1D4XG

Crystal structure of caenorhabditis elegans mg-atp actin complexed with human gelsolin segment 1 at 1.75 a resolution.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of nonvertebrate actin: implications for the ATP hydrolytic mechanism.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Contractile protein
molecule keywords C. ELEGANS ACTIN 1/3
total genus 41
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1d4xG00
5FAFA 1J72A 3EGXB 1PD0A 3A5OS 3FG7A 1SVYA 3A5LS 4BEX1 5FAEA 4JD2H 2KVKA 3CJCG 1WFSA 1KCQA 1D4XG 1TVJA 1P8ZG 1ESVS 2FH3A 3A5NS 5DD2A 1MDUA 3EFOB 1NLVG 3CJBG 5KYYB 1NPHA 3EG9A 5KYWB 2XFAA 1X67A 4KEFA 5A1MA 1JHWA 3TU5B 4PKIG 3DAWB 1CFYA 5L6WC 1WNJA 1YAGG 4CBWG 1AK7A 2FF3A 1Q8GA 1PD1A 1P8XA 1T3XA 1NMDG 1RGIG 2NUTB 2FGHA 3EH1A 1C0GS 1T3YA 3CI5G 5KYXA 4LIZA 2LLFA 1HQZ1 1CNUA 1M2VA 4S10C 3EFOA 2FH1A 2VIKA 3A5MS 1EQYS 2VACA 3EGXA 1COFA 1M4JA 4CBXG 3EH2A 3EGDB 3FG6A 2MOTA 1DEJS 3EGDA 2HD7A 1AK6A 1SVQA 2D8BA 5KYUA 5HVKB 5KYNA 2NUPA 5HVKD 5KYXB 1Q8XA 2I2QA 2LJ8A 3L50A 1YVNG 1TMWA 4CBUG 2LXXA 5KYYA 3EG9B 5KYWA 1VFQA 2MP4A 1UDMA 1NM1G 2MV2A 1SVRA 1QPVA 3CIPG 1T2LA 1F7SA 3FFNA 1PCXA 1WM4A 4Z94G 2NUTA 4PKGG 3FFKA 2W0IA 5KYUB 1T44G 2NUPB 2FH2A 1C0FS 4PKHB 1D0NA 2VILA 2L72A 4KEDA 1H1VG 1M2OA 4KEEA 5IVUA 1AHQA 1V6FA 2FH4A 2QTVA 1M2VB 1VKKA 2XF1A 2FF6G 3Q2BA
chains in the Genus database with same CATH superfamily
5FAFA 1J72A 3EGXB 1PD0A 3A5OS 3FG7A 1SVYA 3A5LS 4BEX1 5FAEA 4JD2H 2KVKA 3CJCG 1WFSA 1KCQA 1D4XG 1TVJA 1P8ZG 1ESVS 2FH3A 3A5NS 5DD2A 1MDUA 3EFOB 1NLVG 3CJBG 5KYYB 1NPHA 3EG9A 5KYWB 2XFAA 1X67A 4KEFA 5A1MA 1JHWA 3TU5B 4PKIG 3DAWB 1CFYA 5L6WC 1WNJA 1YAGG 4CBWG 1AK7A 2FF3A 1Q8GA 1PD1A 1P8XA 1T3XA 1NMDG 1RGIG 2NUTB 2FGHA 3EH1A 1C0GS 1T3YA 3CI5G 5KYXA 4LIZA 2LLFA 1HQZ1 1CNUA 1M2VA 4S10C 3EFOA 2FH1A 2VIKA 3A5MS 1EQYS 2VACA 3EGXA 1COFA 1M4JA 4CBXG 3EH2A 3EGDB 3FG6A 2MOTA 1DEJS 3EGDA 2HD7A 1AK6A 1SVQA 2D8BA 5KYUA 5HVKB 5KYNA 2NUPA 5HVKD 5KYXB 1Q8XA 2I2QA 2LJ8A 3L50A 1YVNG 1TMWA 4CBUG 2LXXA 5KYYA 3EG9B 5KYWA 1VFQA 2MP4A 1UDMA 1NM1G 2MV2A 1SVRA 1QPVA 3CIPG 1T2LA 1F7SA 3FFNA 1PCXA 1WM4A 4Z94G 2NUTA 4PKGG 3FFKA 2W0IA 5KYUB 1T44G 2NUPB 2FH2A 1C0FS 4PKHB 1D0NA 2VILA 2L72A 3DA7A 4KEDA 1H1VG 1M2OA 4KEEA 5IVUA 1AHQA 1V6FA 2FH4A 2QTVA 1M2VB 1VKKA 2XF1A 2FF6G 3Q2BA
chains in the Genus database with same CATH topology
5FAFA 1J72A 3EGXB 1PD0A 3A5OS 3FG7A 1SVYA 3A5LS 4BEX1 5FAEA 4JD2H 2KVKA 3CJCG 1WFSA 1KCQA 1D4XG 1TVJA 1P8ZG 1ESVS 2FH3A 3A5NS 5DD2A 1MDUA 3EFOB 1NLVG 3CJBG 5KYYB 1NPHA 3EG9A 5KYWB 2XFAA 1X67A 4KEFA 5A1MA 1JHWA 3TU5B 4PKIG 3DAWB 1CFYA 5L6WC 1WNJA 1YAGG 4CBWG 1AK7A 2FF3A 1Q8GA 1PD1A 1P8XA 1T3XA 1NMDG 1RGIG 2NUTB 2FGHA 3EH1A 1C0GS 1T3YA 3CI5G 5KYXA 4LIZA 2LLFA 1HQZ1 1CNUA 1M2VA 4S10C 3EFOA 2FH1A 2VIKA 3A5MS 1EQYS 2VACA 3EGXA 1COFA 1M4JA 4CBXG 3EH2A 3EGDB 3FG6A 2MOTA 1DEJS 3EGDA 2HD7A 1AK6A 1SVQA 2D8BA 5KYUA 5HVKB 5KYNA 2NUPA 5HVKD 5KYXB 1Q8XA 2I2QA 2LJ8A 3L50A 1YVNG 1TMWA 4CBUG 2LXXA 5KYYA 3EG9B 5KYWA 1VFQA 2MP4A 1UDMA 1NM1G 2MV2A 1SVRA 1QPVA 3CIPG 1T2LA 1F7SA 3FFNA 1PCXA 1WM4A 4Z94G 2NUTA 4PKGG 3FFKA 2W0IA 5KYUB 1T44G 2NUPB 2FH2A 1C0FS 4PKHB 1D0NA 2VILA 2L72A 3DA7A 4KEDA 1H1VG 1M2OA 4KEEA 5IVUA 1AHQA 1V6FA 2FH4A 2QTVA 1M2VB 1VKKA 2XF1A 2FF6G 3Q2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FAF A;  1J72 A;  3EGX B;  1PD0 A;  3A5O S;  3FG7 A;  1SVY A;  3A5L S;  4BEX 1;  5FAE A;  4JD2 H;  2KVK A;  3CJC G;  1WFS A;  1KCQ A;  1D4X G;  1TVJ A;  1P8Z G;  1ESV S;  2FH3 A;  3A5N S;  5DD2 A;  1MDU A;  3EFO B;  1NLV G;  3CJB G;  5KYY B;  1NPH A;  3EG9 A;  5KYW B;  2XFA A;  1X67 A;  4KEF A;  5A1M A;  1JHW A;  3TU5 B;  4PKI G;  3DAW B;  1CFY A;  5L6W C;  1WNJ A;  1YAG G;  4CBW G;  1AK7 A;  2FF3 A;  1Q8G A;  1PD1 A;  1P8X A;  1T3X A;  1NMD G;  1RGI G;  2NUT B;  2FGH A;  3EH1 A;  1C0G S;  1T3Y A;  3CI5 G;  5KYX A;  4LIZ A;  2LLF A;  1HQZ 1;  1CNU A;  1M2V A;  4S10 C;  3EFO A;  2FH1 A;  2VIK A;  3A5M S;  1EQY S;  2VAC A;  3EGX A;  1COF A;  1M4J A;  4CBX G;  3EH2 A;  3EGD B;  3FG6 A;  2MOT A;  1DEJ S;  3EGD A;  2HD7 A;  1AK6 A;  1SVQ A;  2D8B A;  5KYU A;  5HVK B;  5KYN A;  2NUP A;  5HVK D;  5KYX B;  1Q8X A;  2I2Q A;  2LJ8 A;  3L50 A;  1YVN G;  1TMW A;  4CBU G;  2LXX A;  5KYY A;  3EG9 B;  5KYW A;  1VFQ A;  2MP4 A;  1UDM A;  1NM1 G;  2MV2 A;  1SVR A;  1QPV A;  3CIP G;  1T2L A;  1F7S A;  3FFN A;  1PCX A;  1WM4 A;  4Z94 G;  2NUT A;  4PKG G;  3FFK A;  2W0I A;  5KYU B;  1T44 G;  2NUP B;  2FH2 A;  1C0F S;  4PKH B;  1D0N A;  2VIL A;  2L72 A;  4KED A;  1H1V G;  1M2O A;  4KEE A;  5IVU A;  1AHQ A;  1V6F A;  2FH4 A;  2QTV A;  1M2V B;  1VKK A;  2XF1 A;  2FF6 G;  3Q2B A; 
#chains in the Genus database with same CATH topology
 5FAF A;  1J72 A;  3EGX B;  1PD0 A;  3A5O S;  3FG7 A;  1SVY A;  3A5L S;  4BEX 1;  5FAE A;  4JD2 H;  2KVK A;  3CJC G;  1WFS A;  1KCQ A;  1D4X G;  1TVJ A;  1P8Z G;  1ESV S;  2FH3 A;  3A5N S;  5DD2 A;  1MDU A;  3EFO B;  1NLV G;  3CJB G;  5KYY B;  1NPH A;  3EG9 A;  5KYW B;  2XFA A;  1X67 A;  4KEF A;  5A1M A;  1JHW A;  3TU5 B;  4PKI G;  3DAW B;  1CFY A;  5L6W C;  1WNJ A;  1YAG G;  4CBW G;  1AK7 A;  2FF3 A;  1Q8G A;  1PD1 A;  1P8X A;  1T3X A;  1NMD G;  1RGI G;  2NUT B;  2FGH A;  3EH1 A;  1C0G S;  1T3Y A;  3CI5 G;  5KYX A;  4LIZ A;  2LLF A;  1HQZ 1;  1CNU A;  1M2V A;  4S10 C;  3EFO A;  2FH1 A;  2VIK A;  3A5M S;  1EQY S;  2VAC A;  3EGX A;  1COF A;  1M4J A;  4CBX G;  3EH2 A;  3EGD B;  3FG6 A;  2MOT A;  1DEJ S;  3EGD A;  2HD7 A;  1AK6 A;  1SVQ A;  2D8B A;  5KYU A;  5HVK B;  5KYN A;  2NUP A;  5HVK D;  5KYX B;  1Q8X A;  2I2Q A;  2LJ8 A;  3L50 A;  1YVN G;  1TMW A;  4CBU G;  2LXX A;  5KYY A;  3EG9 B;  5KYW A;  1VFQ A;  2MP4 A;  1UDM A;  1NM1 G;  2MV2 A;  1SVR A;  1QPV A;  3CIP G;  1T2L A;  1F7S A;  3FFN A;  1PCX A;  1WM4 A;  4Z94 G;  2NUT A;  4PKG G;  3FFK A;  2W0I A;  5KYU B;  1T44 G;  2NUP B;  2FH2 A;  1C0F S;  4PKH B;  1D0N A;  2VIL A;  2L72 A;  3DA7 A;  4KED A;  1H1V G;  1M2O A;  4KEE A;  5IVU A;  1AHQ A;  1V6F A;  2FH4 A;  2QTV A;  1M2V B;  1VKK A;  2XF1 A;  2FF6 G;  3Q2B A; 
#chains in the Genus database with same CATH homology
 5FAF A;  1J72 A;  3EGX B;  1PD0 A;  3A5O S;  3FG7 A;  1SVY A;  3A5L S;  4BEX 1;  5FAE A;  4JD2 H;  2KVK A;  3CJC G;  1WFS A;  1KCQ A;  1D4X G;  1TVJ A;  1P8Z G;  1ESV S;  2FH3 A;  3A5N S;  5DD2 A;  1MDU A;  3EFO B;  1NLV G;  3CJB G;  5KYY B;  1NPH A;  3EG9 A;  5KYW B;  2XFA A;  1X67 A;  4KEF A;  5A1M A;  1JHW A;  3TU5 B;  4PKI G;  3DAW B;  1CFY A;  5L6W C;  1WNJ A;  1YAG G;  4CBW G;  1AK7 A;  2FF3 A;  1Q8G A;  1PD1 A;  1P8X A;  1T3X A;  1NMD G;  1RGI G;  2NUT B;  2FGH A;  3EH1 A;  1C0G S;  1T3Y A;  3CI5 G;  5KYX A;  4LIZ A;  2LLF A;  1HQZ 1;  1CNU A;  1M2V A;  4S10 C;  3EFO A;  2FH1 A;  2VIK A;  3A5M S;  1EQY S;  2VAC A;  3EGX A;  1COF A;  1M4J A;  4CBX G;  3EH2 A;  3EGD B;  3FG6 A;  2MOT A;  1DEJ S;  3EGD A;  2HD7 A;  1AK6 A;  1SVQ A;  2D8B A;  5KYU A;  5HVK B;  5KYN A;  2NUP A;  5HVK D;  5KYX B;  1Q8X A;  2I2Q A;  2LJ8 A;  3L50 A;  1YVN G;  1TMW A;  4CBU G;  2LXX A;  5KYY A;  3EG9 B;  5KYW A;  1VFQ A;  2MP4 A;  1UDM A;  1NM1 G;  2MV2 A;  1SVR A;  1QPV A;  3CIP G;  1T2L A;  1F7S A;  3FFN A;  1PCX A;  1WM4 A;  4Z94 G;  2NUT A;  4PKG G;  3FFK A;  2W0I A;  5KYU B;  1T44 G;  2NUP B;  2FH2 A;  1C0F S;  4PKH B;  1D0N A;  2VIL A;  2L72 A;  3DA7 A;  4KED A;  1H1V G;  1M2O A;  4KEE A;  5IVU A;  1AHQ A;  1V6F A;  2FH4 A;  2QTV A;  1M2V B;  1VKK A;  2XF1 A;  2FF6 G;  3Q2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...