2NZ7A 2BBRA 4ZBWA 3CL3A 2YGSA 4RHWA 3CRDA 1FADA 2LS7A 1NGRA 1WXPA 1E3YA 2DBGA 2D96A 2MB9A 2MN4A 2OF5H 2LWDA 3LQQA 3QF2A 2O71A 1PN5A 1CWWA 3LQRA 2YVIA 2MPCA 3EZQA 2DBFA 1WH4A 4IZ7B 1DGNA 3MOPG 3YGSC 2NSNA 2HM2Q 2YQFA 4P4HA 2N97A 2KM6A 2OF5A
chains in the Genus database with same CATH superfamily
4A2WA 2M5VA 4O6XA 2LWEA 1ICHA 4A2QA 3MOPA 2A9IA 2DBHA 2MS7A 2MJMA 4FH0A 4D8OA 2BBZA 4M9ZA 4RHWE 2B1WA 2GF5A 1DDFA 4N1LA 2IB1A 1YGOA 4E9MA 2L9MA 4M9SA 4O7QA 2MS8A 4I16A 4IZAB 4JUPA 2VGQA 4M9XA 1D2ZA 2N80A 4P4HI 3MOPK 1Z6TA 2YU0A 3YGSP 2N00A 2F1SA 1N3KA 3J63A 4N1JA 2KN6A 1E41A 4N1KA 4O9FA 4NQKA 4F44A 4O9LA 2G7RA 2P1HA 4QOBA 4DWNA 1WMGA 3KATA 2N83A 4EWIA 4F42A 1A1ZA 4JQWA 1D2ZB 2DBDA 4LWDA 1UCPA 2A5YB 3J6JA 1CY5A 3EZQB 1A1WA 2N7ZA 4UZ0A 2NAQA 3T6PA 1C15A 2N1FA 4IZ5E 2L6AA 2DO9A 2NZ7A 2BBRA 4ZBWA 3CL3A 2YGSA 4RHWA 3CRDA 1FADA 2LS7A 1NGRA 1WXPA 1E3YA 2DBGA 2D96A 2MB9A 2MN4A 2OF5H 2LWDA 3LQQA 3QF2A 2O71A 1PN5A 1CWWA 3LQRA 2YVIA 2MPCA 3EZQA 2DBFA 1WH4A 4IZ7B 1DGNA 3MOPG 2XV9A 3YGSC 2NSNA 2HM2Q 2YQFA 4P4HA 2N97A 2KM6A 2OF5A
chains in the Genus database with same CATH topology
4A2WA 2M5VA 4O6XA 2LWEA 1ICHA 4A2QA 3MOPA 2A9IA 2DBHA 2MS7A 2MJMA 4FH0A 4D8OA 2BBZA 4M9ZA 4RHWE 2B1WA 2GF5A 1DDFA 4N1LA 2IB1A 1YGOA 4E9MA 2L9MA 4M9SA 4O7QA 2MS8A 4I16A 4IZAB 4JUPA 2VGQA 4M9XA 1D2ZA 2N80A 4P4HI 3MOPK 1Z6TA 2YU0A 3YGSP 2N00A 2F1SA 1N3KA 3J63A 4N1JA 2KN6A 1E41A 4N1KA 4O9FA 4NQKA 4F44A 4O9LA 2G7RA 2P1HA 4QOBA 4DWNA 1WMGA 3KATA 2N83A 4EWIA 4F42A 1A1ZA 4JQWA 1D2ZB 2DBDA 4LWDA 1UCPA 2A5YB 3J6JA 1CY5A 3EZQB 1A1WA 2N7ZA 4UZ0A 2NAQA 3T6PA 1C15A 2N1FA 4IZ5E 2L6AA 2DO9A 2NZ7A 2BBRA 4ZBWA 3CL3A 2YGSA 4RHWA 3CRDA 1FADA 2LS7A 1NGRA 1WXPA 1E3YA 2DBGA 2D96A 2MB9A 2MN4A 2OF5H 2LWDA 3LQQA 3QF2A 2O71A 1PN5A 1CWWA 3LQRA 2YVIA 2MPCA 3EZQA 2DBFA 1WH4A 4IZ7B 1DGNA 3MOPG 2XV9A 3YGSC 2NSNA 2HM2Q 2YQFA 4P4HA 2N97A 2KM6A 2OF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2W A;  2M5V A;  4O6X A;  2LWE A;  1ICH A;  4A2Q A;  3MOP A;  2A9I A;  2DBH A;  2MS7 A;  4FH0 A;  4D8O A;  2BBZ A;  4M9Z A;  4RHW E;  2B1W A;  2GF5 A;  1DDF A;  4N1L A;  2IB1 A;  1YGO A;  4E9M A;  2L9M A;  4M9S A;  4O7Q A;  2MS8 A;  4I16 A;  4IZA B;  4JUP A;  2VGQ A;  4M9X A;  1D2Z A;  2N80 A;  4P4H I;  3MOP K;  1Z6T A;  2YU0 A;  3YGS P;  2N00 A;  2F1S A;  1N3K A;  3J63 A;  4N1J A;  2KN6 A;  1E41 A;  4N1K A;  4O9F A;  4NQK A;  4F44 A;  4O9L A;  2G7R A;  2P1H A;  4QOB A;  4DWN A;  1WMG A;  3KAT A;  2N83 A;  4EWI A;  4F42 A;  1A1Z A;  4JQW A;  1D2Z B;  2DBD A;  4LWD A;  1UCP A;  2A5Y B;  3J6J A;  1CY5 A;  3EZQ B;  1A1W A;  2N7Z A;  4UZ0 A;  2NAQ A;  3T6P A;  1C15 A;  2N1F A;  4IZ5 E;  2L6A A;  2DO9 A;  2NZ7 A;  2BBR A;  4ZBW A;  3CL3 A;  2YGS A;  4RHW A;  3CRD A;  1FAD A;  2LS7 A;  1NGR A;  1WXP A;  1E3Y A;  2DBG A;  2D96 A;  2MB9 A;  2MN4 A;  2OF5 H;  2LWD A;  3LQQ A;  3QF2 A;  2O71 A;  1PN5 A;  1CWW A;  3LQR A;  2YVI A;  2MPC A;  3EZQ A;  2DBF A;  1WH4 A;  4IZ7 B;  1DGN A;  3MOP G;  3YGS C;  2NSN A;  2HM2 Q;  2YQF A;  4P4H A;  2N97 A;  2KM6 A;  2OF5 A; 
#chains in the Genus database with same CATH topology
 4A2W A;  2M5V A;  4O6X A;  2LWE A;  1ICH A;  4A2Q A;  3MOP A;  2A9I A;  2DBH A;  2MS7 A;  2MJM A;  4FH0 A;  4D8O A;  2BBZ A;  4M9Z A;  4RHW E;  2B1W A;  2GF5 A;  1DDF A;  4N1L A;  2IB1 A;  1YGO A;  4E9M A;  2L9M A;  4M9S A;  4O7Q A;  2MS8 A;  4I16 A;  4IZA B;  4JUP A;  2VGQ A;  4M9X A;  1D2Z A;  2N80 A;  4P4H I;  3MOP K;  1Z6T A;  2YU0 A;  3YGS P;  2N00 A;  2F1S A;  1N3K A;  3J63 A;  4N1J A;  2KN6 A;  1E41 A;  4N1K A;  4O9F A;  4NQK A;  4F44 A;  4O9L A;  2G7R A;  2P1H A;  4QOB A;  4DWN A;  1WMG A;  3KAT A;  2N83 A;  4EWI A;  4F42 A;  1A1Z A;  4JQW A;  1D2Z B;  2DBD A;  4LWD A;  1UCP A;  2A5Y B;  3J6J A;  1CY5 A;  3EZQ B;  1A1W A;  2N7Z A;  4UZ0 A;  2NAQ A;  3T6P A;  1C15 A;  2N1F A;  4IZ5 E;  2L6A A;  2DO9 A;  2NZ7 A;  2BBR A;  4ZBW A;  3CL3 A;  2YGS A;  4RHW A;  3CRD A;  1FAD A;  2LS7 A;  1NGR A;  1WXP A;  1E3Y A;  2DBG A;  2D96 A;  2MB9 A;  2MN4 A;  2OF5 H;  2LWD A;  3LQQ A;  3QF2 A;  2O71 A;  1PN5 A;  1CWW A;  3LQR A;  2YVI A;  2MPC A;  3EZQ A;  2DBF A;  1WH4 A;  4IZ7 B;  1DGN A;  3MOP G;  2XV9 A;  3YGS C;  2NSN A;  2HM2 Q;  2YQF A;  4P4H A;  2N97 A;  2KM6 A;  2OF5 A; 
#chains in the Genus database with same CATH homology
 4A2W A;  2M5V A;  4O6X A;  2LWE A;  1ICH A;  4A2Q A;  3MOP A;  2A9I A;  2DBH A;  2MS7 A;  2MJM A;  4FH0 A;  4D8O A;  2BBZ A;  4M9Z A;  4RHW E;  2B1W A;  2GF5 A;  1DDF A;  4N1L A;  2IB1 A;  1YGO A;  4E9M A;  2L9M A;  4M9S A;  4O7Q A;  2MS8 A;  4I16 A;  4IZA B;  4JUP A;  2VGQ A;  4M9X A;  1D2Z A;  2N80 A;  4P4H I;  3MOP K;  1Z6T A;  2YU0 A;  3YGS P;  2N00 A;  2F1S A;  1N3K A;  3J63 A;  4N1J A;  2KN6 A;  1E41 A;  4N1K A;  4O9F A;  4NQK A;  4F44 A;  4O9L A;  2G7R A;  2P1H A;  4QOB A;  4DWN A;  1WMG A;  3KAT A;  2N83 A;  4EWI A;  4F42 A;  1A1Z A;  4JQW A;  1D2Z B;  2DBD A;  4LWD A;  1UCP A;  2A5Y B;  3J6J A;  1CY5 A;  3EZQ B;  1A1W A;  2N7Z A;  4UZ0 A;  2NAQ A;  3T6P A;  1C15 A;  2N1F A;  4IZ5 E;  2L6A A;  2DO9 A;  2NZ7 A;  2BBR A;  4ZBW A;  3CL3 A;  2YGS A;  4RHW A;  3CRD A;  1FAD A;  2LS7 A;  1NGR A;  1WXP A;  1E3Y A;  2DBG A;  2D96 A;  2MB9 A;  2MN4 A;  2OF5 H;  2LWD A;  3LQQ A;  3QF2 A;  2O71 A;  1PN5 A;  1CWW A;  3LQR A;  2YVI A;  2MPC A;  3EZQ A;  2DBF A;  1WH4 A;  4IZ7 B;  1DGN A;  3MOP G;  2XV9 A;  3YGS C;  2NSN A;  2HM2 Q;  2YQF A;  4P4H A;  2N97 A;  2KM6 A;  2OF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...