1D5VA

Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11 (s12)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
b'MLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S12 TRANSCRIPTION FACTOR (FKH-14)
publication title Solution structure and dynamics of the DNA-binding domain of the adipocyte-transcription factor FREAC-11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d5vA00
1MJ9A 2QLZA 1S8NA 2M8EA 5CLSA 2CFXA 4EM0B 1FT9A 3JAMK 1R22A 3SXYA 2V6CA 4UVBA 2CO5A 2MBFA 3HTSB 3IC7A 2XAFA 1S29A 1STZA 2O3FA 2OA4A 5CYVA 3F8BA 2HTJA 1B9MA 4HX7A 3KETA 1XSDA 4I98B 2D1HA 4XBFA 3I54A 4OU0A 1R58A 2M5WA 5A2QZ 1KQ0A 2MD5A 4L0ZB 3MCZA 4RB2C 4OIPF 1U2WA 2XV4S 1K7AA 3PQKA 2DT5A 1LJ9A 4BH9A 4KICA 1FSEA 2EK5A 3Q5FA 4A6EA 1TQMA 4JBAA 2DQRA 1XGSA 2V1DA 2O6GE 4DQ2A 1B4AA 1IN4A 5BMZA 3MWMA 2ZNYA 3GVAA 3WTZA 4HA8A 1LDKB 5HDKA 4IPAA 1S7OA 3BOQA 2MH2A 2LNBA 1Z05A 3ZMSA 4EQQA 2Y48A 2COMA 5K1YA 2CG4A 1ZLJA 4U0VA 4A0XA 4AVPA 1P2FA 3ABTA 3WE2A 4U7DA 2VXZA 2DK8A 1KU9A 2DPUA 3TO7A 1ZREA 5D5WB 3VB2A 2AS5F 2FBIA 5D6EA 1FX7A 2W57A 4WXDA 5FFZA 1OR7A 3WGHA 2P5VA 1U8RA 1W7PA 3TDUC 1GXQA 4PDKA 3V4GA 1IN8A 2IPQX 1NHAA 3E6DA 1YTYA 2FE3A 1ODDA 4MHGA 2PJPA 2Y75A 1GXPA 1FY7A 2WWYA 5L3GA 1IXSB 1USSA 2HTSA 1ZN2A 4ZYHA 4OMZA 3DEUA 1B9NA 3MFKA 3WTTC 5LEJA 3B73A 1LVAA 2KJCA 3P7NA 1T6SA 1QGPA 1D3YA 2CW0F 2KKOA 1B1BA 3FMSA 3BP8A 3ZN1A 1XN7A 1TNSA 2G7UA 1RUNA 3P9KA 2FXAA 3H92A 3CTAA 2FQ3A 3H3ZA 5FD6A 5LLQA 3I59B 2XKPA 3EETA 5ICFA 2HYGD 2HQRA 4YFNF 3K1NA 1Z1DA 2BYVE 1DPUA 2DAOA 5DUKA 2ADUA 3HSEA 4O6JA 3HOTA 4RGRA 1KGSA 4EVIA 3V7RA 1R7JA 3J81K 2K7LA 5HLGA 1AOYA 3ML6A 1MDMA 1FZPB 4U0YA 4OMYA 2DTRA 5ICGA 3KFWX 2R7FA 3WTXC 2RV8A 4IJAA 4XSZF 2PQ8A 3K9TA 1SD4A 5ERIA 3DF8A 3TKYA 3F6OA 4KMUX 1WQ2A 4KDPA 2HFHA 4YG2F 5HS9A 3WTVC 1OYIA 5HDGA 1XSVA 4RB1A 1W7PD 4IHTA 5FD5A 4ETSA 2A5YB 1HXDA 2VONA 1O3QA 4P9FA 2R7DA 2CWEA 4KIGA 2STTA 4OIOF 4RGUA 1DPRA 4BHPA 3O3KA 3KEOA 2IW5A 4IRIA 2PFBA 1ZGAA 2W25A 2VOPA 1HKTA 3W6JB 1D5VA 4IXAA 2PG4A 4CDGA 4BHCA 1REPC 4A0ZA 5D5UB 1J7KA 4HLXA 4M9SA 4S04A 3VEPA 3NQOA 3WGGA 1IF1A 1OPCA 1ZLKA 5L3BA 1MJAA 3MZHA 2LSOA 2VODA 3ECHA 5LHIA 2PLYA 1I6XA 1G3TA 3JSPA 4GO1A 4MQVA 4TV7A 5KK1A 2V9VA 2W85A 1O7LA 3RI4A 3BPXA 1BN5A 4KMFA 3I0TA 2EFOA 2CSOA 1I1SA 3GFIA 3ROUA 2FF4A 3FXUA 4UV8A 4LD5A 5TRDA 1O3TA 4A12A 2V79A 4KN4X 3GFMA 4QLCU 3GXOA 5DV5A 1K78A 2XGXA 1OYYA 2XHKA 5AIQA 2JSCA 2NRAC 5HS7A 3U1DA 3C7JA 2WC2A 1KU2A 1O3RA 3KLNA 4B09A 2Z9OA 4G7HF 4Z2YA 3QU3A 2E1NA 1S7AA 2CYYA 4ESFA 3JTHA 3CO6C 1KYZA 1XGMA 2P5LC 1R1UA 3GEZA 4OOIA 1VTNC 3KP3A 3OOPA 4RB3C 1YO5C 1MKMA 4M6YA 3IKTA 4M6XA 1CF7A 1QBJA 1S6LA 3F3XA 4EMSA 3U2RA 3SQNA 1L0OC 4ZYGA 1QZZA 2O03A 4K2EA 5BPIA 1TW2A 2P6SA 2ZMEB 1D8JA 1FBQA 3FM5A 4EJTA 3R0AA 1YW9A 5LGNA 2GA2A 3QAHA 3HYIA 3GLXA 1FLIA 5EEHA 1I1GA 2JPBA 3F8NA 5E1WA 1YLFA 1PP7U 1BC8C 1X3UA 2AXLA 2EFQA 3WE3A 3K1PA 3WG9A 5LRRA 1IW7F 2QENA 1T98A 3QP5A 3ZPLA 4HDUA 2E7WA 2H6CA 4YFKF 4ZYDA 4OIQF 3L2CA 4M71A 2OBPA 3DPLC 1UB9A 3HRMA 5E18F 2JZYA 5AONA 1IN7A 2OD5A 3VOEA 1KU3A 5FLXK 1R1VA 1E17A 1WI9A 4BQAA 1FNNA 3L09A 4KA4A 3IRQA 2IVMA 2F5CA 1ON2A 3HOSA 3T0YA 1RIOH 4MEYF 4RGXA 5E17F 3JTGA 2ELHA 1TBXA 3RPUA 4WK8F 2A6EF 4KFCA 1XB4A 3F21A 1FBUA 1IRGA 2K4JA 2EJRA 5LGTA 2NAZA 2BEOA 3KE2A 3EDPA 5F6FA 1YQAA 3LAPA 3RIRA 2R3SA 3REOA 5LBQA 2V1XA 3CUOA 1JGSA 4D0PA 2QZ8A 1Z6RA 3ZN0A 1R5GA 3SZTA 3E97A 1Z7UA 4HAMA 4U0WA 1USTA 3TOAA 4HF1A 2PI0A 1MJBA 3KLOA 5BOXA 1IN5A 3G3ZA 5BS6A 4KN7X 1W5TA 2D45A 1U78A 2FNPA 3MEXA 2RNJA 4R1HA 1QZYA 1FPQA 4Y13A 2YU3A 3ERED 1FYMA 4WX9A 4UV9A 2IA2A 1ZRDA 5LHHA 3BDDA 2HEOA 3C1DA 2QQBA 2OQRA 4U88A 4LMYA 3SHFA 3SFZA 5HS8A 1RUOA 2L02A 3IWFA 4MTEA 1H9GA 2EV0A 1YS7A 1IXCA 2FBHA 1Q1HA 2XIGA 5EEGA 1O57A 3GWZA 4L9VA 3ABUA 3WU0A 5CVUA 4YIIA 1FP1D 1XCBA 3I59A 3JSOA 5K5OA 1FSHA 4HOBA 3BY6A 1BI1A 3CJNA 2ZO4A 4P96A 1J9IA 3LFKA 2HWVA 1P92A 4NQWA 4UNOA 2IA1A 1ZARA 3ZP5A 1J5YA 4L9JA 1ZAOA 1SMTA 4EM1A 3HHGA 4BYYA 1LEAA 1K6OA 1P4XA 5J8CA 4XSXF 3F72A 3T8TA 3ZMDA 4NHJA 4HW0A 1DDNA 3C3WA 1IN6A 3IKVA 5J6XA 1L3LA 5ILUA 4UVAA 4ENKA 1SD6A 1HKSA 1Z9CA 4BXUA 4KUMA 5H6RA 2DI3A 2Y0MA 1T39A 2JRTA 2RGVA 2DQLA 2W84A 4EGZA 4B8XA 1TQPA 4HX4A 4I01A 1G3YA 3Q9SA 4KIFA 3T8RA 3RPQA 5ICCA 2EV6A 3M8EA 1I27A 2GWRA 2QQAA 1GHCA 4Q47A 2BGCA 4HBLA 2LF8A 5H20A 2MLKA 4ZH4F 3R6SA 4HZFA 2FBKA 2VC0A 4ON0A 4LGWA 2K02A 3J81Z 3GFJA 1SD7A 3ISPA 1SFEA 3HHHA 3KP6A 5ILSA 3RKWA 1Z6TA 4A2UA 2JTVA 1TTYA 3RJPA 2L4AA 1A04A 4ZZDA 1W4MA 4M73A 1FOKA 4LLNA 1ZYRF 2LKPA 3FXQA 4HV6A 5D4RA 5HOOA 2QQ9A 2QBYB 3C18A 4ZZLA 4FX0A 4M72A 5ED4A 1YG2A 2JPCA 4LFUA 5D5XB 3L7WA 1U6GA 3KCCA 3FMQA 1S3JA 2EWNA 2FOKA 3CUQB 5CVIA 2HYFA 2VBYA 2DBBA 1YS6A 3T1BA 1DUXC 5DD8A 1TW3A 2P8TA 1FBSA 3N97A 3E3VA 1FP2A 1R23A 1JXSA 2V1UA 4GCVA 3KP7A 4I7HA 3QP6A 1XDUA 5IT9K 3DV8A 2X4HA 2OAZA 1R00A 1ZRFA 1PUEE 4Y15A 2Z99A 5FO5A 2GAUA 3BWGA 4P9UA 2D1VA 5LGUA 4WF2A 3WTSC 1FC3A 2Q8KA 3HRUA 2YPRA 2O8XA 2XAQA 2FNAA 1KQ9A 4Q5SF 2VE9A 5KVRA 4ENJA 1DP7P 2FSWA 1J0RA 1WRJA 4HF0A 3WGIA 3F6VA 4JK1X 2OZ6A 5K5RA 4GGGA 2LF7A 3K69A 3N4MA 1Y0UA 2GIVA 3IWZA 3GZ5A 3DFGA 4MTDA 3D5LA 1EV7A 4HYEA 1GVJA 2NYXA 4LLLA 1ZG5A 2JT1A 3DP7A 3SZPA 2K86A 5F64A 3R61A 1UFMA 1RNLA 2E1CA 1T38A 3Q9VA 3FXRA 1OKRA 3KZYA 1YFHA 2CQKA 2VBZA 3RTRA 2L4MA 3FF5A 4L0YB 2FU4A 2A07F 3GO5A 4IHSA 1U5TA 1BBYA 1HW5A 5DCMB 2Q2EA 3LA2A 4DNCA 1HQCA 1RI7A 4M9XA 1LDJA 4G9YA 1IXRC 3KP5A 2RN7A 1JHFA 2OZUA 4CICA 4AIJA 4LG0B 4AD9A 4A6DA 5J8FA 3EYIA 4HLYA 5L3CA 1T0FA 4G6QA 3TO6A 5LHGA 2MC3A 2D2WA 2P6TA 1BI2A 2G7HA 3E5UA 4N9IA 2QYOA 2VT3A 3F8CA 2EFWA 3RKXA 2PMUA 2HZTA 3KZZA 2RQPA 1BM9A 3DPTA 1EH8A 2HR3A 2XAGA 1TNTA 1H0MA 2QVOA 2RDPA 2NS0A 5JR3A 1F5TA 2RC4A 4Q48A 2M87A 3K0LA 1ON1A 4GYGA 2VBXA 2DO7A 5CVVA 2MLGA 2BBYA 3R4KA 5D4SA 4P55A 5DCFA 1MZBA 2DW4A 4PGHA 4I2OA 1JHHA 3COAC 4JQFA 1HW1A 2PN6A 4LK0F 4MQ9F 5FLXZ 3R0JA 2EA4A 1R36A 3HSFA 2OU2A 1OMIA 4P5OA 4EV0A 4BNCA 5E1XA 3LAJA 1J75A 1FYLA 3BPVA 2ZCWA 4HX8A 2DLLA 4XLNF 2HGCA 4BHBA 2KIUA 3V7SA 1D8KA 2IA0A 5AIPA 1BIBA 2M45A 1QQIA 1BI3A 3S2WA 2IT0A 1ULYA 2Z33A 4GYIA 1ZHFA 3GF2A 3DXJF 1C0WA 4L5JA 2ZNZA 3BJ6A 3I58A 4XLPF 5E1ZB 1F9NA 3LQQA 1U3EM 4S05A 2Q0OA 3D0SA 2GQQA 5DYMA 1V3FA 1U5TC 3DKWA 4IVNA 3ZMVA 3GYHX 4CXFA 6PAXA 1W5SA 2KIFA 4ZYEA 5LRSA 1QPMA 1CF7B 4ESJA 4L5IA 4M74A 4AWXB 3WTUC 3AAFA 2ISYA 2ZFWA 2HS5A 4UXNA 2A6HF 1AWCA 2GXBA 2DK5A 4CO8A 4YFXF 4RB0A 1TLHB 4R79A 3V8JA 3PQJA 3V8KA 3OV8A 4EJWA 2X0LA 1OYWA 3M9AA 5TJJA 1G3WA 3T5XA 4G7OF 3RYRA 3J80Z 2DFIA 4LB6B 3K1MA 3CLOA 4WCGA 3HIFA 4WXHA 3LWFA 1IAWA 2H09A 2ZBKA 4I0BA 1YW7A 2BE5F 4WWCA 5D8LB 3P9CA 2F5DA 2FEZA 3J80K 4F7ZA 4RAYA 1XGNA 1ZH5A 2Z3YA 2GXGA 1SFXA 3FWEA 1KQ8A 3E5QA 3FHZA 4UUVA 5ILVA 3CO7C 3BZ6A 4WXCA 1XMKA 4M9ZA 4AIKA 4EM2A 4KNYA 4MGRA 4U7BA 4CZZA 1KA8A 3U9GA 4A5MA 2W24A 1YW8A 3PFIA 2IJLA 4KIBA 2P4WA 2FMLA 4YIFA 5A2QK 3ULQB 4I0AA 2UWMA 2P7CB 4GXOA 3M8FA 2C6YA 2QBYA 3M7GA 4FT8A 5HLHA 3E5XA 1O3SA 2KRFA 2PMHA 3GUDA 2QUFA 2ETHA 3TDZC 2VT2A 5FB2A 1LQ1A 2L01A 2F5EA 1WSUA 2O0YA 3CUQA 2HOEA 2F2EA 1G6NA 2Z5UA 2XASA 4HDVA 2YX7A 1SMYF 3I71A 3LA7A 3M1EA 1Z91A 2STWA 2H27A 1FWZA 3GZ6A 1G3SA 2M30A 3L9FA 3QPHA 1E2XA 4N0BA 1J59A 2VN2A 5D8KB 2UZKA 3FM3A 3J7AO 2E7XA 1LEBA 3QU6A 2GZWA 2A68F 4IRHA 3E6BA 3JW4A 4L9NA 1MGTA 4O5VA 5F1RA 1HSTA 1EH6A 3FX3A 4G94A 2G9WA 2RKHA 2FRHA 5DEQA 3HSRA 2A3SA 2HDCA 1I5ZA 1PP8F 2VBWA 3QOPA 3HUGA 3KP2A 5JI6A 2A61A 4UHTA 4LB5A 4EJVA 3QPTA 1TQIA 1XMAA 1B59A 4R8HA 4RAZA 1KU7A 5L3DA 1LDDA 5H6QA 4I02A 2TDXA 2FMYA 4LK1F 3IRRA 1LB2A 3MAJA 3GX4X 5IT9Z 2VOOA 1J2XA 2ISZA 3WU1B 5DCMA 4RS8A 3VFZA 3GFLA 4ESBA 2IP2A 1BI0A 4XRFA 1FYKA 1SD5A 2DU9A 2EA2A 1ZGJA 4LG0A 2K27A 1CGPA 3ZQ7A 3HTUA 1WWXA 4ASNA 1XCVA 1W7PB 4IF4A 1B6AA 2RVCA 1XDSA 4LJZF 1P4WA 1UHWA 5JFRA 4PZJA 2WTEA 3E6MA 2PBIA 3CUQC 5E8IA 2ZXJA 3I4PA 2ESNA 3IHUA 3KEQA 3RDIA 3V8LA 5L3EA 5JVTA 2XAHA 4Y17A 3I64A 2XROA 2ZMEA 2K4BA 3EUHA 5L3FA 2A69F 4A5NA 3O6BB 4RGSA 3I53A 4CYDA 3RYPA 3ZMUA 4LLGF 1LNWA 1SAXA 3DQVC 4Q4ZF 1F1ZA 1R5HA 5E8GA 5DUIA 1HW2A 2UXXA 2WV0A 4EGYA 3TOBA 4I09A 3LA3A 1P4AA 1BC7C 3FZVA 4N9HA 3RKYA 3TQNA 5CJ9A 2IRFG 2HQNA 2XAJA 4L9TA 4UVCA 4AIHA 1HBXG 4EJOA 2XKOA 2LDUA 4MEXF 5IT3A 2P5KA 4CHUA 3CDHA 2MH9A 1SFUA 1IZ1A 3WTWC 4NB5A 4L18B 5E20A 1MDMB 1QNTA 1IUYA 2MA3A 3H3UA 1ZG1A 3F23A 2QM3A 1YIOA 3TO9A 5FGMA 2NNYA 3E6CC 3BJOA 1F4KA 2YSRA 1O7FA 3P9IA 4MNUA 2CGPA 4OIRF 4KYWA 1KYWA 1HSJA 3NEUA 3R60A 1PDNC 3BJAA 1XD7A 5LEKA 4G6DA 5ICEA 5JHUA 4CGZA 3ECOA 5HLIA 2ZKZA 3WODF 2EB7A 1YYVA 1P6RA 5DD4A 3W6KB 3ELKA 3B02A 2VE8A 2OQGA 1K79A 3BROA 2EFNA 1R1TA 4HV5A 3F8FA 2GA1A 3O2PE 5FFXA 3MZYA 2F5FA 2B0LA 2XVCA 3V7CA 1T2KA 1H9TA 1XSXA 2FA5A 1BJAA 1EH7A 3EYYA 5BPDA 4QWQA 5BQTA 3EQLF 1ONVA 2PEXA 4EJUA 4BAYA 4OINF 3HRSA 3F22A 3G73A 4H0EA 2QWWA 4HQEA 2BV6A 2P7VB 5K5QA 1G4DA 5HDNA 4IRGA 1JE8A 2XRNA 1MD0A 2HKXA 3FMRA 1WKMA 2ZJ2A 1BIAA 3GW2A 2VC1A 2ACJA 3IL2A 2EFPA 2L3DA 3ZMTA 5D5VB 1BOAA 2L54A 4FHTA 3LQRA 2J5PA 5DDGA 1UHMA 2H94A 2DPDA 3K2ZA 1K78B 3MQ0A 4ENMA 3LSTA 2HKOA 3I5UA 2KJBA 4A0YA 1V4RA 1U5TB 4G8XA 2ESHA 2J5OA 3L00A 1RZ4A 1XGOA 3HRTA 2O61A 2M1BA 4ENNA 1UCRA 2NNNA 1ZG3A 4HQMA 4O3MA 4HF2A 2UXNA 4KT5C 5HVQC 1HKQA 3WTYC 4PCQA 4PGGA 3QRFF 5CVJA 2YR2A 3F8MA 3TGNA 2KIMA 3KP4A 4FX4A 3ZMZA 3JAMZ 2XUBA 4G7ZF 1IRFA 2H6BA 2YX4A 5CVRA 1ZRCA 3NRVA 3VODA 5D6FA 4E70A 1QO0D 2EV5A
chains in the Genus database with same CATH superfamily
1A6IA 1MJ9A 2QLZA 5B1AH 1S8NA 2M8EA 5CLSA 1JT0A 2IGKA 4E7IA 2CFXA 3H0GJ 2EINH 4EM0B 4P1WA 1FT9A 4XN3A 2R4GA 3JAMK 3ZQLA 4AUXA 1R22A 2CV1A 4C9YA 3QYFA 3SXYA 2X1DA 4D1QA 1VQ6I 1HA8A 2V6CA 4UVBA 4L5EA 1FOWA 2CO5A 5FKNA 2MBFA 2CQXA 3HTSB 3BT9A 3QYEA 3IC7A 3EUKL 2XAFA 3BR3A 1S29A 2R7VA 1STZA 1UG2A 2O3FA 2EZHA 2OA4A 3UNGC 1P7JA 4CH7A 2PMZA 1DGWY 2HYJA 5CYVA 3B6AA 3F8BA 2HTJA 2N8GA 1B9MA 3JREA 4HX7A 4BJ5C 5M5XJ 2LMDA 4FETA 2LR8A 3Q0VA 1DQUA 4BE2A 4XRSG 1W1WE 3KETA 1XSDA 4I98B 2D1HA 2JVHA 4XBFA 3S2DJ 3HOUJ 3I54A 4OU0A 1R58A 1WJAA 2M5WA 2LBFB 5A2QZ 1KQ0A 2MD5A 4L0ZB 3FXMA 3MCZA 4RB2C 3H9GA 4OIPF 1FMWA 4JX5A 1U2WA 2XV4S 1K7AA 3PQKA 4S0HB 1TWFJ 2DT5A 1LJ9A 2K9QA 2LK2A 4BH9A 2L7KA 4KICA 1FSEA 1VQ4I 2EK5A 3FBNB 2GIZA 1Z3XA 1HF0A 5JLXA 4ABZA 4IX7A 3Q5FA 4A6EA 1TQMA 4JBAA 4RLQA 2DQRA 1XGSA 2DA2A 3BCAA 2V1DA 4JX6A 3S16J 3OYMA 1LPQA 3BG5A 2DDAA 3HOWJ 1OFCX 2O6GE 3OWTA 1XMXA 4DQ2A 2HVRA 2M3AA 2VKVA 2KMUA 1B4AA 1IN4A 5BMZA 4E7ZA 2DT6A 3MWMA 2ZNYA 2R7ZJ 1ZK8A 3HOYJ 3GTLJ 3GVAA 1U0JA 3WTZA 2ID3A 1NTCA 4HA8A 2R5ZB 1LDKB 5HDKA 4IPAA 1S7OA 1UG0A 3BOQA 4PFPA 2MH2A 4D5CA 2LNBA 1Z05A 3ZMSA 1OJLA 4EQQA 5KAFC 3AKZA 5E3MA 2Y48A 2COMA 5K1YA 4C30A 3K4MA 2KRCA 2CG4A 3KPHA 5DM6F 1ZLJA 4U0VA 1NH3A 4A0XA 2E71A 5HNHA 4AVPA 2OJED 1P2FA 3ABTA 3WE2A 4YIRX 4U7DA 4BUPA 3OIQA 1BW6A 1D1AA 2L5QA 2VXZA 2ELKA 2DK8A 1KU9A 2M8GX 4DYQA 2CUZA 2DPUA 3TO7A 1ZREA 5D5WB 2L7ZA 1XTAA 3VB2A 2VPLA 3S3MA 3CJRB 2AS5F 2FBIA 5D6EA 1FX7A 2O7OA 2W57A 4WXDA 2KISA 3BG9A 3ZQIA 5FFZA 1OR7A 3WGHA 2P5VA 3PJRA 1T95A 2R7QA 1U8RA 2W48A 2IGOA 1ETKA 1W7PA 2ZB9A 3TDUC 1GXQA 4B3XA 4PDKA 2BY1A 3V4GA 1IN8A 2QA4I 2LREA 2IPQX 3FXJA 3LSMA 3WG7H 1NHAA 2JRMA 5TISC 3E6DA 1YTYA 2B9SA 3S15J 2BHYA 2FE3A 4NC8A 1TT0A 1ODDA 3H9JA 4MHGA 2PJPA 2Y75A 1GXPA 1FY7A 3ZQGA 2WWYA 5L3GA 3OL4A 4V19K 4J01A 4E6KG 1GLNA 3L2RA 1NK2P 1IXSB 1USSA 4BY7J 2IBDA 2HTSA 1H89C 1ZN2A 3OR1C 5J3LA 4KITB 4ZYHA 4OMZA 5F1JA 3DEUA 1B9NA 3MFKA 5CQEA 3HM5A 1H8AC 3WTTC 2H8WA 3PSIA 5LEJA 3TBIA 1WJBA 3B73A 1LVAA 2KJCA 2MW8A 3P7NA 2VQGA 1T6SA 3IH4A 4PJLA 3UR3C 3NAUA 1QGPA 1D3YA 2CW0F 2KKOA 2ZC2A 2A6TA 1B1BA 3FMSA 4M3FA 1B72A 3BP8A 3ZN1A 2XF7A 5KAIC 1XN7A 3S3NA 1TNSA 2G7UA 4IOCF 3P9KA 1ETVA 1RUNA 2QKLB 2FXAA 3H92A 3CTAA 3CC4I 2JJ7A 2XPVA 2FQ3A 3H3ZA 3HC7A 5FD6A 5LLQA 2W82A 2IGNA 3I59B 2WB1N 3PUBA 1MBEA 1Q1VA 4MLOA 2XKPA 5CQGA 3OYGA 3HBLA 3EETA 5B66C 5ICFA 2HYGD 2HQRA 4YFNF 1OLTA 4OWRB 4ZC3A 1W0TA 3K1NA 2K9SA 1Z1DA 2BYVE 1DPUA 2DAOA 2IAIA 5DUKA 2ADUA 3HSEA 4O6JA 2X1CA 3HOTA 2M4GA 4RGRA 2R7UA 1KGSA 4EVIA 1VQKI 1SVOA 1R7JA 1U9OA 2K7LA 3MD2A 3V7RA 2EILH 3CCYA 5HLGA 3J81K 1AOYA 3AG3H 3ML6A 1MDMA 1FZPB 4U0YA 1ETOA 4OMYA 1B8IA 4IZZA 2DTRA 2DJIA 5ICGA 4BU2A 3KFWX 2R7FA 3WTXC 1ZR2A 2RV8A 4IJAA 1DU6A 2QQ8A 1R4NB 4XSZF 2KT0A 4NBQA 5GADJ 2PQ8A 3TW6A 1Y1VJ 1ETYA 3K9TA 1SD4A 5ERIA 2M9HA 3DF8A 1Y1WJ 4A93J 3BCBA 3K4LA 3UKGA 3TKYA 3F6OA 4KMUX 1WQ2A 4KDPA 5F0CA 2HFHA 4YG2F 3PSFA 3DU5A 4LOCA 5HS9A 2VKDA 3WTVC 1OYIA 4BDZA 3FK7A 3TW7A 1W36C 5HDGA 1BOBA 1XSVA 4RB1A 4IQJA 1W7PD 2NVYJ 4IHTA 5FD5A 4ETSA 1Z0XA 2A5YB 1Y8QB 1HXDA 2MABA 2VKHA 2VONA 1O3QA 4P9FA 2R7DA 3H1CA 2CWEA 3S17J 3GTQJ 4KIGA 4BEHA 2STTA 2KPMA 4OIOF 4RGUA 1DPRA 4BHPA 1I50J 3DKXA 3O3KA 3KEOA 1A35A 2IW5A 4JP0A 4IRIA 4A69C 4CZCA 2PFBA 1ZGAA 2CV0A 2W25A 2VOPA 4F3QA 3G2BA 3G1OA 1F43A 1HKTA 2NS7A 3W6JB 1D5VA 4IXAA 3A03A 2PG4A 4C3HJ 3HGGA 4CDGA 4A3GJ 3PIOF 5C4XJ 4XOPA 3HKZA 2W7NA 3DBLB 4BHCA 5J4YA 1REPC 4A0ZA 5D5UB 1J7KA 1I39A 4HLXA 3LSKA 4M9SA 2V9KA 4XLEA 4S04A 1SFKA 3H0DA 3VEPA 4M6VA 3GTPJ 2WY8Q 1JJ6C 2LKXA 3NQOA 2WBMA 3WGGA 1YRNB 1K61A 1IF1A 1OPCA 1X19A 3A01A 1ZLKA 1NG6A 5EG0B 5L3BA 1MNDA 3DEEA 4PJNA 1MJAA 3SJMA 3MZHA 5E79C 1UELB 2LSOA 2MFZA 2VODA 3ECHA 4A3LJ 1G59A 3I4MJ 1F36A 4BY1J 3H35A 4HSTA 5LHIA 2PLYA 1I6XA 1G3TA 1RETA 1X4PA 3JSPA 3JR9A 3C2BA 1PUFB 2OUMA 4GO1A 4MQVA 4TV7A 2AQEA 2X85A 5KK1A 2V9VA 2W85A 2OTJI 2NVQJ 1O7LA 3RQ4A 2TRTA 3BR5A 3ZQFA 3RI4A 3BPXA 1BN5A 4KMFA 3I0TA 2EFOA 2CSOA 1I1SA 3GFIA 3ROUA 2FF4A 3FXUA 4UV8A 1D5YA 3BR6A 4LD5A 1QU3A 5TRDA 1O3TA 2X6WA 4A12A 2V79A 1G8XA 4KN4X 3GFMA 4QLCU 3GXOA 5DV5A 1K78A 2WY7Q 2XGXA 1OYYA 1WJDA 2DFHA 2KQRA 2JSCA 2XHKA 5AIQA 2NRAC 5HS7A 3U1DA 1HOMA 2DFFA 3C7JA 3CD6I 2WC2A 3SEQA 3GTMJ 1EA3A 2QSGX 3CC2I 1KU2A 1O3RA 1GUUA 2DYRH 3KLNA 4B09A 2LYCA 2WV1A 4I76A 2Z9OA 4G7HF 4A3IJ 4Z2YA 3QU3A 4UUSA 4PFOA 3ABLH 2E1NA 1S7AA 2CYYA 4ESFA 1RKWA 3JTHA 3CO6C 1KYZA 3G1LA 2Y0SA 4HEA2 1XGMA 3NWSA 2P5LC 2E5ZA 1FIPA 1R1UA 3GEZA 2P0WA 2LC2A 4OOIA 5C3EJ 1VTNC 3KP3A 4J00A 3OOPA 4RB3C 1YO5C 2Q1ZB 2W00A 1MKMA 2F4MB 3HKZN 3RSNA 4M6YA 2L9SA 3TL4X 3IKTA 2K3FA 5IYBJ 4M6XA 1CF7A 1QBJA 3DBRB 4DIQA 2YUSA 4ITVA 3DU6A 1S6LA 3F3XA 4EMSA 3U2RA 3SQNA 1L0OC 4ZYGA 1QZZA 2O03A 3CZ6A 3J7ZI 3OYHA 4K2EA 3QPLA 3JRGA 5BPIA 1ZKGA 1TW2A 2HNHA 2P6SA 2ZMEB 5IPAA 1D8JA 4II3A 1FBQA 3FM5A 4EJTA 3R0AA 3OYCA 3KZIC 1YW9A 5LGNA 2GA2A 1BR4A 3O8HA 3QAHA 3HYIA 3S2HJ 1T33A 3GLXA 4F92B 1FLIA 3SFIA 4DOZA 5EEHA 1I1GA 3PUFA 2FX0A 1ZTRA 2JPBA 4B47A 3F8NA 1MBJA 1PVEA 2HOAA 1ZQ3P 2LG4A 5E1WA 1YLFA 1PP7U 3I55I 4NDLA 1BC8C 1X3UA 2AXLA 2CMPA 2EFQA 1MMAA 3M8JA 4Y33A 3WE3A 3K1PA 1T56A 3WG9A 3JRAA 2MD0A 1E3PA 1FMVA 3VSKA 5LRRA 2DT7B 2WADA 2LH9A 3DEWA 1OCPA 1IW7F 2QENA 1T98A 1LKXA 3OIPA 5IOYA 3QP5A 3ZPLA 4HDUA 4ZTJA 3HB9A 2E7WA 2H6CA 4YFKF 2YU9J 4ZYDA 3OYAA 4OIQF 4EATA 3L2CA 1D1CA 4M71A 2OBPA 3DPLC 2R7RA 2E1MB 2QEXI 1UB9A 2I8DA 3LOCA 1VFCA 1MNEA 4PK4A 3HRMA 5E18F 2LBFA 5EDNA 2CU7A 1D0YA 2JZYA 5AONA 1IN7A 2OD5A 5B3SH 3VOEA 4UUTA 3ZQCA 1KU3A 1ORKA 4XLHA 5FLXK 1R1VA 1E17A 3SEZA 3FKJA 1WI9A 4BQAA 1FNNA 3L09A 4CYCB 3IRQA 4KA4A 4C2MJ 2Q2EB 2IVMA 1Z67A 2F5CA 4RAGA 3LL7A 4BBSJ 1ON2A 3HOSA 2QGUA 3T0YA 1RIOH 4BXXJ 4MEYF 3SDBA 4RGXA 5E17F 3AG2H 3JTGA 2ELHA 1TBXA 1UZCA 3HJEA 5FJ8J 5F0HA 3RPUA 1V5EA 2A6EF 1R5ID 4WK8F 2HU9A 4KFCA 4BGDA 1XB4A 4JOMA 3F21A 1SC7A 4IHVA 3EPZA 1FBUA 4LIVA 4HRIA 2X6YA 3FIWA 1IRGA 2K4JA 2OTLI 3A1YA 3A0BC 1TWHJ 2EJRA 1VZ0A 2ICWG 2LP0A 2NAZA 5LGTA 5EYRA 2BEOA 2LLKA 1HLVA 3KE2A 4DZPA 3EDPA 1P9QC 4W1UA 1IRZA 5F6FA 1YQAA 5F27A 3LAPA 3RIRA 1IDYA 2R3SA 3REOA 5LBQA 2V1XA 1JGGA 3DWLE 3CUOA 3ZR8X 1JGSA 1LVKA 4E4HA 2ZJQF 3OYBA 4D0PA 2QZ8A 1MBKA 1Z6RA 3ZN0A 5M3FJ 1R5GA 3BG6A 3SZTA 2XB0X 1SAUA 2MYSA 3E97A 1Z7UA 4HAMA 4U0WA 1USTA 3K6GA 3TOAA 2PI0A 4HF1A 3DTIA 1MJBA 3KLOA 4B3AA 3CCSI 3OIOA 5BOXA 5FRNA 3HOVJ 1IN5A 3G3ZA 5BS6A 4AU7A 1IDZA 4KN7X 3CCLI 1W5TA 4AYBA 3ESWB 4BS9A 2D45A 3CJQB 1U78A 2FNPA 2MG4A 3MEXA 2RNJA 4ZDPA 4R1HA 2JSPA 1QZYA 2KLOA 1FPQA 2PX9A 4Y13A 2M7AA 2YU3A 3ERED 1FYMA 4WX9A 3KYCB 1PYVA 2DJNA 4UV9A 1TWAJ 3C2GA 3KIOA 2FJ1A 2IA2A 4A3EJ 2L9NA 1ZRDA 3TP3A 5LHHA 3BDDA 2HEOA 3C1DA 3CCJI 2QQBA 5EEAA 2OQRA 4U88A 4LMYA 3Q0UA 5KNLA 3H5AA 3RCOA 3SHFA 4BL0B 3SFZA 5HS8A 3Q0WA 3ZQQA 1A5JA 1RUOA 2L02A 3H5RA 3IWFA 4MTEA 1Y56A 2Y69H 1H9GA 2IGMA 1Y39A 4C2UA 2EV0A 5JHFA 2M0MA 2CJJA 2RQQA 1IGNA 1YS7A 1IXCA 3W3CA 2V26A 2X6OA 2BW3B 2FBHA 2GBYA 1R6RA 3OS2A 1MSFC 1Q1HA 2XIGA 5EEGA 1O57A 2DCEA 3GWZA 4L9VA 5FKOA 1VQ9I 1S72I 4IHWA 2JK3A 3ABUA 3RPUD 3WU0A 2XGDA 4Y7NJ 2ZJRF 1P7IA 5CVUA 5H2FC 4YIIA 3JRDA 1YJ9I 1I3QJ 1FP1D 1XCBA 3I59A 2E34A 3CESA 2XPWA 1SVMA 3JSOA 1RKTA 5K5OA 1FSHA 2HZDA 4YEJA 4HOBA 3HPHA 3BY6A 1BI1A 3CJNA 1QPIA 2ZO4A 4P96A 1J9IA 3LFKA 4Y3OA 2DMUA 3OYNA 2HWVA 3ZXSA 5F08A 4CCNA 4ZJZA 2QKMB 3AL0B 1P92A 4DBRA 4NQWA 4M3BA 4UNOA 4IQ4A 2IA1A 1ZARA 4BBRJ 3DTKA 3D1NI 3ZP5A 4F93B 1J5YA 1XPXA 4L9JA 1ZAOA 1SMTA 3NWTA 3CC7I 4EM1A 3HHGA 4BYYA 1LEAA 2JA6J 1K6OA 2CQQA 1P4XA 3FISA 1R9TJ 5J8CA 1YE9A 4XORA 4PUSA 4XSXF 1GV2A 4W97A 3F72A 2CV2A 3T8TA 3ZMDA 4NHJA 2ME6A 4HW0A 4F55A 1Z3YA 1DDNA 1X3ZB 2R5YB 3C3WA 3CJTB 2H1KA 1TP4A 1IN6A 3IKVA 5J6XA 1L3LA 2IS6A 5ILUA 4UVAA 5FKMA 1A31A 2HQ5A 4ENKA 1SD6A 1HKSA 2PMZN 3BQZA 1Z9CA 1XG1A 5C4JJ 1XS9A 4ZDLA 4BXUA 1K83J 1K4SA 4EEFG 4XLAA 1QA6A 1IRXA 4KUMA 3HL2A 5H6RA 2VJ4A 2DI3A 2Y0MA 1IO2A 1T39A 5GP9A 2JRTA 1DGRM 2RGVA 1VQOI 2DQLA 4XICA 3OYDA 2W84A 4EGZA 4B8XA 1OCOH 1QZEA 1TQPA 3I9V2 2L2OA 3QWLA 4HX4A 4I01A 1G3YA 3Q9SA 4KIFA 3T8RA 3OYLA 1YHQI 3RPQA 3KYLA 5ICCA 2EV6A 3CP2A 3M8EA 1I27A 3CDLA 3D5SC 2GWRA 3CQZJ 3CCQI 4IEJA 1WVRA 1W0UA 2QQAA 4BE0A 2VUMJ 3FK6A 1GHCA 1Z21A 4Q47A 2BGCA 4HBLA 3PO2J 2LF8A 2NXNB 5H20A 2NVXJ 2WAFA 1QHGA 2MLKA 2LKSA 3LSHA 4ZH4F 3R6SA 3E1SA 3X2QH 2GOXB 4HZFA 4QTRA 2FBKA 2XF6A 2VC0A 1VNDA 1MMGA 3DPUA 4ON0A 1YRNA 4LGWA 2LY1A 2K02A 4X6AJ 5EG0A 4B44A 1X1CA 3J81Z 3GFJA 1SD7A 1TZLA 3CCVI 3ISPA 1SFEA 3HHHA 3KP6A 2DOFA 3PM1A 5ILSA 1N78A 2ZJPF 3RKWA 1W5CC 1Z6TA 4U87A 4A2UA 2JTVA 4NNJA 1TTYA 3RJPA 3HG9A 2HDDA 2MGQA 2DDBA 1BA5A 2F6CA 1PUFA 3IAS2 1MBFA 2L4AA 1A04A 4ZZDA 1W4MA 1VQ8I 3GTJJ 4M73A 2HPIA 1FOKA 2E1OA 4LLNA 1ZYRF 2L0KA 2LKPA 4E7JA 3FXQA 4HV6A 2GM4A 5D4RA 5HOOA 2QQ9A 2QBYB 2VJ5A 4XKBA 2YS9A 3C18A 4ZZLA 4FX0A 4M72A 5ED4A 1YG2A 3ONQA 1E3HA 2JPCA 4LFUA 2VPRA 1FOYA 4GRIA 4NC7A 5D5XB 3L7WA 4QSHA 2V9PA 3BTLA 5FKLA 2Y31A 2D5VA 1GVDA 1U6GA 3KCCA 3LFUA 3OYIA 3FMQA 1QRYA 4Z6YA 1JJ8C 1X1DA 1JKPC 1S3JA 2EWNA 2FOKA 1RPWA 1OISA 3CUQB 5CVIA 2HYFA 3OYEA 1KONA 1X1BA 2VBYA 3ASNH 2IEKA 1MMDA 2DBBA 3S1NJ 1YS6A 5B1BH 3T1BA 1DUXC 3S93A 5DD8A 1TW3A 2P8TA 4G6TB 3BQYA 1JI8A 1FBSA 3N97A 3E3VA 1FP2A 1R23A 4DZJA 1JXSA 2O9LA 2V1UA 3AG1H 4GCVA 3KP7A 4I7HA 3QP6A 4V2GA 2LY9A 1XDUA 2L9RA 2R7WA 5LD2C 5IT9K 3IP4B 4XNFA 3DV8A 2NOJB 2X4HA 2OAZA 1R00A 2M4KA 1ZRFA 1PUEE 2M34A 3IAM2 4Y15A 2Z99A 5FO5A 3BTIA 3SDGA 2GAUA 3BWGA 4P9UA 2D1VA 2IS4A 5LGUA 3CMMA 5GAGJ 2HDWA 4WF2A 3WTSC 1FC3A 1WI3A 2Q8KA 4CCKA 1N77A 4PJJA 1OR7C 3HRUA 2YPRA 2O8XA 2XAQA 2FNAA 2O5RA 1KQ9A 4Q5SF 2X51A 2VE9A 5KVRA 4ENJA 1DP7P 2FSWA 4BACA 2JA5J 1A36A 2E2JJ 1BR2A 2GOMA 3OY9A 1TL8A 1J0RA 4PSXA 5E3NA 1WRJA 4BE1A 3HXLA 3PO3J 2DA4A 4HF0A 3K70D 3WGIA 2HVSA 1GV5A 3F6VA 4JK1X 2OZ6A 5K5RA 4GGGA 1X1PA 1BL0A 1IJWC 2A05A 2LF7A 3K69A 3N4MA 2AXTC 2E19A 2NS8A 1Y0UA 4MFDA 3FXOA 2GIVA 2AHQA 3IV5A 3IWZA 3CMYA 1AKHB 3GZ5A 3DFGA 4MTDA 4UB6C 3D5LA 1EV7A 1IV6A 3F0CA 3VYSB 5GAEJ 1RESA 4HYEA 1GVJA 3BLYA 2ZFUA 2NYXA 3HUGB 2DMQA 4LLLA 1ZG5A 2CUJA 1V55H 2JT1A 2E2HJ 2FD5A 1KZHA 3S14J 3DP7A 4BQNA 3H3VK 2CQNA 3SZPA 1VQLI 2K86A 1TT5B 1ERDA 5F64A 3FXLA 3R61A 3K4NA 3K70C 1UFMA 1RNLA 4KT6A 2E1CA 3ABMH 1T38A 2MSYA 3Q9VA 3FXRA 1OKRA 3KZYA 4N4OB 4A3MJ 2RNGA 3JRCA 1YFHA 2CQKA 2VBZA 3RTRA 2L4MA 3RZOJ 4XONA 3FF5A 2LY2A 2OF7A 4L0YB 2FU4A 2A07F 3GO5A 4IHSA 4CYCA 1U5TA 4B43A 1BBYA 1HW5A 5DCMB 2Q2EA 3FXKA 3LA2A 4DNCA 1HC8A 1HQCA 3VYRB 1RI7A 2IS2A 2G0EA 3K4BA 2R7SA 4M9XA 1LDJA 1FJLA 3GMEA 1VQ7I 2E2IJ 1MNMC 4G9YA 2X9DA 1H88C 4ZTFA 1IXRC 3KP5A 1OCCH 2EZIA 2RN7A 2Y30A 5J1RA 3OOUA 2NVUB 1JHFA 2OZUA 4CICA 4X0GA 2M0CA 4AIJA 4LG0B 4JYKA 2VJJA 2JMWA 4AD9A 4A6DA 4M3GA 5J8FA 3EYIA 4HLYA 2HOSA 1M1EB 5L3CA 1T0FA 4G6QA 2V6EA 1HCRA 3CCUI 3SYTA 3TO6A 3PFYA 2ECCA 2JA7J 1YJWI 5LHGA 2MC3A 2D2WA 2P6TA 3U21A 1BI2A 2G7HA 3E5UA 4BEHB 4N9IA 1MBGA 2FUG2 2QYOA 2VT3A 4Y4RA 2DFEA 3LSRA 3F8CA 4F91B 2K85A 2EFWA 1YOVB 3E0JB 1UAAA 2L7FP 3RKXA 2PMUA 2HZTA 3KZZA 2RQPA 1BM9A 5TGTA 3JRFA 3DPTA 4BQQA 4DBQA 3HPGA 1EH8A 2HR3A 2XAGA 2NOGA 1TNTA 3K4KA 3MKZA 1H0MA 1WH7A 2QVOA 2EZLA 2RDPA 3TEDA 2AQFA 2NS0A 5JR3A 1F5TA 2RC4A 4Q48A 1AA7A 2M87A 3M3YJ 3K0LA 1ON1A 3SZGA 1WPKA 4GYGA 2VBXA 2DO7A 2WAEA 5CVVA 4XLCA 4XK4A 1J09A 3W2VA 2I10A 4YRVA 2KDZA 2MLGA 3HEFA 2BBYA 2KZVA 4X1EA 5IP7J 2JA8J 1WJCA 2BZTA 2Y2ZA 3R4KA 2R7OA 3H5NA 5D4SA 4P55A 5DCFA 1MZBA 2DW4A 4PGHA 4I2OA 2VB6A 1JHHA 1D0XA 3IH2A 3COAC 1V54H 3K2AA 4F52A 4AVZA 3LMMA 1HW1A 4HPQA 4JQFA 2PN6A 4LK0F 5J47A 4MQ9F 3CLQA 3W2WA 5FLXZ 1OQYA 1X2MA 2EA4A 3E7LA 3R0JA 4FQGA 5KCMA 4GDFA 3AG4H 2GLOA 1HDPA 1R36A 3HSFA 2DMTA 3CP8A 5J40A 4D9JA 2OU2A 2Y9ZA 1OMIA 2K9LA 2MC4A 2H1LA 4P5OA 5M5WJ 1OCRH 4EV0A 1POGA 1SANA 5K7FA 3OYKA 5DTDA 4BNCA 5E1XA 1I3AA 3LAJA 4II2A 1J75A 1FYLA 4N4NB 3BPVA 2OC6A 2ZCWA 4PJMA 1X1AA 3BZKA 4A3KJ 2LTPA 4HX8A 2PJRB 3H36A 2K5CA 2DLLA 1WFXA 3KEYA 4XLNF 2HGCA 4FCYA 4BHBA 2KIUA 3PL8A 3V7SA 1D8KA 2IA0A 3B6CA 5AIPA 2BW3A 5EJCA 3CMEI 1IUFA 1MH4A 1BIBA 1A6QA 2AO9A 2Y0SN 5DM7F 3FDYA 2M45A 4MFEA 5J4VA 2XRLA 1QQIA 3CMAI 2GXAA 1BI3A 5M5YJ 3OMYA 2HI3A 3S2WA 1N25A 2IT0A 2LRDA 1ULYA 2QSHX 2BY3A 2Z33A 1X2NA 2E1MC 1ZHFA 1NG7A 3GF2A 3DXJF 3GZNB 4GYIA 1C0WA 4L5JA 1R71A 2ZNZA 2DYSH 3BJ6A 3I58A 2O8KA 3FBIB 4XLPF 2B63J 4IOAF 5E1ZB 1VQMI 3M1CA 1F9NA 4UUSB 3LQQA 1EF4A 1U3EM 4S05A 2KL4A 3H9QA 4HSRA 3WHBA 2VLAA 2Q0OA 3D0SA 3I56I 2GQQA 4XRSA 5DYMA 3MZ8A 2ID6A 5B5EC 1V3FA 4ANJA 1U5TC 3DKWA 2R5ZA 2ELJA 4CCJA 3DCFA 4IVNA 5EGOB 3ZMVA 4I99C 3GYHX 4CXFA 2DA5A 6PAXA 1FTZA 1V5FA 1W5SA 2KIFA 2BVMA 4IL6C 5FRMA 3V42A 4ZYEA 2CH0A 3L2WA 5LRSA 2ZSIB 1Y0NA 2XPUA 1WCMJ 1QPMA 1CF7B 4ESJA 2VQLA 4L5IA 4M74A 4AWXB 3WTUC 3S32A 2I5UA 5BNGA 5K7ZA 3AAFA 2ISYA 2FOWA 3L1PA 1QVUA 2ZFWA 3I3LA 1DU0A 2HS5A 4UXNA 2A6HF 2W4SA 1AWCA 2GXBA 4D7MA 2DK5A 4CO8A 4XKWA 4XN0A 4YFXF 4RB0A 3CCEI 1ITYA 1TLHB 1JKRC 4R79A 3V8JA 2EPFA 3GTKJ 2Z1DA 4E7KA 3PQJA 3V8KA 3BR0A 3OV8A 4EJWA 2X0LA 3P5JA 1OYWA 1LE8B 3M9AA 5TJJA 1WJEA 1G3WA 1SVLA 3T5XA 4G7OF 1ETXA 4FTHA 3RYRA 3J80Z 2DFIA 1FTTA 3GLLA 4LB6B 3K1MA 3G71I 2DA1A 3CLOA 5C44J 3ABKH 3HIFA 4WXHA 4WCGA 3LWFA 4MO7A 1ENHA 1K6YA 2KHMA 1IAWA 4DW6A 2H09A 2DOEA 2ZBKA 3MKLA 4XM3A 2X1EA 4I0BA 1YW7A 1E0EA 5FLMJ 1UHSA 2JWTA 3OSFA 4OAYA 3M4OJ 2BE5F 3WHCA 4WWCA 2VL8A 1QHHD 5D8LB 3P9CA 3TMOA 2F5DA 2FEZA 4CCLA 3J80K 2XB5A 4F7ZA 3LSPA 3W2AA 3ASOH 4RAYA 1SFOJ 1XGNA 1ZH5A 3CF2A 2Z3YA 2GXGA 4QPOA 1SFXA 5JLWA 3BR1A 3FWEA 1KQ8A 3E5QA 1MMSA 3FHZA 4UUVA 2OCCH 3IUOA 4DJAA 5ILVA 3CO7C 3BZ6A 1YITI 4WXCA 1XMKA 4UB8C 4M9ZA 4AIKA 3CCRI 2VJIA 4EM2A 4ZYAA 2BY2A 4KNYA 2XGEA 1RR7A 4MGRA 4V2FA 5CPRB 4U7BA 2JUGA 1GT0C 4CZZA 2FQ4A 1WJFA 1KA8A 3U9GA 3A02A 2W24A 1YW8A 2X6XA 4A5MA 3PFIA 2IJLA 4KIBA 2P4WA 4LG3A 2DA6A 2FMLA 2ZXWH 4YIFA 5A2QK 2V4JC 2X48A 3ULQB 3K4CA 2CW8A 4I0AA 3GTOJ 1JUPA 2M2EA 2UWMA 3QQAA 2HOTA 2P7CB 4MIMA 2F4OB 1S5LC 4GXOA 1X4OA 1CQTA 3M8FA 2C6YA 2ZSHB 3LSIA 1ETWA 2QBYA 2W1OA 3M7GA 2WB1A 2XDVA 4XIDA 3JRHA 4FT8A 4QIWN 5HLHA 3L2QA 4XKCA 4PJ0C 3E5XA 1O3SA 2DTZA 2KRFA 2PMHA 3GUDA 2QUFA 2ETHA 2QCOA 2H8RA 3TDZC 2VT2A 5FB2A 1LQ1A 3KYDB 4B48A 2L01A 4C3JJ 4AYBN 5HNFA 2F5EA 3ERMA 1WSUA 2O0YA 1ETQA 4J19A 3CUQA 1ZGWA 4M3EA 3NARA 2BVLA 3GCMA 5CKTA 3AL0C 2DA7A 2HOEA 2Z16A 3JRIA 2F2EA 1G6NA 2Z5UA 2JVGA 4LIUA 2XASA 4HDVA 2YX7A 1SMYF 3I71A 3LA7A 3M1EA 4E7SA 1HDDC 1Z91A 3ZCOA 2STWA 2JA2A 2H27A 1FWZA 3GZ6A 1ACIA 1VI0A 1G3SA 1R4MB 3S1MJ 3HGYA 2M30A 1Z77A 3L9FA 1E2XA 3QPHA 4N0BA 1J59A 2VN2A 3L2UA 5D8KB 5GPAA 2UZKA 1X3WB 2HXIA 3FM3A 3HDDA 3J7AO 2E7XA 1LEBA 3QU6A 2GZWA 2A68F 9ANTA 1E3OC 4IRHA 2XF5A 3E6BA 3GBGA 3JW4A 4L9NA 2VIXA 1MGTA 2EBIA 4O5VA 3CDIA 1LFBA 5K7HA 5DS9A 2VKEA 5F1RA 4BDYA 1YX5A 4CA0A 1HSTA 2EQRA 3JCUC 1EH6A 3KX2A 3FX3A 4H4KC 4G94A 5HLTA 2G9WA 5J1UA 2RKHA 5IOZA 5FKKA 2FRHA 4A3FJ 3A2KA 3DLAA 3S8PA 4DYRA 1AHDP 4A3JJ 1R49A 3FKIJ 2EZKA 3K10A 3MKWB 5DEQA 3HSRA 5FLVA 2A3SA 2V1NA 3BTCA 2E35A 3WU2C 1AKHA 4D5FA 3VWBA 2R7TA 4FISA 2HDCA 4B1RA 1I5ZA 2ECBA 2E60A 3EUAA 1PP8F 1DP3A 2F5VA 2VBWA 3QOPA 4OAZA 3HUGA 3KP2A 5JI6A 3J7YJ 2A61A 5GPCA 2WAQA 3PNVA 3TP0A 4UHTA 4LB5A 4ZDOA 4EJVA 4HNVA 3VYTB 1JTYA 1XC5A 3QPTA 1APLC 3K4JA 4XMYA 2EIKH 1TQIA 3BG7A 1XMAA 4XOTA 1B59A 3IH3A 4R8HA 2WA0A 4RAZA 2BOLA 3JRBA 4AC0A 1KU7A 5L3DA 1AU7A 1LDDA 1W36D 5H6QA 1LFUP 4BKXA 4I02A 2TDXA 1Y8RB 2FMYA 4BJTA 4UY8I 2BHZA 3GTGJ 1D1BA 1EJ9A 4NQWB 3BZCA 4LK1F 3IRRA 1LB2A 2JUCA 3MAJA 3GX4X 5IT9Z 5E3OA 2VOOA 4I6ZA 1J2XA 2ISZA 3WU1B 5DCMA 3AFHA 1EKEA 1FEXA 4RS8A 3VFZA 4RAFA 3GFLA 4ESBA 1N75A 3C2HA 2IP2A 1BI0A 4XRFA 1FYKA 5IY5H 4AIDA 3ZGKA 1FOXA 1XX5A 1SD5A 2DU9A 2EA2A 2IS1A 1ZGJA 4Y52J 3OS1A 1PJRA 4JX4A 2DN0A 3FHNA 3ZRGA 3BR2A 3F9KA 4LG0A 3OYJA 2Z2SB 2K27A 3W6VA 2E5NA 2Y9YA 2VASA 1CGPA 4CUGA 3BG3A 1YI2I 3ZQ7A 3HTUA 1WWXA 4BQOA 4ASNA 1XCVA 1W7PB 4IF4A 4XKVA 5IP6A 1V5GA 1B6AA 4HNUA 4IO9F 2RVCA 1XDSA 2HVQA 5GTHC 4LJZF 1P4WA 1UHWA 3Q3SA 3L2VA 5JFRA 2CQ7A 2WTEA 4PZJA 3E6MA 2PBIA 2EIJH 3CUQC 5E8IA 2ZXJA 3I4PA 2ESNA 1SEUA 3IHUA 3KEQA 4FE4A 3RDIA 3CF5F 3V8LA 5L3EA 3RZDJ 3VSLA 4A3CJ 5JVTA 2XAHA 4Y17A 3I64A 2XROA 2ZMEA 4XL9A 2KIQA 1JT6A 1JTXA 3OS0A 2K4BA 4RA2A 3EUHA 1MIJA 2QF7A 1ZR4A 5L3FA 2A69F 2QSFX 4A5NA 3O6BB 4RGSA 3I53A 1MSEC 4CYDA 3RYPA 1VQ5I 2JN6A 3ZMUA 5F0FA 4LLGF 3O8GA 4RM3A 4QPQA 1B72B 1LNWA 3S1RJ 1SAXA 3DQVC 2CUFA 4Q4ZF 2F48A 1F1ZA 1R5HA 3A4CA 5F04A 5E8GA 5DUIA 1LFPA 1HW2A 3OYFA 2UXXA 2WAQN 2XSDC 2WV0A 2E36A 3DTEA 1VF9A 4EGYA 1QVTA 3TOBA 2HXOA 2BXZA 4I09A 1Z7LA 3LA3A 1JUMA 3OL3A 3OSGA 1P4AA 1WH5A 3FZVA 2CFOA 4N9HA 1BC7C 3QPSA 3RKYA 3TQNA 5CJ9A 3LNQA 2IRFG 2HQNA 2XAJA 4L9TA 3ZQHA 4UVCA 1RC9A 3LSJA 4RLFA 4AIHA 1HBXG 4EJOA 2XKOA 1OCTC 2LDUA 4MEXF 5IT3A 5IYDJ 2CS3A 3DKYA 5GTIC 2P5KA 4CHUA 1NK3P 3CDHA 2MH9A 1SFUA 1IZ1A 4RBOA 1IC8A 2IXSA 2F4IA 3WTWC 4BXFA 4NB5A 4L18B 5E20A 1MDMB 4CCMA 2XAUA 1QNTA 1IUYA 2MA3A 2PJRA 1B8IB 2RREA 3H3UA 2KRHA 4B4CA 1ZG1A 3QODA 3F23A 2QM3A 2K3PA 1YIOA 4A3BJ 2COBA 1YIJI 2DODA 3TO9A 4NUBA 1RRJA 5FGMA 1IG7A 4RM2A 1YJNI 3M07A 2NNYA 4A3DJ 3I4NJ 3E6CC 3BJOA 1F4KA 2YSRA 1O7FA 4FE7A 5J1YA 1U8BA 1WGXA 4XQFA 2OV7A 3P9IA 1GDTA 4MNUA 5IYCJ 2CGPA 4KJZA 4OIRF 1TC3C 1S7EA 4KYWA 2K9MA 1KYWA 1MH3A 1HSJA 3NEUA 3R60A 2R7XA 2P81A 1PDNC 5EZHA 4M3DA 2DXIA 3CCMI 2R0QC 3BJAA 4C2TA 5KHDA 1XD7A 5LEKA 2A5WA 4G6DA 5ICEA 1LUJB 5JHUA 4CGZA 1JKOC 1BW5A 3ECOA 5HLIA 2VXDA 2ZKZA 3WODF 2EB7A 2VQHA 5EGOA 2B7EA 1YYVA 5GAHJ 1P6RA 5DD4A 3W6KB 4KISA 3ELKA 3B02A 4PSWA 5IP9J 2RAEA 2VE8A 2XC7A 2TCTA 2OQGA 4LITA 5EF6A 1K79A 1G2HA 4C3IJ 3QOEA 3BROA 2EFNA 3HOXJ 1R1TA 5HODA 1T8IA 4HV5A 1TWGJ 3F8FA 2GA1A 3O2PE 5FFXA 4YELA 4DGWB 3MZYA 2F5FA 3U1KA 2B0LA 2XVCA 3V7CA 1T2KA 3ZOBA 2UUZA 1H9TA 5LFAA 1XSXA 4E7LA 2FA5A 4NC6A 1BJAA 1EH7A 3EYYA 5BPDA 4QWQA 3HZJA 3PNYA 5BQTA 1WZ2A 4XRMA 3EQLF 4IKFA 3VDXA 1ONVA 1YX3A 2PEXA 4EJUA 5EZGA 4CCOA 4BAYA 2K40A 4HG2A 4OINF 1FIAA 4D7NA 2ZXHA 3HRSA 3F22A 3A01B 2V7FA 2XSJC 2NVTJ 4RDUA 1X58A 1LE8A 1JUSA 3G73A 4H0EA 2ZMEC 2OCEA 2EH3A 1S9HA 1K4TA 2QWWA 3BC8A 4IHXA 4XR6A 3MKYB 2BV6A 3EUHC 4HQEA 1VQNI 2LOOA 2HQAA 2P7VB 5K5QA 2XGCA 1G4DA 5HDNA 3MN2A 4IRGA 2L9VA 1JE8A 4DYCA 3BTJA 4E7HA 2XRNA 1MD0A 1WHUA 2HKXA 3LSGA 1BJZA 3RQIA 3S3OA 3N05A 3FMRA 4AM3A 1WKMA 2ZJ2A 3MMYB 1BIAA 3A0HC 3GW2A 2VC1A 3DBHB 3IL2A 1VQPI 2KZGA 4XLFA 2ACJA 4G12A 2EFPA 1ZELA 2L3DA 3ZMTA 5D5VB 1BOAA 1MMNA 2L54A 4FHTA 3LQRA 1IV8A 2KDOA 2J5PA 3VPRA 4CSWA 5DDGA 3G6EI 4FASD 1UHMA 2H94A 1JKQC 2DPDA 3K2ZA 2L7MP 3PIPF 2VI6A 5M3MJ 4HNTA 1K78B 3PNTA 3MQ0A 2R93J 4ENMA 1T08B 1UJ8A 3LSTA 1RR8C 2HKOA 2KP6A 2KJBA 3I5UA 4A0YA 2BY0A 2DMPA 1V4RA 1U5TB 2OPTA 4G8XA 2ESHA 2VQCA 3DLLF 2HPMA 2J5OA 1WJ5A 2K9NA 2ME0A 1RZ4A 1XGOA 3L00A 3G4SI 3HRTA 2O61A 1I6HJ 2M1BA 3OR2C 4GFBA 4ENNA 1UCRA 2NNNA 2CRGA 3S1QJ 2M7BA 1ZG3A 4HQMA 1OCZH 2KFDA 2DA3A 4O3MA 3MVPA 1UMQA 2EIMH 4HF2A 2CW7A 2UXNA 4KT5C 5HVQC 4IHYA 1TWCJ 2UV1A 2LFBA 1HKQA 3WTYC 1O4XA 3VYUB 1U9NA 2ZXIA 4PCQA 1BR1A 3RKQA 4PGGA 2BXYA 3QRFF 5CVJA 2YR2A 3F8MA 5E3LA 3K7AJ 3TGNA 2KIMA 3D5RC 3KP4A 3HOZJ 4RMNA 1Y6IA 4FX4A 3G1MA 3QYBA 1MBHA 3ZMZA 3JAMZ 2LD5A 1T0FC 1MW7A 4BJ6C 2XUBA 4G7ZF 2DMNA 1IRFA 2R5YA 3J7AY 1D0ZA 2H6BA 2YX4A 2CUEA 5CVRA 2JQ7A 1ZRCA 3NRVA 3VODA 5D6FA 4E70A 2LVSA 2DOAA 2R92J 5FROA 1QO0D 5JVGF 2EV5A
chains in the Genus database with same CATH topology
1MJ9A 2QLZA 1S8NA 2M8EA 5CLSA 2CFXA 4EM0B 1FT9A 3JAMK 1R22A 3SXYA 2V6CA 4UVBA 2CO5A 2MBFA 3HTSB 3IC7A 2XAFA 1S29A 1STZA 2O3FA 2OA4A 5CYVA 3F8BA 2HTJA 1B9MA 4HX7A 3KETA 1XSDA 4I98B 2D1HA 4XBFA 3I54A 4OU0A 1R58A 2M5WA 5A2QZ 1KQ0A 2MD5A 4L0ZB 3MCZA 4RB2C 4OIPF 1U2WA 2XV4S 1K7AA 3PQKA 2DT5A 1LJ9A 4BH9A 4KICA 1FSEA 2EK5A 3Q5FA 4A6EA 1TQMA 4JBAA 2DQRA 1XGSA 2V1DA 2O6GE 4DQ2A 1B4AA 1IN4A 5BMZA 3MWMA 2ZNYA 3GVAA 3WTZA 4HA8A 1LDKB 5HDKA 4IPAA 1S7OA 3BOQA 2MH2A 2LNBA 1Z05A 3ZMSA 4EQQA 2Y48A 2COMA 5K1YA 2CG4A 1ZLJA 4U0VA 4A0XA 4AVPA 1P2FA 3ABTA 3WE2A 4U7DA 2VXZA 2DK8A 1KU9A 2DPUA 3TO7A 1ZREA 5D5WB 3VB2A 2AS5F 2FBIA 5D6EA 1FX7A 2W57A 4WXDA 5FFZA 1OR7A 3WGHA 2P5VA 1U8RA 1W7PA 3TDUC 1GXQA 4PDKA 3V4GA 1IN8A 2IPQX 1NHAA 3E6DA 1YTYA 2FE3A 1ODDA 4MHGA 2PJPA 2Y75A 1GXPA 1FY7A 2WWYA 5L3GA 1IXSB 1USSA 2HTSA 1ZN2A 4ZYHA 4OMZA 3DEUA 1B9NA 3MFKA 3WTTC 5LEJA 3B73A 1LVAA 2KJCA 3P7NA 1T6SA 1QGPA 1D3YA 2CW0F 2KKOA 1B1BA 3FMSA 3BP8A 3ZN1A 1XN7A 1TNSA 2G7UA 1RUNA 3P9KA 2FXAA 3H92A 3CTAA 2FQ3A 3H3ZA 5FD6A 5LLQA 3I59B 2XKPA 3EETA 5ICFA 2HYGD 2HQRA 4YFNF 3K1NA 1Z1DA 2BYVE 1DPUA 2DAOA 5DUKA 2ADUA 3HSEA 4O6JA 3HOTA 4RGRA 1KGSA 4EVIA 3V7RA 1R7JA 3J81K 2K7LA 5HLGA 1AOYA 3ML6A 1MDMA 1FZPB 4U0YA 4OMYA 2DTRA 5ICGA 3KFWX 2R7FA 3WTXC 2RV8A 4IJAA 4XSZF 2PQ8A 3K9TA 1SD4A 5ERIA 3DF8A 3TKYA 3F6OA 4KMUX 1WQ2A 4KDPA 2HFHA 4YG2F 5HS9A 3WTVC 1OYIA 5HDGA 1XSVA 4RB1A 1W7PD 4IHTA 5FD5A 4ETSA 2A5YB 1HXDA 2VONA 1O3QA 4P9FA 2R7DA 2CWEA 4KIGA 2STTA 4OIOF 4RGUA 1DPRA 4BHPA 3O3KA 3KEOA 2IW5A 4IRIA 2PFBA 1ZGAA 2W25A 2VOPA 1HKTA 3W6JB 1D5VA 4IXAA 2PG4A 4CDGA 4BHCA 1REPC 4A0ZA 5D5UB 1J7KA 4HLXA 4M9SA 4S04A 3VEPA 3NQOA 3WGGA 1IF1A 1OPCA 1ZLKA 5L3BA 1MJAA 3MZHA 2LSOA 2VODA 3ECHA 5LHIA 2PLYA 1I6XA 1G3TA 3JSPA 4GO1A 4MQVA 4TV7A 5KK1A 2V9VA 2W85A 1O7LA 3RI4A 3BPXA 1BN5A 4KMFA 3I0TA 2EFOA 2CSOA 1I1SA 3GFIA 3ROUA 2FF4A 3FXUA 4UV8A 4LD5A 5TRDA 1O3TA 4A12A 2V79A 4KN4X 3GFMA 4QLCU 3GXOA 5DV5A 1K78A 2XGXA 1OYYA 2XHKA 5AIQA 2JSCA 2NRAC 5HS7A 3U1DA 3C7JA 2WC2A 1KU2A 1O3RA 3KLNA 4B09A 2Z9OA 4G7HF 4Z2YA 3QU3A 2E1NA 1S7AA 2CYYA 4ESFA 3JTHA 3CO6C 1KYZA 1XGMA 2P5LC 1R1UA 3GEZA 4OOIA 1VTNC 3KP3A 3OOPA 4RB3C 1YO5C 1MKMA 4M6YA 3IKTA 4M6XA 1CF7A 1QBJA 1S6LA 3F3XA 4EMSA 3U2RA 3SQNA 1L0OC 4ZYGA 1QZZA 2O03A 4K2EA 5BPIA 1TW2A 2P6SA 2ZMEB 1D8JA 1FBQA 3FM5A 4EJTA 3R0AA 1YW9A 5LGNA 2GA2A 3QAHA 3HYIA 3GLXA 1FLIA 5EEHA 1I1GA 2JPBA 3F8NA 5E1WA 1YLFA 1PP7U 1BC8C 1X3UA 2AXLA 2EFQA 3WE3A 3K1PA 3WG9A 5LRRA 1IW7F 2QENA 1T98A 3QP5A 3ZPLA 4HDUA 2E7WA 2H6CA 4YFKF 4ZYDA 4OIQF 3L2CA 4M71A 2OBPA 3DPLC 1UB9A 3HRMA 5E18F 2JZYA 5AONA 1IN7A 2OD5A 3VOEA 1KU3A 5FLXK 1R1VA 1E17A 1WI9A 4BQAA 1FNNA 3L09A 4KA4A 3IRQA 2IVMA 2F5CA 1ON2A 3HOSA 3T0YA 1RIOH 4MEYF 4RGXA 5E17F 3JTGA 2ELHA 1TBXA 3RPUA 4WK8F 2A6EF 4KFCA 1XB4A 3F21A 1FBUA 1IRGA 2K4JA 2EJRA 5LGTA 2NAZA 2BEOA 3KE2A 3EDPA 5F6FA 1YQAA 3LAPA 3RIRA 2R3SA 3REOA 5LBQA 2V1XA 3CUOA 1JGSA 4D0PA 2QZ8A 1Z6RA 3ZN0A 1R5GA 3SZTA 3E97A 1Z7UA 4HAMA 4U0WA 1USTA 3TOAA 4HF1A 2PI0A 1MJBA 3KLOA 5BOXA 1IN5A 3G3ZA 5BS6A 4KN7X 1W5TA 2D45A 1U78A 2FNPA 3MEXA 2RNJA 4R1HA 1QZYA 1FPQA 4Y13A 2YU3A 3ERED 1FYMA 4WX9A 4UV9A 2IA2A 1ZRDA 5LHHA 3BDDA 2HEOA 3C1DA 2QQBA 2OQRA 4U88A 4LMYA 3SHFA 3SFZA 5HS8A 1RUOA 2L02A 3IWFA 4MTEA 1H9GA 2EV0A 1YS7A 1IXCA 2FBHA 1Q1HA 2XIGA 5EEGA 1O57A 3GWZA 4L9VA 3ABUA 3WU0A 5CVUA 4YIIA 1FP1D 1XCBA 3I59A 3JSOA 5K5OA 1FSHA 4HOBA 3BY6A 1BI1A 3CJNA 2ZO4A 4P96A 1J9IA 3LFKA 2HWVA 1P92A 4NQWA 4UNOA 2IA1A 1ZARA 3ZP5A 1J5YA 4L9JA 1ZAOA 1SMTA 4EM1A 3HHGA 4BYYA 1LEAA 1K6OA 1P4XA 5J8CA 4XSXF 3F72A 3T8TA 3ZMDA 4NHJA 4HW0A 1DDNA 3C3WA 1IN6A 3IKVA 5J6XA 1L3LA 5ILUA 4UVAA 4ENKA 1SD6A 1HKSA 1Z9CA 4BXUA 4KUMA 5H6RA 2DI3A 2Y0MA 1T39A 2JRTA 2RGVA 2DQLA 2W84A 4EGZA 4B8XA 1TQPA 4HX4A 4I01A 1G3YA 3Q9SA 4KIFA 3T8RA 3RPQA 5ICCA 2EV6A 3M8EA 1I27A 2GWRA 2QQAA 1GHCA 4Q47A 2BGCA 4HBLA 2LF8A 5H20A 2MLKA 4ZH4F 3R6SA 4HZFA 2FBKA 2VC0A 4ON0A 4LGWA 2K02A 3J81Z 3GFJA 1SD7A 3ISPA 1SFEA 3HHHA 3KP6A 5ILSA 3RKWA 1Z6TA 4A2UA 2JTVA 1TTYA 3RJPA 2L4AA 1A04A 4ZZDA 1W4MA 4M73A 1FOKA 4LLNA 1ZYRF 2LKPA 3FXQA 4HV6A 5D4RA 5HOOA 2QQ9A 2QBYB 3C18A 4ZZLA 4FX0A 4M72A 5ED4A 1YG2A 2JPCA 4LFUA 5D5XB 3L7WA 1U6GA 3KCCA 3FMQA 1S3JA 2EWNA 2FOKA 3CUQB 5CVIA 2HYFA 2VBYA 2DBBA 1YS6A 3T1BA 1DUXC 5DD8A 1TW3A 2P8TA 1FBSA 3N97A 3E3VA 1FP2A 1R23A 1JXSA 2V1UA 4GCVA 3KP7A 4I7HA 3QP6A 1XDUA 5IT9K 3DV8A 2X4HA 2OAZA 1R00A 1ZRFA 1PUEE 4Y15A 2Z99A 5FO5A 2GAUA 3BWGA 4P9UA 2D1VA 5LGUA 4WF2A 3WTSC 1FC3A 2Q8KA 3HRUA 2YPRA 2O8XA 2XAQA 2FNAA 1KQ9A 4Q5SF 2VE9A 5KVRA 4ENJA 1DP7P 2FSWA 1J0RA 1WRJA 4HF0A 3WGIA 3F6VA 4JK1X 2OZ6A 5K5RA 4GGGA 2LF7A 3K69A 3N4MA 1Y0UA 2GIVA 3IWZA 3GZ5A 3DFGA 4MTDA 3D5LA 1EV7A 4HYEA 1GVJA 2NYXA 4LLLA 1ZG5A 2JT1A 3DP7A 3SZPA 2K86A 5F64A 3R61A 1UFMA 1RNLA 2E1CA 1T38A 3Q9VA 3FXRA 1OKRA 3KZYA 1YFHA 2CQKA 2VBZA 3RTRA 2L4MA 3FF5A 4L0YB 2FU4A 2A07F 3GO5A 4IHSA 1U5TA 1BBYA 1HW5A 5DCMB 2Q2EA 3LA2A 4DNCA 1HQCA 1RI7A 4M9XA 1LDJA 4G9YA 1IXRC 3KP5A 2RN7A 1JHFA 2OZUA 4CICA 4AIJA 4LG0B 4AD9A 4A6DA 5J8FA 3EYIA 4HLYA 5L3CA 1T0FA 4G6QA 3TO6A 5LHGA 2MC3A 2D2WA 2P6TA 1BI2A 2G7HA 3E5UA 4N9IA 2QYOA 2VT3A 3F8CA 2EFWA 3RKXA 2PMUA 2HZTA 3KZZA 2RQPA 1BM9A 3DPTA 1EH8A 2HR3A 2XAGA 1TNTA 1H0MA 2QVOA 2RDPA 2NS0A 5JR3A 1F5TA 2RC4A 4Q48A 2M87A 3K0LA 1ON1A 4GYGA 2VBXA 2DO7A 5CVVA 2MLGA 2BBYA 3R4KA 5D4SA 4P55A 5DCFA 1MZBA 2DW4A 4PGHA 4I2OA 1JHHA 3COAC 4JQFA 1HW1A 2PN6A 4LK0F 4MQ9F 5FLXZ 3R0JA 2EA4A 1R36A 3HSFA 2OU2A 1OMIA 4P5OA 4EV0A 4BNCA 5E1XA 3LAJA 1J75A 1FYLA 3BPVA 2ZCWA 4HX8A 2DLLA 4XLNF 2HGCA 4BHBA 2KIUA 3V7SA 1D8KA 2IA0A 5AIPA 1BIBA 2M45A 1QQIA 1BI3A 3S2WA 2IT0A 1ULYA 2Z33A 4GYIA 1ZHFA 3GF2A 3DXJF 1C0WA 4L5JA 2ZNZA 3BJ6A 3I58A 4XLPF 5E1ZB 1F9NA 3LQQA 1U3EM 4S05A 2Q0OA 3D0SA 2GQQA 5DYMA 1V3FA 1U5TC 3DKWA 4IVNA 3ZMVA 3GYHX 4CXFA 6PAXA 1W5SA 2KIFA 4ZYEA 5LRSA 1QPMA 1CF7B 4ESJA 4L5IA 4M74A 4AWXB 3WTUC 3AAFA 2ISYA 2ZFWA 2HS5A 4UXNA 2A6HF 1AWCA 2GXBA 2DK5A 4CO8A 4YFXF 4RB0A 1TLHB 4R79A 3V8JA 3PQJA 3V8KA 3OV8A 4EJWA 2X0LA 1OYWA 3M9AA 5TJJA 1G3WA 3T5XA 4G7OF 3RYRA 3J80Z 2DFIA 4LB6B 3K1MA 3CLOA 4WCGA 3HIFA 4WXHA 3LWFA 1IAWA 2H09A 2ZBKA 4I0BA 1YW7A 2BE5F 4WWCA 5D8LB 3P9CA 2F5DA 2FEZA 3J80K 4F7ZA 4RAYA 1XGNA 1ZH5A 2Z3YA 2GXGA 1SFXA 3FWEA 1KQ8A 3E5QA 3FHZA 4UUVA 5ILVA 3CO7C 3BZ6A 4WXCA 1XMKA 4M9ZA 4AIKA 4EM2A 4KNYA 4MGRA 4U7BA 4CZZA 1KA8A 3U9GA 4A5MA 2W24A 1YW8A 3PFIA 2IJLA 4KIBA 2P4WA 2FMLA 4YIFA 5A2QK 3ULQB 4I0AA 2UWMA 2P7CB 4GXOA 3M8FA 2C6YA 2QBYA 3M7GA 4FT8A 5HLHA 3E5XA 1O3SA 2KRFA 2PMHA 3GUDA 2QUFA 2ETHA 3TDZC 2VT2A 5FB2A 1LQ1A 2L01A 2F5EA 1WSUA 2O0YA 3CUQA 2HOEA 2F2EA 1G6NA 2Z5UA 2XASA 4HDVA 2YX7A 1SMYF 3I71A 3LA7A 3M1EA 1Z91A 2STWA 2H27A 1FWZA 3GZ6A 1G3SA 2M30A 3L9FA 3QPHA 1E2XA 4N0BA 1J59A 2VN2A 5D8KB 2UZKA 3FM3A 3J7AO 2E7XA 1LEBA 3QU6A 2GZWA 2A68F 4IRHA 3E6BA 3JW4A 4L9NA 1MGTA 4O5VA 5F1RA 1HSTA 1EH6A 3FX3A 4G94A 2G9WA 2RKHA 2FRHA 5DEQA 3HSRA 2A3SA 2HDCA 1I5ZA 1PP8F 2VBWA 3QOPA 3HUGA 3KP2A 5JI6A 2A61A 4UHTA 4LB5A 4EJVA 3QPTA 1TQIA 1XMAA 1B59A 4R8HA 4RAZA 1KU7A 5L3DA 1LDDA 5H6QA 4I02A 2TDXA 2FMYA 4LK1F 3IRRA 1LB2A 3MAJA 3GX4X 5IT9Z 2VOOA 1J2XA 2ISZA 3WU1B 5DCMA 4RS8A 3VFZA 3GFLA 4ESBA 2IP2A 1BI0A 4XRFA 1FYKA 1SD5A 2DU9A 2EA2A 1ZGJA 4LG0A 2K27A 1CGPA 3ZQ7A 3HTUA 1WWXA 4ASNA 1XCVA 1W7PB 4IF4A 1B6AA 2RVCA 1XDSA 4LJZF 1P4WA 1UHWA 5JFRA 4PZJA 2WTEA 3E6MA 2PBIA 3CUQC 5E8IA 2ZXJA 3I4PA 2ESNA 3IHUA 3KEQA 3RDIA 3V8LA 5L3EA 5JVTA 2XAHA 4Y17A 3I64A 2XROA 2ZMEA 2K4BA 3EUHA 5L3FA 2A69F 4A5NA 3O6BB 4RGSA 3I53A 4CYDA 3RYPA 3ZMUA 4LLGF 1LNWA 1SAXA 3DQVC 4Q4ZF 1F1ZA 1R5HA 5E8GA 5DUIA 1HW2A 2UXXA 2WV0A 4EGYA 3TOBA 4I09A 3LA3A 1P4AA 1BC7C 3FZVA 4N9HA 3RKYA 3TQNA 5CJ9A 2IRFG 2HQNA 2XAJA 4L9TA 4UVCA 4AIHA 1HBXG 4EJOA 2XKOA 2LDUA 4MEXF 5IT3A 2P5KA 4CHUA 3CDHA 2MH9A 1SFUA 1IZ1A 3WTWC 4NB5A 4L18B 5E20A 1MDMB 1QNTA 1IUYA 2MA3A 3H3UA 1ZG1A 3F23A 2QM3A 1YIOA 3TO9A 5FGMA 2NNYA 3E6CC 3BJOA 1F4KA 2YSRA 1O7FA 3P9IA 4MNUA 2CGPA 4OIRF 4KYWA 1KYWA 1HSJA 3NEUA 3R60A 1PDNC 3BJAA 1XD7A 5LEKA 4G6DA 5ICEA 5JHUA 4CGZA 3ECOA 5HLIA 2ZKZA 3WODF 2EB7A 1YYVA 1P6RA 5DD4A 3W6KB 3ELKA 3B02A 2VE8A 2OQGA 1K79A 3BROA 2EFNA 1R1TA 4HV5A 3F8FA 2GA1A 3O2PE 5FFXA 3MZYA 2F5FA 2B0LA 2XVCA 3V7CA 1T2KA 1H9TA 1XSXA 2FA5A 1BJAA 1EH7A 3EYYA 5BPDA 4QWQA 5BQTA 3EQLF 1ONVA 2PEXA 4EJUA 4BAYA 4OINF 3HRSA 3F22A 3G73A 4H0EA 2QWWA 4HQEA 2BV6A 2P7VB 5K5QA 1G4DA 5HDNA 4IRGA 1JE8A 2XRNA 1MD0A 2HKXA 3FMRA 1WKMA 2ZJ2A 1BIAA 3GW2A 2VC1A 2ACJA 3IL2A 2EFPA 2L3DA 3ZMTA 5D5VB 1BOAA 2L54A 4FHTA 3LQRA 2J5PA 5DDGA 1UHMA 2H94A 2DPDA 3K2ZA 1K78B 3MQ0A 4ENMA 3LSTA 2HKOA 3I5UA 2KJBA 4A0YA 1V4RA 1U5TB 4G8XA 2ESHA 2J5OA 3L00A 1RZ4A 1XGOA 3HRTA 2O61A 2M1BA 4ENNA 1UCRA 2NNNA 1ZG3A 4HQMA 4O3MA 4HF2A 2UXNA 4KT5C 5HVQC 1HKQA 3WTYC 4PCQA 4PGGA 3QRFF 5CVJA 2YR2A 3F8MA 3TGNA 2KIMA 3KP4A 4FX4A 3ZMZA 3JAMZ 2XUBA 4G7ZF 1IRFA 2H6BA 2YX4A 5CVRA 1ZRCA 3NRVA 3VODA 5D6FA 4E70A 1QO0D 2EV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ9 A;  2QLZ A;  1S8N A;  2M8E A;  5CLS A;  2CFX A;  4EM0 B;  1FT9 A;  3JAM K;  1R22 A;  3SXY A;  2V6C A;  4UVB A;  2CO5 A;  2MBF A;  3HTS B;  3IC7 A;  2XAF A;  1S29 A;  1STZ A;  2O3F A;  2OA4 A;  5CYV A;  3F8B A;  2HTJ A;  1B9M A;  4HX7 A;  3KET A;  1XSD A;  4I98 B;  2D1H A;  4XBF A;  3I54 A;  4OU0 A;  1R58 A;  2M5W A;  5A2Q Z;  1KQ0 A;  2MD5 A;  4L0Z B;  3MCZ A;  4RB2 C;  4OIP F;  1U2W A;  2XV4 S;  1K7A A;  3PQK A;  2DT5 A;  1LJ9 A;  4BH9 A;  4KIC A;  1FSE A;  2EK5 A;  3Q5F A;  4A6E A;  1TQM A;  4JBA A;  2DQR A;  1XGS A;  2V1D A;  2O6G E;  4DQ2 A;  1B4A A;  1IN4 A;  5BMZ A;  3MWM A;  2ZNY A;  3GVA A;  3WTZ A;  4HA8 A;  1LDK B;  5HDK A;  4IPA A;  1S7O A;  3BOQ A;  2MH2 A;  2LNB A;  1Z05 A;  3ZMS A;  4EQQ A;  2Y48 A;  2COM A;  5K1Y A;  2CG4 A;  1ZLJ A;  4U0V A;  4A0X A;  4AVP A;  1P2F A;  3ABT A;  3WE2 A;  4U7D A;  2VXZ A;  2DK8 A;  1KU9 A;  2DPU A;  3TO7 A;  1ZRE A;  5D5W B;  3VB2 A;  2AS5 F;  2FBI A;  5D6E A;  1FX7 A;  2W57 A;  4WXD A;  5FFZ A;  1OR7 A;  3WGH A;  2P5V A;  1U8R A;  1W7P A;  3TDU C;  1GXQ A;  4PDK A;  3V4G A;  1IN8 A;  2IPQ X;  1NHA A;  3E6D A;  1YTY A;  2FE3 A;  1ODD A;  4MHG A;  2PJP A;  2Y75 A;  1GXP A;  1FY7 A;  2WWY A;  5L3G A;  1IXS B;  1USS A;  2HTS A;  1ZN2 A;  4ZYH A;  4OMZ A;  3DEU A;  1B9N A;  3MFK A;  3WTT C;  5LEJ A;  3B73 A;  1LVA A;  2KJC A;  3P7N A;  1T6S A;  1QGP A;  1D3Y A;  2CW0 F;  2KKO A;  1B1B A;  3FMS A;  3BP8 A;  3ZN1 A;  1XN7 A;  1TNS A;  2G7U A;  1RUN A;  3P9K A;  2FXA A;  3H92 A;  3CTA A;  2FQ3 A;  3H3Z A;  5FD6 A;  5LLQ A;  3I59 B;  2XKP A;  3EET A;  5ICF A;  2HYG D;  2HQR A;  4YFN F;  3K1N A;  1Z1D A;  2BYV E;  1DPU A;  2DAO A;  5DUK A;  2ADU A;  3HSE A;  4O6J A;  3HOT A;  4RGR A;  1KGS A;  4EVI A;  3V7R A;  1R7J A;  3J81 K;  2K7L A;  5HLG A;  1AOY A;  3ML6 A;  1MDM A;  1FZP B;  4U0Y A;  4OMY A;  2DTR A;  5ICG A;  3KFW X;  2R7F A;  3WTX C;  2RV8 A;  4IJA A;  4XSZ F;  2PQ8 A;  3K9T A;  1SD4 A;  5ERI A;  3DF8 A;  3TKY A;  3F6O A;  4KMU X;  1WQ2 A;  4KDP A;  2HFH A;  4YG2 F;  5HS9 A;  3WTV C;  1OYI A;  5HDG A;  1XSV A;  4RB1 A;  1W7P D;  4IHT A;  5FD5 A;  4ETS A;  2A5Y B;  1HXD A;  2VON A;  1O3Q A;  4P9F A;  2R7D A;  2CWE A;  4KIG A;  2STT A;  4OIO F;  4RGU A;  1DPR A;  4BHP A;  3O3K A;  3KEO A;  2IW5 A;  4IRI A;  2PFB A;  1ZGA A;  2W25 A;  2VOP A;  1HKT A;  3W6J B;  1D5V A;  4IXA A;  2PG4 A;  4CDG A;  4BHC A;  1REP C;  4A0Z A;  5D5U B;  1J7K A;  4HLX A;  4M9S A;  4S04 A;  3VEP A;  3NQO A;  3WGG A;  1IF1 A;  1OPC A;  1ZLK A;  5L3B A;  1MJA A;  3MZH A;  2LSO A;  2VOD A;  3ECH A;  5LHI A;  2PLY A;  1I6X A;  1G3T A;  3JSP A;  4GO1 A;  4MQV A;  4TV7 A;  5KK1 A;  2V9V A;  2W85 A;  1O7L A;  3RI4 A;  3BPX A;  1BN5 A;  4KMF A;  3I0T A;  2EFO A;  2CSO A;  1I1S A;  3GFI A;  3ROU A;  2FF4 A;  3FXU A;  4UV8 A;  4LD5 A;  5TRD A;  1O3T A;  4A12 A;  2V79 A;  4KN4 X;  3GFM A;  4QLC U;  3GXO A;  5DV5 A;  1K78 A;  2XGX A;  1OYY A;  2XHK A;  5AIQ A;  2JSC A;  2NRA C;  5HS7 A;  3U1D A;  3C7J A;  2WC2 A;  1KU2 A;  1O3R A;  3KLN A;  4B09 A;  2Z9O A;  4G7H F;  4Z2Y A;  3QU3 A;  2E1N A;  1S7A A;  2CYY A;  4ESF A;  3JTH A;  3CO6 C;  1KYZ A;  1XGM A;  2P5L C;  1R1U A;  3GEZ A;  4OOI A;  1VTN C;  3KP3 A;  3OOP A;  4RB3 C;  1YO5 C;  1MKM A;  4M6Y A;  3IKT A;  4M6X A;  1CF7 A;  1QBJ A;  1S6L A;  3F3X A;  4EMS A;  3U2R A;  3SQN A;  1L0O C;  4ZYG A;  1QZZ A;  2O03 A;  4K2E A;  5BPI A;  1TW2 A;  2P6S A;  2ZME B;  1D8J A;  1FBQ A;  3FM5 A;  4EJT A;  3R0A A;  1YW9 A;  5LGN A;  2GA2 A;  3QAH A;  3HYI A;  3GLX A;  1FLI A;  5EEH A;  1I1G A;  2JPB A;  3F8N A;  5E1W A;  1YLF A;  1PP7 U;  1BC8 C;  1X3U A;  2AXL A;  2EFQ A;  3WE3 A;  3K1P A;  3WG9 A;  5LRR A;  1IW7 F;  2QEN A;  1T98 A;  3QP5 A;  3ZPL A;  4HDU A;  2E7W A;  2H6C A;  4YFK F;  4ZYD A;  4OIQ F;  3L2C A;  4M71 A;  2OBP A;  3DPL C;  1UB9 A;  3HRM A;  5E18 F;  2JZY A;  5AON A;  1IN7 A;  2OD5 A;  3VOE A;  1KU3 A;  5FLX K;  1R1V A;  1E17 A;  1WI9 A;  4BQA A;  1FNN A;  3L09 A;  4KA4 A;  3IRQ A;  2IVM A;  2F5C A;  1ON2 A;  3HOS A;  3T0Y A;  1RIO H;  4MEY F;  4RGX A;  5E17 F;  3JTG A;  2ELH A;  1TBX A;  3RPU A;  4WK8 F;  2A6E F;  4KFC A;  1XB4 A;  3F21 A;  1FBU A;  1IRG A;  2K4J A;  2EJR A;  5LGT A;  2NAZ A;  2BEO A;  3KE2 A;  3EDP A;  5F6F A;  1YQA A;  3LAP A;  3RIR A;  2R3S A;  3REO A;  5LBQ A;  2V1X A;  3CUO A;  1JGS A;  4D0P A;  2QZ8 A;  1Z6R A;  3ZN0 A;  1R5G A;  3SZT A;  3E97 A;  1Z7U A;  4HAM A;  4U0W A;  1UST A;  3TOA A;  4HF1 A;  2PI0 A;  1MJB A;  3KLO A;  5BOX A;  1IN5 A;  3G3Z A;  5BS6 A;  4KN7 X;  1W5T A;  2D45 A;  1U78 A;  2FNP A;  3MEX A;  2RNJ A;  4R1H A;  1QZY A;  1FPQ A;  4Y13 A;  2YU3 A;  3ERE D;  1FYM A;  4WX9 A;  4UV9 A;  2IA2 A;  1ZRD A;  5LHH A;  3BDD A;  2HEO A;  3C1D A;  2QQB A;  2OQR A;  4U88 A;  4LMY A;  3SHF A;  3SFZ A;  5HS8 A;  1RUO A;  2L02 A;  3IWF A;  4MTE A;  1H9G A;  2EV0 A;  1YS7 A;  1IXC A;  2FBH A;  1Q1H A;  2XIG A;  5EEG A;  1O57 A;  3GWZ A;  4L9V A;  3ABU A;  3WU0 A;  5CVU A;  4YII A;  1FP1 D;  1XCB A;  3I59 A;  3JSO A;  5K5O A;  1FSH A;  4HOB A;  3BY6 A;  1BI1 A;  3CJN A;  2ZO4 A;  4P96 A;  1J9I A;  3LFK A;  2HWV A;  1P92 A;  4NQW A;  4UNO A;  2IA1 A;  1ZAR A;  3ZP5 A;  1J5Y A;  4L9J A;  1ZAO A;  1SMT A;  4EM1 A;  3HHG A;  4BYY A;  1LEA A;  1K6O A;  1P4X A;  5J8C A;  4XSX F;  3F72 A;  3T8T A;  3ZMD A;  4NHJ A;  4HW0 A;  1DDN A;  3C3W A;  1IN6 A;  3IKV A;  5J6X A;  1L3L A;  5ILU A;  4UVA A;  4ENK A;  1SD6 A;  1HKS A;  1Z9C A;  4BXU A;  4KUM A;  5H6R A;  2DI3 A;  2Y0M A;  1T39 A;  2JRT A;  2RGV A;  2DQL A;  2W84 A;  4EGZ A;  4B8X A;  1TQP A;  4HX4 A;  4I01 A;  1G3Y A;  3Q9S A;  4KIF A;  3T8R A;  3RPQ A;  5ICC A;  2EV6 A;  3M8E A;  1I27 A;  2GWR A;  2QQA A;  1GHC A;  4Q47 A;  2BGC A;  4HBL A;  2LF8 A;  5H20 A;  2MLK A;  4ZH4 F;  3R6S A;  4HZF A;  2FBK A;  2VC0 A;  4ON0 A;  4LGW A;  2K02 A;  3J81 Z;  3GFJ A;  1SD7 A;  3ISP A;  1SFE A;  3HHH A;  3KP6 A;  5ILS A;  3RKW A;  1Z6T A;  4A2U A;  2JTV A;  1TTY A;  3RJP A;  2L4A A;  1A04 A;  4ZZD A;  1W4M A;  4M73 A;  1FOK A;  4LLN A;  1ZYR F;  2LKP A;  3FXQ A;  4HV6 A;  5D4R A;  5HOO A;  2QQ9 A;  2QBY B;  3C18 A;  4ZZL A;  4FX0 A;  4M72 A;  5ED4 A;  1YG2 A;  2JPC A;  4LFU A;  5D5X B;  3L7W A;  1U6G A;  3KCC A;  3FMQ A;  1S3J A;  2EWN A;  2FOK A;  3CUQ B;  5CVI A;  2HYF A;  2VBY A;  2DBB A;  1YS6 A;  3T1B A;  1DUX C;  5DD8 A;  1TW3 A;  2P8T A;  1FBS A;  3N97 A;  3E3V A;  1FP2 A;  1R23 A;  1JXS A;  2V1U A;  4GCV A;  3KP7 A;  4I7H A;  3QP6 A;  1XDU A;  5IT9 K;  3DV8 A;  2X4H A;  2OAZ A;  1R00 A;  1ZRF A;  1PUE E;  4Y15 A;  2Z99 A;  5FO5 A;  2GAU A;  3BWG A;  4P9U A;  2D1V A;  5LGU A;  4WF2 A;  3WTS C;  1FC3 A;  2Q8K A;  3HRU A;  2YPR A;  2O8X A;  2XAQ A;  2FNA A;  1KQ9 A;  4Q5S F;  2VE9 A;  5KVR A;  4ENJ A;  1DP7 P;  2FSW A;  1J0R A;  1WRJ A;  4HF0 A;  3WGI A;  3F6V A;  4JK1 X;  2OZ6 A;  5K5R A;  4GGG A;  2LF7 A;  3K69 A;  3N4M A;  1Y0U A;  2GIV A;  3IWZ A;  3GZ5 A;  3DFG A;  4MTD A;  3D5L A;  1EV7 A;  4HYE A;  1GVJ A;  2NYX A;  4LLL A;  1ZG5 A;  2JT1 A;  3DP7 A;  3SZP A;  2K86 A;  5F64 A;  3R61 A;  1UFM A;  1RNL A;  2E1C A;  1T38 A;  3Q9V A;  3FXR A;  1OKR A;  3KZY A;  1YFH A;  2CQK A;  2VBZ A;  3RTR A;  2L4M A;  3FF5 A;  4L0Y B;  2FU4 A;  2A07 F;  3GO5 A;  4IHS A;  1U5T A;  1BBY A;  1HW5 A;  5DCM B;  2Q2E A;  3LA2 A;  4DNC A;  1HQC A;  1RI7 A;  4M9X A;  1LDJ A;  4G9Y A;  1IXR C;  3KP5 A;  2RN7 A;  1JHF A;  2OZU A;  4CIC A;  4AIJ A;  4LG0 B;  4AD9 A;  4A6D A;  5J8F A;  3EYI A;  4HLY A;  5L3C A;  1T0F A;  4G6Q A;  3TO6 A;  5LHG A;  2MC3 A;  2D2W A;  2P6T A;  1BI2 A;  2G7H A;  3E5U A;  4N9I A;  2QYO A;  2VT3 A;  3F8C A;  2EFW A;  3RKX A;  2PMU A;  2HZT A;  3KZZ A;  2RQP A;  1BM9 A;  3DPT A;  1EH8 A;  2HR3 A;  2XAG A;  1TNT A;  1H0M A;  2QVO A;  2RDP A;  2NS0 A;  5JR3 A;  1F5T A;  2RC4 A;  4Q48 A;  2M87 A;  3K0L A;  1ON1 A;  4GYG A;  2VBX A;  2DO7 A;  5CVV A;  2MLG A;  2BBY A;  3R4K A;  5D4S A;  4P55 A;  5DCF A;  1MZB A;  2DW4 A;  4PGH A;  4I2O A;  1JHH A;  3COA C;  4JQF A;  1HW1 A;  2PN6 A;  4LK0 F;  4MQ9 F;  5FLX Z;  3R0J A;  2EA4 A;  1R36 A;  3HSF A;  2OU2 A;  1OMI A;  4P5O A;  4EV0 A;  4BNC A;  5E1X A;  3LAJ A;  1J75 A;  1FYL A;  3BPV A;  2ZCW A;  4HX8 A;  2DLL A;  4XLN F;  2HGC A;  4BHB A;  2KIU A;  3V7S A;  1D8K A;  2IA0 A;  5AIP A;  1BIB A;  2M45 A;  1QQI A;  1BI3 A;  3S2W A;  2IT0 A;  1ULY A;  2Z33 A;  4GYI A;  1ZHF A;  3GF2 A;  3DXJ F;  1C0W A;  4L5J A;  2ZNZ A;  3BJ6 A;  3I58 A;  4XLP F;  5E1Z B;  1F9N A;  3LQQ A;  1U3E M;  4S05 A;  2Q0O A;  3D0S A;  2GQQ A;  5DYM A;  1V3F A;  1U5T C;  3DKW A;  4IVN A;  3ZMV A;  3GYH X;  4CXF A;  6PAX A;  1W5S A;  2KIF A;  4ZYE A;  5LRS A;  1QPM A;  1CF7 B;  4ESJ A;  4L5I A;  4M74 A;  4AWX B;  3WTU C;  3AAF A;  2ISY A;  2ZFW A;  2HS5 A;  4UXN A;  2A6H F;  1AWC A;  2GXB A;  2DK5 A;  4CO8 A;  4YFX F;  4RB0 A;  1TLH B;  4R79 A;  3V8J A;  3PQJ A;  3V8K A;  3OV8 A;  4EJW A;  2X0L A;  1OYW A;  3M9A A;  5TJJ A;  1G3W A;  3T5X A;  4G7O F;  3RYR A;  3J80 Z;  2DFI A;  4LB6 B;  3K1M A;  3CLO A;  4WCG A;  3HIF A;  4WXH A;  3LWF A;  1IAW A;  2H09 A;  2ZBK A;  4I0B A;  1YW7 A;  2BE5 F;  4WWC A;  5D8L B;  3P9C A;  2F5D A;  2FEZ A;  3J80 K;  4F7Z A;  4RAY A;  1XGN A;  1ZH5 A;  2Z3Y A;  2GXG A;  1SFX A;  3FWE A;  1KQ8 A;  3E5Q A;  3FHZ A;  4UUV A;  5ILV A;  3CO7 C;  3BZ6 A;  4WXC A;  1XMK A;  4M9Z A;  4AIK A;  4EM2 A;  4KNY A;  4MGR A;  4U7B A;  4CZZ A;  1KA8 A;  3U9G A;  4A5M A;  2W24 A;  1YW8 A;  3PFI A;  2IJL A;  4KIB A;  2P4W A;  2FML A;  4YIF A;  5A2Q K;  3ULQ B;  4I0A A;  2UWM A;  2P7C B;  4GXO A;  3M8F A;  2C6Y A;  2QBY A;  3M7G A;  4FT8 A;  5HLH A;  3E5X A;  1O3S A;  2KRF A;  2PMH A;  3GUD A;  2QUF A;  2ETH A;  3TDZ C;  2VT2 A;  5FB2 A;  1LQ1 A;  2L01 A;  2F5E A;  1WSU A;  2O0Y A;  3CUQ A;  2HOE A;  2F2E A;  1G6N A;  2Z5U A;  2XAS A;  4HDV A;  2YX7 A;  1SMY F;  3I71 A;  3LA7 A;  3M1E A;  1Z91 A;  2STW A;  2H27 A;  1FWZ A;  3GZ6 A;  1G3S A;  2M30 A;  3L9F A;  3QPH A;  1E2X A;  4N0B A;  1J59 A;  2VN2 A;  5D8K B;  2UZK A;  3FM3 A;  3J7A O;  2E7X A;  1LEB A;  3QU6 A;  2GZW A;  2A68 F;  4IRH A;  3E6B A;  3JW4 A;  4L9N A;  1MGT A;  4O5V A;  5F1R A;  1HST A;  1EH6 A;  3FX3 A;  4G94 A;  2G9W A;  2RKH A;  2FRH A;  5DEQ A;  3HSR A;  2A3S A;  2HDC A;  1I5Z A;  1PP8 F;  2VBW A;  3QOP A;  3HUG A;  3KP2 A;  5JI6 A;  2A61 A;  4UHT A;  4LB5 A;  4EJV A;  3QPT A;  1TQI A;  1XMA A;  1B59 A;  4R8H A;  4RAZ A;  1KU7 A;  5L3D A;  1LDD A;  5H6Q A;  4I02 A;  2TDX A;  2FMY A;  4LK1 F;  3IRR A;  1LB2 A;  3MAJ A;  3GX4 X;  5IT9 Z;  2VOO A;  1J2X A;  2ISZ A;  3WU1 B;  5DCM A;  4RS8 A;  3VFZ A;  3GFL A;  4ESB A;  2IP2 A;  1BI0 A;  4XRF A;  1FYK A;  1SD5 A;  2DU9 A;  2EA2 A;  1ZGJ A;  4LG0 A;  2K27 A;  1CGP A;  3ZQ7 A;  3HTU A;  1WWX A;  4ASN A;  1XCV A;  1W7P B;  4IF4 A;  1B6A A;  2RVC A;  1XDS A;  4LJZ F;  1P4W A;  1UHW A;  5JFR A;  4PZJ A;  2WTE A;  3E6M A;  2PBI A;  3CUQ C;  5E8I A;  2ZXJ A;  3I4P A;  2ESN A;  3IHU A;  3KEQ A;  3RDI A;  3V8L A;  5L3E A;  5JVT A;  2XAH A;  4Y17 A;  3I64 A;  2XRO A;  2ZME A;  2K4B A;  3EUH A;  5L3F A;  2A69 F;  4A5N A;  3O6B B;  4RGS A;  3I53 A;  4CYD A;  3RYP A;  3ZMU A;  4LLG F;  1LNW A;  1SAX A;  3DQV C;  4Q4Z F;  1F1Z A;  1R5H A;  5E8G A;  5DUI A;  1HW2 A;  2UXX A;  2WV0 A;  4EGY A;  3TOB A;  4I09 A;  3LA3 A;  1P4A A;  1BC7 C;  3FZV A;  4N9H A;  3RKY A;  3TQN A;  5CJ9 A;  2IRF G;  2HQN A;  2XAJ A;  4L9T A;  4UVC A;  4AIH A;  1HBX G;  4EJO A;  2XKO A;  2LDU A;  4MEX F;  5IT3 A;  2P5K A;  4CHU A;  3CDH A;  2MH9 A;  1SFU A;  1IZ1 A;  3WTW C;  4NB5 A;  4L18 B;  5E20 A;  1MDM B;  1QNT A;  1IUY A;  2MA3 A;  3H3U A;  1ZG1 A;  3F23 A;  2QM3 A;  1YIO A;  3TO9 A;  5FGM A;  2NNY A;  3E6C C;  3BJO A;  1F4K A;  2YSR A;  1O7F A;  3P9I A;  4MNU A;  2CGP A;  4OIR F;  4KYW A;  1KYW A;  1HSJ A;  3NEU A;  3R60 A;  1PDN C;  3BJA A;  1XD7 A;  5LEK A;  4G6D A;  5ICE A;  5JHU A;  4CGZ A;  3ECO A;  5HLI A;  2ZKZ A;  3WOD F;  2EB7 A;  1YYV A;  1P6R A;  5DD4 A;  3W6K B;  3ELK A;  3B02 A;  2VE8 A;  2OQG A;  1K79 A;  3BRO A;  2EFN A;  1R1T A;  4HV5 A;  3F8F A;  2GA1 A;  3O2P E;  5FFX A;  3MZY A;  2F5F A;  2B0L A;  2XVC A;  3V7C A;  1T2K A;  1H9T A;  1XSX A;  2FA5 A;  1BJA A;  1EH7 A;  3EYY A;  5BPD A;  4QWQ A;  5BQT A;  3EQL F;  1ONV A;  2PEX A;  4EJU A;  4BAY A;  4OIN F;  3HRS A;  3F22 A;  3G73 A;  4H0E A;  2QWW A;  4HQE A;  2BV6 A;  2P7V B;  5K5Q A;  1G4D A;  5HDN A;  4IRG A;  1JE8 A;  2XRN A;  1MD0 A;  2HKX A;  3FMR A;  1WKM A;  2ZJ2 A;  1BIA A;  3GW2 A;  2VC1 A;  2ACJ A;  3IL2 A;  2EFP A;  2L3D A;  3ZMT A;  5D5V B;  1BOA A;  2L54 A;  4FHT A;  3LQR A;  2J5P A;  5DDG A;  1UHM A;  2H94 A;  2DPD A;  3K2Z A;  1K78 B;  3MQ0 A;  4ENM A;  3LST A;  2HKO A;  3I5U A;  2KJB A;  4A0Y A;  1V4R A;  1U5T B;  4G8X A;  2ESH A;  2J5O A;  3L00 A;  1RZ4 A;  1XGO A;  3HRT A;  2O61 A;  2M1B A;  4ENN A;  1UCR A;  2NNN A;  1ZG3 A;  4HQM A;  4O3M A;  4HF2 A;  2UXN A;  4KT5 C;  5HVQ C;  1HKQ A;  3WTY C;  4PCQ A;  4PGG A;  3QRF F;  5CVJ A;  2YR2 A;  3F8M A;  3TGN A;  2KIM A;  3KP4 A;  4FX4 A;  3ZMZ A;  3JAM Z;  2XUB A;  4G7Z F;  1IRF A;  2H6B A;  2YX4 A;  5CVR A;  1ZRC A;  3NRV A;  3VOD A;  5D6F A;  4E70 A;  1QO0 D;  2EV5 A; 
#chains in the Genus database with same CATH topology
 1A6I A;  1MJ9 A;  2QLZ A;  5B1A H;  1S8N A;  2M8E A;  5CLS A;  1JT0 A;  2IGK A;  4E7I A;  2CFX A;  3H0G J;  2EIN H;  4EM0 B;  4P1W A;  1FT9 A;  4XN3 A;  2R4G A;  3JAM K;  3ZQL A;  4AUX A;  1R22 A;  2CV1 A;  4C9Y A;  3QYF A;  3SXY A;  2X1D A;  4D1Q A;  1VQ6 I;  1HA8 A;  2V6C A;  4UVB A;  4L5E A;  1FOW A;  2CO5 A;  5FKN A;  2MBF A;  2CQX A;  3HTS B;  3BT9 A;  3QYE A;  3IC7 A;  3EUK L;  2XAF A;  3BR3 A;  1S29 A;  2R7V A;  1STZ A;  1UG2 A;  2O3F A;  2EZH A;  2OA4 A;  3UNG C;  1P7J A;  4CH7 A;  2PMZ A;  1DGW Y;  2HYJ A;  5CYV A;  3B6A A;  3F8B A;  2HTJ A;  2N8G A;  1B9M A;  3JRE A;  4HX7 A;  4BJ5 C;  5M5X J;  2LMD A;  4FET A;  2LR8 A;  3Q0V A;  1DQU A;  4BE2 A;  4XRS G;  1W1W E;  3KET A;  1XSD A;  4I98 B;  2D1H A;  2JVH A;  4XBF A;  3S2D J;  3HOU J;  3I54 A;  4OU0 A;  1R58 A;  1WJA A;  2M5W A;  2LBF B;  5A2Q Z;  1KQ0 A;  2MD5 A;  4L0Z B;  3FXM A;  3MCZ A;  4RB2 C;  3H9G A;  4OIP F;  1FMW A;  4JX5 A;  1U2W A;  2XV4 S;  1K7A A;  3PQK A;  4S0H B;  1TWF J;  2DT5 A;  1LJ9 A;  2K9Q A;  2LK2 A;  4BH9 A;  2L7K A;  4KIC A;  1FSE A;  1VQ4 I;  2EK5 A;  3FBN B;  2GIZ A;  1Z3X A;  1HF0 A;  5JLX A;  4ABZ A;  4IX7 A;  3Q5F A;  4A6E A;  1TQM A;  4JBA A;  4RLQ A;  2DQR A;  1XGS A;  2DA2 A;  3BCA A;  2V1D A;  4JX6 A;  3S16 J;  3OYM A;  1LPQ A;  3BG5 A;  2DDA A;  3HOW J;  1OFC X;  2O6G E;  3OWT A;  1XMX A;  4DQ2 A;  2HVR A;  2M3A A;  2VKV A;  2KMU A;  1B4A A;  1IN4 A;  5BMZ A;  4E7Z A;  2DT6 A;  3MWM A;  2ZNY A;  2R7Z J;  1ZK8 A;  3HOY J;  3GTL J;  3GVA A;  1U0J A;  3WTZ A;  2ID3 A;  1NTC A;  4HA8 A;  2R5Z B;  1LDK B;  5HDK A;  4IPA A;  1S7O A;  1UG0 A;  3BOQ A;  4PFP A;  2MH2 A;  4D5C A;  2LNB A;  1Z05 A;  3ZMS A;  1OJL A;  4EQQ A;  5KAF C;  3AKZ A;  5E3M A;  2Y48 A;  2COM A;  5K1Y A;  4C30 A;  3K4M A;  2KRC A;  2CG4 A;  3KPH A;  5DM6 F;  1ZLJ A;  4U0V A;  1NH3 A;  4A0X A;  2E71 A;  5HNH A;  4AVP A;  2OJE D;  1P2F A;  3ABT A;  3WE2 A;  4YIR X;  4U7D A;  4BUP A;  3OIQ A;  1BW6 A;  1D1A A;  2L5Q A;  2VXZ A;  2ELK A;  2DK8 A;  1KU9 A;  2M8G X;  4DYQ A;  2CUZ A;  2DPU A;  3TO7 A;  1ZRE A;  5D5W B;  2L7Z A;  1XTA A;  3VB2 A;  2VPL A;  3S3M A;  3CJR B;  2AS5 F;  2FBI A;  5D6E A;  1FX7 A;  2O7O A;  2W57 A;  4WXD A;  2KIS A;  3BG9 A;  3ZQI A;  5FFZ A;  1OR7 A;  3WGH A;  2P5V A;  3PJR A;  1T95 A;  2R7Q A;  1U8R A;  2W48 A;  2IGO A;  1ETK A;  1W7P A;  2ZB9 A;  3TDU C;  1GXQ A;  4B3X A;  4PDK A;  2BY1 A;  3V4G A;  1IN8 A;  2QA4 I;  2LRE A;  2IPQ X;  3FXJ A;  3LSM A;  3WG7 H;  1NHA A;  2JRM A;  5TIS C;  3E6D A;  1YTY A;  2B9S A;  3S15 J;  2BHY A;  2FE3 A;  4NC8 A;  1TT0 A;  1ODD A;  3H9J A;  4MHG A;  2PJP A;  2Y75 A;  1GXP A;  1FY7 A;  3ZQG A;  2WWY A;  5L3G A;  3OL4 A;  4V19 K;  4J01 A;  4E6K G;  1GLN A;  3L2R A;  1NK2 P;  1IXS B;  1USS A;  4BY7 J;  2IBD A;  2HTS A;  1H89 C;  1ZN2 A;  3OR1 C;  5J3L A;  4KIT B;  4ZYH A;  4OMZ A;  5F1J A;  3DEU A;  1B9N A;  3MFK A;  5CQE A;  3HM5 A;  1H8A C;  3WTT C;  2H8W A;  3PSI A;  5LEJ A;  3TBI A;  1WJB A;  3B73 A;  1LVA A;  2KJC A;  2MW8 A;  3P7N A;  2VQG A;  1T6S A;  3IH4 A;  4PJL A;  3UR3 C;  3NAU A;  1QGP A;  1D3Y A;  2CW0 F;  2KKO A;  2ZC2 A;  2A6T A;  1B1B A;  3FMS A;  4M3F A;  1B72 A;  3BP8 A;  3ZN1 A;  2XF7 A;  5KAI C;  1XN7 A;  3S3N A;  1TNS A;  2G7U A;  4IOC F;  3P9K A;  1ETV A;  1RUN A;  2QKL B;  2FXA A;  3H92 A;  3CTA A;  3CC4 I;  2JJ7 A;  2XPV A;  2FQ3 A;  3H3Z A;  3HC7 A;  5FD6 A;  5LLQ A;  2W82 A;  2IGN A;  3I59 B;  2WB1 N;  3PUB A;  1MBE A;  1Q1V A;  4MLO A;  2XKP A;  5CQG A;  3OYG A;  3HBL A;  3EET A;  5B66 C;  5ICF A;  2HYG D;  2HQR A;  4YFN F;  1OLT A;  4OWR B;  4ZC3 A;  1W0T A;  3K1N A;  2K9S A;  1Z1D A;  2BYV E;  1DPU A;  2DAO A;  2IAI A;  5DUK A;  2ADU A;  3HSE A;  4O6J A;  2X1C A;  3HOT A;  2M4G A;  4RGR A;  2R7U A;  1KGS A;  4EVI A;  1VQK I;  1SVO A;  1R7J A;  1U9O A;  2K7L A;  3MD2 A;  3V7R A;  2EIL H;  3CCY A;  5HLG A;  3J81 K;  1AOY A;  3AG3 H;  3ML6 A;  1MDM A;  1FZP B;  4U0Y A;  1ETO A;  4OMY A;  1B8I A;  4IZZ A;  2DTR A;  2DJI A;  5ICG A;  4BU2 A;  3KFW X;  2R7F A;  3WTX C;  1ZR2 A;  2RV8 A;  4IJA A;  1DU6 A;  2QQ8 A;  1R4N B;  4XSZ F;  2KT0 A;  4NBQ A;  5GAD J;  2PQ8 A;  3TW6 A;  1Y1V J;  1ETY A;  3K9T A;  1SD4 A;  5ERI A;  2M9H A;  3DF8 A;  1Y1W J;  4A93 J;  3BCB A;  3K4L A;  3UKG A;  3TKY A;  3F6O A;  4KMU X;  1WQ2 A;  4KDP A;  5F0C A;  2HFH A;  4YG2 F;  3PSF A;  3DU5 A;  4LOC A;  5HS9 A;  2VKD A;  3WTV C;  1OYI A;  4BDZ A;  3FK7 A;  3TW7 A;  1W36 C;  5HDG A;  1BOB A;  1XSV A;  4RB1 A;  4IQJ A;  1W7P D;  2NVY J;  4IHT A;  5FD5 A;  4ETS A;  1Z0X A;  2A5Y B;  1Y8Q B;  1HXD A;  2MAB A;  2VKH A;  2VON A;  1O3Q A;  4P9F A;  2R7D A;  3H1C A;  2CWE A;  3S17 J;  3GTQ J;  4KIG A;  4BEH A;  2STT A;  2KPM A;  4OIO F;  4RGU A;  1DPR A;  4BHP A;  1I50 J;  3DKX A;  3O3K A;  3KEO A;  1A35 A;  2IW5 A;  4JP0 A;  4IRI A;  4A69 C;  4CZC A;  2PFB A;  1ZGA A;  2CV0 A;  2W25 A;  2VOP A;  4F3Q A;  3G2B A;  3G1O A;  1F43 A;  1HKT A;  2NS7 A;  3W6J B;  1D5V A;  4IXA A;  3A03 A;  2PG4 A;  4C3H J;  3HGG A;  4CDG A;  4A3G J;  3PIO F;  5C4X J;  4XOP A;  3HKZ A;  2W7N A;  3DBL B;  4BHC A;  5J4Y A;  1REP C;  4A0Z A;  5D5U B;  1J7K A;  1I39 A;  4HLX A;  3LSK A;  4M9S A;  2V9K A;  4XLE A;  4S04 A;  1SFK A;  3H0D A;  3VEP A;  4M6V A;  3GTP J;  2WY8 Q;  1JJ6 C;  2LKX A;  3NQO A;  2WBM A;  3WGG A;  1YRN B;  1K61 A;  1IF1 A;  1OPC A;  1X19 A;  3A01 A;  1ZLK A;  1NG6 A;  5EG0 B;  5L3B A;  1MND A;  3DEE A;  4PJN A;  1MJA A;  3SJM A;  3MZH A;  5E79 C;  1UEL B;  2LSO A;  2MFZ A;  2VOD A;  3ECH A;  4A3L J;  1G59 A;  3I4M J;  1F36 A;  4BY1 J;  3H35 A;  4HST A;  5LHI A;  2PLY A;  1I6X A;  1G3T A;  1RET A;  1X4P A;  3JSP A;  3JR9 A;  3C2B A;  1PUF B;  2OUM A;  4GO1 A;  4MQV A;  4TV7 A;  2AQE A;  2X85 A;  5KK1 A;  2V9V A;  2W85 A;  2OTJ I;  2NVQ J;  1O7L A;  3RQ4 A;  2TRT A;  3BR5 A;  3ZQF A;  3RI4 A;  3BPX A;  1BN5 A;  4KMF A;  3I0T A;  2EFO A;  2CSO A;  1I1S A;  3GFI A;  3ROU A;  2FF4 A;  3FXU A;  4UV8 A;  1D5Y A;  3BR6 A;  4LD5 A;  1QU3 A;  5TRD A;  1O3T A;  2X6W A;  4A12 A;  2V79 A;  1G8X A;  4KN4 X;  3GFM A;  4QLC U;  3GXO A;  5DV5 A;  1K78 A;  2WY7 Q;  2XGX A;  1OYY A;  1WJD A;  2DFH A;  2KQR A;  2JSC A;  2XHK A;  5AIQ A;  2NRA C;  5HS7 A;  3U1D A;  1HOM A;  2DFF A;  3C7J A;  3CD6 I;  2WC2 A;  3SEQ A;  3GTM J;  1EA3 A;  2QSG X;  3CC2 I;  1KU2 A;  1O3R A;  1GUU A;  2DYR H;  3KLN A;  4B09 A;  2LYC A;  2WV1 A;  4I76 A;  2Z9O A;  4G7H F;  4A3I J;  4Z2Y A;  3QU3 A;  4UUS A;  4PFO A;  3ABL H;  2E1N A;  1S7A A;  2CYY A;  4ESF A;  1RKW A;  3JTH A;  3CO6 C;  1KYZ A;  3G1L A;  2Y0S A;  4HEA 2;  1XGM A;  3NWS A;  2P5L C;  2E5Z A;  1FIP A;  1R1U A;  3GEZ A;  2P0W A;  2LC2 A;  4OOI A;  5C3E J;  1VTN C;  3KP3 A;  4J00 A;  3OOP A;  4RB3 C;  1YO5 C;  2Q1Z B;  2W00 A;  1MKM A;  2F4M B;  3HKZ N;  3RSN A;  4M6Y A;  2L9S A;  3TL4 X;  3IKT A;  2K3F A;  5IYB J;  4M6X A;  1CF7 A;  1QBJ A;  3DBR B;  4DIQ A;  2YUS A;  4ITV A;  3DU6 A;  1S6L A;  3F3X A;  4EMS A;  3U2R A;  3SQN A;  1L0O C;  4ZYG A;  1QZZ A;  2O03 A;  3CZ6 A;  3J7Z I;  3OYH A;  4K2E A;  3QPL A;  3JRG A;  5BPI A;  1ZKG A;  1TW2 A;  2HNH A;  2P6S A;  2ZME B;  5IPA A;  1D8J A;  4II3 A;  1FBQ A;  3FM5 A;  4EJT A;  3R0A A;  3OYC A;  3KZI C;  1YW9 A;  5LGN A;  2GA2 A;  1BR4 A;  3O8H A;  3QAH A;  3HYI A;  3S2H J;  1T33 A;  3GLX A;  4F92 B;  1FLI A;  3SFI A;  4DOZ A;  5EEH A;  1I1G A;  3PUF A;  2FX0 A;  1ZTR A;  2JPB A;  4B47 A;  3F8N A;  1MBJ A;  1PVE A;  2HOA A;  1ZQ3 P;  2LG4 A;  5E1W A;  1YLF A;  1PP7 U;  3I55 I;  4NDL A;  1BC8 C;  1X3U A;  2AXL A;  2CMP A;  2EFQ A;  1MMA A;  3M8J A;  4Y33 A;  3WE3 A;  3K1P A;  1T56 A;  3WG9 A;  3JRA A;  2MD0 A;  1E3P A;  1FMV A;  3VSK A;  5LRR A;  2DT7 B;  2WAD A;  2LH9 A;  3DEW A;  1OCP A;  1IW7 F;  2QEN A;  1T98 A;  1LKX A;  3OIP A;  5IOY A;  3QP5 A;  3ZPL A;  4HDU A;  4ZTJ A;  3HB9 A;  2E7W A;  2H6C A;  4YFK F;  2YU9 J;  4ZYD A;  3OYA A;  4OIQ F;  4EAT A;  3L2C A;  1D1C A;  4M71 A;  2OBP A;  3DPL C;  2R7R A;  2E1M B;  2QEX I;  1UB9 A;  2I8D A;  3LOC A;  1VFC A;  1MNE A;  4PK4 A;  3HRM A;  5E18 F;  2LBF A;  5EDN A;  2CU7 A;  1D0Y A;  2JZY A;  5AON A;  1IN7 A;  2OD5 A;  5B3S H;  3VOE A;  4UUT A;  3ZQC A;  1KU3 A;  1ORK A;  4XLH A;  5FLX K;  1R1V A;  1E17 A;  3SEZ A;  3FKJ A;  1WI9 A;  4BQA A;  1FNN A;  3L09 A;  4CYC B;  3IRQ A;  4KA4 A;  4C2M J;  2Q2E B;  2IVM A;  1Z67 A;  2F5C A;  4RAG A;  3LL7 A;  4BBS J;  1ON2 A;  3HOS A;  2QGU A;  3T0Y A;  1RIO H;  4BXX J;  4MEY F;  3SDB A;  4RGX A;  5E17 F;  3AG2 H;  3JTG A;  2ELH A;  1TBX A;  1UZC A;  3HJE A;  5FJ8 J;  5F0H A;  3RPU A;  1V5E A;  2A6E F;  1R5I D;  4WK8 F;  2HU9 A;  4KFC A;  4BGD A;  1XB4 A;  4JOM A;  3F21 A;  1SC7 A;  4IHV A;  3EPZ A;  1FBU A;  4LIV A;  4HRI A;  2X6Y A;  3FIW A;  1IRG A;  2K4J A;  2OTL I;  3A1Y A;  3A0B C;  1TWH J;  2EJR A;  1VZ0 A;  2ICW G;  2LP0 A;  2NAZ A;  5LGT A;  5EYR A;  2BEO A;  2LLK A;  1HLV A;  3KE2 A;  4DZP A;  3EDP A;  1P9Q C;  4W1U A;  1IRZ A;  5F6F A;  1YQA A;  5F27 A;  3LAP A;  3RIR A;  1IDY A;  2R3S A;  3REO A;  5LBQ A;  2V1X A;  1JGG A;  3DWL E;  3CUO A;  3ZR8 X;  1JGS A;  1LVK A;  4E4H A;  2ZJQ F;  3OYB A;  4D0P A;  2QZ8 A;  1MBK A;  1Z6R A;  3ZN0 A;  5M3F J;  1R5G A;  3BG6 A;  3SZT A;  2XB0 X;  1SAU A;  2MYS A;  3E97 A;  1Z7U A;  4HAM A;  4U0W A;  1UST A;  3K6G A;  3TOA A;  2PI0 A;  4HF1 A;  3DTI A;  1MJB A;  3KLO A;  4B3A A;  3CCS I;  3OIO A;  5BOX A;  5FRN A;  3HOV J;  1IN5 A;  3G3Z A;  5BS6 A;  4AU7 A;  1IDZ A;  4KN7 X;  3CCL I;  1W5T A;  4AYB A;  3ESW B;  4BS9 A;  2D45 A;  3CJQ B;  1U78 A;  2FNP A;  2MG4 A;  3MEX A;  2RNJ A;  4ZDP A;  4R1H A;  2JSP A;  1QZY A;  2KLO A;  1FPQ A;  2PX9 A;  4Y13 A;  2M7A A;  2YU3 A;  3ERE D;  1FYM A;  4WX9 A;  3KYC B;  1PYV A;  2DJN A;  4UV9 A;  1TWA J;  3C2G A;  3KIO A;  2FJ1 A;  2IA2 A;  4A3E J;  2L9N A;  1ZRD A;  3TP3 A;  5LHH A;  3BDD A;  2HEO A;  3C1D A;  3CCJ I;  2QQB A;  5EEA A;  2OQR A;  4U88 A;  4LMY A;  3Q0U A;  5KNL A;  3H5A A;  3RCO A;  3SHF A;  4BL0 B;  3SFZ A;  5HS8 A;  3Q0W A;  3ZQQ A;  1A5J A;  1RUO A;  2L02 A;  3H5R A;  3IWF A;  4MTE A;  1Y56 A;  2Y69 H;  1H9G A;  2IGM A;  1Y39 A;  4C2U A;  2EV0 A;  5JHF A;  2M0M A;  2CJJ A;  2RQQ A;  1IGN A;  1YS7 A;  1IXC A;  3W3C A;  2V26 A;  2X6O A;  2BW3 B;  2FBH A;  2GBY A;  1R6R A;  3OS2 A;  1MSF C;  1Q1H A;  2XIG A;  5EEG A;  1O57 A;  2DCE A;  3GWZ A;  4L9V A;  5FKO A;  1VQ9 I;  1S72 I;  4IHW A;  2JK3 A;  3ABU A;  3RPU D;  3WU0 A;  2XGD A;  4Y7N J;  2ZJR F;  1P7I A;  5CVU A;  5H2F C;  4YII A;  3JRD A;  1YJ9 I;  1I3Q J;  1FP1 D;  1XCB A;  3I59 A;  2E34 A;  3CES A;  2XPW A;  1SVM A;  3JSO A;  1RKT A;  5K5O A;  1FSH A;  2HZD A;  4YEJ A;  4HOB A;  3HPH A;  3BY6 A;  1BI1 A;  3CJN A;  1QPI A;  2ZO4 A;  4P96 A;  1J9I A;  3LFK A;  4Y3O A;  2DMU A;  3OYN A;  2HWV A;  3ZXS A;  5F08 A;  4CCN A;  4ZJZ A;  2QKM B;  3AL0 B;  1P92 A;  4DBR A;  4NQW A;  4M3B A;  4UNO A;  4IQ4 A;  2IA1 A;  1ZAR A;  4BBR J;  3DTK A;  3D1N I;  3ZP5 A;  4F93 B;  1J5Y A;  1XPX A;  4L9J A;  1ZAO A;  1SMT A;  3NWT A;  3CC7 I;  4EM1 A;  3HHG A;  4BYY A;  1LEA A;  2JA6 J;  1K6O A;  2CQQ A;  1P4X A;  3FIS A;  1R9T J;  5J8C A;  1YE9 A;  4XOR A;  4PUS A;  4XSX F;  1GV2 A;  4W97 A;  3F72 A;  2CV2 A;  3T8T A;  3ZMD A;  4NHJ A;  2ME6 A;  4HW0 A;  4F55 A;  1Z3Y A;  1DDN A;  1X3Z B;  2R5Y B;  3C3W A;  3CJT B;  2H1K A;  1TP4 A;  1IN6 A;  3IKV A;  5J6X A;  1L3L A;  2IS6 A;  5ILU A;  4UVA A;  5FKM A;  1A31 A;  2HQ5 A;  4ENK A;  1SD6 A;  1HKS A;  2PMZ N;  3BQZ A;  1Z9C A;  1XG1 A;  5C4J J;  1XS9 A;  4ZDL A;  4BXU A;  1K83 J;  1K4S A;  4EEF G;  4XLA A;  1QA6 A;  1IRX A;  4KUM A;  3HL2 A;  5H6R A;  2VJ4 A;  2DI3 A;  2Y0M A;  1IO2 A;  1T39 A;  5GP9 A;  2JRT A;  1DGR M;  2RGV A;  1VQO I;  2DQL A;  4XIC A;  3OYD A;  2W84 A;  4EGZ A;  4B8X A;  1OCO H;  1QZE A;  1TQP A;  3I9V 2;  2L2O A;  3QWL A;  4HX4 A;  4I01 A;  1G3Y A;  3Q9S A;  4KIF A;  3T8R A;  3OYL A;  1YHQ I;  3RPQ A;  3KYL A;  5ICC A;  2EV6 A;  3CP2 A;  3M8E A;  1I27 A;  3CDL A;  3D5S C;  2GWR A;  3CQZ J;  3CCQ I;  4IEJ A;  1WVR A;  1W0U A;  2QQA A;  4BE0 A;  2VUM J;  3FK6 A;  1GHC A;  1Z21 A;  4Q47 A;  2BGC A;  4HBL A;  3PO2 J;  2LF8 A;  2NXN B;  5H20 A;  2NVX J;  2WAF A;  1QHG A;  2MLK A;  2LKS A;  3LSH A;  4ZH4 F;  3R6S A;  3E1S A;  3X2Q H;  2GOX B;  4HZF A;  4QTR A;  2FBK A;  2XF6 A;  2VC0 A;  1VND A;  1MMG A;  3DPU A;  4ON0 A;  1YRN A;  4LGW A;  2LY1 A;  2K02 A;  4X6A J;  5EG0 A;  4B44 A;  1X1C A;  3J81 Z;  3GFJ A;  1SD7 A;  1TZL A;  3CCV I;  3ISP A;  1SFE A;  3HHH A;  3KP6 A;  2DOF A;  3PM1 A;  5ILS A;  1N78 A;  2ZJP F;  3RKW A;  1W5C C;  1Z6T A;  4U87 A;  4A2U A;  2JTV A;  4NNJ A;  1TTY A;  3RJP A;  3HG9 A;  2HDD A;  2MGQ A;  2DDB A;  1BA5 A;  2F6C A;  1PUF A;  3IAS 2;  1MBF A;  2L4A A;  1A04 A;  4ZZD A;  1W4M A;  1VQ8 I;  3GTJ J;  4M73 A;  2HPI A;  1FOK A;  2E1O A;  4LLN A;  1ZYR F;  2L0K A;  2LKP A;  4E7J A;  3FXQ A;  4HV6 A;  2GM4 A;  5D4R A;  5HOO A;  2QQ9 A;  2QBY B;  2VJ5 A;  4XKB A;  2YS9 A;  3C18 A;  4ZZL A;  4FX0 A;  4M72 A;  5ED4 A;  1YG2 A;  3ONQ A;  1E3H A;  2JPC A;  4LFU A;  2VPR A;  1FOY A;  4GRI A;  4NC7 A;  5D5X B;  3L7W A;  4QSH A;  2V9P A;  3BTL A;  5FKL A;  2Y31 A;  2D5V A;  1GVD A;  1U6G A;  3KCC A;  3LFU A;  3OYI A;  3FMQ A;  1QRY A;  4Z6Y A;  1JJ8 C;  1X1D A;  1JKP C;  1S3J A;  2EWN A;  2FOK A;  1RPW A;  1OIS A;  3CUQ B;  5CVI A;  2HYF A;  3OYE A;  1KON A;  1X1B A;  2VBY A;  3ASN H;  2IEK A;  1MMD A;  2DBB A;  3S1N J;  1YS6 A;  5B1B H;  3T1B A;  1DUX C;  3S93 A;  5DD8 A;  1TW3 A;  2P8T A;  4G6T B;  3BQY A;  1JI8 A;  1FBS A;  3N97 A;  3E3V A;  1FP2 A;  1R23 A;  4DZJ A;  1JXS A;  2O9L A;  2V1U A;  3AG1 H;  4GCV A;  3KP7 A;  4I7H A;  3QP6 A;  4V2G A;  2LY9 A;  1XDU A;  2L9R A;  2R7W A;  5LD2 C;  5IT9 K;  3IP4 B;  4XNF A;  3DV8 A;  2NOJ B;  2X4H A;  2OAZ A;  1R00 A;  2M4K A;  1ZRF A;  1PUE E;  2M34 A;  3IAM 2;  4Y15 A;  2Z99 A;  5FO5 A;  3BTI A;  3SDG A;  2GAU A;  3BWG A;  4P9U A;  2D1V A;  2IS4 A;  5LGU A;  3CMM A;  5GAG J;  2HDW A;  4WF2 A;  3WTS C;  1FC3 A;  1WI3 A;  2Q8K A;  4CCK A;  1N77 A;  4PJJ A;  1OR7 C;  3HRU A;  2YPR A;  2O8X A;  2XAQ A;  2FNA A;  2O5R A;  1KQ9 A;  4Q5S F;  2X51 A;  2VE9 A;  5KVR A;  4ENJ A;  1DP7 P;  2FSW A;  4BAC A;  2JA5 J;  1A36 A;  2E2J J;  1BR2 A;  2GOM A;  3OY9 A;  1TL8 A;  1J0R A;  4PSX A;  5E3N A;  1WRJ A;  4BE1 A;  3HXL A;  3PO3 J;  2DA4 A;  4HF0 A;  3K70 D;  3WGI A;  2HVS A;  1GV5 A;  3F6V A;  4JK1 X;  2OZ6 A;  5K5R A;  4GGG A;  1X1P A;  1BL0 A;  1IJW C;  2A05 A;  2LF7 A;  3K69 A;  3N4M A;  2AXT C;  2E19 A;  2NS8 A;  1Y0U A;  4MFD A;  3FXO A;  2GIV A;  2AHQ A;  3IV5 A;  3IWZ A;  3CMY A;  1AKH B;  3GZ5 A;  3DFG A;  4MTD A;  4UB6 C;  3D5L A;  1EV7 A;  1IV6 A;  3F0C A;  3VYS B;  5GAE J;  1RES A;  4HYE A;  1GVJ A;  3BLY A;  2ZFU A;  2NYX A;  3HUG B;  2DMQ A;  4LLL A;  1ZG5 A;  2CUJ A;  1V55 H;  2JT1 A;  2E2H J;  2FD5 A;  1KZH A;  3S14 J;  3DP7 A;  4BQN A;  3H3V K;  2CQN A;  3SZP A;  1VQL I;  2K86 A;  1TT5 B;  1ERD A;  5F64 A;  3FXL A;  3R61 A;  3K4N A;  3K70 C;  1UFM A;  1RNL A;  4KT6 A;  2E1C A;  3ABM H;  1T38 A;  2MSY A;  3Q9V A;  3FXR A;  1OKR A;  3KZY A;  4N4O B;  4A3M J;  2RNG A;  3JRC A;  1YFH A;  2CQK A;  2VBZ A;  3RTR A;  2L4M A;  3RZO J;  4XON A;  3FF5 A;  2LY2 A;  2OF7 A;  4L0Y B;  2FU4 A;  2A07 F;  3GO5 A;  4IHS A;  4CYC A;  1U5T A;  4B43 A;  1BBY A;  1HW5 A;  5DCM B;  2Q2E A;  3FXK A;  3LA2 A;  4DNC A;  1HC8 A;  1HQC A;  3VYR B;  1RI7 A;  2IS2 A;  2G0E A;  3K4B A;  2R7S A;  4M9X A;  1LDJ A;  1FJL A;  3GME A;  1VQ7 I;  2E2I J;  1MNM C;  4G9Y A;  2X9D A;  1H88 C;  4ZTF A;  1IXR C;  3KP5 A;  1OCC H;  2EZI A;  2RN7 A;  2Y30 A;  5J1R A;  3OOU A;  2NVU B;  1JHF A;  2OZU A;  4CIC A;  4X0G A;  2M0C A;  4AIJ A;  4LG0 B;  4JYK A;  2VJJ A;  2JMW A;  4AD9 A;  4A6D A;  4M3G A;  5J8F A;  3EYI A;  4HLY A;  2HOS A;  1M1E B;  5L3C A;  1T0F A;  4G6Q A;  2V6E A;  1HCR A;  3CCU I;  3SYT A;  3TO6 A;  3PFY A;  2ECC A;  2JA7 J;  1YJW I;  5LHG A;  2MC3 A;  2D2W A;  2P6T A;  3U21 A;  1BI2 A;  2G7H A;  3E5U A;  4BEH B;  4N9I A;  1MBG A;  2FUG 2;  2QYO A;  2VT3 A;  4Y4R A;  2DFE A;  3LSR A;  3F8C A;  4F91 B;  2K85 A;  2EFW A;  1YOV B;  3E0J B;  1UAA A;  2L7F P;  3RKX A;  2PMU A;  2HZT A;  3KZZ A;  2RQP A;  1BM9 A;  5TGT A;  3JRF A;  3DPT A;  4BQQ A;  4DBQ A;  3HPG A;  1EH8 A;  2HR3 A;  2XAG A;  2NOG A;  1TNT A;  3K4K A;  3MKZ A;  1H0M A;  1WH7 A;  2QVO A;  2EZL A;  2RDP A;  3TED A;  2AQF A;  2NS0 A;  5JR3 A;  1F5T A;  2RC4 A;  4Q48 A;  1AA7 A;  2M87 A;  3M3Y J;  3K0L A;  1ON1 A;  3SZG A;  1WPK A;  4GYG A;  2VBX A;  2DO7 A;  2WAE A;  5CVV A;  4XLC A;  4XK4 A;  1J09 A;  3W2V A;  2I10 A;  4YRV A;  2KDZ A;  2MLG A;  3HEF A;  2BBY A;  2KZV A;  4X1E A;  5IP7 J;  2JA8 J;  1WJC A;  2BZT A;  2Y2Z A;  3R4K A;  2R7O A;  3H5N A;  5D4S A;  4P55 A;  5DCF A;  1MZB A;  2DW4 A;  4PGH A;  4I2O A;  2VB6 A;  1JHH A;  1D0X A;  3IH2 A;  3COA C;  1V54 H;  3K2A A;  4F52 A;  4AVZ A;  3LMM A;  1HW1 A;  4HPQ A;  4JQF A;  2PN6 A;  4LK0 F;  5J47 A;  4MQ9 F;  3CLQ A;  3W2W A;  5FLX Z;  1OQY A;  1X2M A;  2EA4 A;  3E7L A;  3R0J A;  4FQG A;  5KCM A;  4GDF A;  3AG4 H;  2GLO A;  1HDP A;  1R36 A;  3HSF A;  2DMT A;  3CP8 A;  5J40 A;  4D9J A;  2OU2 A;  2Y9Z A;  1OMI A;  2K9L A;  2MC4 A;  2H1L A;  4P5O A;  5M5W J;  1OCR H;  4EV0 A;  1POG A;  1SAN A;  5K7F A;  3OYK A;  5DTD A;  4BNC A;  5E1X A;  1I3A A;  3LAJ A;  4II2 A;  1J75 A;  1FYL A;  4N4N B;  3BPV A;  2OC6 A;  2ZCW A;  4PJM A;  1X1A A;  3BZK A;  4A3K J;  2LTP A;  4HX8 A;  2PJR B;  3H36 A;  2K5C A;  2DLL A;  1WFX A;  3KEY A;  4XLN F;  2HGC A;  4FCY A;  4BHB A;  2KIU A;  3PL8 A;  3V7S A;  1D8K A;  2IA0 A;  3B6C A;  5AIP A;  2BW3 A;  5EJC A;  3CME I;  1IUF A;  1MH4 A;  1BIB A;  1A6Q A;  2AO9 A;  2Y0S N;  5DM7 F;  3FDY A;  2M45 A;  4MFE A;  5J4V A;  2XRL A;  1QQI A;  3CMA I;  2GXA A;  1BI3 A;  5M5Y J;  3OMY A;  2HI3 A;  3S2W A;  1N25 A;  2IT0 A;  2LRD A;  1ULY A;  2QSH X;  2BY3 A;  2Z33 A;  1X2N A;  2E1M C;  1ZHF A;  1NG7 A;  3GF2 A;  3DXJ F;  3GZN B;  4GYI A;  1C0W A;  4L5J A;  1R71 A;  2ZNZ A;  2DYS H;  3BJ6 A;  3I58 A;  2O8K A;  3FBI B;  4XLP F;  2B63 J;  4IOA F;  5E1Z B;  1VQM I;  3M1C A;  1F9N A;  4UUS B;  3LQQ A;  1EF4 A;  1U3E M;  4S05 A;  2KL4 A;  3H9Q A;  4HSR A;  3WHB A;  2VLA A;  2Q0O A;  3D0S A;  3I56 I;  2GQQ A;  4XRS A;  5DYM A;  3MZ8 A;  2ID6 A;  5B5E C;  1V3F A;  4ANJ A;  1U5T C;  3DKW A;  2R5Z A;  2ELJ A;  4CCJ A;  3DCF A;  4IVN A;  5EGO B;  3ZMV A;  4I99 C;  3GYH X;  4CXF A;  2DA5 A;  6PAX A;  1FTZ A;  1V5F A;  1W5S A;  2KIF A;  2BVM A;  4IL6 C;  5FRM A;  3V42 A;  4ZYE A;  2CH0 A;  3L2W A;  5LRS A;  2ZSI B;  1Y0N A;  2XPU A;  1WCM J;  1QPM A;  1CF7 B;  4ESJ A;  2VQL A;  4L5I A;  4M74 A;  4AWX B;  3WTU C;  3S32 A;  2I5U A;  5BNG A;  5K7Z A;  3AAF A;  2ISY A;  2FOW A;  3L1P A;  1QVU A;  2ZFW A;  3I3L A;  1DU0 A;  2HS5 A;  4UXN A;  2A6H F;  2W4S A;  1AWC A;  2GXB A;  4D7M A;  2DK5 A;  4CO8 A;  4XKW A;  4XN0 A;  4YFX F;  4RB0 A;  3CCE I;  1ITY A;  1TLH B;  1JKR C;  4R79 A;  3V8J A;  2EPF A;  3GTK J;  2Z1D A;  4E7K A;  3PQJ A;  3V8K A;  3BR0 A;  3OV8 A;  4EJW A;  2X0L A;  3P5J A;  1OYW A;  1LE8 B;  3M9A A;  5TJJ A;  1WJE A;  1G3W A;  1SVL A;  3T5X A;  4G7O F;  1ETX A;  4FTH A;  3RYR A;  3J80 Z;  2DFI A;  1FTT A;  3GLL A;  4LB6 B;  3K1M A;  3G71 I;  2DA1 A;  3CLO A;  5C44 J;  3ABK H;  3HIF A;  4WXH A;  4WCG A;  3LWF A;  4MO7 A;  1ENH A;  1K6Y A;  2KHM A;  1IAW A;  4DW6 A;  2H09 A;  2DOE A;  2ZBK A;  3MKL A;  4XM3 A;  2X1E A;  4I0B A;  1YW7 A;  1E0E A;  5FLM J;  1UHS A;  2JWT A;  3OSF A;  4OAY A;  3M4O J;  2BE5 F;  3WHC A;  4WWC A;  2VL8 A;  1QHH D;  5D8L B;  3P9C A;  3TMO A;  2F5D A;  2FEZ A;  4CCL A;  3J80 K;  2XB5 A;  4F7Z A;  3LSP A;  3W2A A;  3ASO H;  4RAY A;  1SFO J;  1XGN A;  1ZH5 A;  3CF2 A;  2Z3Y A;  2GXG A;  4QPO A;  1SFX A;  5JLW A;  3BR1 A;  3FWE A;  1KQ8 A;  3E5Q A;  1MMS A;  3FHZ A;  4UUV A;  2OCC H;  3IUO A;  4DJA A;  5ILV A;  3CO7 C;  3BZ6 A;  1YIT I;  4WXC A;  1XMK A;  4UB8 C;  4M9Z A;  4AIK A;  3CCR I;  2VJI A;  4EM2 A;  4ZYA A;  2BY2 A;  4KNY A;  2XGE A;  1RR7 A;  4MGR A;  4V2F A;  5CPR B;  4U7B A;  2JUG A;  1GT0 C;  4CZZ A;  2FQ4 A;  1WJF A;  1KA8 A;  3U9G A;  3A02 A;  2W24 A;  1YW8 A;  2X6X A;  4A5M A;  3PFI A;  2IJL A;  4KIB A;  2P4W A;  4LG3 A;  2DA6 A;  2FML A;  2ZXW H;  4YIF A;  5A2Q K;  2V4J C;  2X48 A;  3ULQ B;  3K4C A;  2CW8 A;  4I0A A;  3GTO J;  1JUP A;  2M2E A;  2UWM A;  3QQA A;  2HOT A;  2P7C B;  4MIM A;  2F4O B;  1S5L C;  4GXO A;  1X4O A;  1CQT A;  3M8F A;  2C6Y A;  2ZSH B;  3LSI A;  1ETW A;  2QBY A;  2W1O A;  3M7G A;  2WB1 A;  2XDV A;  4XID A;  3JRH A;  4FT8 A;  4QIW N;  5HLH A;  3L2Q A;  4XKC A;  4PJ0 C;  3E5X A;  1O3S A;  2DTZ A;  2KRF A;  2PMH A;  3GUD A;  2QUF A;  2ETH A;  2QCO A;  2H8R A;  3TDZ C;  2VT2 A;  5FB2 A;  1LQ1 A;  3KYD B;  4B48 A;  2L01 A;  4C3J J;  4AYB N;  5HNF A;  2F5E A;  3ERM A;  1WSU A;  2O0Y A;  1ETQ A;  4J19 A;  3CUQ A;  1ZGW A;  4M3E A;  3NAR A;  2BVL A;  3GCM A;  5CKT A;  3AL0 C;  2DA7 A;  2HOE A;  2Z16 A;  3JRI A;  2F2E A;  1G6N A;  2Z5U A;  2JVG A;  4LIU A;  2XAS A;  4HDV A;  2YX7 A;  1SMY F;  3I71 A;  3LA7 A;  3M1E A;  4E7S A;  1HDD C;  1Z91 A;  3ZCO A;  2STW A;  2JA2 A;  2H27 A;  1FWZ A;  3GZ6 A;  1ACI A;  1VI0 A;  1G3S A;  1R4M B;  3S1M J;  3HGY A;  2M30 A;  1Z77 A;  3L9F A;  1E2X A;  3QPH A;  4N0B A;  1J59 A;  2VN2 A;  3L2U A;  5D8K B;  5GPA A;  2UZK A;  1X3W B;  2HXI A;  3FM3 A;  3HDD A;  3J7A O;  2E7X A;  1LEB A;  3QU6 A;  2GZW A;  2A68 F;  9ANT A;  1E3O C;  4IRH A;  2XF5 A;  3E6B A;  3GBG A;  3JW4 A;  4L9N A;  2VIX A;  1MGT A;  2EBI A;  4O5V A;  3CDI A;  1LFB A;  5K7H A;  5DS9 A;  2VKE A;  5F1R A;  4BDY A;  1YX5 A;  4CA0 A;  1HST A;  2EQR A;  3JCU C;  1EH6 A;  3KX2 A;  3FX3 A;  4H4K C;  4G94 A;  5HLT A;  2G9W A;  5J1U A;  2RKH A;  5IOZ A;  5FKK A;  2FRH A;  4A3F J;  3A2K A;  3DLA A;  3S8P A;  4DYR A;  1AHD P;  4A3J J;  1R49 A;  3FKI J;  2EZK A;  3K10 A;  3MKW B;  5DEQ A;  3HSR A;  5FLV A;  2A3S A;  2V1N A;  3BTC A;  2E35 A;  3WU2 C;  1AKH A;  4D5F A;  3VWB A;  2R7T A;  4FIS A;  2HDC A;  4B1R A;  1I5Z A;  2ECB A;  2E60 A;  3EUA A;  1PP8 F;  1DP3 A;  2F5V A;  2VBW A;  3QOP A;  4OAZ A;  3HUG A;  3KP2 A;  5JI6 A;  3J7Y J;  2A61 A;  5GPC A;  2WAQ A;  3PNV A;  3TP0 A;  4UHT A;  4LB5 A;  4ZDO A;  4EJV A;  4HNV A;  3VYT B;  1JTY A;  1XC5 A;  3QPT A;  1APL C;  3K4J A;  4XMY A;  2EIK H;  1TQI A;  3BG7 A;  1XMA A;  4XOT A;  1B59 A;  3IH3 A;  4R8H A;  2WA0 A;  4RAZ A;  2BOL A;  3JRB A;  4AC0 A;  1KU7 A;  5L3D A;  1AU7 A;  1LDD A;  1W36 D;  5H6Q A;  1LFU P;  4BKX A;  4I02 A;  2TDX A;  1Y8R B;  2FMY A;  4BJT A;  4UY8 I;  2BHZ A;  3GTG J;  1D1B A;  1EJ9 A;  4NQW B;  3BZC A;  4LK1 F;  3IRR A;  1LB2 A;  2JUC A;  3MAJ A;  3GX4 X;  5IT9 Z;  5E3O A;  2VOO A;  4I6Z A;  1J2X A;  2ISZ A;  3WU1 B;  5DCM A;  3AFH A;  1EKE A;  1FEX A;  4RS8 A;  3VFZ A;  4RAF A;  3GFL A;  4ESB A;  1N75 A;  3C2H A;  2IP2 A;  1BI0 A;  4XRF A;  1FYK A;  5IY5 H;  4AID A;  3ZGK A;  1FOX A;  1XX5 A;  1SD5 A;  2DU9 A;  2EA2 A;  2IS1 A;  1ZGJ A;  4Y52 J;  3OS1 A;  1PJR A;  4JX4 A;  2DN0 A;  3FHN A;  3ZRG A;  3BR2 A;  3F9K A;  4LG0 A;  3OYJ A;  2Z2S B;  2K27 A;  3W6V A;  2E5N A;  2Y9Y A;  2VAS A;  1CGP A;  4CUG A;  3BG3 A;  1YI2 I;  3ZQ7 A;  3HTU A;  1WWX A;  4BQO A;  4ASN A;  1XCV A;  1W7P B;  4IF4 A;  4XKV A;  5IP6 A;  1V5G A;  1B6A A;  4HNU A;  4IO9 F;  2RVC A;  1XDS A;  2HVQ A;  5GTH C;  4LJZ F;  1P4W A;  1UHW A;  3Q3S A;  3L2V A;  5JFR A;  2CQ7 A;  2WTE A;  4PZJ A;  3E6M A;  2PBI A;  2EIJ H;  3CUQ C;  5E8I A;  2ZXJ A;  3I4P A;  2ESN A;  1SEU A;  3IHU A;  3KEQ A;  4FE4 A;  3RDI A;  3CF5 F;  3V8L A;  5L3E A;  3RZD J;  3VSL A;  4A3C J;  5JVT A;  2XAH A;  4Y17 A;  3I64 A;  2XRO A;  2ZME A;  4XL9 A;  2KIQ A;  1JT6 A;  1JTX A;  3OS0 A;  2K4B A;  4RA2 A;  3EUH A;  1MIJ A;  2QF7 A;  1ZR4 A;  5L3F A;  2A69 F;  2QSF X;  4A5N A;  3O6B B;  4RGS A;  3I53 A;  1MSE C;  4CYD A;  3RYP A;  1VQ5 I;  2JN6 A;  3ZMU A;  5F0F A;  4LLG F;  3O8G A;  4RM3 A;  4QPQ A;  1B72 B;  1LNW A;  3S1R J;  1SAX A;  3DQV C;  2CUF A;  4Q4Z F;  2F48 A;  1F1Z A;  1R5H A;  3A4C A;  5F04 A;  5E8G A;  5DUI A;  1LFP A;  1HW2 A;  3OYF A;  2UXX A;  2WAQ N;  2XSD C;  2WV0 A;  2E36 A;  3DTE A;  1VF9 A;  4EGY A;  1QVT A;  3TOB A;  2HXO A;  2BXZ A;  4I09 A;  1Z7L A;  3LA3 A;  1JUM A;  3OL3 A;  3OSG A;  1P4A A;  1WH5 A;  3FZV A;  2CFO A;  4N9H A;  1BC7 C;  3QPS A;  3RKY A;  3TQN A;  5CJ9 A;  3LNQ A;  2IRF G;  2HQN A;  2XAJ A;  4L9T A;  3ZQH A;  4UVC A;  1RC9 A;  3LSJ A;  4RLF A;  4AIH A;  1HBX G;  4EJO A;  2XKO A;  1OCT C;  2LDU A;  4MEX F;  5IT3 A;  5IYD J;  2CS3 A;  3DKY A;  5GTI C;  2P5K A;  4CHU A;  1NK3 P;  3CDH A;  2MH9 A;  1SFU A;  1IZ1 A;  4RBO A;  1IC8 A;  2IXS A;  2F4I A;  3WTW C;  4BXF A;  4NB5 A;  4L18 B;  5E20 A;  1MDM B;  4CCM A;  2XAU A;  1QNT A;  1IUY A;  2MA3 A;  2PJR A;  1B8I B;  2RRE A;  3H3U A;  2KRH A;  4B4C A;  1ZG1 A;  3QOD A;  3F23 A;  2QM3 A;  2K3P A;  1YIO A;  4A3B J;  2COB A;  1YIJ I;  2DOD A;  3TO9 A;  4NUB A;  1RRJ A;  5FGM A;  1IG7 A;  4RM2 A;  1YJN I;  3M07 A;  2NNY A;  4A3D J;  3I4N J;  3E6C C;  3BJO A;  1F4K A;  2YSR A;  1O7F A;  4FE7 A;  5J1Y A;  1U8B A;  1WGX A;  4XQF A;  2OV7 A;  3P9I A;  1GDT A;  4MNU A;  5IYC J;  2CGP A;  4KJZ A;  4OIR F;  1TC3 C;  1S7E A;  4KYW A;  2K9M A;  1KYW A;  1MH3 A;  1HSJ A;  3NEU A;  3R60 A;  2R7X A;  2P81 A;  1PDN C;  5EZH A;  4M3D A;  2DXI A;  3CCM I;  2R0Q C;  3BJA A;  4C2T A;  5KHD A;  1XD7 A;  5LEK A;  2A5W A;  4G6D A;  5ICE A;  1LUJ B;  5JHU A;  4CGZ A;  1JKO C;  1BW5 A;  3ECO A;  5HLI A;  2VXD A;  2ZKZ A;  3WOD F;  2EB7 A;  2VQH A;  5EGO A;  2B7E A;  1YYV A;  5GAH J;  1P6R A;  5DD4 A;  3W6K B;  4KIS A;  3ELK A;  3B02 A;  4PSW A;  5IP9 J;  2RAE A;  2VE8 A;  2XC7 A;  2TCT A;  2OQG A;  4LIT A;  5EF6 A;  1K79 A;  1G2H A;  4C3I J;  3QOE A;  3BRO A;  2EFN A;  3HOX J;  1R1T A;  5HOD A;  1T8I A;  4HV5 A;  1TWG J;  3F8F A;  2GA1 A;  3O2P E;  5FFX A;  4YEL A;  4DGW B;  3MZY A;  2F5F A;  3U1K A;  2B0L A;  2XVC A;  3V7C A;  1T2K A;  3ZOB A;  2UUZ A;  1H9T A;  5LFA A;  1XSX A;  4E7L A;  2FA5 A;  4NC6 A;  1BJA A;  1EH7 A;  3EYY A;  5BPD A;  4QWQ A;  3HZJ A;  3PNY A;  5BQT A;  1WZ2 A;  4XRM A;  3EQL F;  4IKF A;  3VDX A;  1ONV A;  1YX3 A;  2PEX A;  4EJU A;  5EZG A;  4CCO A;  4BAY A;  2K40 A;  4HG2 A;  4OIN F;  1FIA A;  4D7N A;  2ZXH A;  3HRS A;  3F22 A;  3A01 B;  2V7F A;  2XSJ C;  2NVT J;  4RDU A;  1X58 A;  1LE8 A;  1JUS A;  3G73 A;  4H0E A;  2ZME C;  2OCE A;  2EH3 A;  1S9H A;  1K4T A;  2QWW A;  3BC8 A;  4IHX A;  4XR6 A;  3MKY B;  2BV6 A;  3EUH C;  4HQE A;  1VQN I;  2LOO A;  2HQA A;  2P7V B;  5K5Q A;  2XGC A;  1G4D A;  5HDN A;  3MN2 A;  4IRG A;  2L9V A;  1JE8 A;  4DYC A;  3BTJ A;  4E7H A;  2XRN A;  1MD0 A;  1WHU A;  2HKX A;  3LSG A;  1BJZ A;  3RQI A;  3S3O A;  3N05 A;  3FMR A;  4AM3 A;  1WKM A;  2ZJ2 A;  3MMY B;  1BIA A;  3A0H C;  3GW2 A;  2VC1 A;  3DBH B;  3IL2 A;  1VQP I;  2KZG A;  4XLF A;  2ACJ A;  4G12 A;  2EFP A;  1ZEL A;  2L3D A;  3ZMT A;  5D5V B;  1BOA A;  1MMN A;  2L54 A;  4FHT A;  3LQR A;  1IV8 A;  2KDO A;  2J5P A;  3VPR A;  4CSW A;  5DDG A;  3G6E I;  4FAS D;  1UHM A;  2H94 A;  1JKQ C;  2DPD A;  3K2Z A;  2L7M P;  3PIP F;  2VI6 A;  5M3M J;  4HNT A;  1K78 B;  3PNT A;  3MQ0 A;  2R93 J;  4ENM A;  1T08 B;  1UJ8 A;  3LST A;  1RR8 C;  2HKO A;  2KP6 A;  2KJB A;  3I5U A;  4A0Y A;  2BY0 A;  2DMP A;  1V4R A;  1U5T B;  2OPT A;  4G8X A;  2ESH A;  2VQC A;  3DLL F;  2HPM A;  2J5O A;  1WJ5 A;  2K9N A;  2ME0 A;  1RZ4 A;  1XGO A;  3L00 A;  3G4S I;  3HRT A;  2O61 A;  1I6H J;  2M1B A;  3OR2 C;  4GFB A;  4ENN A;  1UCR A;  2NNN A;  2CRG A;  3S1Q J;  2M7B A;  1ZG3 A;  4HQM A;  1OCZ H;  2KFD A;  2DA3 A;  4O3M A;  3MVP A;  1UMQ A;  2EIM H;  4HF2 A;  2CW7 A;  2UXN A;  4KT5 C;  5HVQ C;  4IHY A;  1TWC J;  2UV1 A;  2LFB A;  1HKQ A;  3WTY C;  1O4X A;  3VYU B;  1U9N A;  2ZXI A;  4PCQ A;  1BR1 A;  3RKQ A;  4PGG A;  2BXY A;  3QRF F;  5CVJ A;  2YR2 A;  3F8M A;  5E3L A;  3K7A J;  3TGN A;  2KIM A;  3D5R C;  3KP4 A;  3HOZ J;  4RMN A;  1Y6I A;  4FX4 A;  3G1M A;  3QYB A;  1MBH A;  3ZMZ A;  3JAM Z;  2LD5 A;  1T0F C;  1MW7 A;  4BJ6 C;  2XUB A;  4G7Z F;  2DMN A;  1IRF A;  2R5Y A;  3J7A Y;  1D0Z A;  2H6B A;  2YX4 A;  2CUE A;  5CVR A;  2JQ7 A;  1ZRC A;  3NRV A;  3VOD A;  5D6F A;  4E70 A;  2LVS A;  2DOA A;  2R92 J;  5FRO A;  1QO0 D;  5JVG F;  2EV5 A; 
#chains in the Genus database with same CATH homology
 1MJ9 A;  2QLZ A;  1S8N A;  2M8E A;  5CLS A;  2CFX A;  4EM0 B;  1FT9 A;  3JAM K;  1R22 A;  3SXY A;  2V6C A;  4UVB A;  2CO5 A;  2MBF A;  3HTS B;  3IC7 A;  2XAF A;  1S29 A;  1STZ A;  2O3F A;  2OA4 A;  5CYV A;  3F8B A;  2HTJ A;  1B9M A;  4HX7 A;  3KET A;  1XSD A;  4I98 B;  2D1H A;  4XBF A;  3I54 A;  4OU0 A;  1R58 A;  2M5W A;  5A2Q Z;  1KQ0 A;  2MD5 A;  4L0Z B;  3MCZ A;  4RB2 C;  4OIP F;  1U2W A;  2XV4 S;  1K7A A;  3PQK A;  2DT5 A;  1LJ9 A;  4BH9 A;  4KIC A;  1FSE A;  2EK5 A;  3Q5F A;  4A6E A;  1TQM A;  4JBA A;  2DQR A;  1XGS A;  2V1D A;  2O6G E;  4DQ2 A;  1B4A A;  1IN4 A;  5BMZ A;  3MWM A;  2ZNY A;  3GVA A;  3WTZ A;  4HA8 A;  1LDK B;  5HDK A;  4IPA A;  1S7O A;  3BOQ A;  2MH2 A;  2LNB A;  1Z05 A;  3ZMS A;  4EQQ A;  2Y48 A;  2COM A;  5K1Y A;  2CG4 A;  1ZLJ A;  4U0V A;  4A0X A;  4AVP A;  1P2F A;  3ABT A;  3WE2 A;  4U7D A;  2VXZ A;  2DK8 A;  1KU9 A;  2DPU A;  3TO7 A;  1ZRE A;  5D5W B;  3VB2 A;  2AS5 F;  2FBI A;  5D6E A;  1FX7 A;  2W57 A;  4WXD A;  5FFZ A;  1OR7 A;  3WGH A;  2P5V A;  1U8R A;  1W7P A;  3TDU C;  1GXQ A;  4PDK A;  3V4G A;  1IN8 A;  2IPQ X;  1NHA A;  3E6D A;  1YTY A;  2FE3 A;  1ODD A;  4MHG A;  2PJP A;  2Y75 A;  1GXP A;  1FY7 A;  2WWY A;  5L3G A;  1IXS B;  1USS A;  2HTS A;  1ZN2 A;  4ZYH A;  4OMZ A;  3DEU A;  1B9N A;  3MFK A;  3WTT C;  5LEJ A;  3B73 A;  1LVA A;  2KJC A;  3P7N A;  1T6S A;  1QGP A;  1D3Y A;  2CW0 F;  2KKO A;  1B1B A;  3FMS A;  3BP8 A;  3ZN1 A;  1XN7 A;  1TNS A;  2G7U A;  1RUN A;  3P9K A;  2FXA A;  3H92 A;  3CTA A;  2FQ3 A;  3H3Z A;  5FD6 A;  5LLQ A;  3I59 B;  2XKP A;  3EET A;  5ICF A;  2HYG D;  2HQR A;  4YFN F;  3K1N A;  1Z1D A;  2BYV E;  1DPU A;  2DAO A;  5DUK A;  2ADU A;  3HSE A;  4O6J A;  3HOT A;  4RGR A;  1KGS A;  4EVI A;  3V7R A;  1R7J A;  3J81 K;  2K7L A;  5HLG A;  1AOY A;  3ML6 A;  1MDM A;  1FZP B;  4U0Y A;  4OMY A;  2DTR A;  5ICG A;  3KFW X;  2R7F A;  3WTX C;  2RV8 A;  4IJA A;  4XSZ F;  2PQ8 A;  3K9T A;  1SD4 A;  5ERI A;  3DF8 A;  3TKY A;  3F6O A;  4KMU X;  1WQ2 A;  4KDP A;  2HFH A;  4YG2 F;  5HS9 A;  3WTV C;  1OYI A;  5HDG A;  1XSV A;  4RB1 A;  1W7P D;  4IHT A;  5FD5 A;  4ETS A;  2A5Y B;  1HXD A;  2VON A;  1O3Q A;  4P9F A;  2R7D A;  2CWE A;  4KIG A;  2STT A;  4OIO F;  4RGU A;  1DPR A;  4BHP A;  3O3K A;  3KEO A;  2IW5 A;  4IRI A;  2PFB A;  1ZGA A;  2W25 A;  2VOP A;  1HKT A;  3W6J B;  1D5V A;  4IXA A;  2PG4 A;  4CDG A;  4BHC A;  1REP C;  4A0Z A;  5D5U B;  1J7K A;  4HLX A;  4M9S A;  4S04 A;  3VEP A;  3NQO A;  3WGG A;  1IF1 A;  1OPC A;  1ZLK A;  5L3B A;  1MJA A;  3MZH A;  2LSO A;  2VOD A;  3ECH A;  5LHI A;  2PLY A;  1I6X A;  1G3T A;  3JSP A;  4GO1 A;  4MQV A;  4TV7 A;  5KK1 A;  2V9V A;  2W85 A;  1O7L A;  3RI4 A;  3BPX A;  1BN5 A;  4KMF A;  3I0T A;  2EFO A;  2CSO A;  1I1S A;  3GFI A;  3ROU A;  2FF4 A;  3FXU A;  4UV8 A;  4LD5 A;  5TRD A;  1O3T A;  4A12 A;  2V79 A;  4KN4 X;  3GFM A;  4QLC U;  3GXO A;  5DV5 A;  1K78 A;  2XGX A;  1OYY A;  2XHK A;  5AIQ A;  2JSC A;  2NRA C;  5HS7 A;  3U1D A;  3C7J A;  2WC2 A;  1KU2 A;  1O3R A;  3KLN A;  4B09 A;  2Z9O A;  4G7H F;  4Z2Y A;  3QU3 A;  2E1N A;  1S7A A;  2CYY A;  4ESF A;  3JTH A;  3CO6 C;  1KYZ A;  1XGM A;  2P5L C;  1R1U A;  3GEZ A;  4OOI A;  1VTN C;  3KP3 A;  3OOP A;  4RB3 C;  1YO5 C;  1MKM A;  4M6Y A;  3IKT A;  4M6X A;  1CF7 A;  1QBJ A;  1S6L A;  3F3X A;  4EMS A;  3U2R A;  3SQN A;  1L0O C;  4ZYG A;  1QZZ A;  2O03 A;  4K2E A;  5BPI A;  1TW2 A;  2P6S A;  2ZME B;  1D8J A;  1FBQ A;  3FM5 A;  4EJT A;  3R0A A;  1YW9 A;  5LGN A;  2GA2 A;  3QAH A;  3HYI A;  3GLX A;  1FLI A;  5EEH A;  1I1G A;  2JPB A;  3F8N A;  5E1W A;  1YLF A;  1PP7 U;  1BC8 C;  1X3U A;  2AXL A;  2EFQ A;  3WE3 A;  3K1P A;  3WG9 A;  5LRR A;  1IW7 F;  2QEN A;  1T98 A;  3QP5 A;  3ZPL A;  4HDU A;  2E7W A;  2H6C A;  4YFK F;  4ZYD A;  4OIQ F;  3L2C A;  4M71 A;  2OBP A;  3DPL C;  1UB9 A;  3HRM A;  5E18 F;  2JZY A;  5AON A;  1IN7 A;  2OD5 A;  3VOE A;  1KU3 A;  5FLX K;  1R1V A;  1E17 A;  1WI9 A;  4BQA A;  1FNN A;  3L09 A;  4KA4 A;  3IRQ A;  2IVM A;  2F5C A;  1ON2 A;  3HOS A;  3T0Y A;  1RIO H;  4MEY F;  4RGX A;  5E17 F;  3JTG A;  2ELH A;  1TBX A;  3RPU A;  4WK8 F;  2A6E F;  4KFC A;  1XB4 A;  3F21 A;  1FBU A;  1IRG A;  2K4J A;  2EJR A;  5LGT A;  2NAZ A;  2BEO A;  3KE2 A;  3EDP A;  5F6F A;  1YQA A;  3LAP A;  3RIR A;  2R3S A;  3REO A;  5LBQ A;  2V1X A;  3CUO A;  1JGS A;  4D0P A;  2QZ8 A;  1Z6R A;  3ZN0 A;  1R5G A;  3SZT A;  3E97 A;  1Z7U A;  4HAM A;  4U0W A;  1UST A;  3TOA A;  4HF1 A;  2PI0 A;  1MJB A;  3KLO A;  5BOX A;  1IN5 A;  3G3Z A;  5BS6 A;  4KN7 X;  1W5T A;  2D45 A;  1U78 A;  2FNP A;  3MEX A;  2RNJ A;  4R1H A;  1QZY A;  1FPQ A;  4Y13 A;  2YU3 A;  3ERE D;  1FYM A;  4WX9 A;  4UV9 A;  2IA2 A;  1ZRD A;  5LHH A;  3BDD A;  2HEO A;  3C1D A;  2QQB A;  2OQR A;  4U88 A;  4LMY A;  3SHF A;  3SFZ A;  5HS8 A;  1RUO A;  2L02 A;  3IWF A;  4MTE A;  1H9G A;  2EV0 A;  1YS7 A;  1IXC A;  2FBH A;  1Q1H A;  2XIG A;  5EEG A;  1O57 A;  3GWZ A;  4L9V A;  3ABU A;  3WU0 A;  5CVU A;  4YII A;  1FP1 D;  1XCB A;  3I59 A;  3JSO A;  5K5O A;  1FSH A;  4HOB A;  3BY6 A;  1BI1 A;  3CJN A;  2ZO4 A;  4P96 A;  1J9I A;  3LFK A;  2HWV A;  1P92 A;  4NQW A;  4UNO A;  2IA1 A;  1ZAR A;  3ZP5 A;  1J5Y A;  4L9J A;  1ZAO A;  1SMT A;  4EM1 A;  3HHG A;  4BYY A;  1LEA A;  1K6O A;  1P4X A;  5J8C A;  4XSX F;  3F72 A;  3T8T A;  3ZMD A;  4NHJ A;  4HW0 A;  1DDN A;  3C3W A;  1IN6 A;  3IKV A;  5J6X A;  1L3L A;  5ILU A;  4UVA A;  4ENK A;  1SD6 A;  1HKS A;  1Z9C A;  4BXU A;  4KUM A;  5H6R A;  2DI3 A;  2Y0M A;  1T39 A;  2JRT A;  2RGV A;  2DQL A;  2W84 A;  4EGZ A;  4B8X A;  1TQP A;  4HX4 A;  4I01 A;  1G3Y A;  3Q9S A;  4KIF A;  3T8R A;  3RPQ A;  5ICC A;  2EV6 A;  3M8E A;  1I27 A;  2GWR A;  2QQA A;  1GHC A;  4Q47 A;  2BGC A;  4HBL A;  2LF8 A;  5H20 A;  2MLK A;  4ZH4 F;  3R6S A;  4HZF A;  2FBK A;  2VC0 A;  4ON0 A;  4LGW A;  2K02 A;  3J81 Z;  3GFJ A;  1SD7 A;  3ISP A;  1SFE A;  3HHH A;  3KP6 A;  5ILS A;  3RKW A;  1Z6T A;  4A2U A;  2JTV A;  1TTY A;  3RJP A;  2L4A A;  1A04 A;  4ZZD A;  1W4M A;  4M73 A;  1FOK A;  4LLN A;  1ZYR F;  2LKP A;  3FXQ A;  4HV6 A;  5D4R A;  5HOO A;  2QQ9 A;  2QBY B;  3C18 A;  4ZZL A;  4FX0 A;  4M72 A;  5ED4 A;  1YG2 A;  2JPC A;  4LFU A;  5D5X B;  3L7W A;  1U6G A;  3KCC A;  3FMQ A;  1S3J A;  2EWN A;  2FOK A;  3CUQ B;  5CVI A;  2HYF A;  2VBY A;  2DBB A;  1YS6 A;  3T1B A;  1DUX C;  5DD8 A;  1TW3 A;  2P8T A;  1FBS A;  3N97 A;  3E3V A;  1FP2 A;  1R23 A;  1JXS A;  2V1U A;  4GCV A;  3KP7 A;  4I7H A;  3QP6 A;  1XDU A;  5IT9 K;  3DV8 A;  2X4H A;  2OAZ A;  1R00 A;  1ZRF A;  1PUE E;  4Y15 A;  2Z99 A;  5FO5 A;  2GAU A;  3BWG A;  4P9U A;  2D1V A;  5LGU A;  4WF2 A;  3WTS C;  1FC3 A;  2Q8K A;  3HRU A;  2YPR A;  2O8X A;  2XAQ A;  2FNA A;  1KQ9 A;  4Q5S F;  2VE9 A;  5KVR A;  4ENJ A;  1DP7 P;  2FSW A;  1J0R A;  1WRJ A;  4HF0 A;  3WGI A;  3F6V A;  4JK1 X;  2OZ6 A;  5K5R A;  4GGG A;  2LF7 A;  3K69 A;  3N4M A;  1Y0U A;  2GIV A;  3IWZ A;  3GZ5 A;  3DFG A;  4MTD A;  3D5L A;  1EV7 A;  4HYE A;  1GVJ A;  2NYX A;  4LLL A;  1ZG5 A;  2JT1 A;  3DP7 A;  3SZP A;  2K86 A;  5F64 A;  3R61 A;  1UFM A;  1RNL A;  2E1C A;  1T38 A;  3Q9V A;  3FXR A;  1OKR A;  3KZY A;  1YFH A;  2CQK A;  2VBZ A;  3RTR A;  2L4M A;  3FF5 A;  4L0Y B;  2FU4 A;  2A07 F;  3GO5 A;  4IHS A;  1U5T A;  1BBY A;  1HW5 A;  5DCM B;  2Q2E A;  3LA2 A;  4DNC A;  1HQC A;  1RI7 A;  4M9X A;  1LDJ A;  4G9Y A;  1IXR C;  3KP5 A;  2RN7 A;  1JHF A;  2OZU A;  4CIC A;  4AIJ A;  4LG0 B;  4AD9 A;  4A6D A;  5J8F A;  3EYI A;  4HLY A;  5L3C A;  1T0F A;  4G6Q A;  3TO6 A;  5LHG A;  2MC3 A;  2D2W A;  2P6T A;  1BI2 A;  2G7H A;  3E5U A;  4N9I A;  2QYO A;  2VT3 A;  3F8C A;  2EFW A;  3RKX A;  2PMU A;  2HZT A;  3KZZ A;  2RQP A;  1BM9 A;  3DPT A;  1EH8 A;  2HR3 A;  2XAG A;  1TNT A;  1H0M A;  2QVO A;  2RDP A;  2NS0 A;  5JR3 A;  1F5T A;  2RC4 A;  4Q48 A;  2M87 A;  3K0L A;  1ON1 A;  4GYG A;  2VBX A;  2DO7 A;  5CVV A;  2MLG A;  2BBY A;  3R4K A;  5D4S A;  4P55 A;  5DCF A;  1MZB A;  2DW4 A;  4PGH A;  4I2O A;  1JHH A;  3COA C;  4JQF A;  1HW1 A;  2PN6 A;  4LK0 F;  4MQ9 F;  5FLX Z;  3R0J A;  2EA4 A;  1R36 A;  3HSF A;  2OU2 A;  1OMI A;  4P5O A;  4EV0 A;  4BNC A;  5E1X A;  3LAJ A;  1J75 A;  1FYL A;  3BPV A;  2ZCW A;  4HX8 A;  2DLL A;  4XLN F;  2HGC A;  4BHB A;  2KIU A;  3V7S A;  1D8K A;  2IA0 A;  5AIP A;  1BIB A;  2M45 A;  1QQI A;  1BI3 A;  3S2W A;  2IT0 A;  1ULY A;  2Z33 A;  4GYI A;  1ZHF A;  3GF2 A;  3DXJ F;  1C0W A;  4L5J A;  2ZNZ A;  3BJ6 A;  3I58 A;  4XLP F;  5E1Z B;  1F9N A;  3LQQ A;  1U3E M;  4S05 A;  2Q0O A;  3D0S A;  2GQQ A;  5DYM A;  1V3F A;  1U5T C;  3DKW A;  4IVN A;  3ZMV A;  3GYH X;  4CXF A;  6PAX A;  1W5S A;  2KIF A;  4ZYE A;  5LRS A;  1QPM A;  1CF7 B;  4ESJ A;  4L5I A;  4M74 A;  4AWX B;  3WTU C;  3AAF A;  2ISY A;  2ZFW A;  2HS5 A;  4UXN A;  2A6H F;  1AWC A;  2GXB A;  2DK5 A;  4CO8 A;  4YFX F;  4RB0 A;  1TLH B;  4R79 A;  3V8J A;  3PQJ A;  3V8K A;  3OV8 A;  4EJW A;  2X0L A;  1OYW A;  3M9A A;  5TJJ A;  1G3W A;  3T5X A;  4G7O F;  3RYR A;  3J80 Z;  2DFI A;  4LB6 B;  3K1M A;  3CLO A;  4WCG A;  3HIF A;  4WXH A;  3LWF A;  1IAW A;  2H09 A;  2ZBK A;  4I0B A;  1YW7 A;  2BE5 F;  4WWC A;  5D8L B;  3P9C A;  2F5D A;  2FEZ A;  3J80 K;  4F7Z A;  4RAY A;  1XGN A;  1ZH5 A;  2Z3Y A;  2GXG A;  1SFX A;  3FWE A;  1KQ8 A;  3E5Q A;  3FHZ A;  4UUV A;  5ILV A;  3CO7 C;  3BZ6 A;  4WXC A;  1XMK A;  4M9Z A;  4AIK A;  4EM2 A;  4KNY A;  4MGR A;  4U7B A;  4CZZ A;  1KA8 A;  3U9G A;  4A5M A;  2W24 A;  1YW8 A;  3PFI A;  2IJL A;  4KIB A;  2P4W A;  2FML A;  4YIF A;  5A2Q K;  3ULQ B;  4I0A A;  2UWM A;  2P7C B;  4GXO A;  3M8F A;  2C6Y A;  2QBY A;  3M7G A;  4FT8 A;  5HLH A;  3E5X A;  1O3S A;  2KRF A;  2PMH A;  3GUD A;  2QUF A;  2ETH A;  3TDZ C;  2VT2 A;  5FB2 A;  1LQ1 A;  2L01 A;  2F5E A;  1WSU A;  2O0Y A;  3CUQ A;  2HOE A;  2F2E A;  1G6N A;  2Z5U A;  2XAS A;  4HDV A;  2YX7 A;  1SMY F;  3I71 A;  3LA7 A;  3M1E A;  1Z91 A;  2STW A;  2H27 A;  1FWZ A;  3GZ6 A;  1G3S A;  2M30 A;  3L9F A;  3QPH A;  1E2X A;  4N0B A;  1J59 A;  2VN2 A;  5D8K B;  2UZK A;  3FM3 A;  3J7A O;  2E7X A;  1LEB A;  3QU6 A;  2GZW A;  2A68 F;  4IRH A;  3E6B A;  3JW4 A;  4L9N A;  1MGT A;  4O5V A;  5F1R A;  1HST A;  1EH6 A;  3FX3 A;  4G94 A;  2G9W A;  2RKH A;  2FRH A;  5DEQ A;  3HSR A;  2A3S A;  2HDC A;  1I5Z A;  1PP8 F;  2VBW A;  3QOP A;  3HUG A;  3KP2 A;  5JI6 A;  2A61 A;  4UHT A;  4LB5 A;  4EJV A;  3QPT A;  1TQI A;  1XMA A;  1B59 A;  4R8H A;  4RAZ A;  1KU7 A;  5L3D A;  1LDD A;  5H6Q A;  4I02 A;  2TDX A;  2FMY A;  4LK1 F;  3IRR A;  1LB2 A;  3MAJ A;  3GX4 X;  5IT9 Z;  2VOO A;  1J2X A;  2ISZ A;  3WU1 B;  5DCM A;  4RS8 A;  3VFZ A;  3GFL A;  4ESB A;  2IP2 A;  1BI0 A;  4XRF A;  1FYK A;  1SD5 A;  2DU9 A;  2EA2 A;  1ZGJ A;  4LG0 A;  2K27 A;  1CGP A;  3ZQ7 A;  3HTU A;  1WWX A;  4ASN A;  1XCV A;  1W7P B;  4IF4 A;  1B6A A;  2RVC A;  1XDS A;  4LJZ F;  1P4W A;  1UHW A;  5JFR A;  4PZJ A;  2WTE A;  3E6M A;  2PBI A;  3CUQ C;  5E8I A;  2ZXJ A;  3I4P A;  2ESN A;  3IHU A;  3KEQ A;  3RDI A;  3V8L A;  5L3E A;  5JVT A;  2XAH A;  4Y17 A;  3I64 A;  2XRO A;  2ZME A;  2K4B A;  3EUH A;  5L3F A;  2A69 F;  4A5N A;  3O6B B;  4RGS A;  3I53 A;  4CYD A;  3RYP A;  3ZMU A;  4LLG F;  1LNW A;  1SAX A;  3DQV C;  4Q4Z F;  1F1Z A;  1R5H A;  5E8G A;  5DUI A;  1HW2 A;  2UXX A;  2WV0 A;  4EGY A;  3TOB A;  4I09 A;  3LA3 A;  1P4A A;  1BC7 C;  3FZV A;  4N9H A;  3RKY A;  3TQN A;  5CJ9 A;  2IRF G;  2HQN A;  2XAJ A;  4L9T A;  4UVC A;  4AIH A;  1HBX G;  4EJO A;  2XKO A;  2LDU A;  4MEX F;  5IT3 A;  2P5K A;  4CHU A;  3CDH A;  2MH9 A;  1SFU A;  1IZ1 A;  3WTW C;  4NB5 A;  4L18 B;  5E20 A;  1MDM B;  1QNT A;  1IUY A;  2MA3 A;  3H3U A;  1ZG1 A;  3F23 A;  2QM3 A;  1YIO A;  3TO9 A;  5FGM A;  2NNY A;  3E6C C;  3BJO A;  1F4K A;  2YSR A;  1O7F A;  3P9I A;  4MNU A;  2CGP A;  4OIR F;  4KYW A;  1KYW A;  1HSJ A;  3NEU A;  3R60 A;  1PDN C;  3BJA A;  1XD7 A;  5LEK A;  4G6D A;  5ICE A;  5JHU A;  4CGZ A;  3ECO A;  5HLI A;  2ZKZ A;  3WOD F;  2EB7 A;  1YYV A;  1P6R A;  5DD4 A;  3W6K B;  3ELK A;  3B02 A;  2VE8 A;  2OQG A;  1K79 A;  3BRO A;  2EFN A;  1R1T A;  4HV5 A;  3F8F A;  2GA1 A;  3O2P E;  5FFX A;  3MZY A;  2F5F A;  2B0L A;  2XVC A;  3V7C A;  1T2K A;  1H9T A;  1XSX A;  2FA5 A;  1BJA A;  1EH7 A;  3EYY A;  5BPD A;  4QWQ A;  5BQT A;  3EQL F;  1ONV A;  2PEX A;  4EJU A;  4BAY A;  4OIN F;  3HRS A;  3F22 A;  3G73 A;  4H0E A;  2QWW A;  4HQE A;  2BV6 A;  2P7V B;  5K5Q A;  1G4D A;  5HDN A;  4IRG A;  1JE8 A;  2XRN A;  1MD0 A;  2HKX A;  3FMR A;  1WKM A;  2ZJ2 A;  1BIA A;  3GW2 A;  2VC1 A;  2ACJ A;  3IL2 A;  2EFP A;  2L3D A;  3ZMT A;  5D5V B;  1BOA A;  2L54 A;  4FHT A;  3LQR A;  2J5P A;  5DDG A;  1UHM A;  2H94 A;  2DPD A;  3K2Z A;  1K78 B;  3MQ0 A;  4ENM A;  3LST A;  2HKO A;  3I5U A;  2KJB A;  4A0Y A;  1V4R A;  1U5T B;  4G8X A;  2ESH A;  2J5O A;  3L00 A;  1RZ4 A;  1XGO A;  3HRT A;  2O61 A;  2M1B A;  4ENN A;  1UCR A;  2NNN A;  1ZG3 A;  4HQM A;  4O3M A;  4HF2 A;  2UXN A;  4KT5 C;  5HVQ C;  1HKQ A;  3WTY C;  4PCQ A;  4PGG A;  3QRF F;  5CVJ A;  2YR2 A;  3F8M A;  3TGN A;  2KIM A;  3KP4 A;  4FX4 A;  3ZMZ A;  3JAM Z;  2XUB A;  4G7Z F;  1IRF A;  2H6B A;  2YX4 A;  5CVR A;  1ZRC A;  3NRV A;  3VOD A;  5D6F A;  4E70 A;  1QO0 D;  2EV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...