1D4NA

Human serum transferrin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKESTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFERRIN
publication title Crystal structures of two mutants (K206Q, H207E) of the N-lobe of human transferrin with increased affinity for iron.
pubmed rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 1999-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1d4nA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1d4nA02
3FXQA 1PC3A 4U4XA 3K6WA 4YU0A 5AA4A 3PD8A 1F9BA 3D4GA 4ZDMA 3E9XA 4QSEA 3A3UA 4OFJA 5FHOA 3PD9A 3TCGA 1N0TA 5KDTA 1DTZA 4OEVA 2RCBA 2Q8JA 4KYEA 5CRYA 3G3FA 3RN8A 5CBRA 2HAUA 3O6IA 1LB8A 2P1SA 1MPBA 3TKDA 2THIA 3IX1A 1B6HA 3K01A 2DE2A 3RPWA 3FIRA 4H1XA 5JTYB 1NFTA 2HZLA 2F7AA 3RY3A 2I0CA 1OQGA 4G4PA 2OK2A 3GZGA 4FECA 2AYSA 2V93A 1TXFA 2VGQA 2OJTA 3EHTA 3OMBA 3PU5A 1OVTA 1B58A 3H6VA 3THIA 4POWA 3K6XA 1KWHA 1SW2A 1DMBA 4ZECA 1O64A 2XX9A 4JWYA 1D3KA 4DE8A 2O68A 4NF6B 4I1DA 3C31A 4ESXA 1JQFA 4G2ZA 2DWIA 2H25A 5FHNA 3QUFA 1B3LA 2F5XA 3GLBA 1AL3A 3CFLA 2GRVA 1M5EA 3W15C 3MZ9A 1SBPA 1LAGE 1PBPA 4MLQA 4RPOA 1IEJA 4H65A 5F7VA 1JNFA 3MVZA 1O63A 1A55A 3MQ9A 2XXYA 3ILUB 1Q35A 3USDA 4RXLA 2DS9A 3R26A 2RINA 2ZNSA 4XIGQ 1MY0A 2I48A 3T9XB 2QS2A 5KCJB 1LBBA 1GGGA 3KFMA 1I6AA 1FW0A 3T9UA 1NMUA 1RKMA 3O97A 4O3BA 3G3IA 2NXOA 3PGFA 3FD3A 3K2DA 1P1QA 3L6HA 2F34A 1QKBA 3C35A 3DP6A 1NNKA 1ATGA 1NH7A 4F1UA 2XXHA 1B05A 3VDFA 2X7PA 2CZLA 4KI0E 4RK2A 4GRKA 3IK6B 2F7CA 1B3HA 2PT2A 4GVOA 3VLWA 1URSA 5I57A 2O6AA 1I6QA 3FVOA 1EU8A 3MJNA 3SEVA 3RUMA 4G77A 4O3AA 1N84A 4IGTA 4QFKA 3DM0A 3G3HA 1MG1A 2O7UA 3FJGA 2DE4A 2Y7RA 4XKNA 1P1WA 3BFTA 3KOTA 1D9YA 3OXNA 2F6GA 2Z8DA 4MBPA 4NE4A 4GQOA 1AMFA 1LLSA 1P1UA 4WXJA 1FTLA 5FTHA 4F1YA 1R6ZA 1XVYA 5DTBA 2VP1A 4GIZA 4JDFA 4GL0A 3MVWA 1B5JA 4DLDA 3S9NC 2Y7IA 5CI5A 1OVBA 1SW1A 4YKIA 3G3GA 4F3SA 3U8QA 4GLIA 2DVZA 1VSOA 4Q30B 1LSTA 4U4SA 2H9BA 1Y1ZA 4F31B 1QKAA 4KFQA 3G3KA 4OERA 4F29A 3N5LA 1US4A 3PPNA 5K2YA 5I2NA 1MQGA 4NMYA 4F3BA 3VVDA 4C0RA 1VFDA 5AA2B 2QS4A 3RQTA 3B6WA 3LSFB 2G29A 4DXUA 1WVJA 1FTKA 3H6WA 3LSLA 1SDXA 3K1NA 3HCQA 2H5YA 3GBAA 3SKPA 5ICQA 3C33A 1EZ9A 4U2RA 1MQHA 3F11A 1SI1A 4ZE9A 3PPRA 4H0WA 3OO6A 3TMGA 3FVKA 3C4MA 3H4ZA 2NUVA 1WDNA 2GH9A 1BKAA 1MQDA 5CMKA 3B6QA 3BFUA 3EQ1A 1S50A 2QS3A 4G8NA 3CIJA 1Y3PA 4H8JA 4QHQA 4IO6A 3OD7A 4HS7A 4OFLA 5AE4A 3JV9A 1H43A 2O69A 1EZPA 3ILTB 3IOVA 1N7XA 1FTMA 3B7DA 1XT8A 2E1SA 4IO5A 5F1QA 1B46A 4PFYA 1IXGA 4NF5A 4LA9A 3TYHA 1MRPA 5I59A 2ZXTA 1PEBA 1Y3QA 4ESWA 1EZOA 1FQAA 4PE5B 2Y7PA 1B0HA 1LCTA 3DP8A 5KZTA 1O7TA 4M4GA 1HSJA 2ABHA 1UIVA 3H03A 5I57B 3U94A 1QVSA 2AL5A 1B1XA 2DYXA 4HCYA 1LB9A 2HQ0A 2XX8A 1OLAA 2QMWA 5K2XA 4IY6A 3IB2A 3JZJA 1VE4A 1T0KA 4OQOA 4AQ4A 4NWDA 4EXLA 1L5TA 4HTGA 2DWAA 4Q5TA 3TAJA 4BDMA 1YTVA 3ODBA 3C36A 3ZKLA 4Q8RA 4OEUA 1LGBC 1UTHB 3WAFA 2Z8FA 1B3EA 2GHBA 4MH5A 3HHGA 2ONSA 1XC1A 1FQEA 3K1PA 4BDRA 4R9GA 5I84A 1B51A 3IOWA 4P11A 1MXVA 3IOTA 2B3FA 1R9QA 4R2BA 4R75A 2AL4A 1M5FA 3PUVE 3TUSA 1BLFA 1FQFA 1JW5A 1US5A 1Q1KA 4R73A 4R6HA 2Q88A 4U21A 2VHAA 2OWSA 2FNCA 4BDNA 1Y4TA 4E0XA 2CMOA 5DEXA 4NF8B 2HAVA 4TLLB 4ZEIA 3LC8A 4GWOA 4NF4A 3EHUA 2I49A 3VXCA 3CG3A 3Q26A 2A5TA 3FVGA 3N26A 4MFIA 1SYIA 5TU0A 4WEDA 3M8UA 1MXWA 3PUXE 1H45A 4FE8A 3TTNA 2YJPA 2R71A 3E4RA 2OWTA 1UTBA 2B3BA 2E0SA 1LBCA 3PMWA 2Z23A 3TELA 4OZ9A 2VD3A 3PPPA 5H8QA 3PUYE 3S4UA 5CC2A 1WODA 4EQBA 4FEBA 4QSCA 3ZS6A 1XVXA 1DTGA 5ITOA 3H7MA 1GV8A 1B9JA 4AB5A 2XXWA 1LFHA 5L9SA 3FXRA 3OO7A 1PB7A 3MWBA 1DPPA 5TPAA 3SEYA 4RY1A 3RT8A 2RKMA 4YAHX 4RJZA 4ELPA 5CMCA 3V8XB 4NF5B 1AOVA 1A54A 2D5WA 3KBRA 2Q9TA 3PPOA 1PDAA 5H8NA 1JW4A 3CRBA 1YPNA 4QRZA 3RT6B 1QUIA 1IITA 5DT6A 3IORA 3UA8A 3U93A 3KEIA 2DVCA 4ECFA 2PMSA 3RTFB 1BTJA 2AIXA 4OYVA 2YLNA 3C32A 2UVIA 1UIUA 2O1MA 3DELB 1A8EA 1SD3A 2O51A 3HN0A 3MVXA 4M1VA 1FQDA 5DVIA 1XHYA 2UVGA 4P0GA 1MXUA 4RYAA 5H8HB 2RF1A 4JSOA 5H8FA 2ZMBA 4R2FA 1TWYA 1B7HA 2Y7KA 2WKYA 2GHAA 2DQVA 4DDDA 4FEDA 1IUDA 3O9PA 4RNSA 3PUZE 4Z0IA 4ZZEA 4I9DA 5M2VA 3U1OA 3H6UA 3K00A 4WEPA 5I58A 3IR1A 1GVCA 4Z7EA 3K4UA 4QF9A 4XKPA 2O84X 4ZEFA 4XKQA 2VOZA 1JEUA 4LP2B 3VFJA 1USYE 2PBWA 4MLVA 1N7WA 2V3QA 4GF8A 1MQIA 4H5FA 2DWJA 1MQJA 4F2QA 4GD5A 1QUJA 3DLNA 2ZYOA 2I6EA 2DOJA 4NTLA 4OESA 1IXCA 4ZZAA 3KG2A 3O29A 5DEXB 3E3KA 1LAHE 4RPNA 2REJA 5AA4B 1MY1A 4KHZE 4OFOA 4NF4B 3TQWA 5A5XA 5TP9A 2XX7A 1MDQA 4XXUA 1GR2A 2A5TB 4POXA 4R72A 1Y9UA 5KDTB 2XXQA 1ZLQA 4WKMA 4G68C 3TCFA 1UTBB 2XXUA 5I2KA 3PMVA 3BBRA 2M8CA 5CMBA 3MW0A 2R9JA 1NL5A 4U23A 1JW1A 4IO3A 3JYRA 2NVUB 1POY1 2H4IA 5ICTA 5FTIA 2RC8A 2PT1A 3MP8A 4QFPA 3FJMA 4IB2A 3QK6A 1SI0A 5I56A 2BJJX 4YB7A 4EDPA 4F39A 3HO7A 3A3CA 3A09A 3LSWA 4GOTA 3I5OA 4ZE8A 1POTA 3IB1A 1II5A 3UIFA 3TTKA 4KR5A 4HCWA 2XXRA 4F19A 3S9MC 3MUQA 1QW0A 5DYHA 5LOMA 4ZEKA 2V3UA 1JEVA 3B6TA 5IAIA 3FZVA 5L9MA 3H06B 3LSXA 1QUKA 4N13A 3FVNA 2ZNTA 5JEIA 1A99A 2FYIA 1QULA 5HM4B 1ZJLA 2NWJA 4JWXA 4KYSA 3C9HA 3IB0A 4LZ8A 3EHSA 3W9WA 4FATA 5DVFA 4YB6A 3O28A 1Y4CA 2PVUA 3VVFA 4OHNA 4UACA 2RCAA 3H3GA 1IZ1A 5AA1A 5H8SA 2I0BA 1NNTA 4Q0CA 2OZZA 2Y7WA 2IA4A 5H8FB 3LUYA 4E0WA 1H3DA 3S2VA 5JTYA 2ZNUA 1MY2A 1TFAA 3QXMA 3FATA 4BLAA 2Y84A 2O7IA 2F8DA 3KN3A 2RC9A 2P0SA 4RK9A 1OMPA 2VD2A 4LQ5A 3TTRA 1MS7A 1MM7A 5EHSA 3O6GA 4G68A 4YKJA 4ELQA 1VR5A 2UXAA 4NF6A 4F22A 2QSXA 4PFUA 3OEMA 4BDOA 4TOZA 3K0VA 2QL3A 1B5HA 3RNNA 2HXWA 2DE3A 4ND9A 1ELJA 3T93B 4GXAA 3KJ7A 4JXIA 4H5GA 4C1TA 4TQUQ 1XS5A 1UQWA 3MVYA 3Q25A 3UN6A 1VFEA 3TEPA 3AXFA 3K02A 5TP9B 4DZ1A 3T9HB 1P99A 3FUZA 4BDQA 3O6HA 3HV1A 3MZBA 3UK4A 3M3LA 1CB6A 1FCKA 5KCJA 4KCCA 1I6BA 1OQHA 2F97A 1S9TA 4JBZA 4U1ZA 3EF7A 4H67A 1ZBMA 2Q2AA 3PPQA 1PBQA 1ZMGA 4G8MA 3N94A 2DXRA 4H6DA 4I8CA 3U72A 4KPTA 4EQ7A 1B4HA 5I56B 2V3TA 2QMXA 4R9FA 4ELOA 4ISUA 5AA3A 3QSLA 3W9VA 3CFXA 4NEDA 2UYEA 4U22A 1LFGA 2Z8EA 3GBBA 3FV1A 3K1MA 4N07A 5I2NB 4FIMA 4YMBA 1FTOA 3Q28A 2R6GE 5FHMA 1N3WA 3M3FA 2DWHA 3TTMA 3IJOB 5AA2D 4DCXA 3OENA 3KSJA 1USYH 4F3GA 3O66A 3S9EA 2I4CA 3HHFA 3T96B 2Z22A 3T66A 2HEUA 1BP5A 2A5SA 2ANJA 4LONB 3R7XA 3TZAA 3KSXA 2ONKE 3FASA 4ONYA 1IQ7A 1A40A 1PB9A 2H99A 4LUBA 5ISUA 1FQBA 3QYTA 3RTWB 1SW4A 1B0LA 5L9OA 4F2OA 1GTKA 4PP0A 2QPQA 1SQYA 4YKPA 1JVYA 1NH8A 3O2AA 1ZTYA 2H98A 1ZIUA 3IOUA 2ZYNA 4KQPA 2Q2CA 3TQLA 1URGA 4EF1A 2D21A 2V84A 4KCDA 5I59B 4GL8A 2PX1A 1IXIA 4NWCA 3SDFA 2F6PA 4G68B 1JVXA 4QSDA 3SEWA 3V89B 4IO4A 4OMBA 4QFLA 1MY4A 1FTJA 2D3IA 3WAEA 3U92A 1A8FA 5AA2A 1P1OA 4OXVA 3MP1A 3OSRA 3VVEA 4DIGA 3MPLA 3SEUA 2GFEA 2YPNA 3DP4A 2I3VA 1YCJA 4KYDA 3SETA 2ZYKA 3L6GA 3V5AA 1IIWA 4YMAA 2XHDA 4FJPA 1MXZA 3OELA 1R1NA 1NKXA 3CSBA 2X26A 2DXYA 2XD3A 3G3JA 3LR1A 3CR9A 1A7LA 2ESNA 3UORA 4UA8A 4DCYA 3UGWA 1AIVA 4PFWA 2QJEA 1MXYA 4QFOA 3RGYA 3T22A 1LAXA 3TCHA 3OOAA 4LQ2A 1MDP1 4FORA 4KD5A 4ZEDA 1AH5A 4R74A 3KN8A 3PUWE 2Q89A 3QIMA 1SW5A 1Y3NA 5BUUA 3K6VA 5B7DA 1LFIA 1Y1MA 2HFBA 1D4NA 1IXHA 1Z7ME 3IL1B 4C1UA 4X9TA 2HCAA 3FV2A 3LBSA 4PQJA 2I58A 3KZGA 3ZSFA 3KN7A 3Q27A 2ZYMA 3RLFE 5JK4A 4R6KA 2O1LA 3IO4A 3D4CA 2ALUA 2XD2A 3MPKA 4K3FA 4YKKA 5CM6A 1MXXA 4YZZA 5L8DA 2XXTA 3MC2A 2W7YA 3SEXA 1M5CA 5IKBA 3KJTA 4X1DA 4OETA 1B7UA 2DSFA 2XXXA 4L17A 3CVGA 4R6YA 5H8QB 4OWDA 1NNPA 3TODA 4YICA 4IGRA 3R6UA 1UTHA 1SVXB 2DP8A 2OCUA 4F18A 4BDLA 3OO9A 1MPDA 3GXAA 3TTLA 1FQCA 4IO7A 4ZEBA 1MM6A 5TPAB 4EQ9A 3MZ1A 5DVJA 3UP9A 1N76A 5EYFA 1YAEA 3FJ7A 3HSTA 4IY5A 3PMXA 4FAJA 3FXUA 2XXPA 1H44A 1MY3A 5HPQA 4PFTA 5B70A 3MBPA 3EPEA 1RYOA 1DOTA 2F78A 1B7ZA 2I4BA 5H8NB 1I69A 2UYFA 1DPEA 1XOCA 4LZ7A 2XXIA 3MAMA 3OEKA 2V25A 3G7WA 4NF8A 3V83A 2RC7A 4LVQA 4OTEA 2X7QA 3M3KA 1ZU0A 1P1NA 1ZKBA 3SESA 3FGSA 1B4ZA 1EH3A 4N6PA 1MPCA 3SERA 5J1DA 3PV0E 1B3GA 4EF2A 2F36A 4OVJA 1H76A 1N3XA 3VLVA 1RYXA 1MH3A 4X1BA 4G8HA 2PYYA 4DXBA 4ELRA 1ANFA 1LAFE 1B32A 3EN3A 1MH4A 3OO8A 5CBSA 4P0IA 3N6TA 3TFLA 3TDJA 3TPAA 4ZS9A 1HSLA 4AB6A 1URDA 2I3WA 1S7YA 3MP6A 3I3VA 2F7BA 5I58B 1LCFA 2REGA 3S9LC 1TFDA 4MF3A 1B5IA 2UVJA 3BKIB 1QJMA 4EUOA 2KLFA 4LZ5A 4HW8A 1DSNA 2XXVA 3H6TA 4IO2A 3IO6A 4PETA 5EHMA 4U1OA 4THIA 1BIYA 1PB8A 1B1HA 2UVHA 4TLMB 1R9LA 3KGCA 2QS1A 1B3FA 3VXBA 1NNFA 1OIBA 5ITPA 4DXCA 5A5XB 3KOSA 4GFRA 4F1VA 2HZKA 3HPIA 3ZKKA 1M5DA 2OLBA 5ELVA 4O3CA 2LAOA 4JWOA 3N6UA 4F3PA 4X48A 1OLCA 5I2KB 4OENA 4I62A 5HBCA 3IAZA 1B2HA 5H8HA 2G93A 5CMMA 4RA1A 4GXSB 3CSGA 3VLUA 2ONRA 2QRYA 3CG1A 4XKRA 2B65A 4YB5A 1JETA 3ONMA 4QFNA 3QUJA 2P2AA 3VE1B 1TT1A 3C34A 1SYHA 1Z7NE 1HSEA 3CFZA 1J1NA 3QAXA 3IJXB 3K6UA 4LATA 1B52A 4JB7A 3Q29A 4EXKA 3P7IA 4XTCQ 3T9VA 2NOOA 2IEEA 1CE2A 4JSDA 1M5BA 3CI8A 1B40A 1Y20A 3VV5A 3OSQA 3E13X 1N04A 2OBGA 3I6VA 1D9VA 4H8IA 3ECRA 2F35A 5BWJA 2FA7A
chains in the Genus database with same CATH superfamily
3FXQA 1PC3A 4U4XA 3K6WA 4YU0A 5AA4A 3PD8A 1F9BA 5IZ3B 3D4GA 2PFYA 4ZDMA 3E9XA 4QSEA 3A3UA 4OFJA 5FHOA 3PD9A 3TCGA 1N0TA 5KDTA 1DTZA 4OEVA 2RCBA 2Q8JA 4OVPA 4KYEA 5CRYA 3G3FA 3RN8A 5CBRA 2HAUA 3O6IA 1LB8A 2P1SA 1MPBA 3TKDA 1FRPA 2THIA 3IX1A 1B6HA 3K01A 2DE2A 1YYZA 3RPWA 3FIRA 4H1XA 5JTYB 1NFTA 2HZLA 2F7AA 1FTAA 3RY3A 2I0CA 1OQGA 4G4PA 2OK2A 3GZGA 4FECA 2AYSA 2V93A 1TXFA 1NUXA 2VGQA 2OJTA 3EHTA 3OMBA 3PU5A 1OVTA 1B58A 3H6VA 4MX6A 4POWA 3THIA 3K6XA 4N91A 4GWXA 1KWHA 1SW2A 1DMBA 4ZECA 1O64A 2XX9A 4JWYA 3IFCA 1D3KA 4DE8A 2OWZA 2O68A 4NF6B 4I1DA 3C31A 4GX3A 4ESXA 1JQFA 4G2ZA 1FSAA 2DWIA 2DDKA 2H25A 5FHNA 3QUFA 1B3LA 2P3VA 1NV3A 2F5XA 3GLBA 1AL3A 4I40A 3CFLA 2GRVA 1M5EA 3W15C 3MZ9A 1SBPA 4HE0A 1LAGE 1PBPA 3B8BA 4MLQA 4RPOA 1IEJA 4H65A 4GX4A 5F7VA 1JNFA 3MVZA 1O63A 1A55A 3MQ9A 1KA1A 2XXYA 3ILUB 1Q35A 3USDA 4RXLA 2DS9A 3R26A 2RINA 2WYPA 4KXPA 3BIHA 2ZNSA 4XIGQ 1MY0A 2I48A 3T9XB 2QS2A 5KCJB 1LBBA 1GGGA 3KFMA 1I6AA 1FW0A 3T9UA 1NMUA 1RKMA 3O97A 4O3BA 3G3IA 2NXOA 3PGFA 2QVVA 3FD3A 3K2DA 1P1QA 3L6HA 4OANA 2F34A 1QKBA 1LBYA 3C35A 2Y5LA 3DP6A 1NNKA 5T3JA 1ATGA 3RPLA 2R8TA 1NH7A 4F1UA 2XXHA 1B05A 3VDFA 2X7PA 2CZLA 4KI0E 1NV4A 4P1EA 4RK2A 4GRKA 3IK6B 2F7CA 1B3HA 2PT2A 4PBQA 2ZZWA 4GVOA 3VLWA 1URSA 3KC1A 5I57A 2O6AA 1I6QA 3FVOA 1EU8A 3MJNA 3SEVA 3RUMA 4G77A 4O3AA 1N84A 4IGTA 4QFKA 3DM0A 3G3HA 1MG1A 1IMFA 1FPKA 2OX3A 2O7UA 3FJGA 2DE4A 2Y7RA 4XKNA 1INPA 1P1WA 1FBGA 3BFTA 3KOTA 1D9YA 3OXNA 2F6GA 1LEVA 2Z8DA 2QFLA 4NE4A 4MBPA 4GQOA 1AMFA 1LLSA 2MKZA 1P1UA 4WXJA 3B50A 1FTLA 4X8RA 5FTHA 4F1YA 1R6ZA 1XVYA 5DTBA 2FIEA 2VP1A 4GIZA 4JDFA 1FPJA 4GL0A 3MVWA 1B5JA 4DLDA 3S9NC 2Y7IA 5CI5A 1OVBA 1SW1A 4YKIA 1FPLA 3G3GA 4F3SA 3U8QA 4GLIA 2DVZA 1VSOA 4Q30B 1LSTA 4U4SA 2H9BA 1Y1ZA 4F31B 1QKAA 4KFQA 3G3KA 2Y5KA 1VDWA 4OERA 4F29A 3N5LA 1US4A 3PPNA 4PC9A 5K2YA 5I2NA 1QGXA 1MQGA 1DBZA 4NMYA 4F3BA 3VVDA 4C0RA 4O7IA 1VFDA 5AA2B 2QS4A 3RQTA 3B6WA 5LDZA 1FBDA 4N8GA 4OA4A 2HPGA 2G29A 3LSFB 4DXUA 1EYIA 1WVJA 1FTKA 1YXIA 3H6WA 3LSLA 1SDXA 3K1NA 3HCQA 2H5YA 3GBAA 3SKPA 5ICQA 3C33A 1EZ9A 4N17A 4U2RA 1MQHA 3F11A 1FJ9A 1SI1A 4ZE9A 3PPRA 4H0WA 3OO6A 1FPDA 3TMGA 3FVKA 2KR0A 3C4MA 1FBEA 3H4ZA 2NUVA 4PF6A 1WDNA 2GH9A 1BKAA 1MQDA 5CMKA 3B6QA 3BFUA 3EQ1A 1S50A 2QS3A 4G8NA 3CIJA 1Y3PA 4H8JA 4QHQA 4IO6A 3OD7A 4HS7A 4OFLA 5AE4A 3JV9A 1H43A 2O69A 1EZPA 3ILTB 3IOVA 1IMBA 1N7XA 5J16A 1FTMA 3B7DA 4MNIA 1XT8A 2E1SA 4DI3D 4FBPA 4IO5A 5F1QA 1B46A 2L5VA 4PFYA 1IXGA 4NF5A 4LA9A 3TYHA 1MRPA 5I59A 2ZXTA 1PEBA 1Y3QA 4ESWA 1EZOA 1FQAA 4PE5B 2Y7PA 4GBVA 4MCOA 1B0HA 1LCTA 3DP8A 5KZTA 1O7TA 4M4GA 1HSJA 2ABHA 3ROJA 1UIVA 3H03A 4P3LA 5I57B 3U94A 1QVSA 2AL5A 1B1XA 2DYXA 4GBWA 4HCYA 1LB9A 2HQ0A 4JVDA 2XX8A 1OLAA 2QMWA 5K2XA 5IGAA 4IY6A 3IB2A 3JZJA 1VE4A 1T0KA 4OQOA 4AQ4A 4NWDA 4EXLA 1L5TA 4HTGA 2DWAA 4Q5TA 3TAJA 4BDMA 1YTVA 3ODBA 3C36A 3ZKLA 4Q8RA 4OEUA 1LGBC 1UTHB 3WAFA 2Z8FA 1B3EA 2GHBA 3GYYA 4MH5A 3HHGA 5EQ9A 2ONSA 1LBZA 1XC1A 1FQEA 3K1PA 4BDRA 4R9GA 5LTCA 5I84A 1B51A 3FBPA 3IOWA 4P11A 1MXVA 3IOTA 2B3FA 1R9QA 4R2BA 1FPFA 4R75A 2AL4A 2WYKA 1SPIA 1NUWA 2QVUA 1M5FA 3PUVE 1AWBA 3TUSA 1BLFA 1FQFA 4GWUA 4PDDA 1JW5A 1US5A 1Q1KA 4R73A 4R6HA 2Q88A 3RYDA 4U21A 2VHAA 2CZIA 2FNCA 2OWSA 1YZ0A 4BDNA 1Y4TA 3BIGA 4E0XA 2CMOA 1NI9A 5DEXA 4NF8B 2HAVA 4TLLB 4ZEIA 1RDYA 3LC8A 4XFEA 4GWOA 4NF4A 3EHUA 2I49A 3VXCA 3CG3A 3Q26A 5FBPA 4I3YA 2A5TA 3IFAA 3FVGA 3N26A 4MFIA 1SYIA 3M8UA 3PUXE 1MXWA 4FE8A 4WEDA 1H45A 5TU0A 3TTNA 2VPNA 2YJPA 2R71A 3E4RA 2OWTA 1UTBA 2B3BA 2E0SA 1LBCA 3PMWA 2Z23A 3ISPA 3TELA 4OZ9A 2P3NA 2VD3A 3PPPA 5H8QA 3PUYE 3S4UA 5CC2A 5EYHA 1WODA 4EQBA 4FEBA 4QSCA 3ZS6A 1XVXA 3CHGA 1DTGA 5ITOA 3H7MA 1GV8A 1B9JA 2CEYA 2XXWA 4AB5A 1LFHA 5L9SA 3FXRA 3OO7A 1K9ZA 1PB7A 3MWBA 1DPPA 5TPAA 4AS4A 3SEYA 4RY1A 3RT8A 2RKMA 4YAHX 1EYKA 4RJZA 4ELPA 5CMCA 3V8XB 5EQ7A 5I3SA 4NF5B 3FXBA 1AOVA 4LN5A 1A54A 2D5WA 2VT5A 3KBRA 2Q9TA 3PPOA 1PDAA 5H8NA 1JW4A 3CRBA 2KQZA 1YPNA 4QRZA 4MMPA 4PF8A 3RT6B 1QUIA 3MSTA 1LBWA 4OVRA 1IITA 5DT6A 3IORA 3UA8A 4PAKA 3U93A 3KEIA 2DVCA 4ECFA 2PMSA 3RTFB 1BTJA 2AIXA 4MEVA 1IMEA 4OYVA 2YLNA 3C32A 2UVIA 1UIUA 2O1MA 3DELB 1A8EA 4MNPA 1SD3A 2O51A 3HN0A 3MVXA 4M1VA 1FQDA 5DVIA 4PAIA 1XHYA 3KBZA 2UVGA 4P0GA 1MXUA 4RYAA 5H8HB 2RF1A 4JSOA 5H8FA 2ZMBA 4R2FA 4PAFA 1TWYA 1B7HA 2Y7KA 2WKYA 4O8MA 2GHAA 2DQVA 4DDDA 4FEDA 1IUDA 3O9PA 4RNSA 3PUZE 4Z0IA 4P1LA 4ZZEA 4I9DA 5M2VA 3U1OA 3H6UA 3K00A 4WEPA 5I58A 3IR1A 4N6DA 1GVCA 2Q74A 4Z7EA 3K4UA 4QF9A 3QMFA 4IR8A 4XKPA 2O84X 4ZEFA 5EQAA 4XKQA 2VOZA 1JEUA 4HE1A 4LP2B 3VFJA 4GWWA 1USYE 2PBWA 4MLVA 1N7WA 2V3QA 4GF8A 1MQIA 4H5FA 2DWJA 2XXKA 1MQJA 4F2QA 4PGNA 4GD5A 1QUJA 3DLNA 2ZYOA 2I6EA 2DOJA 4NTLA 1LBXA 4OESA 1IXCA 4ZZAA 3KG2A 3O29A 5DEXB 3E3KA 1LAHE 4RPNA 2REJA 5AA4B 1MY1A 4KHZE 4OFOA 4NF4B 3T0JA 3TQWA 5A5XA 5TP9A 5IM2A 4NN3A 2XX7A 4OVQA 1MDQA 4XXUA 1GR2A 2A5TB 4POXA 4R72A 1Y9UA 5KDTB 2XXQA 1ZLQA 4WKMA 4G68C 3T1BA 3TCFA 1UTBB 1LBVA 2XXUA 5I2KA 4NF0A 3PMVA 4MHFA 3BBRA 2M8CA 5CMBA 2Q8MA 3MW0A 2R9JA 1NL5A 4U23A 1JW1A 4IO3A 3JYRA 2WBDA 2NVUB 1POY1 2H4IA 2WBBA 5ICTA 3E79A 5FTIA 2RC8A 2PT1A 3MP8A 4QFPA 3FJMA 4IB2A 3QK6A 1SI0A 4PFBA 5I56A 2BJJX 4YB7A 4EDPA 4F39A 3HO7A 4NX1A 3A3CA 3A09A 3LSWA 4GOTA 3I5OA 5DW8A 4ZE8A 1POTA 2B4MA 3IB1A 1II5A 3UIFA 3TTKA 4KR5A 4MIJA 4HCWA 1XI6A 2XXRA 4F19A 3EKIA 3S9MC 3MUQA 1QW0A 5DYHA 5LOMA 1D9QA 4H46A 4ZEKA 1K9YA 2V3UA 1JEVA 3B6TA 1DCUA 3FZVA 5IAIA 5L9MA 3H06B 3LSXA 1QUKA 4N13A 3FVNA 2ZNTA 5JEIA 1A99A 2FYIA 1QULA 5HM4B 5IZ3A 4O7MA 1RDXA 1ZJLA 2NWJA 4JWXA 2V4CA 3C9HA 4KYSA 3SZPA 3IB0A 4LZ8A 3EHSA 3W9WA 4FATA 4X04A 5DVFA 4YB6A 3O28A 1Y4CA 2PVUA 3VVFA 4OHNA 4UACA 2RCAA 3E78A 3H3GA 1IZ1A 5AA1A 5H8SA 2I0BA 1NNTA 4Q0CA 5IZ1A 2OZZA 2HHMA 2XWVA 2Y7WA 2IA4A 5H8FB 3LUYA 4E0WA 1H3DA 4JVCA 3S2VA 5JTYA 2ZNUA 1MY2A 1TFAA 3QXMA 3FATA 5I7IA 4BLAA 2Y84A 2O7IA 2F8DA 3KN3A 2RC9A 2P0SA 2WX9A 4RK9A 1OMPA 4PFRA 4NGUA 2VD2A 4LQ5A 2FVZA 3RPLB 3TTRA 4QBAA 1MS7A 1MM7A 4P47A 5EHSA 3O6GA 4G68A 1G0IA 4YKJA 4ELQA 1VR5A 2UXAA 1NV0A 2XWOA 4NF6A 4F22A 2QSXA 4PFUA 3OEMA 4BDOA 4TOZA 3K0VA 2QL3A 1B5HA 3RNNA 2HXWA 4N4UA 2DE3A 2XWIA 2QVRA 4ND9A 1ELJA 3T93B 4GXAA 4GWZA 3KJ7A 4JXIA 4H5GA 4C1TA 4TQUQ 1XS5A 1UQWA 3MVYA 3Q25A 3UN6A 1VFEA 3TEPA 3AXFA 3K02A 5TP9B 4DZ1A 1IMAA 3T9HB 2BJIA 1P99A 3FUZA 5I5PA 4PBHA 4BDQA 3O6HA 4XEQA 3HV1A 3MZBA 3UK4A 3M3LA 1CB6A 1FCKA 5KCJA 4KCCA 1NUYA 1I6BA 1FBPA 1OQHA 2F97A 1S9TA 4JBZA 4U1ZA 3EF7A 4H67A 1ZBMA 2Q2AA 3PPQA 1PBQA 4NQ8A 1ZMGA 4G8MA 5EQ8A 3N94A 2DXRA 4H6DA 4I8CA 3U72A 4KPTA 4EQ7A 1B4HA 5I56B 2V3TA 2QMXA 4R9FA 4ELOA 4ISUA 5AA3A 3QSLA 3W9VA 3CFXA 4NEDA 5EYGA 2UYEA 4U22A 2F3DA 1LFGA 2Z8EA 3GBBA 3FV1A 3K1MA 4N07A 5I2NB 4FIMA 4MNCA 4YMBA 1FTOA 3Q28A 2R6GE 5FHMA 5ET8A 1N3WA 3M3FA 2DWHA 3TTMA 1IMDA 3IJOB 5AA2D 4DCXA 3OENA 3KSJA 1RDZA 1USYH 4F3GA 3O66A 3S9EA 2I4CA 3HHFA 3T96B 2Z22A 1NV2A 2HEUA 3T66A 1KA0A 1NV6A 4NAPA 1BP5A 2A5SA 2ANJA 4LONB 3R7XA 3TZAA 3KSXA 2ONKE 3FASA 2PCRA 4ONYA 1IQ7A 3LUZA 1A40A 1PB9A 4PFIA 2H99A 4LUBA 5ISUA 2ZZXA 1FQBA 3QYTA 3RTWB 1SW4A 1B0LA 5L9OA 4F2OA 1GTKA 4PP0A 2QPQA 1SQYA 4YKPA 1JVYA 1NH8A 1NUZA 3O2AA 1ZTYA 2H98A 1ZIUA 3IOUA 1EYJA 3A29A 2ZYNA 4KQPA 2Q2CA 4N15A 3TQLA 1URGA 4EF1A 2D21A 2V84A 4KCDA 5I59B 4GL8A 2PX1A 1IXIA 4NWCA 3SDFA 1FBHA 2F6PA 4G68B 1JVXA 2JJKA 4QSDA 3SEWA 3V89B 4IO4A 4OMBA 4QFLA 1MY4A 1FTJA 2D3IA 3WAEA 3U92A 4MJOA 1A8FA 5AA2A 1P1OA 5F24A 4OVSA 4OXVA 3MP1A 3OSRA 3VVEA 4DIGA 3MPLA 3SEUA 2GFEA 2YPNA 3DP4A 2I3VA 1YCJA 2VPOA 4KYDA 3SETA 1FPEA 2ZYKA 3L6GA 3V5AA 1IIWA 4YMAA 2XHDA 4FJPA 1MXZA 4HE2A 3OELA 1R1NA 1KZ8A 1NKXA 3CSBA 2X26A 2DXYA 2XD3A 3G3JA 3LR1A 3CR9A 1A7LA 2ESNA 3UORA 3LV0A 4UA8A 4DCYA 3UGWA 1Q9DA 1AIVA 4PFWA 2QJEA 4PTKA 1FBFA 1MXYA 4QFOA 4O94A 4N6KA 3RGYA 3T22A 1LAXA 1JP4A 3TCHA 3OOAA 3NOHA 4LQ2A 1MDP1 2WEFA 4FORA 4KD5A 4ZEDA 1AH5A 4R74A 3KN8A 1DK4A 3PUWE 2Q89A 2CEXA 3QIMA 1SW5A 1Y3NA 5BUUA 3K6VA 5B7DA 1LFIA 4GWSA 1Y1MA 2HFBA 1D4NA 1IXHA 1Z7ME 3IL1B 1NV1A 4C1UA 4X9TA 2HCAA 3FV2A 3LBSA 4PQJA 2I58A 4PCDA 2CZHA 3KZGA 3ZSFA 3KN7A 3Q27A 2ZYMA 3RLFE 5JK4A 4R6KA 2O1LA 3IO4A 3D4CA 2ALUA 2XD2A 4QXDA 3MPKA 4K3FA 4YKKA 5CM6A 1MXXA 4YZZA 1FPGA 4G61A 5L8DA 2XXTA 4HXVA 3MC2A 2W7YA 3SEXA 1M5CA 5IKBA 2F3BA 3KJTA 1BK4A 4X1DA 4OETA 1B7UA 2DSFA 1G0HA 5ET7A 2XXXA 4L17A 3CVGA 4R6YA 5H8QB 4OWDA 4AS5A 4MAGA 1NNPA 4NHBA 3TODA 4YICA 4IGRA 3R6UA 1UTHA 1SVXB 2DP8A 2XA5A 2OCUA 2PFZA 4F18A 4BDLA 3OO9A 1MPDA 3GXAA 3TTLA 4GWYA 1FQCA 4IO7A 4ZEBA 1MM6A 5TPAB 4EQ9A 1CNQA 3MZ1A 5DVJA 3UP9A 1FJ6A 1N76A 5EYFA 1YAEA 3FJ7A 4N81A 3HSTA 4IY5A 3PMXA 4FAJA 3FXUA 2XXPA 1H44A 5ET6A 1MY3A 5HPQA 4PFTA 5B70A 3MBPA 3EPEA 1RYOA 1DOTA 2F78A 2B4LA 1B7ZA 2I4BA 5H8NB 1I69A 2UYFA 4H45A 1DPEA 1XOCA 4LZ7A 2XXIA 2FHYA 3MAMA 3OEKA 2V25A 3G7WA 4NF8A 4P9KA 3V83A 2RC7A 4LVQA 4OVTA 4OTEA 2X7QA 3M3KA 3MYUA 4P56A 1ZU0A 5IZZA 1P1NA 1ZKBA 3SESA 3FGSA 1B4ZA 1EH3A 4N8YA 4N6PA 1MPCA 3SERA 5J1DA 3PV0E 1B3GA 4EF2A 2F36A 4OVJA 3PTYA 1H76A 1N3XA 4PGPA 3VLVA 1RYXA 1MH3A 4X1BA 4G8HA 2PYYA 4DXBA 4ELRA 1ANFA 1LAFE 1B32A 3EN3A 1MH4A 1IMCA 3OO8A 3HFUA 5CBSA 4P0IA 3N6TA 1FBCA 3TFLA 1NV5A 2CZKA 3TDJA 3TPAA 4ZS9A 1HSLA 4AB6A 1URDA 4UABA 2I3WA 1S7YA 3MP6A 3I3VA 2F7BA 5ET5A 5I58B 1LCFA 2REGA 2XWKA 3S9LC 1TFDA 4MF3A 1B5IA 5A5LA 2UVJA 3BKIB 1QJMA 4EUOA 2KLFA 4LZ5A 4HW8A 1DSNA 2HXRA 2XXVA 3H6TA 2FIXA 4PE3A 4IO2A 3IO6A 4PETA 5EHMA 4U1OA 4GX6A 4THIA 1BIYA 1PB8A 2FBPA 1B1HA 2UVHA 4TLMB 1R9LA 3KGCA 2QS1A 1B3FA 3VXBA 2GQ1A 3U65A 5ESYA 1NNFA 1OIBA 5ITPA 4DXCA 5A5XB 3D1RA 3KOSA 4GFRA 4F1VA 2ZZVA 2HZKA 3HPIA 3ZKKA 1M5DA 4NG7A 2OLBA 5ELVA 4O3CA 2LAOA 4JWOA 3N6UA 4F3PA 4X48A 1OLCA 5I2KB 4OENA 4I62A 5HBCA 3IAZA 1B2HA 5H8HA 2G93A 5CMMA 4RA1A 4GXSB 3CSGA 4DI4B 3VLUA 4XF5A 2ONRA 2QRYA 3CG1A 4P8BA 4XKRA 2B65A 4YB5A 1JETA 3ONMA 4JVIA 4QFNA 3QUJA 2P2AA 3VE1B 1TT1A 3C34A 1SYHA 4PDHA 1Z7NE 1HSEA 3CFZA 1J1NA 3QAXA 3KC0A 3IJXB 1NV7A 3K6UA 4LATA 1B52A 4JB7A 3Q29A 4XTCQ 3P7IA 3T9VA 4EXKA 2NOOA 2IEEA 1CE2A 4JSDA 1M5BA 4I3EA 3CI8A 1FPIA 1B40A 1Y20A 3VV5A 3OSQA 3E13X 1FPBA 1N04A 2OBGA 3I6VA 1D9VA 4H8IA 3ECRA 2F35A 5BWJA 2FA7A
chains in the Genus database with same CATH topology
3FXQA 1PC3A 4U4XA 3K6WA 4YU0A 5AA4A 3PD8A 1F9BA 3D4GA 4ZDMA 3E9XA 4QSEA 3A3UA 4OFJA 5FHOA 3PD9A 3TCGA 1N0TA 5KDTA 1DTZA 4OEVA 2RCBA 2Q8JA 4KYEA 5CRYA 3G3FA 3RN8A 5CBRA 2HAUA 3O6IA 1LB8A 2P1SA 1MPBA 3TKDA 2THIA 3IX1A 1B6HA 3K01A 2DE2A 3RPWA 3FIRA 4H1XA 5JTYB 1NFTA 2HZLA 2F7AA 3RY3A 2I0CA 1OQGA 4G4PA 2OK2A 3GZGA 4FECA 2AYSA 2V93A 1TXFA 2VGQA 2OJTA 3EHTA 3OMBA 3PU5A 1OVTA 1B58A 3H6VA 3THIA 4POWA 3K6XA 1KWHA 1SW2A 1DMBA 4ZECA 1O64A 2XX9A 4JWYA 1D3KA 4DE8A 2O68A 4NF6B 4I1DA 3C31A 4ESXA 1JQFA 4G2ZA 2DWIA 2H25A 5FHNA 3QUFA 1B3LA 2F5XA 3GLBA 1AL3A 3CFLA 2GRVA 1M5EA 3W15C 3MZ9A 1SBPA 1LAGE 1PBPA 4MLQA 4RPOA 1IEJA 4H65A 5F7VA 1JNFA 3MVZA 1O63A 1A55A 3MQ9A 2XXYA 3ILUB 1Q35A 3USDA 4RXLA 2DS9A 3R26A 2RINA 2ZNSA 4XIGQ 1MY0A 2I48A 3T9XB 2QS2A 5KCJB 1LBBA 1GGGA 3KFMA 1I6AA 1FW0A 3T9UA 1NMUA 1RKMA 3O97A 4O3BA 3G3IA 2NXOA 3PGFA 3FD3A 3K2DA 1P1QA 3L6HA 2F34A 1QKBA 3C35A 3DP6A 1NNKA 1ATGA 1NH7A 4F1UA 2XXHA 1B05A 3VDFA 2X7PA 2CZLA 4KI0E 4RK2A 4GRKA 3IK6B 2F7CA 1B3HA 2PT2A 4GVOA 3VLWA 1URSA 5I57A 2O6AA 1I6QA 3FVOA 1EU8A 3MJNA 3SEVA 3RUMA 4G77A 4O3AA 1N84A 4IGTA 4QFKA 3DM0A 3G3HA 1MG1A 2O7UA 3FJGA 2DE4A 2Y7RA 4XKNA 1P1WA 3BFTA 3KOTA 1D9YA 3OXNA 2F6GA 2Z8DA 4MBPA 4NE4A 4GQOA 1AMFA 1LLSA 1P1UA 4WXJA 1FTLA 5FTHA 4F1YA 1R6ZA 1XVYA 5DTBA 2VP1A 4GIZA 4JDFA 4GL0A 3MVWA 1B5JA 4DLDA 3S9NC 2Y7IA 5CI5A 1OVBA 1SW1A 4YKIA 3G3GA 4F3SA 3U8QA 4GLIA 2DVZA 1VSOA 4Q30B 1LSTA 4U4SA 2H9BA 1Y1ZA 4F31B 1QKAA 4KFQA 3G3KA 4OERA 4F29A 3N5LA 1US4A 3PPNA 5K2YA 5I2NA 1MQGA 4NMYA 4F3BA 3VVDA 4C0RA 1VFDA 5AA2B 2QS4A 3RQTA 3B6WA 3LSFB 2G29A 4DXUA 1WVJA 1FTKA 3H6WA 3LSLA 1SDXA 3K1NA 3HCQA 2H5YA 3GBAA 3SKPA 5ICQA 3C33A 1EZ9A 4U2RA 1MQHA 3F11A 1SI1A 4ZE9A 3PPRA 4H0WA 3OO6A 3TMGA 3FVKA 3C4MA 3H4ZA 2NUVA 1WDNA 2GH9A 1BKAA 1MQDA 5CMKA 3B6QA 3BFUA 3EQ1A 1S50A 2QS3A 4G8NA 3CIJA 1Y3PA 4H8JA 4QHQA 4IO6A 3OD7A 4HS7A 4OFLA 5AE4A 3JV9A 1H43A 2O69A 1EZPA 3ILTB 3IOVA 1N7XA 1FTMA 3B7DA 1XT8A 2E1SA 4IO5A 5F1QA 1B46A 4PFYA 1IXGA 4NF5A 4LA9A 3TYHA 1MRPA 5I59A 2ZXTA 1PEBA 1Y3QA 4ESWA 1EZOA 1FQAA 4PE5B 2Y7PA 1B0HA 1LCTA 3DP8A 5KZTA 1O7TA 4M4GA 1HSJA 2ABHA 1UIVA 3H03A 5I57B 3U94A 1QVSA 2AL5A 1B1XA 2DYXA 4HCYA 1LB9A 2HQ0A 2XX8A 1OLAA 2QMWA 5K2XA 4IY6A 3IB2A 3JZJA 1VE4A 1T0KA 4OQOA 4AQ4A 4NWDA 4EXLA 1L5TA 4HTGA 2DWAA 4Q5TA 3TAJA 4BDMA 1YTVA 3ODBA 3C36A 3ZKLA 4Q8RA 4OEUA 1LGBC 1UTHB 3WAFA 2Z8FA 1B3EA 2GHBA 4MH5A 3HHGA 2ONSA 1XC1A 1FQEA 3K1PA 4BDRA 4R9GA 5I84A 1B51A 3IOWA 4P11A 1MXVA 3IOTA 2B3FA 1R9QA 4R2BA 4R75A 2AL4A 1M5FA 3PUVE 3TUSA 1BLFA 1FQFA 1JW5A 1US5A 1Q1KA 4R73A 4R6HA 2Q88A 4U21A 2VHAA 2OWSA 2FNCA 4BDNA 1Y4TA 4E0XA 2CMOA 5DEXA 4NF8B 2HAVA 4TLLB 4ZEIA 3LC8A 4GWOA 4NF4A 3EHUA 2I49A 3VXCA 3CG3A 3Q26A 2A5TA 3FVGA 3N26A 4MFIA 1SYIA 5TU0A 4WEDA 3M8UA 1MXWA 3PUXE 1H45A 4FE8A 3TTNA 2YJPA 2R71A 3E4RA 2OWTA 1UTBA 2B3BA 2E0SA 1LBCA 3PMWA 2Z23A 3TELA 4OZ9A 2VD3A 3PPPA 5H8QA 3PUYE 3S4UA 5CC2A 1WODA 4EQBA 4FEBA 4QSCA 3ZS6A 1XVXA 1DTGA 5ITOA 3H7MA 1GV8A 1B9JA 4AB5A 2XXWA 1LFHA 5L9SA 3FXRA 3OO7A 1PB7A 3MWBA 1DPPA 5TPAA 3SEYA 4RY1A 3RT8A 2RKMA 4YAHX 4RJZA 4ELPA 5CMCA 3V8XB 4NF5B 1AOVA 1A54A 2D5WA 3KBRA 2Q9TA 3PPOA 1PDAA 5H8NA 1JW4A 3CRBA 1YPNA 4QRZA 3RT6B 1QUIA 1IITA 5DT6A 3IORA 3UA8A 3U93A 3KEIA 2DVCA 4ECFA 2PMSA 3RTFB 1BTJA 2AIXA 4OYVA 2YLNA 3C32A 2UVIA 1UIUA 2O1MA 3DELB 1A8EA 1SD3A 2O51A 3HN0A 3MVXA 4M1VA 1FQDA 5DVIA 1XHYA 2UVGA 4P0GA 1MXUA 4RYAA 5H8HB 2RF1A 4JSOA 5H8FA 2ZMBA 4R2FA 1TWYA 1B7HA 2Y7KA 2WKYA 2GHAA 2DQVA 4DDDA 4FEDA 1IUDA 3O9PA 4RNSA 3PUZE 4Z0IA 4ZZEA 4I9DA 5M2VA 3U1OA 3H6UA 3K00A 4WEPA 5I58A 3IR1A 1GVCA 4Z7EA 3K4UA 4QF9A 4XKPA 2O84X 4ZEFA 4XKQA 2VOZA 1JEUA 4LP2B 3VFJA 1USYE 2PBWA 4MLVA 1N7WA 2V3QA 4GF8A 1MQIA 4H5FA 2DWJA 1MQJA 4F2QA 4GD5A 1QUJA 3DLNA 2ZYOA 2I6EA 2DOJA 4NTLA 4OESA 1IXCA 4ZZAA 3KG2A 3O29A 5DEXB 3E3KA 1LAHE 4RPNA 2REJA 5AA4B 1MY1A 4KHZE 4OFOA 4NF4B 3TQWA 5A5XA 5TP9A 2XX7A 1MDQA 4XXUA 1GR2A 2A5TB 4POXA 4R72A 1Y9UA 5KDTB 2XXQA 1ZLQA 4WKMA 4G68C 3TCFA 1UTBB 2XXUA 5I2KA 3PMVA 3BBRA 2M8CA 5CMBA 3MW0A 2R9JA 1NL5A 4U23A 1JW1A 4IO3A 3JYRA 2NVUB 1POY1 2H4IA 5ICTA 5FTIA 2RC8A 2PT1A 3MP8A 4QFPA 3FJMA 4IB2A 3QK6A 1SI0A 5I56A 2BJJX 4YB7A 4EDPA 4F39A 3HO7A 3A3CA 3A09A 3LSWA 4GOTA 3I5OA 4ZE8A 1POTA 3IB1A 1II5A 3UIFA 3TTKA 4KR5A 4HCWA 2XXRA 4F19A 3S9MC 3MUQA 1QW0A 5DYHA 5LOMA 4ZEKA 2V3UA 1JEVA 3B6TA 5IAIA 3FZVA 5L9MA 3H06B 3LSXA 1QUKA 4N13A 3FVNA 2ZNTA 5JEIA 1A99A 2FYIA 1QULA 5HM4B 1ZJLA 2NWJA 4JWXA 4KYSA 3C9HA 3IB0A 4LZ8A 3EHSA 3W9WA 4FATA 5DVFA 4YB6A 3O28A 1Y4CA 2PVUA 3VVFA 4OHNA 4UACA 2RCAA 3H3GA 1IZ1A 5AA1A 5H8SA 2I0BA 1NNTA 4Q0CA 2OZZA 2Y7WA 2IA4A 5H8FB 3LUYA 4E0WA 1H3DA 3S2VA 5JTYA 2ZNUA 1MY2A 1TFAA 3QXMA 3FATA 4BLAA 2Y84A 2O7IA 2F8DA 3KN3A 2RC9A 2P0SA 4RK9A 1OMPA 2VD2A 4LQ5A 3TTRA 1MS7A 1MM7A 5EHSA 3O6GA 4G68A 4YKJA 4ELQA 1VR5A 2UXAA 4NF6A 4F22A 2QSXA 4PFUA 3OEMA 4BDOA 4TOZA 3K0VA 2QL3A 1B5HA 3RNNA 2HXWA 2DE3A 4ND9A 1ELJA 3T93B 4GXAA 3KJ7A 4JXIA 4H5GA 4C1TA 4TQUQ 1XS5A 1UQWA 3MVYA 3Q25A 3UN6A 1VFEA 3TEPA 3AXFA 3K02A 5TP9B 4DZ1A 3T9HB 1P99A 3FUZA 4BDQA 3O6HA 3HV1A 3MZBA 3UK4A 3M3LA 1CB6A 1FCKA 5KCJA 4KCCA 1I6BA 1OQHA 2F97A 1S9TA 4JBZA 4U1ZA 3EF7A 4H67A 1ZBMA 2Q2AA 3PPQA 1PBQA 1ZMGA 4G8MA 3N94A 2DXRA 4H6DA 4I8CA 3U72A 4KPTA 4EQ7A 1B4HA 5I56B 2V3TA 2QMXA 4R9FA 4ELOA 4ISUA 5AA3A 3QSLA 3W9VA 3CFXA 4NEDA 2UYEA 4U22A 1LFGA 2Z8EA 3GBBA 3FV1A 3K1MA 4N07A 5I2NB 4FIMA 4YMBA 1FTOA 3Q28A 2R6GE 5FHMA 1N3WA 3M3FA 2DWHA 3TTMA 3IJOB 5AA2D 4DCXA 3OENA 3KSJA 1USYH 4F3GA 3O66A 3S9EA 2I4CA 3HHFA 3T96B 2Z22A 3T66A 2HEUA 1BP5A 2A5SA 2ANJA 4LONB 3R7XA 3TZAA 3KSXA 2ONKE 3FASA 4ONYA 1IQ7A 1A40A 1PB9A 2H99A 4LUBA 5ISUA 1FQBA 3QYTA 3RTWB 1SW4A 1B0LA 5L9OA 4F2OA 1GTKA 4PP0A 2QPQA 1SQYA 4YKPA 1JVYA 1NH8A 3O2AA 1ZTYA 2H98A 1ZIUA 3IOUA 2ZYNA 4KQPA 2Q2CA 3TQLA 1URGA 4EF1A 2D21A 2V84A 4KCDA 5I59B 4GL8A 2PX1A 1IXIA 4NWCA 3SDFA 2F6PA 4G68B 1JVXA 4QSDA 3SEWA 3V89B 4IO4A 4OMBA 4QFLA 1MY4A 1FTJA 2D3IA 3WAEA 3U92A 1A8FA 5AA2A 1P1OA 4OXVA 3MP1A 3OSRA 3VVEA 4DIGA 3MPLA 3SEUA 2GFEA 2YPNA 3DP4A 2I3VA 1YCJA 4KYDA 3SETA 2ZYKA 3L6GA 3V5AA 1IIWA 4YMAA 2XHDA 4FJPA 1MXZA 3OELA 1R1NA 1NKXA 3CSBA 2X26A 2DXYA 2XD3A 3G3JA 3LR1A 3CR9A 1A7LA 2ESNA 3UORA 4UA8A 4DCYA 3UGWA 1AIVA 4PFWA 2QJEA 1MXYA 4QFOA 3RGYA 3T22A 1LAXA 3TCHA 3OOAA 4LQ2A 1MDP1 4FORA 4KD5A 4ZEDA 1AH5A 4R74A 3KN8A 3PUWE 2Q89A 3QIMA 1SW5A 1Y3NA 5BUUA 3K6VA 5B7DA 1LFIA 1Y1MA 2HFBA 1D4NA 1IXHA 1Z7ME 3IL1B 4C1UA 4X9TA 2HCAA 3FV2A 3LBSA 4PQJA 2I58A 3KZGA 3ZSFA 3KN7A 3Q27A 2ZYMA 3RLFE 5JK4A 4R6KA 2O1LA 3IO4A 3D4CA 2ALUA 2XD2A 3MPKA 4K3FA 4YKKA 5CM6A 1MXXA 4YZZA 5L8DA 2XXTA 3MC2A 2W7YA 3SEXA 1M5CA 5IKBA 3KJTA 4X1DA 4OETA 1B7UA 2DSFA 2XXXA 4L17A 3CVGA 4R6YA 5H8QB 4OWDA 1NNPA 3TODA 4YICA 4IGRA 3R6UA 1UTHA 1SVXB 2DP8A 2OCUA 4F18A 4BDLA 3OO9A 1MPDA 3GXAA 3TTLA 1FQCA 4IO7A 4ZEBA 1MM6A 5TPAB 4EQ9A 3MZ1A 5DVJA 3UP9A 1N76A 5EYFA 1YAEA 3FJ7A 3HSTA 4IY5A 3PMXA 4FAJA 3FXUA 2XXPA 1H44A 1MY3A 5HPQA 4PFTA 5B70A 3MBPA 3EPEA 1RYOA 1DOTA 2F78A 1B7ZA 2I4BA 5H8NB 1I69A 2UYFA 1DPEA 1XOCA 4LZ7A 2XXIA 3MAMA 3OEKA 2V25A 3G7WA 4NF8A 3V83A 2RC7A 4LVQA 4OTEA 2X7QA 3M3KA 1ZU0A 1P1NA 1ZKBA 3SESA 3FGSA 1B4ZA 1EH3A 4N6PA 1MPCA 3SERA 5J1DA 3PV0E 1B3GA 4EF2A 2F36A 4OVJA 1H76A 1N3XA 3VLVA 1RYXA 1MH3A 4X1BA 4G8HA 2PYYA 4DXBA 4ELRA 1ANFA 1LAFE 1B32A 3EN3A 1MH4A 3OO8A 5CBSA 4P0IA 3N6TA 3TFLA 3TDJA 3TPAA 4ZS9A 1HSLA 4AB6A 1URDA 2I3WA 1S7YA 3MP6A 3I3VA 2F7BA 5I58B 1LCFA 2REGA 3S9LC 1TFDA 4MF3A 1B5IA 2UVJA 3BKIB 1QJMA 4EUOA 2KLFA 4LZ5A 4HW8A 1DSNA 2XXVA 3H6TA 4IO2A 3IO6A 4PETA 5EHMA 4U1OA 4THIA 1BIYA 1PB8A 1B1HA 2UVHA 4TLMB 1R9LA 3KGCA 2QS1A 1B3FA 3VXBA 1NNFA 1OIBA 5ITPA 4DXCA 5A5XB 3KOSA 4GFRA 4F1VA 2HZKA 3HPIA 3ZKKA 1M5DA 2OLBA 5ELVA 4O3CA 2LAOA 4JWOA 3N6UA 4F3PA 4X48A 1OLCA 5I2KB 4OENA 4I62A 5HBCA 3IAZA 1B2HA 5H8HA 2G93A 5CMMA 4RA1A 4GXSB 3CSGA 3VLUA 2ONRA 2QRYA 3CG1A 4XKRA 2B65A 4YB5A 1JETA 3ONMA 4QFNA 3QUJA 2P2AA 3VE1B 1TT1A 3C34A 1SYHA 1Z7NE 1HSEA 3CFZA 1J1NA 3QAXA 3IJXB 3K6UA 4LATA 1B52A 4JB7A 3Q29A 4EXKA 3P7IA 4XTCQ 3T9VA 2NOOA 2IEEA 1CE2A 4JSDA 1M5BA 3CI8A 1B40A 1Y20A 3VV5A 3OSQA 3E13X 1N04A 2OBGA 3I6VA 1D9VA 4H8IA 3ECRA 2F35A 5BWJA 2FA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXQ A;  1PC3 A;  4U4X A;  3K6W A;  4YU0 A;  5AA4 A;  3PD8 A;  1F9B A;  3D4G A;  4ZDM A;  3E9X A;  4QSE A;  3A3U A;  4OFJ A;  5FHO A;  3PD9 A;  3TCG A;  1N0T A;  5KDT A;  1DTZ A;  4OEV A;  2RCB A;  2Q8J A;  4KYE A;  5CRY A;  3G3F A;  3RN8 A;  5CBR A;  2HAU A;  3O6I A;  1LB8 A;  2P1S A;  1MPB A;  3TKD A;  2THI A;  3IX1 A;  1B6H A;  3K01 A;  2DE2 A;  3RPW A;  3FIR A;  4H1X A;  5JTY B;  1NFT A;  2HZL A;  2F7A A;  3RY3 A;  2I0C A;  1OQG A;  4G4P A;  2OK2 A;  3GZG A;  4FEC A;  2AYS A;  2V93 A;  1TXF A;  2VGQ A;  2OJT A;  3EHT A;  3OMB A;  3PU5 A;  1OVT A;  1B58 A;  3H6V A;  3THI A;  4POW A;  3K6X A;  1KWH A;  1SW2 A;  1DMB A;  4ZEC A;  1O64 A;  2XX9 A;  4JWY A;  1D3K A;  4DE8 A;  2O68 A;  4NF6 B;  4I1D A;  3C31 A;  4ESX A;  1JQF A;  4G2Z A;  2DWI A;  2H25 A;  5FHN A;  3QUF A;  1B3L A;  2F5X A;  3GLB A;  1AL3 A;  3CFL A;  2GRV A;  1M5E A;  3W15 C;  3MZ9 A;  1SBP A;  1LAG E;  1PBP A;  4MLQ A;  4RPO A;  1IEJ A;  4H65 A;  5F7V A;  1JNF A;  3MVZ A;  1O63 A;  1A55 A;  3MQ9 A;  2XXY A;  3ILU B;  1Q35 A;  3USD A;  4RXL A;  2DS9 A;  3R26 A;  2RIN A;  2ZNS A;  4XIG Q;  1MY0 A;  2I48 A;  3T9X B;  2QS2 A;  5KCJ B;  1LBB A;  1GGG A;  3KFM A;  1I6A A;  1FW0 A;  3T9U A;  1NMU A;  1RKM A;  3O97 A;  4O3B A;  3G3I A;  2NXO A;  3PGF A;  3FD3 A;  3K2D A;  1P1Q A;  3L6H A;  2F34 A;  1QKB A;  3C35 A;  3DP6 A;  1NNK A;  1ATG A;  1NH7 A;  4F1U A;  2XXH A;  1B05 A;  3VDF A;  2X7P A;  2CZL A;  4KI0 E;  4RK2 A;  4GRK A;  3IK6 B;  2F7C A;  1B3H A;  2PT2 A;  4GVO A;  3VLW A;  1URS A;  5I57 A;  2O6A A;  1I6Q A;  3FVO A;  1EU8 A;  3MJN A;  3SEV A;  3RUM A;  4G77 A;  4O3A A;  1N84 A;  4IGT A;  4QFK A;  3DM0 A;  3G3H A;  1MG1 A;  2O7U A;  3FJG A;  2DE4 A;  2Y7R A;  4XKN A;  1P1W A;  3BFT A;  3KOT A;  1D9Y A;  3OXN A;  2F6G A;  2Z8D A;  4MBP A;  4NE4 A;  4GQO A;  1AMF A;  1LLS A;  1P1U A;  4WXJ A;  1FTL A;  5FTH A;  4F1Y A;  1R6Z A;  1XVY A;  5DTB A;  2VP1 A;  4GIZ A;  4JDF A;  4GL0 A;  3MVW A;  1B5J A;  4DLD A;  3S9N C;  2Y7I A;  5CI5 A;  1OVB A;  1SW1 A;  4YKI A;  3G3G A;  4F3S A;  3U8Q A;  4GLI A;  2DVZ A;  1VSO A;  4Q30 B;  1LST A;  4U4S A;  2H9B A;  1Y1Z A;  4F31 B;  1QKA A;  4KFQ A;  3G3K A;  4OER A;  4F29 A;  3N5L A;  1US4 A;  3PPN A;  5K2Y A;  5I2N A;  1MQG A;  4NMY A;  4F3B A;  3VVD A;  4C0R A;  1VFD A;  5AA2 B;  2QS4 A;  3RQT A;  3B6W A;  3LSF B;  2G29 A;  4DXU A;  1WVJ A;  1FTK A;  3H6W A;  3LSL A;  1SDX A;  3K1N A;  3HCQ A;  2H5Y A;  3GBA A;  3SKP A;  5ICQ A;  3C33 A;  1EZ9 A;  4U2R A;  1MQH A;  3F11 A;  1SI1 A;  4ZE9 A;  3PPR A;  4H0W A;  3OO6 A;  3TMG A;  3FVK A;  3C4M A;  3H4Z A;  2NUV A;  1WDN A;  2GH9 A;  1BKA A;  1MQD A;  5CMK A;  3B6Q A;  3BFU A;  3EQ1 A;  1S50 A;  2QS3 A;  4G8N A;  3CIJ A;  1Y3P A;  4H8J A;  4QHQ A;  4IO6 A;  3OD7 A;  4HS7 A;  4OFL A;  5AE4 A;  3JV9 A;  1H43 A;  2O69 A;  1EZP A;  3ILT B;  3IOV A;  1N7X A;  1FTM A;  3B7D A;  1XT8 A;  2E1S A;  4IO5 A;  5F1Q A;  1B46 A;  4PFY A;  1IXG A;  4NF5 A;  4LA9 A;  3TYH A;  1MRP A;  5I59 A;  2ZXT A;  1PEB A;  1Y3Q A;  4ESW A;  1EZO A;  1FQA A;  4PE5 B;  2Y7P A;  1B0H A;  1LCT A;  3DP8 A;  5KZT A;  1O7T A;  4M4G A;  1HSJ A;  2ABH A;  1UIV A;  3H03 A;  5I57 B;  3U94 A;  1QVS A;  2AL5 A;  1B1X A;  2DYX A;  4HCY A;  1LB9 A;  2HQ0 A;  2XX8 A;  1OLA A;  2QMW A;  5K2X A;  4IY6 A;  3IB2 A;  3JZJ A;  1VE4 A;  1T0K A;  4OQO A;  4AQ4 A;  4NWD A;  4EXL A;  1L5T A;  4HTG A;  2DWA A;  4Q5T A;  3TAJ A;  4BDM A;  1YTV A;  3ODB A;  3C36 A;  3ZKL A;  4Q8R A;  4OEU A;  1LGB C;  1UTH B;  3WAF A;  2Z8F A;  1B3E A;  2GHB A;  4MH5 A;  3HHG A;  2ONS A;  1XC1 A;  1FQE A;  3K1P A;  4BDR A;  4R9G A;  5I84 A;  1B51 A;  3IOW A;  4P11 A;  1MXV A;  3IOT A;  2B3F A;  1R9Q A;  4R2B A;  4R75 A;  2AL4 A;  1M5F A;  3PUV E;  3TUS A;  1BLF A;  1FQF A;  1JW5 A;  1US5 A;  1Q1K A;  4R73 A;  4R6H A;  2Q88 A;  4U21 A;  2VHA A;  2OWS A;  2FNC A;  4BDN A;  1Y4T A;  4E0X A;  2CMO A;  5DEX A;  4NF8 B;  2HAV A;  4TLL B;  4ZEI A;  3LC8 A;  4GWO A;  4NF4 A;  3EHU A;  2I49 A;  3VXC A;  3CG3 A;  3Q26 A;  2A5T A;  3FVG A;  3N26 A;  4MFI A;  1SYI A;  5TU0 A;  4WED A;  3M8U A;  1MXW A;  3PUX E;  1H45 A;  4FE8 A;  3TTN A;  2YJP A;  2R71 A;  3E4R A;  2OWT A;  1UTB A;  2B3B A;  2E0S A;  1LBC A;  3PMW A;  2Z23 A;  3TEL A;  4OZ9 A;  2VD3 A;  3PPP A;  5H8Q A;  3PUY E;  3S4U A;  5CC2 A;  1WOD A;  4EQB A;  4FEB A;  4QSC A;  3ZS6 A;  1XVX A;  1DTG A;  5ITO A;  3H7M A;  1GV8 A;  1B9J A;  4AB5 A;  2XXW A;  1LFH A;  5L9S A;  3FXR A;  3OO7 A;  1PB7 A;  3MWB A;  1DPP A;  5TPA A;  3SEY A;  4RY1 A;  3RT8 A;  2RKM A;  4YAH X;  4RJZ A;  4ELP A;  5CMC A;  3V8X B;  4NF5 B;  1AOV A;  1A54 A;  2D5W A;  3KBR A;  2Q9T A;  3PPO A;  1PDA A;  5H8N A;  1JW4 A;  3CRB A;  1YPN A;  4QRZ A;  3RT6 B;  1QUI A;  1IIT A;  5DT6 A;  3IOR A;  3UA8 A;  3U93 A;  3KEI A;  2DVC A;  4ECF A;  2PMS A;  3RTF B;  1BTJ A;  2AIX A;  4OYV A;  2YLN A;  3C32 A;  2UVI A;  1UIU A;  2O1M A;  3DEL B;  1A8E A;  1SD3 A;  2O51 A;  3HN0 A;  3MVX A;  4M1V A;  1FQD A;  5DVI A;  1XHY A;  2UVG A;  4P0G A;  1MXU A;  4RYA A;  5H8H B;  2RF1 A;  4JSO A;  5H8F A;  2ZMB A;  4R2F A;  1TWY A;  1B7H A;  2Y7K A;  2WKY A;  2GHA A;  2DQV A;  4DDD A;  4FED A;  1IUD A;  3O9P A;  4RNS A;  3PUZ E;  4Z0I A;  4ZZE A;  4I9D A;  5M2V A;  3U1O A;  3H6U A;  3K00 A;  4WEP A;  5I58 A;  3IR1 A;  1GVC A;  4Z7E A;  3K4U A;  4QF9 A;  4XKP A;  2O84 X;  4ZEF A;  4XKQ A;  2VOZ A;  1JEU A;  4LP2 B;  3VFJ A;  1USY E;  2PBW A;  4MLV A;  1N7W A;  2V3Q A;  4GF8 A;  1MQI A;  4H5F A;  2DWJ A;  1MQJ A;  4F2Q A;  4GD5 A;  1QUJ A;  3DLN A;  2ZYO A;  2I6E A;  2DOJ A;  4NTL A;  4OES A;  1IXC A;  4ZZA A;  3KG2 A;  3O29 A;  5DEX B;  3E3K A;  1LAH E;  4RPN A;  2REJ A;  5AA4 B;  1MY1 A;  4KHZ E;  4OFO A;  4NF4 B;  3TQW A;  5A5X A;  5TP9 A;  2XX7 A;  1MDQ A;  4XXU A;  1GR2 A;  2A5T B;  4POX A;  4R72 A;  1Y9U A;  5KDT B;  2XXQ A;  1ZLQ A;  4WKM A;  4G68 C;  3TCF A;  1UTB B;  2XXU A;  5I2K A;  3PMV A;  3BBR A;  2M8C A;  5CMB A;  3MW0 A;  2R9J A;  1NL5 A;  4U23 A;  1JW1 A;  4IO3 A;  3JYR A;  2NVU B;  1POY 1;  2H4I A;  5ICT A;  5FTI A;  2RC8 A;  2PT1 A;  3MP8 A;  4QFP A;  3FJM A;  4IB2 A;  3QK6 A;  1SI0 A;  5I56 A;  2BJJ X;  4YB7 A;  4EDP A;  4F39 A;  3HO7 A;  3A3C A;  3A09 A;  3LSW A;  4GOT A;  3I5O A;  4ZE8 A;  1POT A;  3IB1 A;  1II5 A;  3UIF A;  3TTK A;  4KR5 A;  4HCW A;  2XXR A;  4F19 A;  3S9M C;  3MUQ A;  1QW0 A;  5DYH A;  5LOM A;  4ZEK A;  2V3U A;  1JEV A;  3B6T A;  5IAI A;  3FZV A;  5L9M A;  3H06 B;  3LSX A;  1QUK A;  4N13 A;  3FVN A;  2ZNT A;  5JEI A;  1A99 A;  2FYI A;  1QUL A;  5HM4 B;  1ZJL A;  2NWJ A;  4JWX A;  4KYS A;  3C9H A;  3IB0 A;  4LZ8 A;  3EHS A;  3W9W A;  4FAT A;  5DVF A;  4YB6 A;  3O28 A;  1Y4C A;  2PVU A;  3VVF A;  4OHN A;  4UAC A;  2RCA A;  3H3G A;  1IZ1 A;  5AA1 A;  5H8S A;  2I0B A;  1NNT A;  4Q0C A;  2OZZ A;  2Y7W A;  2IA4 A;  5H8F B;  3LUY A;  4E0W A;  1H3D A;  3S2V A;  5JTY A;  2ZNU A;  1MY2 A;  1TFA A;  3QXM A;  3FAT A;  4BLA A;  2Y84 A;  2O7I A;  2F8D A;  3KN3 A;  2RC9 A;  2P0S A;  4RK9 A;  1OMP A;  2VD2 A;  4LQ5 A;  3TTR A;  1MS7 A;  1MM7 A;  5EHS A;  3O6G A;  4G68 A;  4YKJ A;  4ELQ A;  1VR5 A;  2UXA A;  4NF6 A;  4F22 A;  2QSX A;  4PFU A;  3OEM A;  4BDO A;  4TOZ A;  3K0V A;  2QL3 A;  1B5H A;  3RNN A;  2HXW A;  2DE3 A;  4ND9 A;  1ELJ A;  3T93 B;  4GXA A;  3KJ7 A;  4JXI A;  4H5G A;  4C1T A;  4TQU Q;  1XS5 A;  1UQW A;  3MVY A;  3Q25 A;  3UN6 A;  1VFE A;  3TEP A;  3AXF A;  3K02 A;  5TP9 B;  4DZ1 A;  3T9H B;  1P99 A;  3FUZ A;  4BDQ A;  3O6H A;  3HV1 A;  3MZB A;  3UK4 A;  3M3L A;  1CB6 A;  1FCK A;  5KCJ A;  4KCC A;  1I6B A;  1OQH A;  2F97 A;  1S9T A;  4JBZ A;  4U1Z A;  3EF7 A;  4H67 A;  1ZBM A;  2Q2A A;  3PPQ A;  1PBQ A;  1ZMG A;  4G8M A;  3N94 A;  2DXR A;  4H6D A;  4I8C A;  3U72 A;  4KPT A;  4EQ7 A;  1B4H A;  5I56 B;  2V3T A;  2QMX A;  4R9F A;  4ELO A;  4ISU A;  5AA3 A;  3QSL A;  3W9V A;  3CFX A;  4NED A;  2UYE A;  4U22 A;  1LFG A;  2Z8E A;  3GBB A;  3FV1 A;  3K1M A;  4N07 A;  5I2N B;  4FIM A;  4YMB A;  1FTO A;  3Q28 A;  2R6G E;  5FHM A;  1N3W A;  3M3F A;  2DWH A;  3TTM A;  3IJO B;  5AA2 D;  4DCX A;  3OEN A;  3KSJ A;  1USY H;  4F3G A;  3O66 A;  3S9E A;  2I4C A;  3HHF A;  3T96 B;  2Z22 A;  3T66 A;  2HEU A;  1BP5 A;  2A5S A;  2ANJ A;  4LON B;  3R7X A;  3TZA A;  3KSX A;  2ONK E;  3FAS A;  4ONY A;  1IQ7 A;  1A40 A;  1PB9 A;  2H99 A;  4LUB A;  5ISU A;  1FQB A;  3QYT A;  3RTW B;  1SW4 A;  1B0L A;  5L9O A;  4F2O A;  1GTK A;  4PP0 A;  2QPQ A;  1SQY A;  4YKP A;  1JVY A;  1NH8 A;  3O2A A;  1ZTY A;  2H98 A;  1ZIU A;  3IOU A;  2ZYN A;  4KQP A;  2Q2C A;  3TQL A;  1URG A;  4EF1 A;  2D21 A;  2V84 A;  4KCD A;  5I59 B;  4GL8 A;  2PX1 A;  1IXI A;  4NWC A;  3SDF A;  2F6P A;  4G68 B;  1JVX A;  4QSD A;  3SEW A;  3V89 B;  4IO4 A;  4OMB A;  4QFL A;  1MY4 A;  1FTJ A;  2D3I A;  3WAE A;  3U92 A;  1A8F A;  5AA2 A;  1P1O A;  4OXV A;  3MP1 A;  3OSR A;  3VVE A;  4DIG A;  3MPL A;  3SEU A;  2GFE A;  2YPN A;  3DP4 A;  2I3V A;  1YCJ A;  4KYD A;  3SET A;  2ZYK A;  3L6G A;  3V5A A;  1IIW A;  4YMA A;  2XHD A;  4FJP A;  1MXZ A;  3OEL A;  1R1N A;  1NKX A;  3CSB A;  2X26 A;  2DXY A;  2XD3 A;  3G3J A;  3LR1 A;  3CR9 A;  1A7L A;  2ESN A;  3UOR A;  4UA8 A;  4DCY A;  3UGW A;  1AIV A;  4PFW A;  2QJE A;  1MXY A;  4QFO A;  3RGY A;  3T22 A;  1LAX A;  3TCH A;  3OOA A;  4LQ2 A;  1MDP 1;  4FOR A;  4KD5 A;  4ZED A;  1AH5 A;  4R74 A;  3KN8 A;  3PUW E;  2Q89 A;  3QIM A;  1SW5 A;  1Y3N A;  5BUU A;  3K6V A;  5B7D A;  1LFI A;  1Y1M A;  2HFB A;  1D4N A;  1IXH A;  1Z7M E;  3IL1 B;  4C1U A;  4X9T A;  2HCA A;  3FV2 A;  3LBS A;  4PQJ A;  2I58 A;  3KZG A;  3ZSF A;  3KN7 A;  3Q27 A;  2ZYM A;  3RLF E;  5JK4 A;  4R6K A;  2O1L A;  3IO4 A;  3D4C A;  2ALU A;  2XD2 A;  3MPK A;  4K3F A;  4YKK A;  5CM6 A;  1MXX A;  4YZZ A;  5L8D A;  2XXT A;  3MC2 A;  2W7Y A;  3SEX A;  1M5C A;  5IKB A;  3KJT A;  4X1D A;  4OET A;  1B7U A;  2DSF A;  2XXX A;  4L17 A;  3CVG A;  4R6Y A;  5H8Q B;  4OWD A;  1NNP A;  3TOD A;  4YIC A;  4IGR A;  3R6U A;  1UTH A;  1SVX B;  2DP8 A;  2OCU A;  4F18 A;  4BDL A;  3OO9 A;  1MPD A;  3GXA A;  3TTL A;  1FQC A;  4IO7 A;  4ZEB A;  1MM6 A;  5TPA B;  4EQ9 A;  3MZ1 A;  5DVJ A;  3UP9 A;  1N76 A;  5EYF A;  1YAE A;  3FJ7 A;  3HST A;  4IY5 A;  3PMX A;  4FAJ A;  3FXU A;  2XXP A;  1H44 A;  1MY3 A;  5HPQ A;  4PFT A;  5B70 A;  3MBP A;  3EPE A;  1RYO A;  1DOT A;  2F78 A;  1B7Z A;  2I4B A;  5H8N B;  1I69 A;  2UYF A;  1DPE A;  1XOC A;  4LZ7 A;  2XXI A;  3MAM A;  3OEK A;  2V25 A;  3G7W A;  4NF8 A;  3V83 A;  2RC7 A;  4LVQ A;  4OTE A;  2X7Q A;  3M3K A;  1ZU0 A;  1P1N A;  1ZKB A;  3SES A;  3FGS A;  1B4Z A;  1EH3 A;  4N6P A;  1MPC A;  3SER A;  5J1D A;  3PV0 E;  1B3G A;  4EF2 A;  2F36 A;  4OVJ A;  1H76 A;  1N3X A;  3VLV A;  1RYX A;  1MH3 A;  4X1B A;  4G8H A;  2PYY A;  4DXB A;  4ELR A;  1ANF A;  1LAF E;  1B32 A;  3EN3 A;  1MH4 A;  3OO8 A;  5CBS A;  4P0I A;  3N6T A;  3TFL A;  3TDJ A;  3TPA A;  4ZS9 A;  1HSL A;  4AB6 A;  1URD A;  2I3W A;  1S7Y A;  3MP6 A;  3I3V A;  2F7B A;  5I58 B;  1LCF A;  2REG A;  3S9L C;  1TFD A;  4MF3 A;  1B5I A;  2UVJ A;  3BKI B;  1QJM A;  4EUO A;  2KLF A;  4LZ5 A;  4HW8 A;  1DSN A;  2XXV A;  3H6T A;  4IO2 A;  3IO6 A;  4PET A;  5EHM A;  4U1O A;  4THI A;  1BIY A;  1PB8 A;  1B1H A;  2UVH A;  4TLM B;  1R9L A;  3KGC A;  2QS1 A;  1B3F A;  3VXB A;  1NNF A;  1OIB A;  5ITP A;  4DXC A;  5A5X B;  3KOS A;  4GFR A;  4F1V A;  2HZK A;  3HPI A;  3ZKK A;  1M5D A;  2OLB A;  5ELV A;  4O3C A;  2LAO A;  4JWO A;  3N6U A;  4F3P A;  4X48 A;  1OLC A;  5I2K B;  4OEN A;  4I62 A;  5HBC A;  3IAZ A;  1B2H A;  5H8H A;  2G93 A;  5CMM A;  4RA1 A;  4GXS B;  3CSG A;  3VLU A;  2ONR A;  2QRY A;  3CG1 A;  4XKR A;  2B65 A;  4YB5 A;  1JET A;  3ONM A;  4QFN A;  3QUJ A;  2P2A A;  3VE1 B;  1TT1 A;  3C34 A;  1SYH A;  1Z7N E;  1HSE A;  3CFZ A;  1J1N A;  3QAX A;  3IJX B;  3K6U A;  4LAT A;  1B52 A;  4JB7 A;  3Q29 A;  4EXK A;  3P7I A;  4XTC Q;  3T9V A;  2NOO A;  2IEE A;  1CE2 A;  4JSD A;  1M5B A;  3CI8 A;  1B40 A;  1Y20 A;  3VV5 A;  3OSQ A;  3E13 X;  1N04 A;  2OBG A;  3I6V A;  1D9V A;  4H8I A;  3ECR A;  2F35 A;  5BWJ A;  2FA7 A; 
#chains in the Genus database with same CATH topology
 3FXQ A;  1PC3 A;  4U4X A;  3K6W A;  4YU0 A;  5AA4 A;  3PD8 A;  1F9B A;  5IZ3 B;  3D4G A;  2PFY A;  4ZDM A;  3E9X A;  4QSE A;  3A3U A;  4OFJ A;  5FHO A;  3PD9 A;  3TCG A;  1N0T A;  5KDT A;  1DTZ A;  4OEV A;  2RCB A;  2Q8J A;  4OVP A;  4KYE A;  5CRY A;  3G3F A;  3RN8 A;  5CBR A;  2HAU A;  3O6I A;  1LB8 A;  2P1S A;  1MPB A;  3TKD A;  1FRP A;  2THI A;  3IX1 A;  1B6H A;  3K01 A;  2DE2 A;  1YYZ A;  3RPW A;  3FIR A;  4H1X A;  5JTY B;  1NFT A;  2HZL A;  2F7A A;  1FTA A;  3RY3 A;  2I0C A;  1OQG A;  4G4P A;  2OK2 A;  3GZG A;  4FEC A;  2AYS A;  2V93 A;  1TXF A;  1NUX A;  2VGQ A;  2OJT A;  3EHT A;  3OMB A;  3PU5 A;  1OVT A;  1B58 A;  3H6V A;  4MX6 A;  4POW A;  3THI A;  3K6X A;  4N91 A;  4GWX A;  1KWH A;  1SW2 A;  1DMB A;  4ZEC A;  1O64 A;  2XX9 A;  4JWY A;  3IFC A;  1D3K A;  4DE8 A;  2OWZ A;  2O68 A;  4NF6 B;  4I1D A;  3C31 A;  4GX3 A;  4ESX A;  1JQF A;  4G2Z A;  1FSA A;  2DWI A;  2DDK A;  2H25 A;  5FHN A;  3QUF A;  1B3L A;  2P3V A;  1NV3 A;  2F5X A;  3GLB A;  1AL3 A;  4I40 A;  3CFL A;  2GRV A;  1M5E A;  3W15 C;  3MZ9 A;  1SBP A;  4HE0 A;  1LAG E;  1PBP A;  3B8B A;  4MLQ A;  4RPO A;  1IEJ A;  4H65 A;  4GX4 A;  5F7V A;  1JNF A;  3MVZ A;  1O63 A;  1A55 A;  3MQ9 A;  1KA1 A;  2XXY A;  3ILU B;  1Q35 A;  3USD A;  4RXL A;  2DS9 A;  3R26 A;  2RIN A;  2WYP A;  4KXP A;  3BIH A;  2ZNS A;  4XIG Q;  1MY0 A;  2I48 A;  3T9X B;  2QS2 A;  5KCJ B;  1LBB A;  1GGG A;  3KFM A;  1I6A A;  1FW0 A;  3T9U A;  1NMU A;  1RKM A;  3O97 A;  4O3B A;  3G3I A;  2NXO A;  3PGF A;  2QVV A;  3FD3 A;  3K2D A;  1P1Q A;  3L6H A;  4OAN A;  2F34 A;  1QKB A;  1LBY A;  3C35 A;  2Y5L A;  3DP6 A;  1NNK A;  5T3J A;  1ATG A;  3RPL A;  2R8T A;  1NH7 A;  4F1U A;  2XXH A;  1B05 A;  3VDF A;  2X7P A;  2CZL A;  4KI0 E;  1NV4 A;  4P1E A;  4RK2 A;  4GRK A;  3IK6 B;  2F7C A;  1B3H A;  2PT2 A;  4PBQ A;  2ZZW A;  4GVO A;  3VLW A;  1URS A;  3KC1 A;  5I57 A;  2O6A A;  1I6Q A;  3FVO A;  1EU8 A;  3MJN A;  3SEV A;  3RUM A;  4G77 A;  4O3A A;  1N84 A;  4IGT A;  4QFK A;  3DM0 A;  3G3H A;  1MG1 A;  1IMF A;  1FPK A;  2OX3 A;  2O7U A;  3FJG A;  2DE4 A;  2Y7R A;  4XKN A;  1INP A;  1P1W A;  1FBG A;  3BFT A;  3KOT A;  1D9Y A;  3OXN A;  2F6G A;  1LEV A;  2Z8D A;  2QFL A;  4NE4 A;  4MBP A;  4GQO A;  1AMF A;  1LLS A;  2MKZ A;  1P1U A;  4WXJ A;  3B50 A;  1FTL A;  4X8R A;  5FTH A;  4F1Y A;  1R6Z A;  1XVY A;  5DTB A;  2FIE A;  2VP1 A;  4GIZ A;  4JDF A;  1FPJ A;  4GL0 A;  3MVW A;  1B5J A;  4DLD A;  3S9N C;  2Y7I A;  5CI5 A;  1OVB A;  1SW1 A;  4YKI A;  1FPL A;  3G3G A;  4F3S A;  3U8Q A;  4GLI A;  2DVZ A;  1VSO A;  4Q30 B;  1LST A;  4U4S A;  2H9B A;  1Y1Z A;  4F31 B;  1QKA A;  4KFQ A;  3G3K A;  2Y5K A;  1VDW A;  4OER A;  4F29 A;  3N5L A;  1US4 A;  3PPN A;  4PC9 A;  5K2Y A;  5I2N A;  1QGX A;  1MQG A;  1DBZ A;  4NMY A;  4F3B A;  3VVD A;  4C0R A;  4O7I A;  1VFD A;  5AA2 B;  2QS4 A;  3RQT A;  3B6W A;  5LDZ A;  1FBD A;  4N8G A;  4OA4 A;  2HPG A;  2G29 A;  3LSF B;  4DXU A;  1EYI A;  1WVJ A;  1FTK A;  1YXI A;  3H6W A;  3LSL A;  1SDX A;  3K1N A;  3HCQ A;  2H5Y A;  3GBA A;  3SKP A;  5ICQ A;  3C33 A;  1EZ9 A;  4N17 A;  4U2R A;  1MQH A;  3F11 A;  1FJ9 A;  1SI1 A;  4ZE9 A;  3PPR A;  4H0W A;  3OO6 A;  1FPD A;  3TMG A;  3FVK A;  2KR0 A;  3C4M A;  1FBE A;  3H4Z A;  2NUV A;  4PF6 A;  1WDN A;  2GH9 A;  1BKA A;  1MQD A;  5CMK A;  3B6Q A;  3BFU A;  3EQ1 A;  1S50 A;  2QS3 A;  4G8N A;  3CIJ A;  1Y3P A;  4H8J A;  4QHQ A;  4IO6 A;  3OD7 A;  4HS7 A;  4OFL A;  5AE4 A;  3JV9 A;  1H43 A;  2O69 A;  1EZP A;  3ILT B;  3IOV A;  1IMB A;  1N7X A;  5J16 A;  1FTM A;  3B7D A;  4MNI A;  1XT8 A;  2E1S A;  4DI3 D;  4FBP A;  4IO5 A;  5F1Q A;  1B46 A;  2L5V A;  4PFY A;  1IXG A;  4NF5 A;  4LA9 A;  3TYH A;  1MRP A;  5I59 A;  2ZXT A;  1PEB A;  1Y3Q A;  4ESW A;  1EZO A;  1FQA A;  4PE5 B;  2Y7P A;  4GBV A;  4MCO A;  1B0H A;  1LCT A;  3DP8 A;  5KZT A;  1O7T A;  4M4G A;  1HSJ A;  2ABH A;  3ROJ A;  1UIV A;  3H03 A;  4P3L A;  5I57 B;  3U94 A;  1QVS A;  2AL5 A;  1B1X A;  2DYX A;  4GBW A;  4HCY A;  1LB9 A;  2HQ0 A;  4JVD A;  2XX8 A;  1OLA A;  2QMW A;  5K2X A;  5IGA A;  4IY6 A;  3IB2 A;  3JZJ A;  1VE4 A;  1T0K A;  4OQO A;  4AQ4 A;  4NWD A;  4EXL A;  1L5T A;  4HTG A;  2DWA A;  4Q5T A;  3TAJ A;  4BDM A;  1YTV A;  3ODB A;  3C36 A;  3ZKL A;  4Q8R A;  4OEU A;  1LGB C;  1UTH B;  3WAF A;  2Z8F A;  1B3E A;  2GHB A;  3GYY A;  4MH5 A;  3HHG A;  5EQ9 A;  2ONS A;  1LBZ A;  1XC1 A;  1FQE A;  3K1P A;  4BDR A;  4R9G A;  5LTC A;  5I84 A;  1B51 A;  3FBP A;  3IOW A;  4P11 A;  1MXV A;  3IOT A;  2B3F A;  1R9Q A;  4R2B A;  1FPF A;  4R75 A;  2AL4 A;  2WYK A;  1SPI A;  1NUW A;  2QVU A;  1M5F A;  3PUV E;  1AWB A;  3TUS A;  1BLF A;  1FQF A;  4GWU A;  4PDD A;  1JW5 A;  1US5 A;  1Q1K A;  4R73 A;  4R6H A;  2Q88 A;  3RYD A;  4U21 A;  2VHA A;  2CZI A;  2FNC A;  2OWS A;  1YZ0 A;  4BDN A;  1Y4T A;  3BIG A;  4E0X A;  2CMO A;  1NI9 A;  5DEX A;  4NF8 B;  2HAV A;  4TLL B;  4ZEI A;  1RDY A;  3LC8 A;  4XFE A;  4GWO A;  4NF4 A;  3EHU A;  2I49 A;  3VXC A;  3CG3 A;  3Q26 A;  5FBP A;  4I3Y A;  2A5T A;  3IFA A;  3FVG A;  3N26 A;  4MFI A;  1SYI A;  3M8U A;  3PUX E;  1MXW A;  4FE8 A;  4WED A;  1H45 A;  5TU0 A;  3TTN A;  2VPN A;  2YJP A;  2R71 A;  3E4R A;  2OWT A;  1UTB A;  2B3B A;  2E0S A;  1LBC A;  3PMW A;  2Z23 A;  3ISP A;  3TEL A;  4OZ9 A;  2P3N A;  2VD3 A;  3PPP A;  5H8Q A;  3PUY E;  3S4U A;  5CC2 A;  5EYH A;  1WOD A;  4EQB A;  4FEB A;  4QSC A;  3ZS6 A;  1XVX A;  3CHG A;  1DTG A;  5ITO A;  3H7M A;  1GV8 A;  1B9J A;  2CEY A;  2XXW A;  4AB5 A;  1LFH A;  5L9S A;  3FXR A;  3OO7 A;  1K9Z A;  1PB7 A;  3MWB A;  1DPP A;  5TPA A;  4AS4 A;  3SEY A;  4RY1 A;  3RT8 A;  2RKM A;  4YAH X;  1EYK A;  4RJZ A;  4ELP A;  5CMC A;  3V8X B;  5EQ7 A;  5I3S A;  4NF5 B;  3FXB A;  1AOV A;  4LN5 A;  1A54 A;  2D5W A;  2VT5 A;  3KBR A;  2Q9T A;  3PPO A;  1PDA A;  5H8N A;  1JW4 A;  3CRB A;  2KQZ A;  1YPN A;  4QRZ A;  4MMP A;  4PF8 A;  3RT6 B;  1QUI A;  3MST A;  1LBW A;  4OVR A;  1IIT A;  5DT6 A;  3IOR A;  3UA8 A;  4PAK A;  3U93 A;  3KEI A;  2DVC A;  4ECF A;  2PMS A;  3RTF B;  1BTJ A;  2AIX A;  4MEV A;  1IME A;  4OYV A;  2YLN A;  3C32 A;  2UVI A;  1UIU A;  2O1M A;  3DEL B;  1A8E A;  4MNP A;  1SD3 A;  2O51 A;  3HN0 A;  3MVX A;  4M1V A;  1FQD A;  5DVI A;  4PAI A;  1XHY A;  3KBZ A;  2UVG A;  4P0G A;  1MXU A;  4RYA A;  5H8H B;  2RF1 A;  4JSO A;  5H8F A;  2ZMB A;  4R2F A;  4PAF A;  1TWY A;  1B7H A;  2Y7K A;  2WKY A;  4O8M A;  2GHA A;  2DQV A;  4DDD A;  4FED A;  1IUD A;  3O9P A;  4RNS A;  3PUZ E;  4Z0I A;  4P1L A;  4ZZE A;  4I9D A;  5M2V A;  3U1O A;  3H6U A;  3K00 A;  4WEP A;  5I58 A;  3IR1 A;  4N6D A;  1GVC A;  2Q74 A;  4Z7E A;  3K4U A;  4QF9 A;  3QMF A;  4IR8 A;  4XKP A;  2O84 X;  4ZEF A;  5EQA A;  4XKQ A;  2VOZ A;  1JEU A;  4HE1 A;  4LP2 B;  3VFJ A;  4GWW A;  1USY E;  2PBW A;  4MLV A;  1N7W A;  2V3Q A;  4GF8 A;  1MQI A;  4H5F A;  2DWJ A;  2XXK A;  1MQJ A;  4F2Q A;  4PGN A;  4GD5 A;  1QUJ A;  3DLN A;  2ZYO A;  2I6E A;  2DOJ A;  4NTL A;  1LBX A;  4OES A;  1IXC A;  4ZZA A;  3KG2 A;  3O29 A;  5DEX B;  3E3K A;  1LAH E;  4RPN A;  2REJ A;  5AA4 B;  1MY1 A;  4KHZ E;  4OFO A;  4NF4 B;  3T0J A;  3TQW A;  5A5X A;  5TP9 A;  5IM2 A;  4NN3 A;  2XX7 A;  4OVQ A;  1MDQ A;  4XXU A;  1GR2 A;  2A5T B;  4POX A;  4R72 A;  1Y9U A;  5KDT B;  2XXQ A;  1ZLQ A;  4WKM A;  4G68 C;  3T1B A;  3TCF A;  1UTB B;  1LBV A;  2XXU A;  5I2K A;  4NF0 A;  3PMV A;  4MHF A;  3BBR A;  2M8C A;  5CMB A;  2Q8M A;  3MW0 A;  2R9J A;  1NL5 A;  4U23 A;  1JW1 A;  4IO3 A;  3JYR A;  2WBD A;  2NVU B;  1POY 1;  2H4I A;  2WBB A;  5ICT A;  3E79 A;  5FTI A;  2RC8 A;  2PT1 A;  3MP8 A;  4QFP A;  3FJM A;  4IB2 A;  3QK6 A;  1SI0 A;  4PFB A;  5I56 A;  2BJJ X;  4YB7 A;  4EDP A;  4F39 A;  3HO7 A;  4NX1 A;  3A3C A;  3A09 A;  3LSW A;  4GOT A;  3I5O A;  5DW8 A;  4ZE8 A;  1POT A;  2B4M A;  3IB1 A;  1II5 A;  3UIF A;  3TTK A;  4KR5 A;  4MIJ A;  4HCW A;  1XI6 A;  2XXR A;  4F19 A;  3EKI A;  3S9M C;  3MUQ A;  1QW0 A;  5DYH A;  5LOM A;  1D9Q A;  4H46 A;  4ZEK A;  1K9Y A;  2V3U A;  1JEV A;  3B6T A;  1DCU A;  3FZV A;  5IAI A;  5L9M A;  3H06 B;  3LSX A;  1QUK A;  4N13 A;  3FVN A;  2ZNT A;  5JEI A;  1A99 A;  2FYI A;  1QUL A;  5HM4 B;  5IZ3 A;  4O7M A;  1RDX A;  1ZJL A;  2NWJ A;  4JWX A;  2V4C A;  3C9H A;  4KYS A;  3SZP A;  3IB0 A;  4LZ8 A;  3EHS A;  3W9W A;  4FAT A;  4X04 A;  5DVF A;  4YB6 A;  3O28 A;  1Y4C A;  2PVU A;  3VVF A;  4OHN A;  4UAC A;  2RCA A;  3E78 A;  3H3G A;  1IZ1 A;  5AA1 A;  5H8S A;  2I0B A;  1NNT A;  4Q0C A;  5IZ1 A;  2OZZ A;  2HHM A;  2XWV A;  2Y7W A;  2IA4 A;  5H8F B;  3LUY A;  4E0W A;  1H3D A;  4JVC A;  3S2V A;  5JTY A;  2ZNU A;  1MY2 A;  1TFA A;  3QXM A;  3FAT A;  5I7I A;  4BLA A;  2Y84 A;  2O7I A;  2F8D A;  3KN3 A;  2RC9 A;  2P0S A;  2WX9 A;  4RK9 A;  1OMP A;  4PFR A;  4NGU A;  2VD2 A;  4LQ5 A;  2FVZ A;  3RPL B;  3TTR A;  4QBA A;  1MS7 A;  1MM7 A;  4P47 A;  5EHS A;  3O6G A;  4G68 A;  1G0I A;  4YKJ A;  4ELQ A;  1VR5 A;  2UXA A;  1NV0 A;  2XWO A;  4NF6 A;  4F22 A;  2QSX A;  4PFU A;  3OEM A;  4BDO A;  4TOZ A;  3K0V A;  2QL3 A;  1B5H A;  3RNN A;  2HXW A;  4N4U A;  2DE3 A;  2XWI A;  2QVR A;  4ND9 A;  1ELJ A;  3T93 B;  4GXA A;  4GWZ A;  3KJ7 A;  4JXI A;  4H5G A;  4C1T A;  4TQU Q;  1XS5 A;  1UQW A;  3MVY A;  3Q25 A;  3UN6 A;  1VFE A;  3TEP A;  3AXF A;  3K02 A;  5TP9 B;  4DZ1 A;  1IMA A;  3T9H B;  2BJI A;  1P99 A;  3FUZ A;  5I5P A;  4PBH A;  4BDQ A;  3O6H A;  4XEQ A;  3HV1 A;  3MZB A;  3UK4 A;  3M3L A;  1CB6 A;  1FCK A;  5KCJ A;  4KCC A;  1NUY A;  1I6B A;  1FBP A;  1OQH A;  2F97 A;  1S9T A;  4JBZ A;  4U1Z A;  3EF7 A;  4H67 A;  1ZBM A;  2Q2A A;  3PPQ A;  1PBQ A;  4NQ8 A;  1ZMG A;  4G8M A;  5EQ8 A;  3N94 A;  2DXR A;  4H6D A;  4I8C A;  3U72 A;  4KPT A;  4EQ7 A;  1B4H A;  5I56 B;  2V3T A;  2QMX A;  4R9F A;  4ELO A;  4ISU A;  5AA3 A;  3QSL A;  3W9V A;  3CFX A;  4NED A;  5EYG A;  2UYE A;  4U22 A;  2F3D A;  1LFG A;  2Z8E A;  3GBB A;  3FV1 A;  3K1M A;  4N07 A;  5I2N B;  4FIM A;  4MNC A;  4YMB A;  1FTO A;  3Q28 A;  2R6G E;  5FHM A;  5ET8 A;  1N3W A;  3M3F A;  2DWH A;  3TTM A;  1IMD A;  3IJO B;  5AA2 D;  4DCX A;  3OEN A;  3KSJ A;  1RDZ A;  1USY H;  4F3G A;  3O66 A;  3S9E A;  2I4C A;  3HHF A;  3T96 B;  2Z22 A;  1NV2 A;  2HEU A;  3T66 A;  1KA0 A;  1NV6 A;  4NAP A;  1BP5 A;  2A5S A;  2ANJ A;  4LON B;  3R7X A;  3TZA A;  3KSX A;  2ONK E;  3FAS A;  2PCR A;  4ONY A;  1IQ7 A;  3LUZ A;  1A40 A;  1PB9 A;  4PFI A;  2H99 A;  4LUB A;  5ISU A;  2ZZX A;  1FQB A;  3QYT A;  3RTW B;  1SW4 A;  1B0L A;  5L9O A;  4F2O A;  1GTK A;  4PP0 A;  2QPQ A;  1SQY A;  4YKP A;  1JVY A;  1NH8 A;  1NUZ A;  3O2A A;  1ZTY A;  2H98 A;  1ZIU A;  3IOU A;  1EYJ A;  3A29 A;  2ZYN A;  4KQP A;  2Q2C A;  4N15 A;  3TQL A;  1URG A;  4EF1 A;  2D21 A;  2V84 A;  4KCD A;  5I59 B;  4GL8 A;  2PX1 A;  1IXI A;  4NWC A;  3SDF A;  1FBH A;  2F6P A;  4G68 B;  1JVX A;  2JJK A;  4QSD A;  3SEW A;  3V89 B;  4IO4 A;  4OMB A;  4QFL A;  1MY4 A;  1FTJ A;  2D3I A;  3WAE A;  3U92 A;  4MJO A;  1A8F A;  5AA2 A;  1P1O A;  5F24 A;  4OVS A;  4OXV A;  3MP1 A;  3OSR A;  3VVE A;  4DIG A;  3MPL A;  3SEU A;  2GFE A;  2YPN A;  3DP4 A;  2I3V A;  1YCJ A;  2VPO A;  4KYD A;  3SET A;  1FPE A;  2ZYK A;  3L6G A;  3V5A A;  1IIW A;  4YMA A;  2XHD A;  4FJP A;  1MXZ A;  4HE2 A;  3OEL A;  1R1N A;  1KZ8 A;  1NKX A;  3CSB A;  2X26 A;  2DXY A;  2XD3 A;  3G3J A;  3LR1 A;  3CR9 A;  1A7L A;  2ESN A;  3UOR A;  3LV0 A;  4UA8 A;  4DCY A;  3UGW A;  1Q9D A;  1AIV A;  4PFW A;  2QJE A;  4PTK A;  1FBF A;  1MXY A;  4QFO A;  4O94 A;  4N6K A;  3RGY A;  3T22 A;  1LAX A;  1JP4 A;  3TCH A;  3OOA A;  3NOH A;  4LQ2 A;  1MDP 1;  2WEF A;  4FOR A;  4KD5 A;  4ZED A;  1AH5 A;  4R74 A;  3KN8 A;  1DK4 A;  3PUW E;  2Q89 A;  2CEX A;  3QIM A;  1SW5 A;  1Y3N A;  5BUU A;  3K6V A;  5B7D A;  1LFI A;  4GWS A;  1Y1M A;  2HFB A;  1D4N A;  1IXH A;  1Z7M E;  3IL1 B;  1NV1 A;  4C1U A;  4X9T A;  2HCA A;  3FV2 A;  3LBS A;  4PQJ A;  2I58 A;  4PCD A;  2CZH A;  3KZG A;  3ZSF A;  3KN7 A;  3Q27 A;  2ZYM A;  3RLF E;  5JK4 A;  4R6K A;  2O1L A;  3IO4 A;  3D4C A;  2ALU A;  2XD2 A;  4QXD A;  3MPK A;  4K3F A;  4YKK A;  5CM6 A;  1MXX A;  4YZZ A;  1FPG A;  4G61 A;  5L8D A;  2XXT A;  4HXV A;  3MC2 A;  2W7Y A;  3SEX A;  1M5C A;  5IKB A;  2F3B A;  3KJT A;  1BK4 A;  4X1D A;  4OET A;  1B7U A;  2DSF A;  1G0H A;  5ET7 A;  2XXX A;  4L17 A;  3CVG A;  4R6Y A;  5H8Q B;  4OWD A;  4AS5 A;  4MAG A;  1NNP A;  4NHB A;  3TOD A;  4YIC A;  4IGR A;  3R6U A;  1UTH A;  1SVX B;  2DP8 A;  2XA5 A;  2OCU A;  2PFZ A;  4F18 A;  4BDL A;  3OO9 A;  1MPD A;  3GXA A;  3TTL A;  4GWY A;  1FQC A;  4IO7 A;  4ZEB A;  1MM6 A;  5TPA B;  4EQ9 A;  1CNQ A;  3MZ1 A;  5DVJ A;  3UP9 A;  1FJ6 A;  1N76 A;  5EYF A;  1YAE A;  3FJ7 A;  4N81 A;  3HST A;  4IY5 A;  3PMX A;  4FAJ A;  3FXU A;  2XXP A;  1H44 A;  5ET6 A;  1MY3 A;  5HPQ A;  4PFT A;  5B70 A;  3MBP A;  3EPE A;  1RYO A;  1DOT A;  2F78 A;  2B4L A;  1B7Z A;  2I4B A;  5H8N B;  1I69 A;  2UYF A;  4H45 A;  1DPE A;  1XOC A;  4LZ7 A;  2XXI A;  2FHY A;  3MAM A;  3OEK A;  2V25 A;  3G7W A;  4NF8 A;  4P9K A;  3V83 A;  2RC7 A;  4LVQ A;  4OVT A;  4OTE A;  2X7Q A;  3M3K A;  3MYU A;  4P56 A;  1ZU0 A;  5IZZ A;  1P1N A;  1ZKB A;  3SES A;  3FGS A;  1B4Z A;  1EH3 A;  4N8Y A;  4N6P A;  1MPC A;  3SER A;  5J1D A;  3PV0 E;  1B3G A;  4EF2 A;  2F36 A;  4OVJ A;  3PTY A;  1H76 A;  1N3X A;  4PGP A;  3VLV A;  1RYX A;  1MH3 A;  4X1B A;  4G8H A;  2PYY A;  4DXB A;  4ELR A;  1ANF A;  1LAF E;  1B32 A;  3EN3 A;  1MH4 A;  1IMC A;  3OO8 A;  3HFU A;  5CBS A;  4P0I A;  3N6T A;  1FBC A;  3TFL A;  1NV5 A;  2CZK A;  3TDJ A;  3TPA A;  4ZS9 A;  1HSL A;  4AB6 A;  1URD A;  4UAB A;  2I3W A;  1S7Y A;  3MP6 A;  3I3V A;  2F7B A;  5ET5 A;  5I58 B;  1LCF A;  2REG A;  2XWK A;  3S9L C;  1TFD A;  4MF3 A;  1B5I A;  5A5L A;  2UVJ A;  3BKI B;  1QJM A;  4EUO A;  2KLF A;  4LZ5 A;  4HW8 A;  1DSN A;  2HXR A;  2XXV A;  3H6T A;  2FIX A;  4PE3 A;  4IO2 A;  3IO6 A;  4PET A;  5EHM A;  4U1O A;  4GX6 A;  4THI A;  1BIY A;  1PB8 A;  2FBP A;  1B1H A;  2UVH A;  4TLM B;  1R9L A;  3KGC A;  2QS1 A;  1B3F A;  3VXB A;  2GQ1 A;  3U65 A;  5ESY A;  1NNF A;  1OIB A;  5ITP A;  4DXC A;  5A5X B;  3D1R A;  3KOS A;  4GFR A;  4F1V A;  2ZZV A;  2HZK A;  3HPI A;  3ZKK A;  1M5D A;  4NG7 A;  2OLB A;  5ELV A;  4O3C A;  2LAO A;  4JWO A;  3N6U A;  4F3P A;  4X48 A;  1OLC A;  5I2K B;  4OEN A;  4I62 A;  5HBC A;  3IAZ A;  1B2H A;  5H8H A;  2G93 A;  5CMM A;  4RA1 A;  4GXS B;  3CSG A;  4DI4 B;  3VLU A;  4XF5 A;  2ONR A;  2QRY A;  3CG1 A;  4P8B A;  4XKR A;  2B65 A;  4YB5 A;  1JET A;  3ONM A;  4JVI A;  4QFN A;  3QUJ A;  2P2A A;  3VE1 B;  1TT1 A;  3C34 A;  1SYH A;  4PDH A;  1Z7N E;  1HSE A;  3CFZ A;  1J1N A;  3QAX A;  3KC0 A;  3IJX B;  1NV7 A;  3K6U A;  4LAT A;  1B52 A;  4JB7 A;  3Q29 A;  4XTC Q;  3P7I A;  3T9V A;  4EXK A;  2NOO A;  2IEE A;  1CE2 A;  4JSD A;  1M5B A;  4I3E A;  3CI8 A;  1FPI A;  1B40 A;  1Y20 A;  3VV5 A;  3OSQ A;  3E13 X;  1FPB A;  1N04 A;  2OBG A;  3I6V A;  1D9V A;  4H8I A;  3ECR A;  2F35 A;  5BWJ A;  2FA7 A; 
#chains in the Genus database with same CATH homology
 3FXQ A;  1PC3 A;  4U4X A;  3K6W A;  4YU0 A;  5AA4 A;  3PD8 A;  1F9B A;  3D4G A;  4ZDM A;  3E9X A;  4QSE A;  3A3U A;  4OFJ A;  5FHO A;  3PD9 A;  3TCG A;  1N0T A;  5KDT A;  1DTZ A;  4OEV A;  2RCB A;  2Q8J A;  4KYE A;  5CRY A;  3G3F A;  3RN8 A;  5CBR A;  2HAU A;  3O6I A;  1LB8 A;  2P1S A;  1MPB A;  3TKD A;  2THI A;  3IX1 A;  1B6H A;  3K01 A;  2DE2 A;  3RPW A;  3FIR A;  4H1X A;  5JTY B;  1NFT A;  2HZL A;  2F7A A;  3RY3 A;  2I0C A;  1OQG A;  4G4P A;  2OK2 A;  3GZG A;  4FEC A;  2AYS A;  2V93 A;  1TXF A;  2VGQ A;  2OJT A;  3EHT A;  3OMB A;  3PU5 A;  1OVT A;  1B58 A;  3H6V A;  3THI A;  4POW A;  3K6X A;  1KWH A;  1SW2 A;  1DMB A;  4ZEC A;  1O64 A;  2XX9 A;  4JWY A;  1D3K A;  4DE8 A;  2O68 A;  4NF6 B;  4I1D A;  3C31 A;  4ESX A;  1JQF A;  4G2Z A;  2DWI A;  2H25 A;  5FHN A;  3QUF A;  1B3L A;  2F5X A;  3GLB A;  1AL3 A;  3CFL A;  2GRV A;  1M5E A;  3W15 C;  3MZ9 A;  1SBP A;  1LAG E;  1PBP A;  4MLQ A;  4RPO A;  1IEJ A;  4H65 A;  5F7V A;  1JNF A;  3MVZ A;  1O63 A;  1A55 A;  3MQ9 A;  2XXY A;  3ILU B;  1Q35 A;  3USD A;  4RXL A;  2DS9 A;  3R26 A;  2RIN A;  2ZNS A;  4XIG Q;  1MY0 A;  2I48 A;  3T9X B;  2QS2 A;  5KCJ B;  1LBB A;  1GGG A;  3KFM A;  1I6A A;  1FW0 A;  3T9U A;  1NMU A;  1RKM A;  3O97 A;  4O3B A;  3G3I A;  2NXO A;  3PGF A;  3FD3 A;  3K2D A;  1P1Q A;  3L6H A;  2F34 A;  1QKB A;  3C35 A;  3DP6 A;  1NNK A;  1ATG A;  1NH7 A;  4F1U A;  2XXH A;  1B05 A;  3VDF A;  2X7P A;  2CZL A;  4KI0 E;  4RK2 A;  4GRK A;  3IK6 B;  2F7C A;  1B3H A;  2PT2 A;  4GVO A;  3VLW A;  1URS A;  5I57 A;  2O6A A;  1I6Q A;  3FVO A;  1EU8 A;  3MJN A;  3SEV A;  3RUM A;  4G77 A;  4O3A A;  1N84 A;  4IGT A;  4QFK A;  3DM0 A;  3G3H A;  1MG1 A;  2O7U A;  3FJG A;  2DE4 A;  2Y7R A;  4XKN A;  1P1W A;  3BFT A;  3KOT A;  1D9Y A;  3OXN A;  2F6G A;  2Z8D A;  4MBP A;  4NE4 A;  4GQO A;  1AMF A;  1LLS A;  1P1U A;  4WXJ A;  1FTL A;  5FTH A;  4F1Y A;  1R6Z A;  1XVY A;  5DTB A;  2VP1 A;  4GIZ A;  4JDF A;  4GL0 A;  3MVW A;  1B5J A;  4DLD A;  3S9N C;  2Y7I A;  5CI5 A;  1OVB A;  1SW1 A;  4YKI A;  3G3G A;  4F3S A;  3U8Q A;  4GLI A;  2DVZ A;  1VSO A;  4Q30 B;  1LST A;  4U4S A;  2H9B A;  1Y1Z A;  4F31 B;  1QKA A;  4KFQ A;  3G3K A;  4OER A;  4F29 A;  3N5L A;  1US4 A;  3PPN A;  5K2Y A;  5I2N A;  1MQG A;  4NMY A;  4F3B A;  3VVD A;  4C0R A;  1VFD A;  5AA2 B;  2QS4 A;  3RQT A;  3B6W A;  3LSF B;  2G29 A;  4DXU A;  1WVJ A;  1FTK A;  3H6W A;  3LSL A;  1SDX A;  3K1N A;  3HCQ A;  2H5Y A;  3GBA A;  3SKP A;  5ICQ A;  3C33 A;  1EZ9 A;  4U2R A;  1MQH A;  3F11 A;  1SI1 A;  4ZE9 A;  3PPR A;  4H0W A;  3OO6 A;  3TMG A;  3FVK A;  3C4M A;  3H4Z A;  2NUV A;  1WDN A;  2GH9 A;  1BKA A;  1MQD A;  5CMK A;  3B6Q A;  3BFU A;  3EQ1 A;  1S50 A;  2QS3 A;  4G8N A;  3CIJ A;  1Y3P A;  4H8J A;  4QHQ A;  4IO6 A;  3OD7 A;  4HS7 A;  4OFL A;  5AE4 A;  3JV9 A;  1H43 A;  2O69 A;  1EZP A;  3ILT B;  3IOV A;  1N7X A;  1FTM A;  3B7D A;  1XT8 A;  2E1S A;  4IO5 A;  5F1Q A;  1B46 A;  4PFY A;  1IXG A;  4NF5 A;  4LA9 A;  3TYH A;  1MRP A;  5I59 A;  2ZXT A;  1PEB A;  1Y3Q A;  4ESW A;  1EZO A;  1FQA A;  4PE5 B;  2Y7P A;  1B0H A;  1LCT A;  3DP8 A;  5KZT A;  1O7T A;  4M4G A;  1HSJ A;  2ABH A;  1UIV A;  3H03 A;  5I57 B;  3U94 A;  1QVS A;  2AL5 A;  1B1X A;  2DYX A;  4HCY A;  1LB9 A;  2HQ0 A;  2XX8 A;  1OLA A;  2QMW A;  5K2X A;  4IY6 A;  3IB2 A;  3JZJ A;  1VE4 A;  1T0K A;  4OQO A;  4AQ4 A;  4NWD A;  4EXL A;  1L5T A;  4HTG A;  2DWA A;  4Q5T A;  3TAJ A;  4BDM A;  1YTV A;  3ODB A;  3C36 A;  3ZKL A;  4Q8R A;  4OEU A;  1LGB C;  1UTH B;  3WAF A;  2Z8F A;  1B3E A;  2GHB A;  4MH5 A;  3HHG A;  2ONS A;  1XC1 A;  1FQE A;  3K1P A;  4BDR A;  4R9G A;  5I84 A;  1B51 A;  3IOW A;  4P11 A;  1MXV A;  3IOT A;  2B3F A;  1R9Q A;  4R2B A;  4R75 A;  2AL4 A;  1M5F A;  3PUV E;  3TUS A;  1BLF A;  1FQF A;  1JW5 A;  1US5 A;  1Q1K A;  4R73 A;  4R6H A;  2Q88 A;  4U21 A;  2VHA A;  2OWS A;  2FNC A;  4BDN A;  1Y4T A;  4E0X A;  2CMO A;  5DEX A;  4NF8 B;  2HAV A;  4TLL B;  4ZEI A;  3LC8 A;  4GWO A;  4NF4 A;  3EHU A;  2I49 A;  3VXC A;  3CG3 A;  3Q26 A;  2A5T A;  3FVG A;  3N26 A;  4MFI A;  1SYI A;  5TU0 A;  4WED A;  3M8U A;  1MXW A;  3PUX E;  1H45 A;  4FE8 A;  3TTN A;  2YJP A;  2R71 A;  3E4R A;  2OWT A;  1UTB A;  2B3B A;  2E0S A;  1LBC A;  3PMW A;  2Z23 A;  3TEL A;  4OZ9 A;  2VD3 A;  3PPP A;  5H8Q A;  3PUY E;  3S4U A;  5CC2 A;  1WOD A;  4EQB A;  4FEB A;  4QSC A;  3ZS6 A;  1XVX A;  1DTG A;  5ITO A;  3H7M A;  1GV8 A;  1B9J A;  4AB5 A;  2XXW A;  1LFH A;  5L9S A;  3FXR A;  3OO7 A;  1PB7 A;  3MWB A;  1DPP A;  5TPA A;  3SEY A;  4RY1 A;  3RT8 A;  2RKM A;  4YAH X;  4RJZ A;  4ELP A;  5CMC A;  3V8X B;  4NF5 B;  1AOV A;  1A54 A;  2D5W A;  3KBR A;  2Q9T A;  3PPO A;  1PDA A;  5H8N A;  1JW4 A;  3CRB A;  1YPN A;  4QRZ A;  3RT6 B;  1QUI A;  1IIT A;  5DT6 A;  3IOR A;  3UA8 A;  3U93 A;  3KEI A;  2DVC A;  4ECF A;  2PMS A;  3RTF B;  1BTJ A;  2AIX A;  4OYV A;  2YLN A;  3C32 A;  2UVI A;  1UIU A;  2O1M A;  3DEL B;  1A8E A;  1SD3 A;  2O51 A;  3HN0 A;  3MVX A;  4M1V A;  1FQD A;  5DVI A;  1XHY A;  2UVG A;  4P0G A;  1MXU A;  4RYA A;  5H8H B;  2RF1 A;  4JSO A;  5H8F A;  2ZMB A;  4R2F A;  1TWY A;  1B7H A;  2Y7K A;  2WKY A;  2GHA A;  2DQV A;  4DDD A;  4FED A;  1IUD A;  3O9P A;  4RNS A;  3PUZ E;  4Z0I A;  4ZZE A;  4I9D A;  5M2V A;  3U1O A;  3H6U A;  3K00 A;  4WEP A;  5I58 A;  3IR1 A;  1GVC A;  4Z7E A;  3K4U A;  4QF9 A;  4XKP A;  2O84 X;  4ZEF A;  4XKQ A;  2VOZ A;  1JEU A;  4LP2 B;  3VFJ A;  1USY E;  2PBW A;  4MLV A;  1N7W A;  2V3Q A;  4GF8 A;  1MQI A;  4H5F A;  2DWJ A;  1MQJ A;  4F2Q A;  4GD5 A;  1QUJ A;  3DLN A;  2ZYO A;  2I6E A;  2DOJ A;  4NTL A;  4OES A;  1IXC A;  4ZZA A;  3KG2 A;  3O29 A;  5DEX B;  3E3K A;  1LAH E;  4RPN A;  2REJ A;  5AA4 B;  1MY1 A;  4KHZ E;  4OFO A;  4NF4 B;  3TQW A;  5A5X A;  5TP9 A;  2XX7 A;  1MDQ A;  4XXU A;  1GR2 A;  2A5T B;  4POX A;  4R72 A;  1Y9U A;  5KDT B;  2XXQ A;  1ZLQ A;  4WKM A;  4G68 C;  3TCF A;  1UTB B;  2XXU A;  5I2K A;  3PMV A;  3BBR A;  2M8C A;  5CMB A;  3MW0 A;  2R9J A;  1NL5 A;  4U23 A;  1JW1 A;  4IO3 A;  3JYR A;  2NVU B;  1POY 1;  2H4I A;  5ICT A;  5FTI A;  2RC8 A;  2PT1 A;  3MP8 A;  4QFP A;  3FJM A;  4IB2 A;  3QK6 A;  1SI0 A;  5I56 A;  2BJJ X;  4YB7 A;  4EDP A;  4F39 A;  3HO7 A;  3A3C A;  3A09 A;  3LSW A;  4GOT A;  3I5O A;  4ZE8 A;  1POT A;  3IB1 A;  1II5 A;  3UIF A;  3TTK A;  4KR5 A;  4HCW A;  2XXR A;  4F19 A;  3S9M C;  3MUQ A;  1QW0 A;  5DYH A;  5LOM A;  4ZEK A;  2V3U A;  1JEV A;  3B6T A;  5IAI A;  3FZV A;  5L9M A;  3H06 B;  3LSX A;  1QUK A;  4N13 A;  3FVN A;  2ZNT A;  5JEI A;  1A99 A;  2FYI A;  1QUL A;  5HM4 B;  1ZJL A;  2NWJ A;  4JWX A;  4KYS A;  3C9H A;  3IB0 A;  4LZ8 A;  3EHS A;  3W9W A;  4FAT A;  5DVF A;  4YB6 A;  3O28 A;  1Y4C A;  2PVU A;  3VVF A;  4OHN A;  4UAC A;  2RCA A;  3H3G A;  1IZ1 A;  5AA1 A;  5H8S A;  2I0B A;  1NNT A;  4Q0C A;  2OZZ A;  2Y7W A;  2IA4 A;  5H8F B;  3LUY A;  4E0W A;  1H3D A;  3S2V A;  5JTY A;  2ZNU A;  1MY2 A;  1TFA A;  3QXM A;  3FAT A;  4BLA A;  2Y84 A;  2O7I A;  2F8D A;  3KN3 A;  2RC9 A;  2P0S A;  4RK9 A;  1OMP A;  2VD2 A;  4LQ5 A;  3TTR A;  1MS7 A;  1MM7 A;  5EHS A;  3O6G A;  4G68 A;  4YKJ A;  4ELQ A;  1VR5 A;  2UXA A;  4NF6 A;  4F22 A;  2QSX A;  4PFU A;  3OEM A;  4BDO A;  4TOZ A;  3K0V A;  2QL3 A;  1B5H A;  3RNN A;  2HXW A;  2DE3 A;  4ND9 A;  1ELJ A;  3T93 B;  4GXA A;  3KJ7 A;  4JXI A;  4H5G A;  4C1T A;  4TQU Q;  1XS5 A;  1UQW A;  3MVY A;  3Q25 A;  3UN6 A;  1VFE A;  3TEP A;  3AXF A;  3K02 A;  5TP9 B;  4DZ1 A;  3T9H B;  1P99 A;  3FUZ A;  4BDQ A;  3O6H A;  3HV1 A;  3MZB A;  3UK4 A;  3M3L A;  1CB6 A;  1FCK A;  5KCJ A;  4KCC A;  1I6B A;  1OQH A;  2F97 A;  1S9T A;  4JBZ A;  4U1Z A;  3EF7 A;  4H67 A;  1ZBM A;  2Q2A A;  3PPQ A;  1PBQ A;  1ZMG A;  4G8M A;  3N94 A;  2DXR A;  4H6D A;  4I8C A;  3U72 A;  4KPT A;  4EQ7 A;  1B4H A;  5I56 B;  2V3T A;  2QMX A;  4R9F A;  4ELO A;  4ISU A;  5AA3 A;  3QSL A;  3W9V A;  3CFX A;  4NED A;  2UYE A;  4U22 A;  1LFG A;  2Z8E A;  3GBB A;  3FV1 A;  3K1M A;  4N07 A;  5I2N B;  4FIM A;  4YMB A;  1FTO A;  3Q28 A;  2R6G E;  5FHM A;  1N3W A;  3M3F A;  2DWH A;  3TTM A;  3IJO B;  5AA2 D;  4DCX A;  3OEN A;  3KSJ A;  1USY H;  4F3G A;  3O66 A;  3S9E A;  2I4C A;  3HHF A;  3T96 B;  2Z22 A;  3T66 A;  2HEU A;  1BP5 A;  2A5S A;  2ANJ A;  4LON B;  3R7X A;  3TZA A;  3KSX A;  2ONK E;  3FAS A;  4ONY A;  1IQ7 A;  1A40 A;  1PB9 A;  2H99 A;  4LUB A;  5ISU A;  1FQB A;  3QYT A;  3RTW B;  1SW4 A;  1B0L A;  5L9O A;  4F2O A;  1GTK A;  4PP0 A;  2QPQ A;  1SQY A;  4YKP A;  1JVY A;  1NH8 A;  3O2A A;  1ZTY A;  2H98 A;  1ZIU A;  3IOU A;  2ZYN A;  4KQP A;  2Q2C A;  3TQL A;  1URG A;  4EF1 A;  2D21 A;  2V84 A;  4KCD A;  5I59 B;  4GL8 A;  2PX1 A;  1IXI A;  4NWC A;  3SDF A;  2F6P A;  4G68 B;  1JVX A;  4QSD A;  3SEW A;  3V89 B;  4IO4 A;  4OMB A;  4QFL A;  1MY4 A;  1FTJ A;  2D3I A;  3WAE A;  3U92 A;  1A8F A;  5AA2 A;  1P1O A;  4OXV A;  3MP1 A;  3OSR A;  3VVE A;  4DIG A;  3MPL A;  3SEU A;  2GFE A;  2YPN A;  3DP4 A;  2I3V A;  1YCJ A;  4KYD A;  3SET A;  2ZYK A;  3L6G A;  3V5A A;  1IIW A;  4YMA A;  2XHD A;  4FJP A;  1MXZ A;  3OEL A;  1R1N A;  1NKX A;  3CSB A;  2X26 A;  2DXY A;  2XD3 A;  3G3J A;  3LR1 A;  3CR9 A;  1A7L A;  2ESN A;  3UOR A;  4UA8 A;  4DCY A;  3UGW A;  1AIV A;  4PFW A;  2QJE A;  1MXY A;  4QFO A;  3RGY A;  3T22 A;  1LAX A;  3TCH A;  3OOA A;  4LQ2 A;  1MDP 1;  4FOR A;  4KD5 A;  4ZED A;  1AH5 A;  4R74 A;  3KN8 A;  3PUW E;  2Q89 A;  3QIM A;  1SW5 A;  1Y3N A;  5BUU A;  3K6V A;  5B7D A;  1LFI A;  1Y1M A;  2HFB A;  1D4N A;  1IXH A;  1Z7M E;  3IL1 B;  4C1U A;  4X9T A;  2HCA A;  3FV2 A;  3LBS A;  4PQJ A;  2I58 A;  3KZG A;  3ZSF A;  3KN7 A;  3Q27 A;  2ZYM A;  3RLF E;  5JK4 A;  4R6K A;  2O1L A;  3IO4 A;  3D4C A;  2ALU A;  2XD2 A;  3MPK A;  4K3F A;  4YKK A;  5CM6 A;  1MXX A;  4YZZ A;  5L8D A;  2XXT A;  3MC2 A;  2W7Y A;  3SEX A;  1M5C A;  5IKB A;  3KJT A;  4X1D A;  4OET A;  1B7U A;  2DSF A;  2XXX A;  4L17 A;  3CVG A;  4R6Y A;  5H8Q B;  4OWD A;  1NNP A;  3TOD A;  4YIC A;  4IGR A;  3R6U A;  1UTH A;  1SVX B;  2DP8 A;  2OCU A;  4F18 A;  4BDL A;  3OO9 A;  1MPD A;  3GXA A;  3TTL A;  1FQC A;  4IO7 A;  4ZEB A;  1MM6 A;  5TPA B;  4EQ9 A;  3MZ1 A;  5DVJ A;  3UP9 A;  1N76 A;  5EYF A;  1YAE A;  3FJ7 A;  3HST A;  4IY5 A;  3PMX A;  4FAJ A;  3FXU A;  2XXP A;  1H44 A;  1MY3 A;  5HPQ A;  4PFT A;  5B70 A;  3MBP A;  3EPE A;  1RYO A;  1DOT A;  2F78 A;  1B7Z A;  2I4B A;  5H8N B;  1I69 A;  2UYF A;  1DPE A;  1XOC A;  4LZ7 A;  2XXI A;  3MAM A;  3OEK A;  2V25 A;  3G7W A;  4NF8 A;  3V83 A;  2RC7 A;  4LVQ A;  4OTE A;  2X7Q A;  3M3K A;  1ZU0 A;  1P1N A;  1ZKB A;  3SES A;  3FGS A;  1B4Z A;  1EH3 A;  4N6P A;  1MPC A;  3SER A;  5J1D A;  3PV0 E;  1B3G A;  4EF2 A;  2F36 A;  4OVJ A;  1H76 A;  1N3X A;  3VLV A;  1RYX A;  1MH3 A;  4X1B A;  4G8H A;  2PYY A;  4DXB A;  4ELR A;  1ANF A;  1LAF E;  1B32 A;  3EN3 A;  1MH4 A;  3OO8 A;  5CBS A;  4P0I A;  3N6T A;  3TFL A;  3TDJ A;  3TPA A;  4ZS9 A;  1HSL A;  4AB6 A;  1URD A;  2I3W A;  1S7Y A;  3MP6 A;  3I3V A;  2F7B A;  5I58 B;  1LCF A;  2REG A;  3S9L C;  1TFD A;  4MF3 A;  1B5I A;  2UVJ A;  3BKI B;  1QJM A;  4EUO A;  2KLF A;  4LZ5 A;  4HW8 A;  1DSN A;  2XXV A;  3H6T A;  4IO2 A;  3IO6 A;  4PET A;  5EHM A;  4U1O A;  4THI A;  1BIY A;  1PB8 A;  1B1H A;  2UVH A;  4TLM B;  1R9L A;  3KGC A;  2QS1 A;  1B3F A;  3VXB A;  1NNF A;  1OIB A;  5ITP A;  4DXC A;  5A5X B;  3KOS A;  4GFR A;  4F1V A;  2HZK A;  3HPI A;  3ZKK A;  1M5D A;  2OLB A;  5ELV A;  4O3C A;  2LAO A;  4JWO A;  3N6U A;  4F3P A;  4X48 A;  1OLC A;  5I2K B;  4OEN A;  4I62 A;  5HBC A;  3IAZ A;  1B2H A;  5H8H A;  2G93 A;  5CMM A;  4RA1 A;  4GXS B;  3CSG A;  3VLU A;  2ONR A;  2QRY A;  3CG1 A;  4XKR A;  2B65 A;  4YB5 A;  1JET A;  3ONM A;  4QFN A;  3QUJ A;  2P2A A;  3VE1 B;  1TT1 A;  3C34 A;  1SYH A;  1Z7N E;  1HSE A;  3CFZ A;  1J1N A;  3QAX A;  3IJX B;  3K6U A;  4LAT A;  1B52 A;  4JB7 A;  3Q29 A;  4EXK A;  3P7I A;  4XTC Q;  3T9V A;  2NOO A;  2IEE A;  1CE2 A;  4JSD A;  1M5B A;  3CI8 A;  1B40 A;  1Y20 A;  3VV5 A;  3OSQ A;  3E13 X;  1N04 A;  2OBG A;  3I6V A;  1D9V A;  4H8I A;  3ECR A;  2F35 A;  5BWJ A;  2FA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...