1D5VA

Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11 (s12)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
MLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the DNA-binding domain of the adipocyte-transcription factor FREAC-11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords S12 TRANSCRIPTION FACTOR (FKH-14)
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d5vA00
2QQBA 2ISYA 1O57A 1QO0D 2ETHA 5HDGA 2F5EA 1BN5A 5E1ZB 3O3KA 2PMUA 2A6EF 1WI9A 5DCFA 2KIUA 4I0BA 1BI3A 1F5TA 4Q5SF 3K0LA 1W7PB 5CVIA 3EETA 4R8HA 2M5WA 4M9ZA 3CLOA 4ESJA 4I09A 2XHKA 1XGMA 3SZPA 5E8IA 3W6KB 1O7LA 3WU1B 1HSJA 3QPTA 3SHFA 1BIBA 1IRGA 2ZNYA 4ESBA 4Y13A 3F72A 3K2ZA 3CDHA 1P4WA 2GXGA 5AONA 1JXSA 1FT9A 2TDXA 1HKSA 3LWFA 1OMIA 3KZZA 1YW7A 2DQLA 4HX8A 4KMUX 5IT3A 3WGGA 3G3ZA 5BOXA 3BY6A 5E8GA 2Q0OA 1R1TA 1UHMA 3R0AA 2LSOA 2ZMEB 2GQQA 2P5LC 3V4GA 2FEZA 3RKXA 5LEKA 2H6BA 2WWYA 2RDPA 3T5XA 3COAC 2MLGA 5CVJA 3OOPA 4LLNA 2HQNA 2A61A 2V9VA 4Q47A 5AIQA 1ZLKA 4A6DA 2QBYB 2EV0A 3I54A 4KUMA 2VE8A 1YYVA 4RGRA 2E7XA 1K78A 2OQGA 3J80K 2VT2A 4I0AA 4KT5C 3EDPA 2P6TA 3FHZA 2FRHA 2PJPA 2ESHA 4JQFA 3RPUA 4KMFA 1HW2A 3CUQB 2AXLA 2LNBA 1IRFA 4P9UA 4GYGA 3ZPLA 3F8CA 2OZ6A 1R23A 4OIOF 2KIFA 4ENKA 4OINF 2ZJ2A 2VONA 3V7SA 1QGPA 3ISPA 4HZFA 3MCZA 3KEQA 2B0LA 3QOPA 5D6FA 1Z9CA 2K02A 3P9KA 2HR3A 4HW0A 1EH8A 3WTWC 4UVBA 3ULQB 1JGSA 3HSEA 4LMYA 3MZYA 2H09A 4ZYEA 3GUDA 3J81Z 2BEOA 4CXFA 3LFKA 4Z2YA 3GWZA 2Z3YA 4YIFA 3HRUA 1OR7A 2LDUA 3G73A 1ON1A 4A6EA 2OQRA 4RB1A 4ZYGA 2DLLA 4JK1X 1MD0A 3I53A 1W7PD 4P9FA 1DPUA 1OYWA 5HS8A 4KDPA 3C1DA 3ABUA 2ISZA 2LF7A 2NAZA 5HDNA 2OBPA 4O6JA 1S8NA 1O3RA 3JTHA 4YFNF 2P7CB 2XIGA 5ILSA 1LNWA 1CGPA 4A0YA 1FY7A 2RQPA 3E3VA 5F64A 3TGNA 3RYRA 1P4AA 3CJNA 3HRTA 1ONVA 1TW2A 3RIRA 3WU0A 2G7UA 1XCBA 3M9AA 1O3SA 4F7ZA 1U6GA 2PMHA 2V1XA 4M6YA 2VBZA 3ECHA 3GZ5A 4A0ZA 1XMAA 1FSEA 1Z6RA 2CFXA 4MTEA 1SD5A 2YX7A 3DPTA 1ODDA 4CICA 2JPBA 5HS7A 1USTA 1L0OC 2BYVE 3VOEA 2HYGD 3DV8A 4U0WA 4BQAA 3PQJA 4HF1A 4JBAA 1SD6A 2HKOA 4HLXA 3GXOA 4GO1A 4EMSA 3ZN0A 1TLHB 4ZZLA 1GVJA 1XD7A 4KNYA 4HOBA 5JVTA 1CF7B 5CJ9A 1LEBA 2QLZA 2FMYA 3F6VA 3V8LA 5E1WA 3RKWA 3R60A 3TKYA 2IA0A 4ON0A 2VE9A 4U88A 2ELHA 4CHUA 1Z05A 1CF7A 5L3CA 2L02A 1UCRA 3E97A 3J81K 5D5WB 1G4DA 4HF2A 3WE3A 1T2KA 1QPMA 2PLYA 1TBXA 1LB2A 4I2OA 1T39A 3V8KA 5BQTA 5E1XA 2V79A 3EYIA 4XLNF 1E2XA 1YLFA 5LEJA 4ENNA 3KP2A 1HKTA 1OKRA 3TOAA 2FBIA 1I5ZA 4CDGA 4L9TA 3C7JA 4L5JA 2O8XA 2IRFG 3Q5FA 2QWWA 1K6OA 1B9MA 5D5UB 4I7HA 1G6NA 1R00A 5L3GA 4P55A 3R4KA 4G7HF 2XAJA 4IF4A 1R7JA 3E5UA 5IT9Z 2O0YA 4E70A 2L01A 4ZYDA 2NNNA 1FP2A 2Q8KA 3KEOA 3TO7A 3IWFA 5CLSA 3WE2A 3E5QA 1FNNA 2O6GE 5JR3A 1H9GA 2K4JA 1FP1D 3RKYA 1U2WA 3P9CA 4FX0A 3V7RA 1ZG1A 1XGNA 1T98A 3R6SA 3DPLC 3R0JA 1E17A 3ZMSA 3I64A 3MQ0A 2IW5A 3F8FA 2VOPA 3FM3A 2RGVA 1Y0UA 2UZKA 3KLOA 1I6XA 4AVPA 1Q1HA 2FSWA 3CUQC 2XUBA 4Q4ZF 3N4MA 2F5CA 3NQOA 3ZMVA 5JI6A 1BC7C 2V1DA 4XBFA 4AWXB 1SD4A 2OAZA 3LAJA 4EV0A 4I98B 3KETA 4AIKA 1B4AA 5HLIA 2M30A 3BROA 3NRVA 5FD5A 4N0BA 3BJOA 2DW4A 5HLGA 4MEXF 4HYEA 3ZMUA 1J7KA 2DTRA 3TO9A 1KQ9A 4A5MA 3JAMZ 5CVRA 1UHWA 1HBXG 3TQNA 1ZH5A 2DPUA 2HOEA 1KYZA 3R61A 1K79A 2XVCA 5FD6A 1WKMA 3HTSB 2QYOA 3LA2A 3O6BB 4UHTA 1TQIA 5DV5A 2QM3A 3K69A 2L4AA 2DO7A 1ZREA 1GXQA 3WTZA 2A6HF 2VBYA 2FE3A 3LQRA 4P5OA 2COMA 4TV7A 5FO5A 3OV8A 3ZQ7A 3IL2A 1ZRCA 1LVAA 4LB5A 1R5HA 1XB4A 1ZARA 2M1BA 4ETSA 4UNOA 2OD5A 1R36A 1YS6A 1IN5A 3KP6A 3EYYA 5IT9K 1Z1DA 1YIOA 3ECOA 3GW2A 3M8FA 1TNSA 4H0EA 4ZYHA 2UXNA 1ZG5A 1REPC 1TW3A 4OOIA 2EFPA 2OA4A 4S05A 3HSRA 3C3WA 3HOTA 1IN4A 3SFZA 1FSHA 2ZNZA 5BPIA 4EGYA 1ON2A 2WC2A 2WV0A 5H6RA 3TDZC 3QU6A 4G6QA 5D4RA 1J2XA 3WODF 3VB2A 2K86A 4A5NA 5ICCA 4ZH4F 1EV7A 2P8TA 4OU0A 1BOAA 1F4KA 4A12A 1OYYA 4DQ2A 2HTJA 5FFXA 1MJ9A 1P4XA 1FZPB 1TNTA 3L00A 1MZBA 1AOYA 5H20A 5A2QK 3ZP5A 3RYPA 3VODA 4HV6A 1U3EM 2IA1A 1QQIA 5LBQA 2O3FA 3MEXA 4GYIA 2ESNA 4L0ZB 4WX9A 1BC8C 2X4HA 2EB7A 2P5KA 2FNAA 2PFBA 2FNPA 5FB2A 1OPCA 1D3YA 1BI0A 4MGRA 3BZ6A 1UB9A 3C18A 4EJVA 1HKQA 3GYHX 1RUNA 3P9IA 2VN2A 3GFLA 3LA7A 3KP4A 1MJAA 4AIHA 4LGWA 2DU9A 1IF1A 2NYXA 3DXJF 3WTXC 4L0YB 5FGMA 4KICA 1WWXA 5F1RA 3IC7A 2J5OA 1RUOA 4LG0B 1FOKA 3ZN1A 2QENA 1FLIA 4Y17A 1OYIA 4ENJA 2Y48A 3WTTC 3REOA 5ED4A 2KJCA 1B1BA 1S7AA 1G3TA 3WTSC 1O3QA 2L4MA 1T0FA 5AIPA 2IA2A 1W5SA 2PI0A 3IKTA 1R22A 1MGTA 1ZN2A 2HS5A 5ICGA 4B09A 2W84A 2Z99A 3AAFA 1RI7A 1BI2A 2J5PA 2RKHA 3GFMA 3V8JA 4OMYA 3MAJA 1XMKA 2F2EA 3SZTA 3FXQA 4G7ZF 2QBYA 2VC0A 1XCVA 4A2UA 3I59B 3ZMTA 1QBJA 5DUKA 2MLKA 2QQ9A 5E17F 1FBSA 2FBHA 1S29A 4LLGF 3E6CC 2R7DA 2PQ8A 1HW1A 2F5FA 2FQ3A 5D6EA 2D1VA 2ZBKA 4CZZA 3T0YA 1YO5C 3WTVC 2GWRA 3VEPA 5H6QA 1JHHA 4L9JA 4M9SA 5D5XB 3WG9A 2ZMEA 4HX7A 2K4BA 4EM1A 3RPQA 2MH9A 2G9WA 5LRRA 3FXUA 3KZYA 4KA4A 2EV5A 3U1DA 4DNCA 1S3JA 3I0TA 3HSFA 4M74A 1ZYRF 1MKMA 1W4MA 2EFNA 3KCCA 5KK1A 5HLHA 1U8RA 3HUGA 4RAYA 1SD7A 4O3MA 4LK0F 1Z6TA 3FXRA 1DPRA 2PG4A 2RV8A 1I1SA 4L9NA 4RAZA 3Q9SA 4EJUA 4G94A 3NEUA 3E6MA 1Z91A 3D0SA 1C0WA 1BIAA 1H0MA 4EM2A 4BHPA 1ZLJA 5DD8A 4LD5A 2MH2A 4EJTA 3MZHA 5LLQA 3QRFF 3DEUA 2STWA 4RB2C 2ZFWA 3ELKA 3WGHA 1D5VA 3HRSA 4OMZA 2W24A 2A69F 3KP5A 5CVVA 4LK1F 1HQCA 2LKPA 3BP8A 4GCVA 3HOSA 1V4RA 1IN8A 2HQRA 4IHSA 1R1UA 1IUYA 2QQAA 2KJBA 5LGNA 2YR2A 2Z9OA 2WTEA 4KIBA 1BJAA 1U5TB 2V1UA 2GZWA 5L3BA 2EK5A 2Z5UA 4HV5A 3DFGA 2JZYA 1TTYA 1H9TA 1J59A 2FXAA 4NB5A 5JFRA 4BYYA 3F23A 1R5GA 4IJAA 3Q9VA 5J6XA 2ZO4A 3GF2A 4YIIA 3SQNA 2E7WA 1G3YA 1IXRC 2M8EA 2O03A 2E1NA 1SMYF 3BPXA 4WF2A 3GX4X 2XASA 3WTYC 2EV6A 3KE2A 5A2QZ 3DF8A 4HQMA 4OIQF 3DP7A 1A04A 1ZAOA 1IXCA 2RVCA 4KYWA 3FMQA 1T38A 5CVUA 2H27A 4BH9A 3ZMDA 5ERIA 3SXYA 2IJLA 3F3XA 3HRMA 2P7VB 3M1EA 2DI3A 4Q48A 5BPDA 2RC4A 2H94A 1L3LA 2HWVA 4P96A 3TDUC 4YFKF 2CG4A 4U0VA 3CTAA 3L9FA 2W85A 4N9HA 1FPQA 4I02A 3J7AO 1B6AA 2K27A 5CYVA 2XGXA 3TOBA 6PAXA 3KLNA 1XGSA 4BAYA 4WWCA 4HF0A 3LAPA 1RIOH 4IVNA 1KGSA 2MD5A 4PZJA 5EEHA 2JTVA 1EH6A 1K7AA 2KKOA 4LLLA 1FX7A 1PUEE 4U0YA 3DQVC 3D5LA 3W6JB 4NHJA 1F1ZA 1WQ2A 2EA2A 2GA2A 4LFUA 3F8NA 5FFZA 2W57A 2W25A 2Z33A 3QP5A 2OU2A 3JTGA 1SFXA 4LB6B 3HHHA 2XAHA 2M45A 1DUXC 2XROA 2A3SA 2PN6A 2DAOA 3H3ZA 1J9IA 5L3DA 3K9TA 1U5TC 2ADUA 3GZ6A 1PP7U 1ZHFA 3FMSA 1JHFA 1HXDA 2LF8A 3L7WA 2VBWA 4OIPF 2CSOA 4PGHA 4EJOA 3EQLF 1KQ0A 3GLXA 2DK8A 1TQMA 3GEZA 1SFUA 3F21A 2EFWA 2L54A 1KYWA 1MDMA 1KU3A 2HGCA 5L3EA 3RJPA 5J8CA 5EEGA 4R1HA 3RI4A 4CYDA 4HDVA 2DBBA 3T8TA 4AIJA 2BGCA 1KU7A 2HTSA 2R3SA 5FLXK 3WTUC 4QWQA 2XV4S 2HZTA 3M8EA 1QNTA 4CO8A 5K5OA 5J8FA 1FWZA 5L3FA 4EGZA 5ICFA 1F9NA 3E6DA 2AS5F 1XSXA 4XSXF 4G7OF 1FBQA 4UV8A 4LJZF 2BE5F 5ILUA 5HS9A 4ESFA 1XSDA 2HKXA 1T6SA 2UWMA 1G3SA 5HDKA 1WRJA 5LGTA 1FBUA 2D2WA 1HW5A 2STTA 4M6XA 3ZMZA 4EQQA 3O2PE 5FLXZ 3FF5A 2CYYA 2A5YB 2KIMA 3HYIA 4WK8F 3ML6A 4N9IA 4Y15A 1G3WA 1SFEA 3U2RA 3H92A 4OIRF 1S6LA 3P7NA 3CO7C 3GO5A 1KA8A 2MA3A 1FYKA 3F6OA 3CO6C 4UVCA 4YFXF 4HLYA 1YTYA 1P92A 5JHUA 3LSTA 5DDGA 4MHGA 4MNUA 4LG0A 3I58A 2C6YA 2YPRA 3N97A 2EWNA 3M7GA 3V7CA 2MC3A 3E6BA 3JAMK 1USSA 1LJ9A 2ACJA 3MWMA 2JRTA 4ASNA 1J5YA 1BM9A 3BDDA 1ZGJA 3QP6A 1YQAA 2OZUA 3LQQA 5LGUA 2A68F 4BXUA 4B8XA 2PEXA 1RNLA 4BHCA 5DYMA 3K1MA 4M9XA 1SAXA 1IW7F 1KQ8A 4M71A 4UUVA 2EJRA 4IRIA 2PBIA 3QAHA 2L3DA 4GGGA 1D8KA 4WXHA 4UXNA 3KP7A 4U7DA 1YFHA 1MDMB 2DQRA 1YS7A 2KRFA 3JSOA 1K78B 3BPVA 3HTUA 4HDUA 4HQEA 4IRHA 4EVIA 4FT8A 2NNYA 1YW8A 2Q2EA 3E5XA 4BNCA 1IN7A 2VT3A 1IZ1A 5D5VB 1V3FA 1WSUA 3TO6A 4UV9A 4ENMA 5HVQC 2A07F 4FHTA 1MJBA 5DCMB 4WXCA 1W5TA 3I71A 2IT0A 4G6DA 3I5UA 1R1VA 5LHHA 5D4SA 4PDKA 5DCMA 1UFMA 1ZGAA 1I27A 3PFIA 3FX3A 2BV6A 2ZKZA 2FBKA 4GXOA 3EUHA 2VBXA 2ZCWA 3IHUA 5LRSA 2FOKA 1LDKB 1X3UA 5LHIA 2G7HA 4BHBA 1XDSA 2IP2A 3BJ6A 4IRGA 2YU3A 1KU2A 4RB0A 1HSTA 2O61A 1J0RA 3FMRA 1LDJA 1JE8A 2GAUA 3U9GA 2CWEA 4XRFA 4L9VA 1I1GA 4PGGA 2GIVA 2XRNA 5ILVA 3LA3A 2QVOA 2H6CA 2M87A 2VXZA 1BBYA 4EJWA 1P2FA 3ROUA 1P6RA 2RN7A 4IPAA 2MBFA 4M72A 1W7PA 2NS0A 4A0XA 3ABTA 2HEOA 4XSZF 2YSRA 1O7FA 2X0LA 3QU3A 4MEYF 2FU4A 5ICEA 1LDDA 1NHAA 1U5TA 4IXAA 2YX4A 3S2WA 3T8RA 3GFJA 1YW9A 1B59A 2GXBA 1SMTA 2CO5A 2XAQA 2DK5A 1B9NA 4R79A 2R7FA 1BI1A 3L2CA 2XAGA 1PDNC 4WXDA 3JSPA 1XDUA 2HYFA 5BS6A 3KFWX 4HX4A 3WGIA 4G8XA 2JSCA 4L5IA 2P6SA 5DEQA 1FC3A 1LEAA 4MQ9F 4EM0B 2DFIA 1PP8F 2CW0F 3GFIA 4FX4A 1ZRFA 3IRRA 2ZXJA 4RS8A 1ULYA 2V6CA 4L18B 1LQ1A 3HIFA 1Z7UA 5TRDA 4D0PA 2D45A 4HAMA 1EH7A 3FWEA 3FM5A 2BBYA 4CGZA 3HHGA 5D8KB 2IPQX 3GVAA 5LHGA 3PQKA 1R58A 1ZRDA 4S04A 3BWGA 2DPDA 1ZG3A 4RB3C 2GA1A 5K5QA 1RZ4A 1XN7A 3QPHA 4MTDA 4WCGA 2NRAC 3CUOA 1S7OA 4RGUA 5E18F 3F8BA 4KIFA 2Y75A 1O3TA 4KN4X 4U7BA 3MFKA 3F8MA 3J80Z 4UVAA 4RGSA 1FYLA 1VTNC 5BMZA 3I4PA 1XSVA 1D8JA 2HDCA 3RTRA 5D8LB 4HBLA 2FMLA 3BJAA 4YG2F 2CQKA 2VOOA 4IHTA 4G9YA 5K5RA 4O5VA 1QZZA 5F6FA 2P5VA 5DUIA 2DT5A 4XLPF 2XKOA 2FA5A 3L09A 4KIGA 4QLCU 2JPCA 3T1BA 3JW4A 3I59A 2XAFA 3ERED 5HOOA 4KN7X 1U78A 4M73A 2P4WA 2EFQA 1YG2A 3VFZA 1TQPA 4PCQA 5E20A 2UXXA 1KU9A 2VODA 2EFOA 3B73A 2F5DA 1AWCA 1J75A 2HFHA 4RGXA 3FZVA 1DDNA 4KFCA 1XGOA 2D1HA 1IAWA 5K1YA 2XKPA 2FF4A 3K1NA 3BOQA 1IN6A 2EA4A 1DP7P 2CGPA 1GXPA 2QUFA 2VC1A 5KVRA 1IXSB 3IRQA 2JT1A 3B02A 4ZZDA 2K7LA 2E1CA 2Y0MA 3CUQA 3H3UA 1QZYA 4I01A 3K1PA 4K2EA 4MQVA 4NQWA 2IVMA 3IWZA 5DD4A 5TJJA 1STZA 2RNJA 3RDIA 3DKWA 4AD9A 1FYMA 3KP3A 2QZ8A 3IKVA 1GHCA 4HA8A 3F22A
chains in the Genus database with same CATH superfamily
2QQBA 2ISYA 1WJDA 1O57A 2CU7A 1QO0D 2ETHA 1AU7A 5HDGA 1OCCH 2F5EA 2W82A 4D5FA 2M4KA 1BN5A 1YJWI 4RDUA 3ZCOA 3DU5A 2XB0X 5E1ZB 2VI6A 3O3KA 2PMUA 2A6EF 1WI9A 5EEAA 3FXMA 5DCFA 2KIUA 4XLEA 3HOVJ 3CC7I 4I0BA 2FOWA 1BI3A 1VQ4I 1F5TA 4IZZA 4A3EJ 5HNHA 5FLVA 3MKLA 4BQNA 4Q5SF 3FXLA 3K0LA 3CMAI 4IHWA 2HYJA 5IYDJ 5CPRB 3S16J 1W7PB 1QPIA 1MBHA 5CVIA 2XGDA 3EETA 4R8HA 2M5WA 4M9ZA 5C4JJ 2A5WA 3CLOA 4ESJA 1X3ZB 2XHKA 4I09A 3TP3A 1XGMA 3SZPA 4PFOA 4S0HB 3W6KB 5E8IA 1O7LA 3WU1B 1QHHD 1HSJA 1MNEA 3QPTA 3SHFA 1BIBA 2OCCH 1XX5A 1IRGA 2ZNYA 2LG4A 1Y6IA 4ESBA 4B3AA 1OCZH 4Y13A 3HL2A 3SZGA 3F72A 2ELJA 2UV1A 3WHBA 1X19A 4IX7A 2QEXI 3K2ZA 4PFPA 3CDHA 3E1SA 1P4WA 2DDBA 4M3DA 5E3LA 2GXGA 1IG7A 5AONA 1JXSA 3D5SC 1FT9A 2TDXA 4UUSB 1HKSA 5H2FC 3LWFA 1OMIA 1BW5A 2JVGA 3KZZA 1YW7A 3LSJA 2DQLA 3B6CA 4HX8A 4KMUX 5IT3A 1JUMA 3WGGA 1VZ0A 2YS9A 2IBDA 3G3ZA 2WA0A 5BOXA 3BY6A 5EGOB 5E8GA 1BW6A 3MZ8A 4HG2A 2Q0OA 3SDGA 1R1TA 1UHMA 2F4MB 3R0AA 2LSOA 2WB1N 2DA1A 3KPHA 1YJNI 1Z0XA 3A03A 2IEKA 4E7JA 4A3JJ 2ZMEB 2GQQA 3H5RA 2X51A 3SYTA 2Y30A 3TL4X 2P5LC 3V4GA 2FEZA 5EG0B 3RKXA 2BVMA 4BS9A 5LEKA 2CQNA 2H6BA 2WWYA 1WCMJ 2XDVA 2RREA 2RDPA 3LSKA 3T5XA 3COAC 3CF5F 2MLGA 5CVJA 3OOPA 4LLNA 2HQNA 4DBQA 1PYVA 1FOYA 2A61A 2V9VA 4Q47A 5AIQA 5GPAA 1ZLKA 4A6DA 4I6ZA 3SJMA 1R9TJ 2X1DA 2QBYB 2LVSA 4XLCA 2EV0A 2EQRA 3I54A 4KUMA 2VE8A 1YYVA 2ID3A 2L0KA 4RGRA 2PMZN 2E7XA 1K78A 2LKSA 2OQGA 3HOWJ 3J80K 2VT2A 2MSYA 2DT6A 3IUOA 4I0AA 2K9MA 4KT5C 4BY1J 1ZR4A 3EDPA 2P6TA 5C44J 3FHZA 2FRHA 2PJPA 2ESHA 4D7NA 4E7HA 2ZFUA 4JQFA 2KIQA 3RPUA 1DGWY 4KMFA 1F43A 4CCMA 1HW2A 2YU9J 3CUQB 2E1MC 2AXLA 2LNBA 3CCEI 1Z77A 4V2FA 3L1PA 1IRFA 3HG9A 4P9UA 4GYGA 3ZPLA 3ZRGA 4AYBA 3F8CA 1LUJB 2OZ6A 3DPUA 1G8XA 3HGGA 1R23A 4OIOF 2KIFA 4ENKA 2LFBA 3A01B 4OINF 3H9GA 2ZJ2A 2VONA 1Y1WJ 3V7SA 1QGPA 3ISPA 4HZFA 3MCZA 3KEQA 2R5YA 2B0LA 3QOPA 5D6FA 1Z9CA 2K02A 3QYBA 3ASNH 2QKLB 1MW7A 3P9KA 1T08B 2HR3A 3K4CA 2BXYA 4HW0A 2MG4A 3OR1C 3Q0UA 4A3IJ 3G6EI 2MFZA 1EH8A 4E7SA 3KYCB 2CV0A 3CZ6A 3WTWC 4UVBA 3ULQB 5M5YJ 1JGSA 3HSEA 3ZQFA 4RM3A 2F4OB 3OYDA 2HQAA 4LMYA 4BXFA 2B7EA 3MZYA 2H09A 1U9OA 4ZYEA 5B1AH 3GUDA 4KITB 3VSKA 3J81Z 2BEOA 3GTKJ 4BBRJ 4CXFA 3LFKA 4Z2YA 1X2MA 2M7BA 2VJ4A 3GWZA 2Z3YA 4YIFA 3HRUA 4L5EA 1OR7A 2LDUA 3G73A 2K3FA 4HNTA 3AG2H 4FQGA 5FJ8J 4C9YA 2XPUA 1ON1A 4A6EA 4GFBA 2OQRA 1BJZA 4P1WA 2Z2SB 4PJJA 1D0ZA 3HEFA 1VQKI 3MKZA 1WVRA 2KZVA 4C2UA 3JR9A 1RKTA 5DS9A 4RB1A 2QF7A 3BG6A 2LBFB 2M2EA 4ZYGA 2DLLA 2KRHA 4JK1X 3RZOJ 1MD0A 3I53A 2Q1ZB 3NAUA 2R7RA 1W7PD 4YIRX 5M5WJ 4D5CA 1O4XA 4P9FA 1DPUA 1OYWA 1YE9A 5HS8A 3ZXSA 1N75A 4KDPA 1WJAA 3E0JB 1WJFA 3C1DA 4FE4A 2DYSH 3ABUA 2ISZA 2LF7A 1A36A 2NAZA 5HDNA 2OBPA 4O6JA 1S8NA 1O3RA 1K4SA 2ZMEC 3M8JA 3JTHA 1MNDA 2ZB9A 4YFNF 2XIGA 5ILSA 2JQ7A 2P7CB 1LNWA 1CGPA 4A0YA 2E36A 1FY7A 1K83J 2RQPA 3E3VA 4ITVA 5F64A 3TGNA 4XMYA 2MD0A 3ESWB 3FIWA 4FISA 2HXIA 3KZIC 3RYRA 2DA3A 1P4AA 3CJNA 2BVLA 3HRTA 1ONVA 1TW2A 3RIRA 2M3AA 2DFEA 3WU0A 3B6AA 2G7UA 1XCBA 3VDXA 2H8RA 3M9AA 4F7ZA 4CCKA 1O3SA 1U6GA 4Z6YA 2PMHA 5DM6F 1R4MB 2V1XA 4M6YA 2VBZA 2R7OA 3RQ4A 5J4VA 5EG0A 3ECHA 3GZ5A 2K40A 4A0ZA 1VQLI 1XMAA 1FSEA 1Z6RA 2CFXA 4MTEA 4XR6A 1SD5A 2YX7A 3OSGA 1OISA 5GPCA 3DPTA 1ODDA 4CICA 5J40A 4E7KA 1E3HA 2JPBA 3S2HJ 1D0YA 5HS7A 1USTA 1L0OC 2BYVE 2VJIA 3VOEA 4B4CA 3L2WA 2HYGD 3DV8A 1VF9A 4IHYA 2H8WA 4U0WA 4XOTA 4BQAA 3PQJA 4M3FA 4HF1A 1E3PA 4JBAA 1SD6A 3MKYB 3SEQA 2L7KA 2R5YB 1IJWC 4A93J 2HKOA 3ZQLA 1X58A 4HLXA 2R4GA 1G2HA 3GXOA 3HUGB 4GO1A 4EMSA 3ZN0A 1TLHB 5E3MA 4ZZLA 1UHSA 1GVJA 1XD7A 4KNYA 3RKQA 4HOBA 5JVTA 1CF7B 5CJ9A 2VIXA 4AVZA 1LEBA 2QLZA 2N8GA 3DTEA 2FMYA 3F6VA 1MSFC 1D1BA 2M9HA 2X6XA 5E1WA 3RKWA 3S93A 3R60A 3V8LA 2R5ZA 3TKYA 2FQ4A 1R71A 2IA0A 3A01A 4ON0A 1LE8A 2VE9A 4U88A 2ELHA 2GM4A 4CHUA 1Z05A 2OTJI 5M3MJ 5E3OA 1JKQC 1CF7A 3H35A 5L3CA 2L02A 1UCRA 4DOZA 1X1PA 2EINH 2OF7A 3E97A 2DN0A 3M1CA 2E35A 2XF5A 3J81K 3CCLI 4RBOA 5D5WB 3J7ZI 2IS6A 1G4DA 4HF2A 1GV2A 3WE3A 3LOCA 5DTDA 1T2KA 1QPMA 4ZJZA 5EDNA 2PLYA 1TBXA 1LB2A 4I2OA 1T39A 1WGXA 3V8KA 5BQTA 1LPQA 1X2NA 2R0QC 4U87A 5E1XA 2DMPA 3OIPA 2V79A 4XLNF 2VJJA 3EYIA 5J1YA 1EKEA 3EUHC 1E2XA 1YLFA 4E6KG 3SFIA 4DIQA 5LEJA 3DCFA 4ENNA 1YIJI 3OY9A 1SFKA 3IV5A 3GBGA 4DZPA 2W7NA 1SFOJ 3BR2A 3KP2A 2CV1A 1OKRA 3TW7A 1HKTA 3TOAA 1TWCJ 2FBIA 4QPQA 1I5ZA 4CDGA 4L9TA 3C7JA 1RPWA 2WAFA 4L5JA 2O8XA 2IRFG 3CMYA 3Q5FA 2QWWA 1AKHA 4IQ4A 1K6OA 1B9MA 2W48A 2NVUB 3CJQB 5D5UB 4I7HA 2LK2A 3PSIA 5FKMA 1G6NA 1R00A 5L3GA 4LIVA 4P55A 4YEJA 3R4KA 2ELKA 2OC6A 1EA3A 2XAJA 4G7HF 1XTAA 4IF4A 1MH4A 1R7JA 3OMYA 3E5UA 4KT6A 1WJEA 4C3IJ 5IT9Z 2O0YA 4FCYA 3K4BA 4E70A 1DP3A 2WAQA 2L01A 5J1RA 3LSHA 1A6QA 4ZYDA 2IAIA 1H89C 2VQLA 2BZTA 2NNNA 2VXDA 3A02A 4UY8I 3OYIA 1FP2A 4QIWN 4II2A 2Q8KA 2RAEA 2KL4A 3KEOA 3TO7A 3IWFA 5CLSA 1SVOA 3WE2A 3E5QA 3JRDA 1FNNA 4NC7A 1ZK8A 2O6GE 5JR3A 1H9GA 4BGDA 2HXOA 2K4JA 1FP1D 3RKYA 4BACA 1U2WA 1V5GA 3P9CA 3DBLB 3G2BA 4FX0A 3V7RA 1ZG1A 1XGNA 4N4OB 2KDOA 1R49A 1T98A 3R6SA 1Y39A 3DPLC 3R0JA 5IOYA 3I9V2 1E17A 2VKDA 3ZMSA 3I64A 4UB6C 4YELA 3MQ0A 2IW5A 3F8FA 2VOPA 3FM3A 2JVHA 3HOUJ 2HDWA 2RGVA 3BQYA 1Y0UA 3CQZJ 2UZKA 2AXTC 3KLOA 2JUCA 1I6XA 3CMMA 4AVPA 1Q1HA 2V7FA 2FSWA 3RCOA 3CUQC 2XUBA 4Q4ZF 3N4MA 2LD5A 1QVUA 2CW7A 2F5CA 3NQOA 3ZMVA 2XGEA 3VYRB 2ME0A 5JI6A 2BY1A 1BC7C 1X4OA 2V1DA 4XBFA 4AWXB 1OCPA 4BKXA 5GAHJ 1SD4A 3GTMJ 2XSDC 1LE8B 2OAZA 4HPQA 3LAJA 4EV0A 1WJ5A 4I98B 3KETA 3U1KA 4AIKA 2OUMA 4F3QA 1B4AA 3TW6A 5HLIA 2M30A 3BROA 3NRVA 5FD5A 1MMNA 3HC7A 3K70C 4N0BA 3BJOA 2DW4A 5HLGA 1WHUA 4MEXF 4HYEA 3ZMUA 1J7KA 2DTRA 3TO9A 1NH3A 1KQ9A 3DLAA 4A5MA 3DU6A 3JAMZ 5CVRA 1UHWA 2HDDA 3JCUC 3TQNA 4B1RA 1HBXG 1ZH5A 5DM7F 5M5XJ 2DPUA 3HKZN 2HOEA 1KYZA 2F5VA 3R61A 3MN2A 4G12A 1YX3A 1K79A 2XVCA 5FD6A 1WKMA 3QYFA 3FKIJ 5IP9J 1X1CA 2QYOA 3LA2A 3O6BB 5M3FJ 3HTSB 1IDZA 1ETOA 5FRNA 2DJIA 4UHTA 1TQIA 4BDYA 2VB6A 1XC5A 2L9SA 5DV5A 2K9QA 4A3LJ 2QM3A 3K69A 2L4AA 2XB5A 3CDIA 2DO7A 4F55A 1VI0A 2JN6A 1ZREA 1GXQA 4H4KC 3H9JA 3WTZA 2A6HF 2LR8A 2VBYA 2FE3A 3LQRA 1X4PA 1TZLA 4P5OA 2COMA 1UZCA 4TV7A 2COBA 5FO5A 5FRMA 3OV8A 3ZQ7A 3IL2A 3CJTB 2AQEA 4CYCA 1ZRCA 4ABZA 4FE7A 2NVTJ 1LVAA 1RC9A 4LB5A 1R5HA 3DWLE 3ABKH 1XB4A 1ZARA 2M1BA 2MGQA 4ETSA 2E5ZA 2GXAA 4UNOA 2OD5A 1R36A 1YS6A 1IN5A 3H5AA 1YRNB 4C3HJ 4CSWA 4RM2A 1BR1A 4N4NB 3LSPA 3KP6A 3BZKA 3EYYA 3JRHA 1MMGA 2X6YA 5IT9K 1Z1DA 1YIOA 3ECOA 3FISA 3GW2A 4JX5A 3M8FA 1TNSA 1YITI 3CF2A 3DKYA 3IP4B 4MFDA 1AA7A 4H0EA 5KHDA 4ZYHA 2UXNA 1ZG5A 1OLTA 2OPTA 3OOUA 3AFHA 1REPC 1TW3A 2M0CA 2VQGA 4OOIA 2EFPA 2OA4A 3DKXA 2O7OA 2BY0A 4S05A 3I4MJ 3HSRA 3WG7H 5LFAA 1WH5A 3DBHB 3C3WA 3LL7A 3HOTA 1DU6A 1IN4A 4DW6A 3SFZA 3W6VA 1FSHA 2L9NA 2ZNZA 2L7MP 5BPIA 2CW8A 3CCVI 3L2RA 4EGYA 3CD6I 1ON2A 2QSHX 2DTZA 1ACIA 2Y0SN 2WC2A 2WV0A 5H6RA 2GBYA 3ZQIA 1JJ8C 2M8GX 3JREA 3PO3J 3TDZC 3QU6A 4G6QA 5D4RA 1LVKA 4ZDOA 4BJ6C 2IGOA 1D5YA 1J2XA 3WODF 3VB2A 2K86A 4A5NA 1OQYA 4ZH4F 1EV7A 2P8TA 5ICCA 4OU0A 1BOAA 2NOJB 3C2HA 1F4KA 3K4JA 1FTTA 1SVMA 5F04A 4A12A 1OYYA 3HBLA 4DQ2A 2HTJA 3CCSI 5FFXA 1MJ9A 2AO9A 2DMQA 3K6GA 4B43A 1ZELA 1P4XA 4IEJA 1FZPB 4CH7A 2BY2A 4BJ5C 1TNTA 2K9LA 3PUBA 4RAFA 1WJCA 2ECBA 2ZJQF 3ABMH 3S3OA 3L00A 1PUFA 1MZBA 1PVEA 2K9NA 2I5UA 1TL8A 1AOYA 3BCAA 3O8HA 5H20A 5A2QK 3ZP5A 3RYPA 3VODA 2H1KA 1W1WE 4HV6A 1U3EM 4Y7NJ 2HI3A 2IA1A 3J7YJ 1QQIA 4E7IA 5LBQA 1I6HJ 2O3FA 3MEXA 4GYIA 2EBIA 2ESNA 4UB8C 4L0ZB 4WX9A 1BC8C 2X4HA 3BLYA 1RKWA 2EB7A 2P5KA 5GAGJ 2FNAA 2PFBA 2FNPA 3HPGA 5FB2A 4Y33A 1OPCA 1D3YA 1BI0A 3H1CA 1LFUP 4MGRA 4M3BA 2Y69H 3BZ6A 1R5ID 1UB9A 3OS1A 3C18A 4EJVA 1HKQA 3GYHX 2WY8Q 1RUNA 1JKPC 3P9IA 2VN2A 3GFLA 3OWTA 4M3GA 4RLFA 1V54H 2O8KA 5F0HA 3LA7A 2JK3A 5IOZA 3KP4A 1MJAA 2X1EA 4AIHA 4LGWA 2WB1A 2DU9A 1IF1A 3SEZA 2NYXA 3W2WA 1IRXA 3BG9A 3DXJF 4NUBA 3WTXC 3HGYA 4L0YB 5FGMA 2CFOA 4KICA 1WWXA 5F1RA 3IC7A 2J5OA 3UNGC 1RUOA 5F0CA 3K70D 4LG0B 1FOKA 3ZN1A 3DLLF 2VKHA 4ZDLA 2JA7J 2QENA 4E7LA 4A3GJ 1FLIA 2JA2A 1X1DA 4Y17A 2ZXWH 1OYIA 1MBGA 2BHYA 4LIUA 3M3YJ 2JA8J 3A0HC 4ENJA 2Y48A 3ZOBA 2KHMA 3S14J 3WTTC 3REOA 5E79C 4A3CJ 2KMUA 5KAIC 5ED4A 2KJCA 4IQJA 1B1BA 1S7AA 3ERMA 2JSPA 3CP8A 2CV2A 4PJNA 2F48A 2LC2A 4D9JA 1G3TA 1OCRH 3WTSC 1O3QA 2O9LA 3D5RC 1FMVA 2L4MA 1T0FA 5AIPA 2IA2A 4LOCA 1W5SA 5J4YA 2PI0A 3OYEA 1MMDA 3IKTA 1R22A 3BCBA 4XL9A 1MGTA 3ZQCA 2LY9A 1ZN2A 2HS5A 1Z3YA 5ICGA 4J00A 4B09A 2W84A 2Z99A 3AAFA 1RI7A 1HDPA 1BI2A 3WHCA 1MBKA 2J5PA 2RKHA 2OTLI 3GFMA 4NC6A 3V8JA 4OMYA 3MAJA 3NARA 4AYBN 3GTQJ 2DODA 1XMKA 2F2EA 3SZTA 1FMWA 3FXQA 4G7ZF 2EZHA 2QBYA 2LREA 2A6TA 3PFYA 1BL0A 4XKBA 2VC0A 1LFBA 2K85A 1XCVA 2HZDA 4A2UA 3I59B 3ZMTA 2O5RA 1QBJA 2DMTA 3Q0WA 5DUKA 4IOCF 2MLKA 2QQ9A 5E17F 1FBSA 2FBHA 2M0MA 1BR4A 1S29A 4LLGF 3E6CC 3PM1A 3BR5A 4AC0A 2CUEA 2E71A 2R7DA 3H3VK 2E19A 1UMQA 2PQ8A 4BU2A 1HW1A 1VQPI 2F5FA 2FQ3A 2R7QA 5D6EA 2D1VA 2ZBKA 3BTCA 4CZZA 3SDBA 1R6RA 3X2QH 3OS2A 2DYRH 3T0YA 1YO5C 3WTVC 3TEDA 2GWRA 3BC8A 2NVQJ 3VEPA 5H6QA 1SVLA 1JHHA 1GVDA 4L9JA 4M9SA 5D5XB 3H9QA 2RQQA 3WG9A 5F27A 2W00A 2ZMEA 4HX7A 1MBEA 1UELB 1GLNA 2K4BA 3QOEA 3RPQA 4EM1A 2MH9A 2G9WA 4BQOA 4NDLA 5LRRA 3FXUA 3KZYA 4DYCA 1GV5A 2EV5A 4KA4A 3U1DA 4DNCA 1S3JA 5F08A 1YJ9I 1A6IA 1B8IB 2IGNA 3I0TA 3HSFA 3H0DA 4M74A 4AIDA 5TGTA 4BUPA 1ZYRF 4A3KJ 1MKMA 1RR8C 1W4MA 1OJLA 2EFNA 3KCCA 5KK1A 5HLHA 1U8RA 3HUGA 4RAYA 1SD7A 4O3MA 2KPMA 2W1OA 2BW3A 4BXXJ 5K7FA 3K2AA 3H5NA 2CMPA 4LK0F 1ITYA 1Z6TA 3FXRA 1DPRA 3VYTB 1ETWA 2PG4A 2RV8A 1I1SA 1D0XA 4L9NA 3S17J 4RAZA 4CCNA 3Q9SA 2JA6J 3FKJA 4EJUA 4G94A 1RR7A 3GCMA 2R5ZB 3NEUA 3E6MA 1Z91A 3D0SA 4A3MJ 1C0WA 1BIAA 3G1MA 1H0MA 4EM2A 2K5CA 5IY5H 3QPLA 1WH7A 4RLQA 4BHPA 1IC8A 1UG2A 1ZLJA 3NWSA 5DD8A 2R7VA 2DOAA 3K4NA 4LD5A 1RESA 4C2TA 2MH2A 4EJTA 1NG6A 5J47A 1TWAJ 5HODA 3MZHA 2Y9ZA 2E60A 2MC4A 5LLQA 1H88C 1IV6A 2GLOA 2IS2A 3FBIB 3DEUA 2X85A 3QRFF 2STWA 4RB2C 4B3XA 2LMDA 2ZFWA 3ELKA 3WGHA 4CYCB 1D5VA 4V2GA 3HRSA 3FXKA 4OMZA 2WV1A 1B72B 3MKWB 1LKXA 2A69F 2W24A 3KP5A 5CVVA 1S7EA 4NQWB 1HA8A 4LK1F 4FASD 1HQCA 2LKPA 3PIPF 3HJEA 2VPLA 1IUFA 3BP8A 1XS9A 4GCVA 3HOSA 1V4RA 1IN8A 4C3JJ 2EIJH 1XMXA 2HQRA 1E3OC 4IHSA 2LRDA 1BA5A 1R1UA 1IUYA 2CRGA 2QQAA 5EYRA 2KJBA 2VPRA 2HVRA 1IO2A 5LGNA 2YR2A 2Z9OA 2WTEA 4KIBA 3D1NI 1BJAA 3HOZJ 1U5TB 2V1UA 2ZXIA 2GZWA 5L3BA 2ZC2A 1X1AA 1QU3A 2QQ8A 3IH4A 1TWFJ 2JJ7A 2EK5A 2Z5UA 3OYNA 4HV5A 3DFGA 2JZYA 1TTYA 5BNGA 4B44A 1IDYA 5LD2C 1H9TA 3ZQQA 1J59A 2DFHA 2FXAA 4NB5A 5JFRA 1Y0NA 1LFPA 4BYYA 4PJMA 1I39A 1V5EA 3FDYA 5GP9A 3F23A 3L2QA 1V5FA 3A0BC 1JT6A 1R5GA 2HPIA 5IYBJ 4BE2A 4ZDPA 1K61A 3HDDA 1Z67A 3OYLA 1Z3XA 2NVXJ 4X6AJ 4IJAA 1X3WB 3ZQGA 3AKZA 4F91B 3Q9VA 3LMMA 9ANTA 5J6XA 4ZC3A 2Y2ZA 2ZO4A 3GF2A 1Y1VJ 3K7AJ 4FTHA 2DMNA 3GTLJ 2EILH 2LY2A 4YIIA 3OSFA 3SQNA 2E7WA 1G3YA 1IXRC 3S1RJ 2M8EA 1Z7LA 2O03A 2E1NA 1MMSA 3BR6A 3S32A 1SMYF 4YRVA 4BL0B 3W2VA 3BPXA 4HSRA 2LOOA 4WF2A 3GX4X 1GDTA 2XASA 3EUAA 2EV6A 2HNHA 2DJNA 3WTYC 3FXJA 3KE2A 1P9QC 1NK3P 3BR3A 5A2QZ 1FOWA 3DF8A 4HQMA 2Z1DA 4OIQF 2DOEA 3DP7A 4LITA 1A04A 1ZAOA 2DDAA 1IXCA 2E5NA 2RVCA 3FMQA 4D7MA 4F52A 1T38A 5CVUA 4KYWA 2EIMH 3L2UA 4BBSJ 3AG4H 5JHFA 5JLXA 2H27A 4BH9A 3ZMDA 4CZCA 5ERIA 3SXYA 3JRIA 4PSWA 4Y4RA 3P5JA 2IJLA 3F3XA 3HRMA 4W1UA 2P7VB 1M1EB 1S9HA 1S5LC 3M1EA 1TT5B 2DI3A 3GTPJ 4Q48A 5C3EJ 1OR7C 4JOMA 5BPDA 2RC4A 1JTXA 2H94A 5B5EC 1L3LA 4PSXA 1Y56A 1JT0A 2HWVA 2PJRB 3IH2A 2BOLA 4P96A 2CQXA 3GMEA 1KONA 2HVQA 3TDUC 3PO2J 4YFKF 3RQIA 2CG4A 4U0VA 2XAUA 3CTAA 2W85A 3L9FA 4N9HA 1FPQA 2FD5A 4I02A 3J7AO 4EEFG 1B6AA 2CUZA 2K27A 1T33A 3OYFA 3JRAA 1YX5A 5CYVA 2JA5J 4HEA2 5IP7J 2LBFA 2OJED 5FKOA 2ZXHA 1TT0A 2CUJA 2XGXA 3CC4I 3TOBA 6PAXA 2V26A 3KLNA 5B66C 4F93B 1XGSA 2IS4A 2P81A 4BAYA 4WWCA 3G1OA 4HF0A 4NC8A 3LAPA 5C4XJ 5JVGF 1RIOH 4IVNA 1KGSA 1A35A 2MD5A 4PZJA 5EEHA 2JTVA 4X1EA 2WBMA 3VYSB 4A69C 1EH6A 1K7AA 2K9SA 1IV8A 2KKOA 2EZIA 4LLLA 3O8GA 1FX7A 1SEUA 1PUEE 4XKCA 4U0YA 3DQVC 1VQ9I 3D5LA 3QWLA 3LSGA 3W6JB 3M4OJ 4NHJA 3ABLH 1F1ZA 1WQ2A 2EA2A 3CP2A 3G71I 2PJRA 2LTPA 2GA2A 3W3CA 4DYRA 4LFUA 3F8NA 3OYGA 1QA6A 2X1CA 1P7IA 5FFZA 5HNFA 2TCTA 1UG0A 2W57A 4XN0A 1WZ2A 2NVYJ 2L5QA 2W25A 2Z33A 1ETXA 3QP5A 2OU2A 3IAM2 4BEHB 3JTGA 1SFXA 2KP6A 2HOAA 4LB6B 4CCOA 2XC7A 2QSGX 4HNVA 3HHHA 1T8IA 2XAHA 2LY1A 2M45A 1D1CA 1DUXC 2DT7B 3OR2C 2XROA 5KNLA 2QA4I 3CCUI 2A3SA 2PN6A 2DAOA 2M7AA 3H3ZA 1JUPA 4IHVA 1FIAA 1DQUA 3L2VA 1ETKA 1ZR2A 1J9IA 1MMAA 2L2OA 5L3DA 3K9TA 1U5TC 2ADUA 4C2MJ 1J09A 4RMNA 3GZ6A 1PP7U 2BXZA 1ZHFA 2E34A 3FMSA 1JHFA 2LH9A 1HXDA 2LF8A 4QPOA 2CS3A 3L7WA 2F6CA 2VBWA 2VQHA 4OIPF 2CJJA 2CSOA 3BTJA 1Q1VA 2ICWG 3I3LA 4PGHA 1HOMA 1IRZA 4CUGA 4EJOA 1ETVA 3EQLF 1KQ0A 3GLXA 2DK8A 1TQMA 3GEZA 5FKLA 2KQRA 1SFUA 3BG5A 1OCTC 3F21A 3VPRA 2AQFA 1MBJA 1K6YA 2EFWA 3VWBA 2L54A 1KYWA 1MDMA 2X9DA 1KU3A 4DGWB 3JRCA 3OS0A 2HGCA 1N78A 2K3PA 5L3EA 3RJPA 5J8CA 5EEGA 4R1HA 3RI4A 2E2IJ 2X48A 4J19A 4CYDA 1TC3C 2R7SA 4HDVA 2DBBA 3T8TA 2B63J 2FX0A 4AIJA 2BGCA 1KU7A 2HTSA 2R3SA 5FLXK 1FOXA 3WTUC 3CCRI 3S1MJ 4QWQA 4CA0A 3DTIA 2XV4S 1W36D 1D1AA 2HZTA 1QZEA 3M8EA 2JMWA 3OL4A 3QPSA 1QNTA 4CO8A 5K5OA 1FJLA 5J8FA 2KISA 1FWZA 5L3FA 4EGZA 4AU7A 5ICFA 3RZDJ 2G0EA 1F9NA 3E6DA 1VQMI 1N25A 2AS5F 4XICA 1XSXA 4XSXF 4G7OF 1T0FC 1FBQA 4XN3A 2R7ZJ 4UV8A 4LJZF 2L9VA 3S2DJ 3J7AY 4A3FJ 2ZJRF 2OV7A 2BE5F 4B48A 5ILUA 5FLMJ 5HS9A 4ESFA 2XPWA 1XSDA 2HKXA 1T6SA 3S15J 2UWMA 2WADA 1G3SA 2L7ZA 4PJLA 5HDKA 3AL0B 1WRJA 3E7LA 3CJRB 2VQCA 5LGTA 1FBUA 2D2WA 1HW5A 1W0TA 2STTA 3G1LA 4M6XA 3ZMZA 3OYMA 3PJRA 5E3NA 1U0JA 4DYQA 1ZKGA 4EQQA 4BE1A 3O2PE 5FLXZ 3FF5A 2CYYA 3IAS2 2A5YB 2HPMA 2KIMA 3HYIA 3CDLA 4WK8F 3ML6A 4N9IA 4XKWA 4B47A 5B3SH 2M4GA 4Y15A 4D1QA 2EH3A 1G3WA 1T56A 2CUFA 2OCEA 1XPXA 1GUUA 3H36A 3OYBA 4PJ0C 1HF0A 3Q3SA 1SFEA 1JTYA 3U2RA 5GADJ 3H92A 4OIRF 1S6LA 3HPHA 3P7NA 2XF6A 5IYCJ 2HOSA 5KCMA 2ZJPF 4W97A 1DGRM 3CO7C 5FROA 3UR3C 2GIZA 3QQAA 3GO5A 2M34A 1Y8QB 1KA8A 1WPKA 5CQEA 2MA3A 1FYKA 3F6OA 2IGKA 3A1YA 3FK6A 3CO6C 2UUZA 4UVCA 4YFXF 4Y52J 4HLYA 1YTYA 2EIKH 1P92A 2NS7A 5JHUA 3HM5A 3LSTA 5DDGA 3TMOA 4MHGA 2WAEA 4HRIA 2KT0A 4MNUA 1FEXA 1BOBA 1K4TA 1VQ5I 3I4NJ 1OFCX 3BR0A 3HXLA 4LG0A 3I58A 2C6YA 2YPRA 2AHQA 3N97A 2EWNA 3M7GA 3V7CA 2MC3A 3E6BA 2HOTA 3JAMK 3OYAA 1USSA 2X6OA 2WAQN 1LJ9A 2EPFA 3TBIA 5GTHC 2W4SA 2ACJA 4G6TB 3MWMA 2JRTA 1JJ6C 2QKMB 4ASNA 1J5YA 1BM9A 3BDDA 1ZGJA 3QP6A 2FJ1A 2KFDA 4BE0A 1MH3A 1YQAA 2OZUA 4EATA 3LQQA 5LGUA 2A68F 3GTGJ 4BXUA 1SAUA 4B8XA 4QSHA 1IGNA 2CQ7A 2BY3A 2PEXA 1RNLA 4BHCA 5DYMA 3K1MA 1W0UA 4I76A 4M9XA 1SAXA 1IW7F 1R4NB 2EZLA 1KQ8A 4M71A 3UKGA 4UUVA 2EJRA 4IRIA 3BG7A 2PBIA 2ZSHB 3QAHA 2L3DA 2A05A 4GGGA 5HLTA 1D8KA 2DFFA 4CCLA 3QODA 3OYCA 3JRFA 4WXHA 2WY7Q 3FBNB 4F92B 3EUKL 2LYCA 4UXNA 2R7XA 2DCEA 3OIQA 3KP7A 4U7DA 1YFHA 4FETA 1TP4A 4UUSA 2DQRA 1MDMB 1MBFA 3PNTA 2R7WA 1YS7A 2KRFA 3VSLA 3JSOA 3I55I 4XRMA 1I3AA 1K78B 3KEYA 2VUMJ 3BPVA 3HTUA 1QRYA 4ANJA 1Y8RB 4HDUA 4HQEA 1V55H 4IRHA 5J1UA 1I3QJ 4EVIA 4FT8A 2NNYA 4J01A 3BTIA 1YW8A 3DEWA 1HC8A 2Q2EA 3CC2I 3FXOA 5JLWA 1EJ9A 3E5XA 4BNCA 1IN7A 2VT3A 2IS1A 3MVPA 4XONA 2CH0A 3CLQA 1CQTA 1SANA 2V9PA 1IZ1A 4I99C 5TISC 5D5VB 1V3FA 1WSUA 3TO6A 4UV9A 4ENMA 5HVQC 2A07F 2KZGA 3S3MA 1A31A 1OCOH 2FUG2 4FHTA 1MJBA 5DCMB 2I10A 4WXCA 3PNVA 1HDDC 1W5TA 2XF7A 4Y3OA 1W36C 5EZHA 4E7ZA 3K10A 3I71A 2E2JJ 2IT0A 4G6DA 3I5UA 1RRJA 1R1VA 2DOFA 3LNQA 4A3DJ 5LHHA 4M6VA 2BHZA 5D4SA 4PDKA 5DCMA 3JRBA 1NTCA 1UFMA 1ZGAA 1I27A 3PFIA 2ME6A 3FX3A 4KJZA 2XGCA 2BV6A 3OYHA 1QHGA 2ZKZA 2FBKA 4GXOA 3EUHA 2VBXA 2ZCWA 3IHUA 3K4KA 1TWHJ 5LRSA 2FOKA 3C2GA 1ZQ3P 4RAGA 1LDKB 3MMYB 1X3UA 4OAYA 5LHIA 2P0WA 3KYDB 2G7HA 4M3EA 4BHBA 3LSRA 1XDSA 2IP2A 3BJ6A 5FKKA 2E1MB 4IRGA 3S3NA 1ENHA 4JX6A 5K7HA 3C2BA 1RETA 5CQGA 2YU3A 1KU2A 4RB0A 1HSTA 2O61A 1J0RA 3FMRA 1LDJA 4BEHA 1YHQI 1JE8A 2GAUA 1POGA 3U9GA 3ZGKA 2MYSA 3VYUB 1PJRA 2KRCA 2CWEA 4XK4A 1MIJA 4HNUA 4XRFA 4L9VA 1I1GA 1VFCA 4PGGA 3KIOA 2GIVA 2XRNA 2XPVA 5ILVA 3LA3A 2QVOA 2H6CA 2M87A 2VXZA 1VQOI 2JUGA 1BBYA 4EJWA 1P2FA 2EZKA 4JP0A 3ROUA 1P6RA 2RN7A 3BT9A 4IPAA 2RNGA 2MBFA 3HB9A 4M72A 1W7PA 2NS0A 1ETYA 4NBQA 4A0XA 3ABTA 4BQQA 2DXIA 2HEOA 4XSZF 3F0CA 1FTZA 2YSRA 4GDFA 3A2KA 1VQ6I 3CMEI 1O7FA 5EGOA 2X0LA 3QU3A 4ZYAA 1EF4A 4MEYF 1TWGJ 3W2AA 2QSFX 3AG1H 3CCJI 2FU4A 2QGUA 4IKFA 4AM3A 1ZTRA 5ICEA 1WI3A 1LDDA 1NHAA 3CESA 1U5TA 1VQNI 3FHNA 4IXAA 2YX4A 2DA6A 3S2WA 5GTIC 3CCYA 3T8RA 3GFJA 1JUSA 3GTJJ 4X0GA 1YW9A 3MD2A 4ZTFA 4XLAA 1B59A 4RA2A 2GXBA 4XOPA 2YUSA 3BQZA 1SMTA 2CO5A 2XAQA 2DK5A 1B9NA 4R79A 2JRMA 1UAAA 2R7FA 1BI1A 3Q0VA 2JWTA 3L2CA 2X6WA 2XAGA 4XLFA 3U21A 1PDNC 5EF6A 1B8IA 4JX4A 4WXDA 3BR1A 3JSPA 1XDUA 2HYFA 5BS6A 3KFWX 5IP6A 3LFUA 2I8DA 4HX4A 3WGIA 4G8XA 2JSCA 4L5IA 3DTKA 2P6SA 2VKVA 5DEQA 1FC3A 1P7JA 1LEAA 1YOVB 2CQQA 4MQ9F 5F0FA 2DA2A 2Y0SA 4EM0B 2DFIA 1PP8F 2CW0F 2HQ5A 5K7ZA 3GFIA 2LKXA 4FX4A 1U9NA 1ZRFA 3RPUD 3IRRA 3K4LA 2ZXJA 2VJ5A 3AG3H 4RS8A 1ULYA 2Q2EB 5B1BH 2V6CA 5KAFC 2DA7A 4L18B 5EZGA 1G59A 4IL6C 5EJCA 3S8PA 1APLC 1LQ1A 2NXNB 3HIFA 1Z7UA 1F36A 5TRDA 2L9RA 2R92J 4D0PA 2D45A 3OYKA 2LP0A 4HAMA 1PUFB 1EH7A 2BW3B 1ETQA 4IHXA 3FWEA 3FM5A 2DMUA 1AHDP 2BBYA 4XIDA 2NOGA 1XG1A 1HLVA 3KYLA 1HCRA 4CGZA 3BG3A 2HVSA 3HHGA 5D8KB 3PNYA 2IPQX 3GVAA 3HOXJ 1JGGA 5LHGA 3PQKA 4BY7J 1R58A 1B72A 4XQFA 1ZRDA 2NS8A 5J3LA 4S04A 3BWGA 4MO7A 3OYJA 2B9SA 1ZG3A 3LSMA 2DPDA 4RB3C 4II3A 2GA1A 2IXSA 5K5QA 1RZ4A 1UJ8A 1XN7A 4IOAF 1A5JA 3A4CA 3QPHA 3GTOJ 3BZCA 1BR2A 2R7UA 4MTDA 3KX2A 4WCGA 2VKEA 3V42A 2NRAC 1N77A 3CUOA 1S7OA 4C30A 4RGUA 5E18F 3F8BA 4KIFA 1NK2P 2Y75A 1O3TA 2XRLA 4KISA 4KN4X 2KLOA 4U7BA 3MFKA 3S1NJ 3RSNA 4XKVA 1GT0C 3F8MA 3IH3A 2Z16A 3J80Z 4UVAA 3M07A 4RGSA 4JYKA 3ZR8X 1FYLA 1VTNC 5BMZA 2QCOA 3I4PA 2TRTA 1XSVA 1D8JA 3I56I 2Y9YA 2V9KA 2HDCA 3HKZA 3RTRA 5D8LB 4HBLA 1U8BA 1VQ7I 2FMLA 2PMZA 3BJAA 1S72I 4E4HA 2DA5A 1YI2I 4MIMA 4YG2F 3H0GJ 3WU2C 2CQKA 3PSFA 2VOOA 2Y31A 3F9KA 4IHTA 4G9YA 1NG7A 3JRGA 2V4JC 1YRNA 2VASA 5K5RA 1X1BA 4O5VA 1VNDA 1ORKA 1QZZA 2DA4A 5F6FA 3OL3A 2IGMA 3ONQA 2P5VA 2ZSIB 3FK7A 3OIOA 4XORA 1WJBA 5DUIA 2DT5A 4XLPF 2XKOA 4GRIA 2FA5A 3L09A 4KIGA 4HSTA 3PUFA 1JKRC 2VLAA 4QLCU 2VL8A 2JPCA 4BDZA 3T1BA 1H8AC 5F1JA 3JW4A 3I59A 1I50J 1KZHA 5IPAA 2XAFA 3GZNB 3ERED 5HOOA 4KN7X 1AKHB 3DBRB 1W5CC 4M73A 1U78A 2V6EA 1VQ8I 2P4WA 5CKTA 4PK4A 2EFQA 1YG2A 3VFZA 1E0EA 1TQPA 4PCQA 2F4IA 2H1LA 2XSJC 1ERDA 3S1QJ 3CCMI 5E20A 4DZJA 4V19K 2UXXA 3AL0C 5FKNA 1KU9A 4PUSA 2VODA 3LSIA 2EFOA 4OAZA 3B73A 2F5DA 1AWCA 1J75A 2HFHA 3N05A 3EPZA 4RGXA 4XRSG 3FZVA 1DDNA 4KFCA 4MFEA 2HU9A 1XGOA 2MABA 2D1HA 2ID6A 4BJTA 1IAWA 1Z21A 2GOXB 5K1YA 2ECCA 2E1OA 1JI8A 2XKPA 4DJAA 2FF4A 3ZQHA 3K1NA 2V1NA 1MSEC 3BOQA 1IN6A 2EA4A 1DP7P 2CGPA 4CCJA 1GXPA 4UUTA 3TP0A 2QUFA 2MW8A 2VC1A 1T95A 5KVRA 1IXSB 2R7TA 4MLOA 4XLHA 3IRQA 2JT1A 4ZTJA 3B02A 5GAEJ 3PL8A 4QTRA 2GOMA 4ZZDA 1WFXA 2K7LA 2E1CA 2Y0MA 3CUQA 3ASOH 4XNFA 3H3UA 1QZYA 3CCQI 4I01A 4LG3A 3K1PA 4K2EA 1FIPA 4OWRB 3GLLA 3BTLA 1SC7A 1QVTA 3K4MA 2KDZA 4MQVA 2R93J 1DU0A 2LLKA 2L7FP 4NQWA 2D5VA 2IVMA 3IWZA 5DD4A 3HZJA 1MNMC 5TJJA 1STZA 3QYEA 3G4SI 3HOYJ 2RNJA 2PX9A 4IO9F 3RDIA 3DKWA 3NWTA 3DEEA 4AD9A 1FYMA 3KP3A 4AUXA 4XRSA 4A3BJ 4NNJA 2E2HJ 2QZ8A 3IKVA 1JKOC 1GHCA 4DBRA 4HA8A 3F22A 4XM3A 3PIOF 1ZGWA
chains in the Genus database with same CATH topology
2QQBA 2ISYA 1O57A 1QO0D 2ETHA 5HDGA 2F5EA 1BN5A 5E1ZB 3O3KA 2PMUA 2A6EF 1WI9A 5DCFA 2KIUA 4I0BA 1BI3A 1F5TA 4Q5SF 3K0LA 1W7PB 5CVIA 3EETA 4R8HA 2M5WA 4M9ZA 3CLOA 4ESJA 4I09A 2XHKA 1XGMA 3SZPA 5E8IA 3W6KB 1O7LA 3WU1B 1HSJA 3QPTA 3SHFA 1BIBA 1IRGA 2ZNYA 4ESBA 4Y13A 3F72A 3K2ZA 3CDHA 1P4WA 2GXGA 5AONA 1JXSA 1FT9A 2TDXA 1HKSA 3LWFA 1OMIA 3KZZA 1YW7A 2DQLA 4HX8A 4KMUX 5IT3A 3WGGA 3G3ZA 5BOXA 3BY6A 5E8GA 2Q0OA 1R1TA 1UHMA 3R0AA 2LSOA 2ZMEB 2GQQA 2P5LC 3V4GA 2FEZA 3RKXA 5LEKA 2H6BA 2WWYA 2RDPA 3T5XA 3COAC 2MLGA 5CVJA 3OOPA 4LLNA 2HQNA 2A61A 2V9VA 4Q47A 5AIQA 1ZLKA 4A6DA 2QBYB 2EV0A 3I54A 4KUMA 2VE8A 1YYVA 4RGRA 2E7XA 1K78A 2OQGA 3J80K 2VT2A 4I0AA 4KT5C 3EDPA 2P6TA 3FHZA 2FRHA 2PJPA 2ESHA 4JQFA 3RPUA 4KMFA 1HW2A 3CUQB 2AXLA 2LNBA 1IRFA 4P9UA 4GYGA 3ZPLA 3F8CA 2OZ6A 1R23A 4OIOF 2KIFA 4ENKA 4OINF 2ZJ2A 2VONA 3V7SA 1QGPA 3ISPA 4HZFA 3MCZA 3KEQA 2B0LA 3QOPA 5D6FA 1Z9CA 2K02A 3P9KA 2HR3A 4HW0A 1EH8A 3WTWC 4UVBA 3ULQB 1JGSA 3HSEA 4LMYA 3MZYA 2H09A 4ZYEA 3GUDA 3J81Z 2BEOA 4CXFA 3LFKA 4Z2YA 3GWZA 2Z3YA 4YIFA 3HRUA 1OR7A 2LDUA 3G73A 1ON1A 4A6EA 2OQRA 4RB1A 4ZYGA 2DLLA 4JK1X 1MD0A 3I53A 1W7PD 4P9FA 1DPUA 1OYWA 5HS8A 4KDPA 3C1DA 3ABUA 2ISZA 2LF7A 2NAZA 5HDNA 2OBPA 4O6JA 1S8NA 1O3RA 3JTHA 4YFNF 2P7CB 2XIGA 5ILSA 1LNWA 1CGPA 4A0YA 1FY7A 2RQPA 3E3VA 5F64A 3TGNA 3RYRA 1P4AA 3CJNA 3HRTA 1ONVA 1TW2A 3RIRA 3WU0A 2G7UA 1XCBA 3M9AA 1O3SA 4F7ZA 1U6GA 2PMHA 2V1XA 4M6YA 2VBZA 3ECHA 3GZ5A 4A0ZA 1XMAA 1FSEA 1Z6RA 2CFXA 4MTEA 1SD5A 2YX7A 3DPTA 1ODDA 4CICA 2JPBA 5HS7A 1USTA 1L0OC 2BYVE 3VOEA 2HYGD 3DV8A 4U0WA 4BQAA 3PQJA 4HF1A 4JBAA 1SD6A 2HKOA 4HLXA 3GXOA 4GO1A 4EMSA 3ZN0A 1TLHB 4ZZLA 1GVJA 1XD7A 4KNYA 4HOBA 5JVTA 1CF7B 5CJ9A 1LEBA 2QLZA 2FMYA 3F6VA 3V8LA 5E1WA 3RKWA 3R60A 3TKYA 2IA0A 4ON0A 2VE9A 4U88A 2ELHA 4CHUA 1Z05A 1CF7A 5L3CA 2L02A 1UCRA 3E97A 3J81K 5D5WB 1G4DA 4HF2A 3WE3A 1T2KA 1QPMA 2PLYA 1TBXA 1LB2A 4I2OA 1T39A 3V8KA 5BQTA 5E1XA 2V79A 3EYIA 4XLNF 1E2XA 1YLFA 5LEJA 4ENNA 3KP2A 1HKTA 1OKRA 3TOAA 2FBIA 1I5ZA 4CDGA 4L9TA 3C7JA 4L5JA 2O8XA 2IRFG 3Q5FA 2QWWA 1K6OA 1B9MA 5D5UB 4I7HA 1G6NA 1R00A 5L3GA 4P55A 3R4KA 4G7HF 2XAJA 4IF4A 1R7JA 3E5UA 5IT9Z 2O0YA 4E70A 2L01A 4ZYDA 2NNNA 1FP2A 2Q8KA 3KEOA 3TO7A 3IWFA 5CLSA 3WE2A 3E5QA 1FNNA 2O6GE 5JR3A 1H9GA 2K4JA 1FP1D 3RKYA 1U2WA 3P9CA 4FX0A 3V7RA 1ZG1A 1XGNA 1T98A 3R6SA 3DPLC 3R0JA 1E17A 3ZMSA 3I64A 3MQ0A 2IW5A 3F8FA 2VOPA 3FM3A 2RGVA 1Y0UA 2UZKA 3KLOA 1I6XA 4AVPA 1Q1HA 2FSWA 3CUQC 2XUBA 4Q4ZF 3N4MA 2F5CA 3NQOA 3ZMVA 5JI6A 1BC7C 2V1DA 4XBFA 4AWXB 1SD4A 2OAZA 3LAJA 4EV0A 4I98B 3KETA 4AIKA 1B4AA 5HLIA 2M30A 3BROA 3NRVA 5FD5A 4N0BA 3BJOA 2DW4A 5HLGA 4MEXF 4HYEA 3ZMUA 1J7KA 2DTRA 3TO9A 1KQ9A 4A5MA 3JAMZ 5CVRA 1UHWA 1HBXG 3TQNA 1ZH5A 2DPUA 2HOEA 1KYZA 3R61A 1K79A 2XVCA 5FD6A 1WKMA 3HTSB 2QYOA 3LA2A 3O6BB 4UHTA 1TQIA 5DV5A 2QM3A 3K69A 2L4AA 2DO7A 1ZREA 1GXQA 3WTZA 2A6HF 2VBYA 2FE3A 3LQRA 4P5OA 2COMA 4TV7A 5FO5A 3OV8A 3ZQ7A 3IL2A 1ZRCA 1LVAA 4LB5A 1R5HA 1XB4A 1ZARA 2M1BA 4ETSA 4UNOA 2OD5A 1R36A 1YS6A 1IN5A 3KP6A 3EYYA 5IT9K 1Z1DA 1YIOA 3ECOA 3GW2A 3M8FA 1TNSA 4H0EA 4ZYHA 2UXNA 1ZG5A 1REPC 1TW3A 4OOIA 2EFPA 2OA4A 4S05A 3HSRA 3C3WA 3HOTA 1IN4A 3SFZA 1FSHA 2ZNZA 5BPIA 4EGYA 1ON2A 2WC2A 2WV0A 5H6RA 3TDZC 3QU6A 4G6QA 5D4RA 1J2XA 3WODF 3VB2A 2K86A 4A5NA 5ICCA 4ZH4F 1EV7A 2P8TA 4OU0A 1BOAA 1F4KA 4A12A 1OYYA 4DQ2A 2HTJA 5FFXA 1MJ9A 1P4XA 1FZPB 1TNTA 3L00A 1MZBA 1AOYA 5H20A 5A2QK 3ZP5A 3RYPA 3VODA 4HV6A 1U3EM 2IA1A 1QQIA 5LBQA 2O3FA 3MEXA 4GYIA 2ESNA 4L0ZB 4WX9A 1BC8C 2X4HA 2EB7A 2P5KA 2FNAA 2PFBA 2FNPA 5FB2A 1OPCA 1D3YA 1BI0A 4MGRA 3BZ6A 1UB9A 3C18A 4EJVA 1HKQA 3GYHX 1RUNA 3P9IA 2VN2A 3GFLA 3LA7A 3KP4A 1MJAA 4AIHA 4LGWA 2DU9A 1IF1A 2NYXA 3DXJF 3WTXC 4L0YB 5FGMA 4KICA 1WWXA 5F1RA 3IC7A 2J5OA 1RUOA 4LG0B 1FOKA 3ZN1A 2QENA 1FLIA 4Y17A 1OYIA 4ENJA 2Y48A 3WTTC 3REOA 5ED4A 2KJCA 1B1BA 1S7AA 1G3TA 3WTSC 1O3QA 2L4MA 1T0FA 5AIPA 2IA2A 1W5SA 2PI0A 3IKTA 1R22A 1MGTA 1ZN2A 2HS5A 5ICGA 4B09A 2W84A 2Z99A 3AAFA 1RI7A 1BI2A 2J5PA 2RKHA 3GFMA 3V8JA 4OMYA 3MAJA 1XMKA 2F2EA 3SZTA 3FXQA 4G7ZF 2QBYA 2VC0A 1XCVA 4A2UA 3I59B 3ZMTA 1QBJA 5DUKA 2MLKA 2QQ9A 5E17F 1FBSA 2FBHA 1S29A 4LLGF 3E6CC 2R7DA 2PQ8A 1HW1A 2F5FA 2FQ3A 5D6EA 2D1VA 2ZBKA 4CZZA 3T0YA 1YO5C 3WTVC 2GWRA 3VEPA 5H6QA 1JHHA 4L9JA 4M9SA 5D5XB 3WG9A 2ZMEA 4HX7A 2K4BA 4EM1A 3RPQA 2MH9A 2G9WA 5LRRA 3FXUA 3KZYA 4KA4A 2EV5A 3U1DA 4DNCA 1S3JA 3I0TA 3HSFA 4M74A 1ZYRF 1MKMA 1W4MA 2EFNA 3KCCA 5KK1A 5HLHA 1U8RA 3HUGA 4RAYA 1SD7A 4O3MA 4LK0F 1Z6TA 3FXRA 1DPRA 2PG4A 2RV8A 1I1SA 4L9NA 4RAZA 3Q9SA 4EJUA 4G94A 3NEUA 3E6MA 1Z91A 3D0SA 1C0WA 1BIAA 1H0MA 4EM2A 4BHPA 1ZLJA 5DD8A 4LD5A 2MH2A 4EJTA 3MZHA 5LLQA 3QRFF 3DEUA 2STWA 4RB2C 2ZFWA 3ELKA 3WGHA 1D5VA 3HRSA 4OMZA 2W24A 2A69F 3KP5A 5CVVA 4LK1F 1HQCA 2LKPA 3BP8A 4GCVA 3HOSA 1V4RA 1IN8A 2HQRA 4IHSA 1R1UA 1IUYA 2QQAA 2KJBA 5LGNA 2YR2A 2Z9OA 2WTEA 4KIBA 1BJAA 1U5TB 2V1UA 2GZWA 5L3BA 2EK5A 2Z5UA 4HV5A 3DFGA 2JZYA 1TTYA 1H9TA 1J59A 2FXAA 4NB5A 5JFRA 4BYYA 3F23A 1R5GA 4IJAA 3Q9VA 5J6XA 2ZO4A 3GF2A 4YIIA 3SQNA 2E7WA 1G3YA 1IXRC 2M8EA 2O03A 2E1NA 1SMYF 3BPXA 4WF2A 3GX4X 2XASA 3WTYC 2EV6A 3KE2A 5A2QZ 3DF8A 4HQMA 4OIQF 3DP7A 1A04A 1ZAOA 1IXCA 2RVCA 4KYWA 3FMQA 1T38A 5CVUA 2H27A 4BH9A 3ZMDA 5ERIA 3SXYA 2IJLA 3F3XA 3HRMA 2P7VB 3M1EA 2DI3A 4Q48A 5BPDA 2RC4A 2H94A 1L3LA 2HWVA 4P96A 3TDUC 4YFKF 2CG4A 4U0VA 3CTAA 3L9FA 2W85A 4N9HA 1FPQA 4I02A 3J7AO 1B6AA 2K27A 5CYVA 2XGXA 3TOBA 6PAXA 3KLNA 1XGSA 4BAYA 4WWCA 4HF0A 3LAPA 1RIOH 4IVNA 1KGSA 2MD5A 4PZJA 5EEHA 2JTVA 1EH6A 1K7AA 2KKOA 4LLLA 1FX7A 1PUEE 4U0YA 3DQVC 3D5LA 3W6JB 4NHJA 1F1ZA 1WQ2A 2EA2A 2GA2A 4LFUA 3F8NA 5FFZA 2W57A 2W25A 2Z33A 3QP5A 2OU2A 3JTGA 1SFXA 4LB6B 3HHHA 2XAHA 2M45A 1DUXC 2XROA 2A3SA 2PN6A 2DAOA 3H3ZA 1J9IA 5L3DA 3K9TA 1U5TC 2ADUA 3GZ6A 1PP7U 1ZHFA 3FMSA 1JHFA 1HXDA 2LF8A 3L7WA 2VBWA 4OIPF 2CSOA 4PGHA 4EJOA 3EQLF 1KQ0A 3GLXA 2DK8A 1TQMA 3GEZA 1SFUA 3F21A 2EFWA 2L54A 1KYWA 1MDMA 1KU3A 2HGCA 5L3EA 3RJPA 5J8CA 5EEGA 4R1HA 3RI4A 4CYDA 4HDVA 2DBBA 3T8TA 4AIJA 2BGCA 1KU7A 2HTSA 2R3SA 5FLXK 3WTUC 4QWQA 2XV4S 2HZTA 3M8EA 1QNTA 4CO8A 5K5OA 5J8FA 1FWZA 5L3FA 4EGZA 5ICFA 1F9NA 3E6DA 2AS5F 1XSXA 4XSXF 4G7OF 1FBQA 4UV8A 4LJZF 2BE5F 5ILUA 5HS9A 4ESFA 1XSDA 2HKXA 1T6SA 2UWMA 1G3SA 5HDKA 1WRJA 5LGTA 1FBUA 2D2WA 1HW5A 2STTA 4M6XA 3ZMZA 4EQQA 3O2PE 5FLXZ 3FF5A 2CYYA 2A5YB 2KIMA 3HYIA 4WK8F 3ML6A 4N9IA 4Y15A 1G3WA 1SFEA 3U2RA 3H92A 4OIRF 1S6LA 3P7NA 3CO7C 3GO5A 1KA8A 2MA3A 1FYKA 3F6OA 3CO6C 4UVCA 4YFXF 4HLYA 1YTYA 1P92A 5JHUA 3LSTA 5DDGA 4MHGA 4MNUA 4LG0A 3I58A 2C6YA 2YPRA 3N97A 2EWNA 3M7GA 3V7CA 2MC3A 3E6BA 3JAMK 1USSA 1LJ9A 2ACJA 3MWMA 2JRTA 4ASNA 1J5YA 1BM9A 3BDDA 1ZGJA 3QP6A 1YQAA 2OZUA 3LQQA 5LGUA 2A68F 4BXUA 4B8XA 2PEXA 1RNLA 4BHCA 5DYMA 3K1MA 4M9XA 1SAXA 1IW7F 1KQ8A 4M71A 4UUVA 2EJRA 4IRIA 2PBIA 3QAHA 2L3DA 4GGGA 1D8KA 4WXHA 4UXNA 3KP7A 4U7DA 1YFHA 1MDMB 2DQRA 1YS7A 2KRFA 3JSOA 1K78B 3BPVA 3HTUA 4HDUA 4HQEA 4IRHA 4EVIA 4FT8A 2NNYA 1YW8A 2Q2EA 3E5XA 4BNCA 1IN7A 2VT3A 1IZ1A 5D5VB 1V3FA 1WSUA 3TO6A 4UV9A 4ENMA 5HVQC 2A07F 4FHTA 1MJBA 5DCMB 4WXCA 1W5TA 3I71A 2IT0A 4G6DA 3I5UA 1R1VA 5LHHA 5D4SA 4PDKA 5DCMA 1UFMA 1ZGAA 1I27A 3PFIA 3FX3A 2BV6A 2ZKZA 2FBKA 4GXOA 3EUHA 2VBXA 2ZCWA 3IHUA 5LRSA 2FOKA 1LDKB 1X3UA 5LHIA 2G7HA 4BHBA 1XDSA 2IP2A 3BJ6A 4IRGA 2YU3A 1KU2A 4RB0A 1HSTA 2O61A 1J0RA 3FMRA 1LDJA 1JE8A 2GAUA 3U9GA 2CWEA 4XRFA 4L9VA 1I1GA 4PGGA 2GIVA 2XRNA 5ILVA 3LA3A 2QVOA 2H6CA 2M87A 2VXZA 1BBYA 4EJWA 1P2FA 3ROUA 1P6RA 2RN7A 4IPAA 2MBFA 4M72A 1W7PA 2NS0A 4A0XA 3ABTA 2HEOA 4XSZF 2YSRA 1O7FA 2X0LA 3QU3A 4MEYF 2FU4A 5ICEA 1LDDA 1NHAA 1U5TA 4IXAA 2YX4A 3S2WA 3T8RA 3GFJA 1YW9A 1B59A 2GXBA 1SMTA 2CO5A 2XAQA 2DK5A 1B9NA 4R79A 2R7FA 1BI1A 3L2CA 2XAGA 1PDNC 4WXDA 3JSPA 1XDUA 2HYFA 5BS6A 3KFWX 4HX4A 3WGIA 4G8XA 2JSCA 4L5IA 2P6SA 5DEQA 1FC3A 1LEAA 4MQ9F 4EM0B 2DFIA 1PP8F 2CW0F 3GFIA 4FX4A 1ZRFA 3IRRA 2ZXJA 4RS8A 1ULYA 2V6CA 4L18B 1LQ1A 3HIFA 1Z7UA 5TRDA 4D0PA 2D45A 4HAMA 1EH7A 3FWEA 3FM5A 2BBYA 4CGZA 3HHGA 5D8KB 2IPQX 3GVAA 5LHGA 3PQKA 1R58A 1ZRDA 4S04A 3BWGA 2DPDA 1ZG3A 4RB3C 2GA1A 5K5QA 1RZ4A 1XN7A 3QPHA 4MTDA 4WCGA 2NRAC 3CUOA 1S7OA 4RGUA 5E18F 3F8BA 4KIFA 2Y75A 1O3TA 4KN4X 4U7BA 3MFKA 3F8MA 3J80Z 4UVAA 4RGSA 1FYLA 1VTNC 5BMZA 3I4PA 1XSVA 1D8JA 2HDCA 3RTRA 5D8LB 4HBLA 2FMLA 3BJAA 4YG2F 2CQKA 2VOOA 4IHTA 4G9YA 5K5RA 4O5VA 1QZZA 5F6FA 2P5VA 5DUIA 2DT5A 4XLPF 2XKOA 2FA5A 3L09A 4KIGA 4QLCU 2JPCA 3T1BA 3JW4A 3I59A 2XAFA 3ERED 5HOOA 4KN7X 1U78A 4M73A 2P4WA 2EFQA 1YG2A 3VFZA 1TQPA 4PCQA 5E20A 2UXXA 1KU9A 2VODA 2EFOA 3B73A 2F5DA 1AWCA 1J75A 2HFHA 4RGXA 3FZVA 1DDNA 4KFCA 1XGOA 2D1HA 1IAWA 5K1YA 2XKPA 2FF4A 3K1NA 3BOQA 1IN6A 2EA4A 1DP7P 2CGPA 1GXPA 2QUFA 2VC1A 5KVRA 1IXSB 3IRQA 2JT1A 3B02A 4ZZDA 2K7LA 2E1CA 2Y0MA 3CUQA 3H3UA 1QZYA 4I01A 3K1PA 4K2EA 4MQVA 4NQWA 2IVMA 3IWZA 5DD4A 5TJJA 1STZA 2RNJA 3RDIA 3DKWA 4AD9A 1FYMA 3KP3A 2QZ8A 3IKVA 1GHCA 4HA8A 3F22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQB A;  2ISY A;  1O57 A;  1QO0 D;  2ETH A;  5HDG A;  2F5E A;  1BN5 A;  5E1Z B;  3O3K A;  2PMU A;  2A6E F;  1WI9 A;  5DCF A;  2KIU A;  4I0B A;  1BI3 A;  1F5T A;  4Q5S F;  3K0L A;  1W7P B;  5CVI A;  3EET A;  4R8H A;  2M5W A;  4M9Z A;  3CLO A;  4ESJ A;  4I09 A;  2XHK A;  1XGM A;  3SZP A;  5E8I A;  3W6K B;  1O7L A;  3WU1 B;  1HSJ A;  3QPT A;  3SHF A;  1BIB A;  1IRG A;  2ZNY A;  4ESB A;  4Y13 A;  3F72 A;  3K2Z A;  3CDH A;  1P4W A;  2GXG A;  5AON A;  1JXS A;  1FT9 A;  2TDX A;  1HKS A;  3LWF A;  1OMI A;  3KZZ A;  1YW7 A;  2DQL A;  4HX8 A;  4KMU X;  5IT3 A;  3WGG A;  3G3Z A;  5BOX A;  3BY6 A;  5E8G A;  2Q0O A;  1R1T A;  1UHM A;  3R0A A;  2LSO A;  2ZME B;  2GQQ A;  2P5L C;  3V4G A;  2FEZ A;  3RKX A;  5LEK A;  2H6B A;  2WWY A;  2RDP A;  3T5X A;  3COA C;  2MLG A;  5CVJ A;  3OOP A;  4LLN A;  2HQN A;  2A61 A;  2V9V A;  4Q47 A;  5AIQ A;  1ZLK A;  4A6D A;  2QBY B;  2EV0 A;  3I54 A;  4KUM A;  2VE8 A;  1YYV A;  4RGR A;  2E7X A;  1K78 A;  2OQG A;  3J80 K;  2VT2 A;  4I0A A;  4KT5 C;  3EDP A;  2P6T A;  3FHZ A;  2FRH A;  2PJP A;  2ESH A;  4JQF A;  3RPU A;  4KMF A;  1HW2 A;  3CUQ B;  2AXL A;  2LNB A;  1IRF A;  4P9U A;  4GYG A;  3ZPL A;  3F8C A;  2OZ6 A;  1R23 A;  4OIO F;  2KIF A;  4ENK A;  4OIN F;  2ZJ2 A;  2VON A;  3V7S A;  1QGP A;  3ISP A;  4HZF A;  3MCZ A;  3KEQ A;  2B0L A;  3QOP A;  5D6F A;  1Z9C A;  2K02 A;  3P9K A;  2HR3 A;  4HW0 A;  1EH8 A;  3WTW C;  4UVB A;  3ULQ B;  1JGS A;  3HSE A;  4LMY A;  3MZY A;  2H09 A;  4ZYE A;  3GUD A;  3J81 Z;  2BEO A;  4CXF A;  3LFK A;  4Z2Y A;  3GWZ A;  2Z3Y A;  4YIF A;  3HRU A;  1OR7 A;  2LDU A;  3G73 A;  1ON1 A;  4A6E A;  2OQR A;  4RB1 A;  4ZYG A;  2DLL A;  4JK1 X;  1MD0 A;  3I53 A;  1W7P D;  4P9F A;  1DPU A;  1OYW A;  5HS8 A;  4KDP A;  3C1D A;  3ABU A;  2ISZ A;  2LF7 A;  2NAZ A;  5HDN A;  2OBP A;  4O6J A;  1S8N A;  1O3R A;  3JTH A;  4YFN F;  2P7C B;  2XIG A;  5ILS A;  1LNW A;  1CGP A;  4A0Y A;  1FY7 A;  2RQP A;  3E3V A;  5F64 A;  3TGN A;  3RYR A;  1P4A A;  3CJN A;  3HRT A;  1ONV A;  1TW2 A;  3RIR A;  3WU0 A;  2G7U A;  1XCB A;  3M9A A;  1O3S A;  4F7Z A;  1U6G A;  2PMH A;  2V1X A;  4M6Y A;  2VBZ A;  3ECH A;  3GZ5 A;  4A0Z A;  1XMA A;  1FSE A;  1Z6R A;  2CFX A;  4MTE A;  1SD5 A;  2YX7 A;  3DPT A;  1ODD A;  4CIC A;  2JPB A;  5HS7 A;  1UST A;  1L0O C;  2BYV E;  3VOE A;  2HYG D;  3DV8 A;  4U0W A;  4BQA A;  3PQJ A;  4HF1 A;  4JBA A;  1SD6 A;  2HKO A;  4HLX A;  3GXO A;  4GO1 A;  4EMS A;  3ZN0 A;  1TLH B;  4ZZL A;  1GVJ A;  1XD7 A;  4KNY A;  4HOB A;  5JVT A;  1CF7 B;  5CJ9 A;  1LEB A;  2QLZ A;  2FMY A;  3F6V A;  3V8L A;  5E1W A;  3RKW A;  3R60 A;  3TKY A;  2IA0 A;  4ON0 A;  2VE9 A;  4U88 A;  2ELH A;  4CHU A;  1Z05 A;  1CF7 A;  5L3C A;  2L02 A;  1UCR A;  3E97 A;  3J81 K;  5D5W B;  1G4D A;  4HF2 A;  3WE3 A;  1T2K A;  1QPM A;  2PLY A;  1TBX A;  1LB2 A;  4I2O A;  1T39 A;  3V8K A;  5BQT A;  5E1X A;  2V79 A;  3EYI A;  4XLN F;  1E2X A;  1YLF A;  5LEJ A;  4ENN A;  3KP2 A;  1HKT A;  1OKR A;  3TOA A;  2FBI A;  1I5Z A;  4CDG A;  4L9T A;  3C7J A;  4L5J A;  2O8X A;  2IRF G;  3Q5F A;  2QWW A;  1K6O A;  1B9M A;  5D5U B;  4I7H A;  1G6N A;  1R00 A;  5L3G A;  4P55 A;  3R4K A;  4G7H F;  2XAJ A;  4IF4 A;  1R7J A;  3E5U A;  5IT9 Z;  2O0Y A;  4E70 A;  2L01 A;  4ZYD A;  2NNN A;  1FP2 A;  2Q8K A;  3KEO A;  3TO7 A;  3IWF A;  5CLS A;  3WE2 A;  3E5Q A;  1FNN A;  2O6G E;  5JR3 A;  1H9G A;  2K4J A;  1FP1 D;  3RKY A;  1U2W A;  3P9C A;  4FX0 A;  3V7R A;  1ZG1 A;  1XGN A;  1T98 A;  3R6S A;  3DPL C;  3R0J A;  1E17 A;  3ZMS A;  3I64 A;  3MQ0 A;  2IW5 A;  3F8F A;  2VOP A;  3FM3 A;  2RGV A;  1Y0U A;  2UZK A;  3KLO A;  1I6X A;  4AVP A;  1Q1H A;  2FSW A;  3CUQ C;  2XUB A;  4Q4Z F;  3N4M A;  2F5C A;  3NQO A;  3ZMV A;  5JI6 A;  1BC7 C;  2V1D A;  4XBF A;  4AWX B;  1SD4 A;  2OAZ A;  3LAJ A;  4EV0 A;  4I98 B;  3KET A;  4AIK A;  1B4A A;  5HLI A;  2M30 A;  3BRO A;  3NRV A;  5FD5 A;  4N0B A;  3BJO A;  2DW4 A;  5HLG A;  4MEX F;  4HYE A;  3ZMU A;  1J7K A;  2DTR A;  3TO9 A;  1KQ9 A;  4A5M A;  3JAM Z;  5CVR A;  1UHW A;  1HBX G;  3TQN A;  1ZH5 A;  2DPU A;  2HOE A;  1KYZ A;  3R61 A;  1K79 A;  2XVC A;  5FD6 A;  1WKM A;  3HTS B;  2QYO A;  3LA2 A;  3O6B B;  4UHT A;  1TQI A;  5DV5 A;  2QM3 A;  3K69 A;  2L4A A;  2DO7 A;  1ZRE A;  1GXQ A;  3WTZ A;  2A6H F;  2VBY A;  2FE3 A;  3LQR A;  4P5O A;  2COM A;  4TV7 A;  5FO5 A;  3OV8 A;  3ZQ7 A;  3IL2 A;  1ZRC A;  1LVA A;  4LB5 A;  1R5H A;  1XB4 A;  1ZAR A;  2M1B A;  4ETS A;  4UNO A;  2OD5 A;  1R36 A;  1YS6 A;  1IN5 A;  3KP6 A;  3EYY A;  5IT9 K;  1Z1D A;  1YIO A;  3ECO A;  3GW2 A;  3M8F A;  1TNS A;  4H0E A;  4ZYH A;  2UXN A;  1ZG5 A;  1REP C;  1TW3 A;  4OOI A;  2EFP A;  2OA4 A;  4S05 A;  3HSR A;  3C3W A;  3HOT A;  1IN4 A;  3SFZ A;  1FSH A;  2ZNZ A;  5BPI A;  4EGY A;  1ON2 A;  2WC2 A;  2WV0 A;  5H6R A;  3TDZ C;  3QU6 A;  4G6Q A;  5D4R A;  1J2X A;  3WOD F;  3VB2 A;  2K86 A;  4A5N A;  5ICC A;  4ZH4 F;  1EV7 A;  2P8T A;  4OU0 A;  1BOA A;  1F4K A;  4A12 A;  1OYY A;  4DQ2 A;  2HTJ A;  5FFX A;  1MJ9 A;  1P4X A;  1FZP B;  1TNT A;  3L00 A;  1MZB A;  1AOY A;  5H20 A;  5A2Q K;  3ZP5 A;  3RYP A;  3VOD A;  4HV6 A;  1U3E M;  2IA1 A;  1QQI A;  5LBQ A;  2O3F A;  3MEX A;  4GYI A;  2ESN A;  4L0Z B;  4WX9 A;  1BC8 C;  2X4H A;  2EB7 A;  2P5K A;  2FNA A;  2PFB A;  2FNP A;  5FB2 A;  1OPC A;  1D3Y A;  1BI0 A;  4MGR A;  3BZ6 A;  1UB9 A;  3C18 A;  4EJV A;  1HKQ A;  3GYH X;  1RUN A;  3P9I A;  2VN2 A;  3GFL A;  3LA7 A;  3KP4 A;  1MJA A;  4AIH A;  4LGW A;  2DU9 A;  1IF1 A;  2NYX A;  3DXJ F;  3WTX C;  4L0Y B;  5FGM A;  4KIC A;  1WWX A;  5F1R A;  3IC7 A;  2J5O A;  1RUO A;  4LG0 B;  1FOK A;  3ZN1 A;  2QEN A;  1FLI A;  4Y17 A;  1OYI A;  4ENJ A;  2Y48 A;  3WTT C;  3REO A;  5ED4 A;  2KJC A;  1B1B A;  1S7A A;  1G3T A;  3WTS C;  1O3Q A;  2L4M A;  1T0F A;  5AIP A;  2IA2 A;  1W5S A;  2PI0 A;  3IKT A;  1R22 A;  1MGT A;  1ZN2 A;  2HS5 A;  5ICG A;  4B09 A;  2W84 A;  2Z99 A;  3AAF A;  1RI7 A;  1BI2 A;  2J5P A;  2RKH A;  3GFM A;  3V8J A;  4OMY A;  3MAJ A;  1XMK A;  2F2E A;  3SZT A;  3FXQ A;  4G7Z F;  2QBY A;  2VC0 A;  1XCV A;  4A2U A;  3I59 B;  3ZMT A;  1QBJ A;  5DUK A;  2MLK A;  2QQ9 A;  5E17 F;  1FBS A;  2FBH A;  1S29 A;  4LLG F;  3E6C C;  2R7D A;  2PQ8 A;  1HW1 A;  2F5F A;  2FQ3 A;  5D6E A;  2D1V A;  2ZBK A;  4CZZ A;  3T0Y A;  1YO5 C;  3WTV C;  2GWR A;  3VEP A;  5H6Q A;  1JHH A;  4L9J A;  4M9S A;  5D5X B;  3WG9 A;  2ZME A;  4HX7 A;  2K4B A;  4EM1 A;  3RPQ A;  2MH9 A;  2G9W A;  5LRR A;  3FXU A;  3KZY A;  4KA4 A;  2EV5 A;  3U1D A;  4DNC A;  1S3J A;  3I0T A;  3HSF A;  4M74 A;  1ZYR F;  1MKM A;  1W4M A;  2EFN A;  3KCC A;  5KK1 A;  5HLH A;  1U8R A;  3HUG A;  4RAY A;  1SD7 A;  4O3M A;  4LK0 F;  1Z6T A;  3FXR A;  1DPR A;  2PG4 A;  2RV8 A;  1I1S A;  4L9N A;  4RAZ A;  3Q9S A;  4EJU A;  4G94 A;  3NEU A;  3E6M A;  1Z91 A;  3D0S A;  1C0W A;  1BIA A;  1H0M A;  4EM2 A;  4BHP A;  1ZLJ A;  5DD8 A;  4LD5 A;  2MH2 A;  4EJT A;  3MZH A;  5LLQ A;  3QRF F;  3DEU A;  2STW A;  4RB2 C;  2ZFW A;  3ELK A;  3WGH A;  1D5V A;  3HRS A;  4OMZ A;  2W24 A;  2A69 F;  3KP5 A;  5CVV A;  4LK1 F;  1HQC A;  2LKP A;  3BP8 A;  4GCV A;  3HOS A;  1V4R A;  1IN8 A;  2HQR A;  4IHS A;  1R1U A;  1IUY A;  2QQA A;  2KJB A;  5LGN A;  2YR2 A;  2Z9O A;  2WTE A;  4KIB A;  1BJA A;  1U5T B;  2V1U A;  2GZW A;  5L3B A;  2EK5 A;  2Z5U A;  4HV5 A;  3DFG A;  2JZY A;  1TTY A;  1H9T A;  1J59 A;  2FXA A;  4NB5 A;  5JFR A;  4BYY A;  3F23 A;  1R5G A;  4IJA A;  3Q9V A;  5J6X A;  2ZO4 A;  3GF2 A;  4YII A;  3SQN A;  2E7W A;  1G3Y A;  1IXR C;  2M8E A;  2O03 A;  2E1N A;  1SMY F;  3BPX A;  4WF2 A;  3GX4 X;  2XAS A;  3WTY C;  2EV6 A;  3KE2 A;  5A2Q Z;  3DF8 A;  4HQM A;  4OIQ F;  3DP7 A;  1A04 A;  1ZAO A;  1IXC A;  2RVC A;  4KYW A;  3FMQ A;  1T38 A;  5CVU A;  2H27 A;  4BH9 A;  3ZMD A;  5ERI A;  3SXY A;  2IJL A;  3F3X A;  3HRM A;  2P7V B;  3M1E A;  2DI3 A;  4Q48 A;  5BPD A;  2RC4 A;  2H94 A;  1L3L A;  2HWV A;  4P96 A;  3TDU C;  4YFK F;  2CG4 A;  4U0V A;  3CTA A;  3L9F A;  2W85 A;  4N9H A;  1FPQ A;  4I02 A;  3J7A O;  1B6A A;  2K27 A;  5CYV A;  2XGX A;  3TOB A;  6PAX A;  3KLN A;  1XGS A;  4BAY A;  4WWC A;  4HF0 A;  3LAP A;  1RIO H;  4IVN A;  1KGS A;  2MD5 A;  4PZJ A;  5EEH A;  2JTV A;  1EH6 A;  1K7A A;  2KKO A;  4LLL A;  1FX7 A;  1PUE E;  4U0Y A;  3DQV C;  3D5L A;  3W6J B;  4NHJ A;  1F1Z A;  1WQ2 A;  2EA2 A;  2GA2 A;  4LFU A;  3F8N A;  5FFZ A;  2W57 A;  2W25 A;  2Z33 A;  3QP5 A;  2OU2 A;  3JTG A;  1SFX A;  4LB6 B;  3HHH A;  2XAH A;  2M45 A;  1DUX C;  2XRO A;  2A3S A;  2PN6 A;  2DAO A;  3H3Z A;  1J9I A;  5L3D A;  3K9T A;  1U5T C;  2ADU A;  3GZ6 A;  1PP7 U;  1ZHF A;  3FMS A;  1JHF A;  1HXD A;  2LF8 A;  3L7W A;  2VBW A;  4OIP F;  2CSO A;  4PGH A;  4EJO A;  3EQL F;  1KQ0 A;  3GLX A;  2DK8 A;  1TQM A;  3GEZ A;  1SFU A;  3F21 A;  2EFW A;  2L54 A;  1KYW A;  1MDM A;  1KU3 A;  2HGC A;  5L3E A;  3RJP A;  5J8C A;  5EEG A;  4R1H A;  3RI4 A;  4CYD A;  4HDV A;  2DBB A;  3T8T A;  4AIJ A;  2BGC A;  1KU7 A;  2HTS A;  2R3S A;  5FLX K;  3WTU C;  4QWQ A;  2XV4 S;  2HZT A;  3M8E A;  1QNT A;  4CO8 A;  5K5O A;  5J8F A;  1FWZ A;  5L3F A;  4EGZ A;  5ICF A;  1F9N A;  3E6D A;  2AS5 F;  1XSX A;  4XSX F;  4G7O F;  1FBQ A;  4UV8 A;  4LJZ F;  2BE5 F;  5ILU A;  5HS9 A;  4ESF A;  1XSD A;  2HKX A;  1T6S A;  2UWM A;  1G3S A;  5HDK A;  1WRJ A;  5LGT A;  1FBU A;  2D2W A;  1HW5 A;  2STT A;  4M6X A;  3ZMZ A;  4EQQ A;  3O2P E;  5FLX Z;  3FF5 A;  2CYY A;  2A5Y B;  2KIM A;  3HYI A;  4WK8 F;  3ML6 A;  4N9I A;  4Y15 A;  1G3W A;  1SFE A;  3U2R A;  3H92 A;  4OIR F;  1S6L A;  3P7N A;  3CO7 C;  3GO5 A;  1KA8 A;  2MA3 A;  1FYK A;  3F6O A;  3CO6 C;  4UVC A;  4YFX F;  4HLY A;  1YTY A;  1P92 A;  5JHU A;  3LST A;  5DDG A;  4MHG A;  4MNU A;  4LG0 A;  3I58 A;  2C6Y A;  2YPR A;  3N97 A;  2EWN A;  3M7G A;  3V7C A;  2MC3 A;  3E6B A;  3JAM K;  1USS A;  1LJ9 A;  2ACJ A;  3MWM A;  2JRT A;  4ASN A;  1J5Y A;  1BM9 A;  3BDD A;  1ZGJ A;  3QP6 A;  1YQA A;  2OZU A;  3LQQ A;  5LGU A;  2A68 F;  4BXU A;  4B8X A;  2PEX A;  1RNL A;  4BHC A;  5DYM A;  3K1M A;  4M9X A;  1SAX A;  1IW7 F;  1KQ8 A;  4M71 A;  4UUV A;  2EJR A;  4IRI A;  2PBI A;  3QAH A;  2L3D A;  4GGG A;  1D8K A;  4WXH A;  4UXN A;  3KP7 A;  4U7D A;  1YFH A;  1MDM B;  2DQR A;  1YS7 A;  2KRF A;  3JSO A;  1K78 B;  3BPV A;  3HTU A;  4HDU A;  4HQE A;  4IRH A;  4EVI A;  4FT8 A;  2NNY A;  1YW8 A;  2Q2E A;  3E5X A;  4BNC A;  1IN7 A;  2VT3 A;  1IZ1 A;  5D5V B;  1V3F A;  1WSU A;  3TO6 A;  4UV9 A;  4ENM A;  5HVQ C;  2A07 F;  4FHT A;  1MJB A;  5DCM B;  4WXC A;  1W5T A;  3I71 A;  2IT0 A;  4G6D A;  3I5U A;  1R1V A;  5LHH A;  5D4S A;  4PDK A;  5DCM A;  1UFM A;  1ZGA A;  1I27 A;  3PFI A;  3FX3 A;  2BV6 A;  2ZKZ A;  2FBK A;  4GXO A;  3EUH A;  2VBX A;  2ZCW A;  3IHU A;  5LRS A;  2FOK A;  1LDK B;  1X3U A;  5LHI A;  2G7H A;  4BHB A;  1XDS A;  2IP2 A;  3BJ6 A;  4IRG A;  2YU3 A;  1KU2 A;  4RB0 A;  1HST A;  2O61 A;  1J0R A;  3FMR A;  1LDJ A;  1JE8 A;  2GAU A;  3U9G A;  2CWE A;  4XRF A;  4L9V A;  1I1G A;  4PGG A;  2GIV A;  2XRN A;  5ILV A;  3LA3 A;  2QVO A;  2H6C A;  2M87 A;  2VXZ A;  1BBY A;  4EJW A;  1P2F A;  3ROU A;  1P6R A;  2RN7 A;  4IPA A;  2MBF A;  4M72 A;  1W7P A;  2NS0 A;  4A0X A;  3ABT A;  2HEO A;  4XSZ F;  2YSR A;  1O7F A;  2X0L A;  3QU3 A;  4MEY F;  2FU4 A;  5ICE A;  1LDD A;  1NHA A;  1U5T A;  4IXA A;  2YX4 A;  3S2W A;  3T8R A;  3GFJ A;  1YW9 A;  1B59 A;  2GXB A;  1SMT A;  2CO5 A;  2XAQ A;  2DK5 A;  1B9N A;  4R79 A;  2R7F A;  1BI1 A;  3L2C A;  2XAG A;  1PDN C;  4WXD A;  3JSP A;  1XDU A;  2HYF A;  5BS6 A;  3KFW X;  4HX4 A;  3WGI A;  4G8X A;  2JSC A;  4L5I A;  2P6S A;  5DEQ A;  1FC3 A;  1LEA A;  4MQ9 F;  4EM0 B;  2DFI A;  1PP8 F;  2CW0 F;  3GFI A;  4FX4 A;  1ZRF A;  3IRR A;  2ZXJ A;  4RS8 A;  1ULY A;  2V6C A;  4L18 B;  1LQ1 A;  3HIF A;  1Z7U A;  5TRD A;  4D0P A;  2D45 A;  4HAM A;  1EH7 A;  3FWE A;  3FM5 A;  2BBY A;  4CGZ A;  3HHG A;  5D8K B;  2IPQ X;  3GVA A;  5LHG A;  3PQK A;  1R58 A;  1ZRD A;  4S04 A;  3BWG A;  2DPD A;  1ZG3 A;  4RB3 C;  2GA1 A;  5K5Q A;  1RZ4 A;  1XN7 A;  3QPH A;  4MTD A;  4WCG A;  2NRA C;  3CUO A;  1S7O A;  4RGU A;  5E18 F;  3F8B A;  4KIF A;  2Y75 A;  1O3T A;  4KN4 X;  4U7B A;  3MFK A;  3F8M A;  3J80 Z;  4UVA A;  4RGS A;  1FYL A;  1VTN C;  5BMZ A;  3I4P A;  1XSV A;  1D8J A;  2HDC A;  3RTR A;  5D8L B;  4HBL A;  2FML A;  3BJA A;  4YG2 F;  2CQK A;  2VOO A;  4IHT A;  4G9Y A;  5K5R A;  4O5V A;  1QZZ A;  5F6F A;  2P5V A;  5DUI A;  2DT5 A;  4XLP F;  2XKO A;  2FA5 A;  3L09 A;  4KIG A;  4QLC U;  2JPC A;  3T1B A;  3JW4 A;  3I59 A;  2XAF A;  3ERE D;  5HOO A;  4KN7 X;  1U78 A;  4M73 A;  2P4W A;  2EFQ A;  1YG2 A;  3VFZ A;  1TQP A;  4PCQ A;  5E20 A;  2UXX A;  1KU9 A;  2VOD A;  2EFO A;  3B73 A;  2F5D A;  1AWC A;  1J75 A;  2HFH A;  4RGX A;  3FZV A;  1DDN A;  4KFC A;  1XGO A;  2D1H A;  1IAW A;  5K1Y A;  2XKP A;  2FF4 A;  3K1N A;  3BOQ A;  1IN6 A;  2EA4 A;  1DP7 P;  2CGP A;  1GXP A;  2QUF A;  2VC1 A;  5KVR A;  1IXS B;  3IRQ A;  2JT1 A;  3B02 A;  4ZZD A;  2K7L A;  2E1C A;  2Y0M A;  3CUQ A;  3H3U A;  1QZY A;  4I01 A;  3K1P A;  4K2E A;  4MQV A;  4NQW A;  2IVM A;  3IWZ A;  5DD4 A;  5TJJ A;  1STZ A;  2RNJ A;  3RDI A;  3DKW A;  4AD9 A;  1FYM A;  3KP3 A;  2QZ8 A;  3IKV A;  1GHC A;  4HA8 A;  3F22 A; 
#chains in the Genus database with same CATH topology
 2QQB A;  2ISY A;  1WJD A;  1O57 A;  2CU7 A;  1QO0 D;  2ETH A;  1AU7 A;  5HDG A;  1OCC H;  2F5E A;  2W82 A;  4D5F A;  2M4K A;  1BN5 A;  1YJW I;  4RDU A;  3ZCO A;  3DU5 A;  2XB0 X;  5E1Z B;  2VI6 A;  3O3K A;  2PMU A;  2A6E F;  1WI9 A;  5EEA A;  3FXM A;  5DCF A;  2KIU A;  4XLE A;  3HOV J;  3CC7 I;  4I0B A;  2FOW A;  1BI3 A;  1VQ4 I;  1F5T A;  4IZZ A;  4A3E J;  5HNH A;  5FLV A;  3MKL A;  4BQN A;  4Q5S F;  3FXL A;  3K0L A;  3CMA I;  4IHW A;  2HYJ A;  5IYD J;  5CPR B;  3S16 J;  1W7P B;  1QPI A;  1MBH A;  5CVI A;  2XGD A;  3EET A;  4R8H A;  2M5W A;  4M9Z A;  5C4J J;  2A5W A;  3CLO A;  4ESJ A;  1X3Z B;  2XHK A;  4I09 A;  3TP3 A;  1XGM A;  3SZP A;  4PFO A;  4S0H B;  3W6K B;  5E8I A;  1O7L A;  3WU1 B;  1QHH D;  1HSJ A;  1MNE A;  3QPT A;  3SHF A;  1BIB A;  2OCC H;  1XX5 A;  1IRG A;  2ZNY A;  2LG4 A;  1Y6I A;  4ESB A;  4B3A A;  1OCZ H;  4Y13 A;  3HL2 A;  3SZG A;  3F72 A;  2ELJ A;  2UV1 A;  3WHB A;  1X19 A;  4IX7 A;  2QEX I;  3K2Z A;  4PFP A;  3CDH A;  3E1S A;  1P4W A;  2DDB A;  4M3D A;  5E3L A;  2GXG A;  1IG7 A;  5AON A;  1JXS A;  3D5S C;  1FT9 A;  2TDX A;  4UUS B;  1HKS A;  5H2F C;  3LWF A;  1OMI A;  1BW5 A;  2JVG A;  3KZZ A;  1YW7 A;  3LSJ A;  2DQL A;  3B6C A;  4HX8 A;  4KMU X;  5IT3 A;  1JUM A;  3WGG A;  1VZ0 A;  2YS9 A;  2IBD A;  3G3Z A;  2WA0 A;  5BOX A;  3BY6 A;  5EGO B;  5E8G A;  1BW6 A;  3MZ8 A;  4HG2 A;  2Q0O A;  3SDG A;  1R1T A;  1UHM A;  2F4M B;  3R0A A;  2LSO A;  2WB1 N;  2DA1 A;  3KPH A;  1YJN I;  1Z0X A;  3A03 A;  2IEK A;  4E7J A;  4A3J J;  2ZME B;  2GQQ A;  3H5R A;  2X51 A;  3SYT A;  2Y30 A;  3TL4 X;  2P5L C;  3V4G A;  2FEZ A;  5EG0 B;  3RKX A;  2BVM A;  4BS9 A;  5LEK A;  2CQN A;  2H6B A;  2WWY A;  1WCM J;  2XDV A;  2RRE A;  2RDP A;  3LSK A;  3T5X A;  3COA C;  3CF5 F;  2MLG A;  5CVJ A;  3OOP A;  4LLN A;  2HQN A;  4DBQ A;  1PYV A;  1FOY A;  2A61 A;  2V9V A;  4Q47 A;  5AIQ A;  5GPA A;  1ZLK A;  4A6D A;  4I6Z A;  3SJM A;  1R9T J;  2X1D A;  2QBY B;  2LVS A;  4XLC A;  2EV0 A;  2EQR A;  3I54 A;  4KUM A;  2VE8 A;  1YYV A;  2ID3 A;  2L0K A;  4RGR A;  2PMZ N;  2E7X A;  1K78 A;  2LKS A;  2OQG A;  3HOW J;  3J80 K;  2VT2 A;  2MSY A;  2DT6 A;  3IUO A;  4I0A A;  2K9M A;  4KT5 C;  4BY1 J;  1ZR4 A;  3EDP A;  2P6T A;  5C44 J;  3FHZ A;  2FRH A;  2PJP A;  2ESH A;  4D7N A;  4E7H A;  2ZFU A;  4JQF A;  2KIQ A;  3RPU A;  1DGW Y;  4KMF A;  1F43 A;  4CCM A;  1HW2 A;  2YU9 J;  3CUQ B;  2E1M C;  2AXL A;  2LNB A;  3CCE I;  1Z77 A;  4V2F A;  3L1P A;  1IRF A;  3HG9 A;  4P9U A;  4GYG A;  3ZPL A;  3ZRG A;  4AYB A;  3F8C A;  1LUJ B;  2OZ6 A;  3DPU A;  1G8X A;  3HGG A;  1R23 A;  4OIO F;  2KIF A;  4ENK A;  2LFB A;  3A01 B;  4OIN F;  3H9G A;  2ZJ2 A;  2VON A;  1Y1W J;  3V7S A;  1QGP A;  3ISP A;  4HZF A;  3MCZ A;  3KEQ A;  2R5Y A;  2B0L A;  3QOP A;  5D6F A;  1Z9C A;  2K02 A;  3QYB A;  3ASN H;  2QKL B;  1MW7 A;  3P9K A;  1T08 B;  2HR3 A;  3K4C A;  2BXY A;  4HW0 A;  2MG4 A;  3OR1 C;  3Q0U A;  4A3I J;  3G6E I;  2MFZ A;  1EH8 A;  4E7S A;  3KYC B;  2CV0 A;  3CZ6 A;  3WTW C;  4UVB A;  3ULQ B;  5M5Y J;  1JGS A;  3HSE A;  3ZQF A;  4RM3 A;  2F4O B;  3OYD A;  2HQA A;  4LMY A;  4BXF A;  2B7E A;  3MZY A;  2H09 A;  1U9O A;  4ZYE A;  5B1A H;  3GUD A;  4KIT B;  3VSK A;  3J81 Z;  2BEO A;  3GTK J;  4BBR J;  4CXF A;  3LFK A;  4Z2Y A;  1X2M A;  2M7B A;  2VJ4 A;  3GWZ A;  2Z3Y A;  4YIF A;  3HRU A;  4L5E A;  1OR7 A;  2LDU A;  3G73 A;  2K3F A;  4HNT A;  3AG2 H;  4FQG A;  5FJ8 J;  4C9Y A;  2XPU A;  1ON1 A;  4A6E A;  4GFB A;  2OQR A;  1BJZ A;  4P1W A;  2Z2S B;  4PJJ A;  1D0Z A;  3HEF A;  1VQK I;  3MKZ A;  1WVR A;  2KZV A;  4C2U A;  3JR9 A;  1RKT A;  5DS9 A;  4RB1 A;  2QF7 A;  3BG6 A;  2LBF B;  2M2E A;  4ZYG A;  2DLL A;  2KRH A;  4JK1 X;  3RZO J;  1MD0 A;  3I53 A;  2Q1Z B;  3NAU A;  2R7R A;  1W7P D;  4YIR X;  5M5W J;  4D5C A;  1O4X A;  4P9F A;  1DPU A;  1OYW A;  1YE9 A;  5HS8 A;  3ZXS A;  1N75 A;  4KDP A;  1WJA A;  3E0J B;  1WJF A;  3C1D A;  4FE4 A;  2DYS H;  3ABU A;  2ISZ A;  2LF7 A;  1A36 A;  2NAZ A;  5HDN A;  2OBP A;  4O6J A;  1S8N A;  1O3R A;  1K4S A;  2ZME C;  3M8J A;  3JTH A;  1MND A;  2ZB9 A;  4YFN F;  2XIG A;  5ILS A;  2JQ7 A;  2P7C B;  1LNW A;  1CGP A;  4A0Y A;  2E36 A;  1FY7 A;  1K83 J;  2RQP A;  3E3V A;  4ITV A;  5F64 A;  3TGN A;  4XMY A;  2MD0 A;  3ESW B;  3FIW A;  4FIS A;  2HXI A;  3KZI C;  3RYR A;  2DA3 A;  1P4A A;  3CJN A;  2BVL A;  3HRT A;  1ONV A;  1TW2 A;  3RIR A;  2M3A A;  2DFE A;  3WU0 A;  3B6A A;  2G7U A;  1XCB A;  3VDX A;  2H8R A;  3M9A A;  4F7Z A;  4CCK A;  1O3S A;  1U6G A;  4Z6Y A;  2PMH A;  5DM6 F;  1R4M B;  2V1X A;  4M6Y A;  2VBZ A;  2R7O A;  3RQ4 A;  5J4V A;  5EG0 A;  3ECH A;  3GZ5 A;  2K40 A;  4A0Z A;  1VQL I;  1XMA A;  1FSE A;  1Z6R A;  2CFX A;  4MTE A;  4XR6 A;  1SD5 A;  2YX7 A;  3OSG A;  1OIS A;  5GPC A;  3DPT A;  1ODD A;  4CIC A;  5J40 A;  4E7K A;  1E3H A;  2JPB A;  3S2H J;  1D0Y A;  5HS7 A;  1UST A;  1L0O C;  2BYV E;  2VJI A;  3VOE A;  4B4C A;  3L2W A;  2HYG D;  3DV8 A;  1VF9 A;  4IHY A;  2H8W A;  4U0W A;  4XOT A;  4BQA A;  3PQJ A;  4M3F A;  4HF1 A;  1E3P A;  4JBA A;  1SD6 A;  3MKY B;  3SEQ A;  2L7K A;  2R5Y B;  1IJW C;  4A93 J;  2HKO A;  3ZQL A;  1X58 A;  4HLX A;  2R4G A;  1G2H A;  3GXO A;  3HUG B;  4GO1 A;  4EMS A;  3ZN0 A;  1TLH B;  5E3M A;  4ZZL A;  1UHS A;  1GVJ A;  1XD7 A;  4KNY A;  3RKQ A;  4HOB A;  5JVT A;  1CF7 B;  5CJ9 A;  2VIX A;  4AVZ A;  1LEB A;  2QLZ A;  2N8G A;  3DTE A;  2FMY A;  3F6V A;  1MSF C;  1D1B A;  2M9H A;  2X6X A;  5E1W A;  3RKW A;  3S93 A;  3R60 A;  3V8L A;  2R5Z A;  3TKY A;  2FQ4 A;  1R71 A;  2IA0 A;  3A01 A;  4ON0 A;  1LE8 A;  2VE9 A;  4U88 A;  2ELH A;  2GM4 A;  4CHU A;  1Z05 A;  2OTJ I;  5M3M J;  5E3O A;  1JKQ C;  1CF7 A;  3H35 A;  5L3C A;  2L02 A;  1UCR A;  4DOZ A;  1X1P A;  2EIN H;  2OF7 A;  3E97 A;  2DN0 A;  3M1C A;  2E35 A;  2XF5 A;  3J81 K;  3CCL I;  4RBO A;  5D5W B;  3J7Z I;  2IS6 A;  1G4D A;  4HF2 A;  1GV2 A;  3WE3 A;  3LOC A;  5DTD A;  1T2K A;  1QPM A;  4ZJZ A;  5EDN A;  2PLY A;  1TBX A;  1LB2 A;  4I2O A;  1T39 A;  1WGX A;  3V8K A;  5BQT A;  1LPQ A;  1X2N A;  2R0Q C;  4U87 A;  5E1X A;  2DMP A;  3OIP A;  2V79 A;  4XLN F;  2VJJ A;  3EYI A;  5J1Y A;  1EKE A;  3EUH C;  1E2X A;  1YLF A;  4E6K G;  3SFI A;  4DIQ A;  5LEJ A;  3DCF A;  4ENN A;  1YIJ I;  3OY9 A;  1SFK A;  3IV5 A;  3GBG A;  4DZP A;  2W7N A;  1SFO J;  3BR2 A;  3KP2 A;  2CV1 A;  1OKR A;  3TW7 A;  1HKT A;  3TOA A;  1TWC J;  2FBI A;  4QPQ A;  1I5Z A;  4CDG A;  4L9T A;  3C7J A;  1RPW A;  2WAF A;  4L5J A;  2O8X A;  2IRF G;  3CMY A;  3Q5F A;  2QWW A;  1AKH A;  4IQ4 A;  1K6O A;  1B9M A;  2W48 A;  2NVU B;  3CJQ B;  5D5U B;  4I7H A;  2LK2 A;  3PSI A;  5FKM A;  1G6N A;  1R00 A;  5L3G A;  4LIV A;  4P55 A;  4YEJ A;  3R4K A;  2ELK A;  2OC6 A;  1EA3 A;  2XAJ A;  4G7H F;  1XTA A;  4IF4 A;  1MH4 A;  1R7J A;  3OMY A;  3E5U A;  4KT6 A;  1WJE A;  4C3I J;  5IT9 Z;  2O0Y A;  4FCY A;  3K4B A;  4E70 A;  1DP3 A;  2WAQ A;  2L01 A;  5J1R A;  3LSH A;  1A6Q A;  4ZYD A;  2IAI A;  1H89 C;  2VQL A;  2BZT A;  2NNN A;  2VXD A;  3A02 A;  4UY8 I;  3OYI A;  1FP2 A;  4QIW N;  4II2 A;  2Q8K A;  2RAE A;  2KL4 A;  3KEO A;  3TO7 A;  3IWF A;  5CLS A;  1SVO A;  3WE2 A;  3E5Q A;  3JRD A;  1FNN A;  4NC7 A;  1ZK8 A;  2O6G E;  5JR3 A;  1H9G A;  4BGD A;  2HXO A;  2K4J A;  1FP1 D;  3RKY A;  4BAC A;  1U2W A;  1V5G A;  3P9C A;  3DBL B;  3G2B A;  4FX0 A;  3V7R A;  1ZG1 A;  1XGN A;  4N4O B;  2KDO A;  1R49 A;  1T98 A;  3R6S A;  1Y39 A;  3DPL C;  3R0J A;  5IOY A;  3I9V 2;  1E17 A;  2VKD A;  3ZMS A;  3I64 A;  4UB6 C;  4YEL A;  3MQ0 A;  2IW5 A;  3F8F A;  2VOP A;  3FM3 A;  2JVH A;  3HOU J;  2HDW A;  2RGV A;  3BQY A;  1Y0U A;  3CQZ J;  2UZK A;  2AXT C;  3KLO A;  2JUC A;  1I6X A;  3CMM A;  4AVP A;  1Q1H A;  2V7F A;  2FSW A;  3RCO A;  3CUQ C;  2XUB A;  4Q4Z F;  3N4M A;  2LD5 A;  1QVU A;  2CW7 A;  2F5C A;  3NQO A;  3ZMV A;  2XGE A;  3VYR B;  2ME0 A;  5JI6 A;  2BY1 A;  1BC7 C;  1X4O A;  2V1D A;  4XBF A;  4AWX B;  1OCP A;  4BKX A;  5GAH J;  1SD4 A;  3GTM J;  2XSD C;  1LE8 B;  2OAZ A;  4HPQ A;  3LAJ A;  4EV0 A;  1WJ5 A;  4I98 B;  3KET A;  3U1K A;  4AIK A;  2OUM A;  4F3Q A;  1B4A A;  3TW6 A;  5HLI A;  2M30 A;  3BRO A;  3NRV A;  5FD5 A;  1MMN A;  3HC7 A;  3K70 C;  4N0B A;  3BJO A;  2DW4 A;  5HLG A;  1WHU A;  4MEX F;  4HYE A;  3ZMU A;  1J7K A;  2DTR A;  3TO9 A;  1NH3 A;  1KQ9 A;  3DLA A;  4A5M A;  3DU6 A;  3JAM Z;  5CVR A;  1UHW A;  2HDD A;  3JCU C;  3TQN A;  4B1R A;  1HBX G;  1ZH5 A;  5DM7 F;  5M5X J;  2DPU A;  3HKZ N;  2HOE A;  1KYZ A;  2F5V A;  3R61 A;  3MN2 A;  4G12 A;  1YX3 A;  1K79 A;  2XVC A;  5FD6 A;  1WKM A;  3QYF A;  3FKI J;  5IP9 J;  1X1C A;  2QYO A;  3LA2 A;  3O6B B;  5M3F J;  3HTS B;  1IDZ A;  1ETO A;  5FRN A;  2DJI A;  4UHT A;  1TQI A;  4BDY A;  2VB6 A;  1XC5 A;  2L9S A;  5DV5 A;  2K9Q A;  4A3L J;  2QM3 A;  3K69 A;  2L4A A;  2XB5 A;  3CDI A;  2DO7 A;  4F55 A;  1VI0 A;  2JN6 A;  1ZRE A;  1GXQ A;  4H4K C;  3H9J A;  3WTZ A;  2A6H F;  2LR8 A;  2VBY A;  2FE3 A;  3LQR A;  1X4P A;  1TZL A;  4P5O A;  2COM A;  1UZC A;  4TV7 A;  2COB A;  5FO5 A;  5FRM A;  3OV8 A;  3ZQ7 A;  3IL2 A;  3CJT B;  2AQE A;  4CYC A;  1ZRC A;  4ABZ A;  4FE7 A;  2NVT J;  1LVA A;  1RC9 A;  4LB5 A;  1R5H A;  3DWL E;  3ABK H;  1XB4 A;  1ZAR A;  2M1B A;  2MGQ A;  4ETS A;  2E5Z A;  2GXA A;  4UNO A;  2OD5 A;  1R36 A;  1YS6 A;  1IN5 A;  3H5A A;  1YRN B;  4C3H J;  4CSW A;  4RM2 A;  1BR1 A;  4N4N B;  3LSP A;  3KP6 A;  3BZK A;  3EYY A;  3JRH A;  1MMG A;  2X6Y A;  5IT9 K;  1Z1D A;  1YIO A;  3ECO A;  3FIS A;  3GW2 A;  4JX5 A;  3M8F A;  1TNS A;  1YIT I;  3CF2 A;  3DKY A;  3IP4 B;  4MFD A;  1AA7 A;  4H0E A;  5KHD A;  4ZYH A;  2UXN A;  1ZG5 A;  1OLT A;  2OPT A;  3OOU A;  3AFH A;  1REP C;  1TW3 A;  2M0C A;  2VQG A;  4OOI A;  2EFP A;  2OA4 A;  3DKX A;  2O7O A;  2BY0 A;  4S05 A;  3I4M J;  3HSR A;  3WG7 H;  5LFA A;  1WH5 A;  3DBH B;  3C3W A;  3LL7 A;  3HOT A;  1DU6 A;  1IN4 A;  4DW6 A;  3SFZ A;  3W6V A;  1FSH A;  2L9N A;  2ZNZ A;  2L7M P;  5BPI A;  2CW8 A;  3CCV I;  3L2R A;  4EGY A;  3CD6 I;  1ON2 A;  2QSH X;  2DTZ A;  1ACI A;  2Y0S N;  2WC2 A;  2WV0 A;  5H6R A;  2GBY A;  3ZQI A;  1JJ8 C;  2M8G X;  3JRE A;  3PO3 J;  3TDZ C;  3QU6 A;  4G6Q A;  5D4R A;  1LVK A;  4ZDO A;  4BJ6 C;  2IGO A;  1D5Y A;  1J2X A;  3WOD F;  3VB2 A;  2K86 A;  4A5N A;  1OQY A;  4ZH4 F;  1EV7 A;  2P8T A;  5ICC A;  4OU0 A;  1BOA A;  2NOJ B;  3C2H A;  1F4K A;  3K4J A;  1FTT A;  1SVM A;  5F04 A;  4A12 A;  1OYY A;  3HBL A;  4DQ2 A;  2HTJ A;  3CCS I;  5FFX A;  1MJ9 A;  2AO9 A;  2DMQ A;  3K6G A;  4B43 A;  1ZEL A;  1P4X A;  4IEJ A;  1FZP B;  4CH7 A;  2BY2 A;  4BJ5 C;  1TNT A;  2K9L A;  3PUB A;  4RAF A;  1WJC A;  2ECB A;  2ZJQ F;  3ABM H;  3S3O A;  3L00 A;  1PUF A;  1MZB A;  1PVE A;  2K9N A;  2I5U A;  1TL8 A;  1AOY A;  3BCA A;  3O8H A;  5H20 A;  5A2Q K;  3ZP5 A;  3RYP A;  3VOD A;  2H1K A;  1W1W E;  4HV6 A;  1U3E M;  4Y7N J;  2HI3 A;  2IA1 A;  3J7Y J;  1QQI A;  4E7I A;  5LBQ A;  1I6H J;  2O3F A;  3MEX A;  4GYI A;  2EBI A;  2ESN A;  4UB8 C;  4L0Z B;  4WX9 A;  1BC8 C;  2X4H A;  3BLY A;  1RKW A;  2EB7 A;  2P5K A;  5GAG J;  2FNA A;  2PFB A;  2FNP A;  3HPG A;  5FB2 A;  4Y33 A;  1OPC A;  1D3Y A;  1BI0 A;  3H1C A;  1LFU P;  4MGR A;  4M3B A;  2Y69 H;  3BZ6 A;  1R5I D;  1UB9 A;  3OS1 A;  3C18 A;  4EJV A;  1HKQ A;  3GYH X;  2WY8 Q;  1RUN A;  1JKP C;  3P9I A;  2VN2 A;  3GFL A;  3OWT A;  4M3G A;  4RLF A;  1V54 H;  2O8K A;  5F0H A;  3LA7 A;  2JK3 A;  5IOZ A;  3KP4 A;  1MJA A;  2X1E A;  4AIH A;  4LGW A;  2WB1 A;  2DU9 A;  1IF1 A;  3SEZ A;  2NYX A;  3W2W A;  1IRX A;  3BG9 A;  3DXJ F;  4NUB A;  3WTX C;  3HGY A;  4L0Y B;  5FGM A;  2CFO A;  4KIC A;  1WWX A;  5F1R A;  3IC7 A;  2J5O A;  3UNG C;  1RUO A;  5F0C A;  3K70 D;  4LG0 B;  1FOK A;  3ZN1 A;  3DLL F;  2VKH A;  4ZDL A;  2JA7 J;  2QEN A;  4E7L A;  4A3G J;  1FLI A;  2JA2 A;  1X1D A;  4Y17 A;  2ZXW H;  1OYI A;  1MBG A;  2BHY A;  4LIU A;  3M3Y J;  2JA8 J;  3A0H C;  4ENJ A;  2Y48 A;  3ZOB A;  2KHM A;  3S14 J;  3WTT C;  3REO A;  5E79 C;  4A3C J;  2KMU A;  5KAI C;  5ED4 A;  2KJC A;  4IQJ A;  1B1B A;  1S7A A;  3ERM A;  2JSP A;  3CP8 A;  2CV2 A;  4PJN A;  2F48 A;  2LC2 A;  4D9J A;  1G3T A;  1OCR H;  3WTS C;  1O3Q A;  2O9L A;  3D5R C;  1FMV A;  2L4M A;  1T0F A;  5AIP A;  2IA2 A;  4LOC A;  1W5S A;  5J4Y A;  2PI0 A;  3OYE A;  1MMD A;  3IKT A;  1R22 A;  3BCB A;  4XL9 A;  1MGT A;  3ZQC A;  2LY9 A;  1ZN2 A;  2HS5 A;  1Z3Y A;  5ICG A;  4J00 A;  4B09 A;  2W84 A;  2Z99 A;  3AAF A;  1RI7 A;  1HDP A;  1BI2 A;  3WHC A;  1MBK A;  2J5P A;  2RKH A;  2OTL I;  3GFM A;  4NC6 A;  3V8J A;  4OMY A;  3MAJ A;  3NAR A;  4AYB N;  3GTQ J;  2DOD A;  1XMK A;  2F2E A;  3SZT A;  1FMW A;  3FXQ A;  4G7Z F;  2EZH A;  2QBY A;  2LRE A;  2A6T A;  3PFY A;  1BL0 A;  4XKB A;  2VC0 A;  1LFB A;  2K85 A;  1XCV A;  2HZD A;  4A2U A;  3I59 B;  3ZMT A;  2O5R A;  1QBJ A;  2DMT A;  3Q0W A;  5DUK A;  4IOC F;  2MLK A;  2QQ9 A;  5E17 F;  1FBS A;  2FBH A;  2M0M A;  1BR4 A;  1S29 A;  4LLG F;  3E6C C;  3PM1 A;  3BR5 A;  4AC0 A;  2CUE A;  2E71 A;  2R7D A;  3H3V K;  2E19 A;  1UMQ A;  2PQ8 A;  4BU2 A;  1HW1 A;  1VQP I;  2F5F A;  2FQ3 A;  2R7Q A;  5D6E A;  2D1V A;  2ZBK A;  3BTC A;  4CZZ A;  3SDB A;  1R6R A;  3X2Q H;  3OS2 A;  2DYR H;  3T0Y A;  1YO5 C;  3WTV C;  3TED A;  2GWR A;  3BC8 A;  2NVQ J;  3VEP A;  5H6Q A;  1SVL A;  1JHH A;  1GVD A;  4L9J A;  4M9S A;  5D5X B;  3H9Q A;  2RQQ A;  3WG9 A;  5F27 A;  2W00 A;  2ZME A;  4HX7 A;  1MBE A;  1UEL B;  1GLN A;  2K4B A;  3QOE A;  3RPQ A;  4EM1 A;  2MH9 A;  2G9W A;  4BQO A;  4NDL A;  5LRR A;  3FXU A;  3KZY A;  4DYC A;  1GV5 A;  2EV5 A;  4KA4 A;  3U1D A;  4DNC A;  1S3J A;  5F08 A;  1YJ9 I;  1A6I A;  1B8I B;  2IGN A;  3I0T A;  3HSF A;  3H0D A;  4M74 A;  4AID A;  5TGT A;  4BUP A;  1ZYR F;  4A3K J;  1MKM A;  1RR8 C;  1W4M A;  1OJL A;  2EFN A;  3KCC A;  5KK1 A;  5HLH A;  1U8R A;  3HUG A;  4RAY A;  1SD7 A;  4O3M A;  2KPM A;  2W1O A;  2BW3 A;  4BXX J;  5K7F A;  3K2A A;  3H5N A;  2CMP A;  4LK0 F;  1ITY A;  1Z6T A;  3FXR A;  1DPR A;  3VYT B;  1ETW A;  2PG4 A;  2RV8 A;  1I1S A;  1D0X A;  4L9N A;  3S17 J;  4RAZ A;  4CCN A;  3Q9S A;  2JA6 J;  3FKJ A;  4EJU A;  4G94 A;  1RR7 A;  3GCM A;  2R5Z B;  3NEU A;  3E6M A;  1Z91 A;  3D0S A;  4A3M J;  1C0W A;  1BIA A;  3G1M A;  1H0M A;  4EM2 A;  2K5C A;  5IY5 H;  3QPL A;  1WH7 A;  4RLQ A;  4BHP A;  1IC8 A;  1UG2 A;  1ZLJ A;  3NWS A;  5DD8 A;  2R7V A;  2DOA A;  3K4N A;  4LD5 A;  1RES A;  4C2T A;  2MH2 A;  4EJT A;  1NG6 A;  5J47 A;  1TWA J;  5HOD A;  3MZH A;  2Y9Z A;  2E60 A;  2MC4 A;  5LLQ A;  1H88 C;  1IV6 A;  2GLO A;  2IS2 A;  3FBI B;  3DEU A;  2X85 A;  3QRF F;  2STW A;  4RB2 C;  4B3X A;  2LMD A;  2ZFW A;  3ELK A;  3WGH A;  4CYC B;  1D5V A;  4V2G A;  3HRS A;  3FXK A;  4OMZ A;  2WV1 A;  1B72 B;  3MKW B;  1LKX A;  2A69 F;  2W24 A;  3KP5 A;  5CVV A;  1S7E A;  4NQW B;  1HA8 A;  4LK1 F;  4FAS D;  1HQC A;  2LKP A;  3PIP F;  3HJE A;  2VPL A;  1IUF A;  3BP8 A;  1XS9 A;  4GCV A;  3HOS A;  1V4R A;  1IN8 A;  4C3J J;  2EIJ H;  1XMX A;  2HQR A;  1E3O C;  4IHS A;  2LRD A;  1BA5 A;  1R1U A;  1IUY A;  2CRG A;  2QQA A;  5EYR A;  2KJB A;  2VPR A;  2HVR A;  1IO2 A;  5LGN A;  2YR2 A;  2Z9O A;  2WTE A;  4KIB A;  3D1N I;  1BJA A;  3HOZ J;  1U5T B;  2V1U A;  2ZXI A;  2GZW A;  5L3B A;  2ZC2 A;  1X1A A;  1QU3 A;  2QQ8 A;  3IH4 A;  1TWF J;  2JJ7 A;  2EK5 A;  2Z5U A;  3OYN A;  4HV5 A;  3DFG A;  2JZY A;  1TTY A;  5BNG A;  4B44 A;  1IDY A;  5LD2 C;  1H9T A;  3ZQQ A;  1J59 A;  2DFH A;  2FXA A;  4NB5 A;  5JFR A;  1Y0N A;  1LFP A;  4BYY A;  4PJM A;  1I39 A;  1V5E A;  3FDY A;  5GP9 A;  3F23 A;  3L2Q A;  1V5F A;  3A0B C;  1JT6 A;  1R5G A;  2HPI A;  5IYB J;  4BE2 A;  4ZDP A;  1K61 A;  3HDD A;  1Z67 A;  3OYL A;  1Z3X A;  2NVX J;  4X6A J;  4IJA A;  1X3W B;  3ZQG A;  3AKZ A;  4F91 B;  3Q9V A;  3LMM A;  9ANT A;  5J6X A;  4ZC3 A;  2Y2Z A;  2ZO4 A;  3GF2 A;  1Y1V J;  3K7A J;  4FTH A;  2DMN A;  3GTL J;  2EIL H;  2LY2 A;  4YII A;  3OSF A;  3SQN A;  2E7W A;  1G3Y A;  1IXR C;  3S1R J;  2M8E A;  1Z7L A;  2O03 A;  2E1N A;  1MMS A;  3BR6 A;  3S32 A;  1SMY F;  4YRV A;  4BL0 B;  3W2V A;  3BPX A;  4HSR A;  2LOO A;  4WF2 A;  3GX4 X;  1GDT A;  2XAS A;  3EUA A;  2EV6 A;  2HNH A;  2DJN A;  3WTY C;  3FXJ A;  3KE2 A;  1P9Q C;  1NK3 P;  3BR3 A;  5A2Q Z;  1FOW A;  3DF8 A;  4HQM A;  2Z1D A;  4OIQ F;  2DOE A;  3DP7 A;  4LIT A;  1A04 A;  1ZAO A;  2DDA A;  1IXC A;  2E5N A;  2RVC A;  3FMQ A;  4D7M A;  4F52 A;  1T38 A;  5CVU A;  4KYW A;  2EIM H;  3L2U A;  4BBS J;  3AG4 H;  5JHF A;  5JLX A;  2H27 A;  4BH9 A;  3ZMD A;  4CZC A;  5ERI A;  3SXY A;  3JRI A;  4PSW A;  4Y4R A;  3P5J A;  2IJL A;  3F3X A;  3HRM A;  4W1U A;  2P7V B;  1M1E B;  1S9H A;  1S5L C;  3M1E A;  1TT5 B;  2DI3 A;  3GTP J;  4Q48 A;  5C3E J;  1OR7 C;  4JOM A;  5BPD A;  2RC4 A;  1JTX A;  2H94 A;  5B5E C;  1L3L A;  4PSX A;  1Y56 A;  1JT0 A;  2HWV A;  2PJR B;  3IH2 A;  2BOL A;  4P96 A;  2CQX A;  3GME A;  1KON A;  2HVQ A;  3TDU C;  3PO2 J;  4YFK F;  3RQI A;  2CG4 A;  4U0V A;  2XAU A;  3CTA A;  2W85 A;  3L9F A;  4N9H A;  1FPQ A;  2FD5 A;  4I02 A;  3J7A O;  4EEF G;  1B6A A;  2CUZ A;  2K27 A;  1T33 A;  3OYF A;  3JRA A;  1YX5 A;  5CYV A;  2JA5 J;  4HEA 2;  5IP7 J;  2LBF A;  2OJE D;  5FKO A;  2ZXH A;  1TT0 A;  2CUJ A;  2XGX A;  3CC4 I;  3TOB A;  6PAX A;  2V26 A;  3KLN A;  5B66 C;  4F93 B;  1XGS A;  2IS4 A;  2P81 A;  4BAY A;  4WWC A;  3G1O A;  4HF0 A;  4NC8 A;  3LAP A;  5C4X J;  5JVG F;  1RIO H;  4IVN A;  1KGS A;  1A35 A;  2MD5 A;  4PZJ A;  5EEH A;  2JTV A;  4X1E A;  2WBM A;  3VYS B;  4A69 C;  1EH6 A;  1K7A A;  2K9S A;  1IV8 A;  2KKO A;  2EZI A;  4LLL A;  3O8G A;  1FX7 A;  1SEU A;  1PUE E;  4XKC A;  4U0Y A;  3DQV C;  1VQ9 I;  3D5L A;  3QWL A;  3LSG A;  3W6J B;  3M4O J;  4NHJ A;  3ABL H;  1F1Z A;  1WQ2 A;  2EA2 A;  3CP2 A;  3G71 I;  2PJR A;  2LTP A;  2GA2 A;  3W3C A;  4DYR A;  4LFU A;  3F8N A;  3OYG A;  1QA6 A;  2X1C A;  1P7I A;  5FFZ A;  5HNF A;  2TCT A;  1UG0 A;  2W57 A;  4XN0 A;  1WZ2 A;  2NVY J;  2L5Q A;  2W25 A;  2Z33 A;  1ETX A;  3QP5 A;  2OU2 A;  3IAM 2;  4BEH B;  3JTG A;  1SFX A;  2KP6 A;  2HOA A;  4LB6 B;  4CCO A;  2XC7 A;  2QSG X;  4HNV A;  3HHH A;  1T8I A;  2XAH A;  2LY1 A;  2M45 A;  1D1C A;  1DUX C;  2DT7 B;  3OR2 C;  2XRO A;  5KNL A;  2QA4 I;  3CCU I;  2A3S A;  2PN6 A;  2DAO A;  2M7A A;  3H3Z A;  1JUP A;  4IHV A;  1FIA A;  1DQU A;  3L2V A;  1ETK A;  1ZR2 A;  1J9I A;  1MMA A;  2L2O A;  5L3D A;  3K9T A;  1U5T C;  2ADU A;  4C2M J;  1J09 A;  4RMN A;  3GZ6 A;  1PP7 U;  2BXZ A;  1ZHF A;  2E34 A;  3FMS A;  1JHF A;  2LH9 A;  1HXD A;  2LF8 A;  4QPO A;  2CS3 A;  3L7W A;  2F6C A;  2VBW A;  2VQH A;  4OIP F;  2CJJ A;  2CSO A;  3BTJ A;  1Q1V A;  2ICW G;  3I3L A;  4PGH A;  1HOM A;  1IRZ A;  4CUG A;  4EJO A;  1ETV A;  3EQL F;  1KQ0 A;  3GLX A;  2DK8 A;  1TQM A;  3GEZ A;  5FKL A;  2KQR A;  1SFU A;  3BG5 A;  1OCT C;  3F21 A;  3VPR A;  2AQF A;  1MBJ A;  1K6Y A;  2EFW A;  3VWB A;  2L54 A;  1KYW A;  1MDM A;  2X9D A;  1KU3 A;  4DGW B;  3JRC A;  3OS0 A;  2HGC A;  1N78 A;  2K3P A;  5L3E A;  3RJP A;  5J8C A;  5EEG A;  4R1H A;  3RI4 A;  2E2I J;  2X48 A;  4J19 A;  4CYD A;  1TC3 C;  2R7S A;  4HDV A;  2DBB A;  3T8T A;  2B63 J;  2FX0 A;  4AIJ A;  2BGC A;  1KU7 A;  2HTS A;  2R3S A;  5FLX K;  1FOX A;  3WTU C;  3CCR I;  3S1M J;  4QWQ A;  4CA0 A;  3DTI A;  2XV4 S;  1W36 D;  1D1A A;  2HZT A;  1QZE A;  3M8E A;  2JMW A;  3OL4 A;  3QPS A;  1QNT A;  4CO8 A;  5K5O A;  1FJL A;  5J8F A;  2KIS A;  1FWZ A;  5L3F A;  4EGZ A;  4AU7 A;  5ICF A;  3RZD J;  2G0E A;  1F9N A;  3E6D A;  1VQM I;  1N25 A;  2AS5 F;  4XIC A;  1XSX A;  4XSX F;  4G7O F;  1T0F C;  1FBQ A;  4XN3 A;  2R7Z J;  4UV8 A;  4LJZ F;  2L9V A;  3S2D J;  3J7A Y;  4A3F J;  2ZJR F;  2OV7 A;  2BE5 F;  4B48 A;  5ILU A;  5FLM J;  5HS9 A;  4ESF A;  2XPW A;  1XSD A;  2HKX A;  1T6S A;  3S15 J;  2UWM A;  2WAD A;  1G3S A;  2L7Z A;  4PJL A;  5HDK A;  3AL0 B;  1WRJ A;  3E7L A;  3CJR B;  2VQC A;  5LGT A;  1FBU A;  2D2W A;  1HW5 A;  1W0T A;  2STT A;  3G1L A;  4M6X A;  3ZMZ A;  3OYM A;  3PJR A;  5E3N A;  1U0J A;  4DYQ A;  1ZKG A;  4EQQ A;  4BE1 A;  3O2P E;  5FLX Z;  3FF5 A;  2CYY A;  3IAS 2;  2A5Y B;  2HPM A;  2KIM A;  3HYI A;  3CDL A;  4WK8 F;  3ML6 A;  4N9I A;  4XKW A;  4B47 A;  5B3S H;  2M4G A;  4Y15 A;  4D1Q A;  2EH3 A;  1G3W A;  1T56 A;  2CUF A;  2OCE A;  1XPX A;  1GUU A;  3H36 A;  3OYB A;  4PJ0 C;  1HF0 A;  3Q3S A;  1SFE A;  1JTY A;  3U2R A;  5GAD J;  3H92 A;  4OIR F;  1S6L A;  3HPH A;  3P7N A;  2XF6 A;  5IYC J;  2HOS A;  5KCM A;  2ZJP F;  4W97 A;  1DGR M;  3CO7 C;  5FRO A;  3UR3 C;  2GIZ A;  3QQA A;  3GO5 A;  2M34 A;  1Y8Q B;  1KA8 A;  1WPK A;  5CQE A;  2MA3 A;  1FYK A;  3F6O A;  2IGK A;  3A1Y A;  3FK6 A;  3CO6 C;  2UUZ A;  4UVC A;  4YFX F;  4Y52 J;  4HLY A;  1YTY A;  2EIK H;  1P92 A;  2NS7 A;  5JHU A;  3HM5 A;  3LST A;  5DDG A;  3TMO A;  4MHG A;  2WAE A;  4HRI A;  2KT0 A;  4MNU A;  1FEX A;  1BOB A;  1K4T A;  1VQ5 I;  3I4N J;  1OFC X;  3BR0 A;  3HXL A;  4LG0 A;  3I58 A;  2C6Y A;  2YPR A;  2AHQ A;  3N97 A;  2EWN A;  3M7G A;  3V7C A;  2MC3 A;  3E6B A;  2HOT A;  3JAM K;  3OYA A;  1USS A;  2X6O A;  2WAQ N;  1LJ9 A;  2EPF A;  3TBI A;  5GTH C;  2W4S A;  2ACJ A;  4G6T B;  3MWM A;  2JRT A;  1JJ6 C;  2QKM B;  4ASN A;  1J5Y A;  1BM9 A;  3BDD A;  1ZGJ A;  3QP6 A;  2FJ1 A;  2KFD A;  4BE0 A;  1MH3 A;  1YQA A;  2OZU A;  4EAT A;  3LQQ A;  5LGU A;  2A68 F;  3GTG J;  4BXU A;  1SAU A;  4B8X A;  4QSH A;  1IGN A;  2CQ7 A;  2BY3 A;  2PEX A;  1RNL A;  4BHC A;  5DYM A;  3K1M A;  1W0U A;  4I76 A;  4M9X A;  1SAX A;  1IW7 F;  1R4N B;  2EZL A;  1KQ8 A;  4M71 A;  3UKG A;  4UUV A;  2EJR A;  4IRI A;  3BG7 A;  2PBI A;  2ZSH B;  3QAH A;  2L3D A;  2A05 A;  4GGG A;  5HLT A;  1D8K A;  2DFF A;  4CCL A;  3QOD A;  3OYC A;  3JRF A;  4WXH A;  2WY7 Q;  3FBN B;  4F92 B;  3EUK L;  2LYC A;  4UXN A;  2R7X A;  2DCE A;  3OIQ A;  3KP7 A;  4U7D A;  1YFH A;  4FET A;  1TP4 A;  4UUS A;  2DQR A;  1MDM B;  1MBF A;  3PNT A;  2R7W A;  1YS7 A;  2KRF A;  3VSL A;  3JSO A;  3I55 I;  4XRM A;  1I3A A;  1K78 B;  3KEY A;  2VUM J;  3BPV A;  3HTU A;  1QRY A;  4ANJ A;  1Y8R B;  4HDU A;  4HQE A;  1V55 H;  4IRH A;  5J1U A;  1I3Q J;  4EVI A;  4FT8 A;  2NNY A;  4J01 A;  3BTI A;  1YW8 A;  3DEW A;  1HC8 A;  2Q2E A;  3CC2 I;  3FXO A;  5JLW A;  1EJ9 A;  3E5X A;  4BNC A;  1IN7 A;  2VT3 A;  2IS1 A;  3MVP A;  4XON A;  2CH0 A;  3CLQ A;  1CQT A;  1SAN A;  2V9P A;  1IZ1 A;  4I99 C;  5TIS C;  5D5V B;  1V3F A;  1WSU A;  3TO6 A;  4UV9 A;  4ENM A;  5HVQ C;  2A07 F;  2KZG A;  3S3M A;  1A31 A;  1OCO H;  2FUG 2;  4FHT A;  1MJB A;  5DCM B;  2I10 A;  4WXC A;  3PNV A;  1HDD C;  1W5T A;  2XF7 A;  4Y3O A;  1W36 C;  5EZH A;  4E7Z A;  3K10 A;  3I71 A;  2E2J J;  2IT0 A;  4G6D A;  3I5U A;  1RRJ A;  1R1V A;  2DOF A;  3LNQ A;  4A3D J;  5LHH A;  4M6V A;  2BHZ A;  5D4S A;  4PDK A;  5DCM A;  3JRB A;  1NTC A;  1UFM A;  1ZGA A;  1I27 A;  3PFI A;  2ME6 A;  3FX3 A;  4KJZ A;  2XGC A;  2BV6 A;  3OYH A;  1QHG A;  2ZKZ A;  2FBK A;  4GXO A;  3EUH A;  2VBX A;  2ZCW A;  3IHU A;  3K4K A;  1TWH J;  5LRS A;  2FOK A;  3C2G A;  1ZQ3 P;  4RAG A;  1LDK B;  3MMY B;  1X3U A;  4OAY A;  5LHI A;  2P0W A;  3KYD B;  2G7H A;  4M3E A;  4BHB A;  3LSR A;  1XDS A;  2IP2 A;  3BJ6 A;  5FKK A;  2E1M B;  4IRG A;  3S3N A;  1ENH A;  4JX6 A;  5K7H A;  3C2B A;  1RET A;  5CQG A;  2YU3 A;  1KU2 A;  4RB0 A;  1HST A;  2O61 A;  1J0R A;  3FMR A;  1LDJ A;  4BEH A;  1YHQ I;  1JE8 A;  2GAU A;  1POG A;  3U9G A;  3ZGK A;  2MYS A;  3VYU B;  1PJR A;  2KRC A;  2CWE A;  4XK4 A;  1MIJ A;  4HNU A;  4XRF A;  4L9V A;  1I1G A;  1VFC A;  4PGG A;  3KIO A;  2GIV A;  2XRN A;  2XPV A;  5ILV A;  3LA3 A;  2QVO A;  2H6C A;  2M87 A;  2VXZ A;  1VQO I;  2JUG A;  1BBY A;  4EJW A;  1P2F A;  2EZK A;  4JP0 A;  3ROU A;  1P6R A;  2RN7 A;  3BT9 A;  4IPA A;  2RNG A;  2MBF A;  3HB9 A;  4M72 A;  1W7P A;  2NS0 A;  1ETY A;  4NBQ A;  4A0X A;  3ABT A;  4BQQ A;  2DXI A;  2HEO A;  4XSZ F;  3F0C A;  1FTZ A;  2YSR A;  4GDF A;  3A2K A;  1VQ6 I;  3CME I;  1O7F A;  5EGO A;  2X0L A;  3QU3 A;  4ZYA A;  1EF4 A;  4MEY F;  1TWG J;  3W2A A;  2QSF X;  3AG1 H;  3CCJ I;  2FU4 A;  2QGU A;  4IKF A;  4AM3 A;  1ZTR A;  5ICE A;  1WI3 A;  1LDD A;  1NHA A;  3CES A;  1U5T A;  1VQN I;  3FHN A;  4IXA A;  2YX4 A;  2DA6 A;  3S2W A;  5GTI C;  3CCY A;  3T8R A;  3GFJ A;  1JUS A;  3GTJ J;  4X0G A;  1YW9 A;  3MD2 A;  4ZTF A;  4XLA A;  1B59 A;  4RA2 A;  2GXB A;  4XOP A;  2YUS A;  3BQZ A;  1SMT A;  2CO5 A;  2XAQ A;  2DK5 A;  1B9N A;  4R79 A;  2JRM A;  1UAA A;  2R7F A;  1BI1 A;  3Q0V A;  2JWT A;  3L2C A;  2X6W A;  2XAG A;  4XLF A;  3U21 A;  1PDN C;  5EF6 A;  1B8I A;  4JX4 A;  4WXD A;  3BR1 A;  3JSP A;  1XDU A;  2HYF A;  5BS6 A;  3KFW X;  5IP6 A;  3LFU A;  2I8D A;  4HX4 A;  3WGI A;  4G8X A;  2JSC A;  4L5I A;  3DTK A;  2P6S A;  2VKV A;  5DEQ A;  1FC3 A;  1P7J A;  1LEA A;  1YOV B;  2CQQ A;  4MQ9 F;  5F0F A;  2DA2 A;  2Y0S A;  4EM0 B;  2DFI A;  1PP8 F;  2CW0 F;  2HQ5 A;  5K7Z A;  3GFI A;  2LKX A;  4FX4 A;  1U9N A;  1ZRF A;  3RPU D;  3IRR A;  3K4L A;  2ZXJ A;  2VJ5 A;  3AG3 H;  4RS8 A;  1ULY A;  2Q2E B;  5B1B H;  2V6C A;  5KAF C;  2DA7 A;  4L18 B;  5EZG A;  1G59 A;  4IL6 C;  5EJC A;  3S8P A;  1APL C;  1LQ1 A;  2NXN B;  3HIF A;  1Z7U A;  1F36 A;  5TRD A;  2L9R A;  2R92 J;  4D0P A;  2D45 A;  3OYK A;  2LP0 A;  4HAM A;  1PUF B;  1EH7 A;  2BW3 B;  1ETQ A;  4IHX A;  3FWE A;  3FM5 A;  2DMU A;  1AHD P;  2BBY A;  4XID A;  2NOG A;  1XG1 A;  1HLV A;  3KYL A;  1HCR A;  4CGZ A;  3BG3 A;  2HVS A;  3HHG A;  5D8K B;  3PNY A;  2IPQ X;  3GVA A;  3HOX J;  1JGG A;  5LHG A;  3PQK A;  4BY7 J;  1R58 A;  1B72 A;  4XQF A;  1ZRD A;  2NS8 A;  5J3L A;  4S04 A;  3BWG A;  4MO7 A;  3OYJ A;  2B9S A;  1ZG3 A;  3LSM A;  2DPD A;  4RB3 C;  4II3 A;  2GA1 A;  2IXS A;  5K5Q A;  1RZ4 A;  1UJ8 A;  1XN7 A;  4IOA F;  1A5J A;  3A4C A;  3QPH A;  3GTO J;  3BZC A;  1BR2 A;  2R7U A;  4MTD A;  3KX2 A;  4WCG A;  2VKE A;  3V42 A;  2NRA C;  1N77 A;  3CUO A;  1S7O A;  4C30 A;  4RGU A;  5E18 F;  3F8B A;  4KIF A;  1NK2 P;  2Y75 A;  1O3T A;  2XRL A;  4KIS A;  4KN4 X;  2KLO A;  4U7B A;  3MFK A;  3S1N J;  3RSN A;  4XKV A;  1GT0 C;  3F8M A;  3IH3 A;  2Z16 A;  3J80 Z;  4UVA A;  3M07 A;  4RGS A;  4JYK A;  3ZR8 X;  1FYL A;  1VTN C;  5BMZ A;  2QCO A;  3I4P A;  2TRT A;  1XSV A;  1D8J A;  3I56 I;  2Y9Y A;  2V9K A;  2HDC A;  3HKZ A;  3RTR A;  5D8L B;  4HBL A;  1U8B A;  1VQ7 I;  2FML A;  2PMZ A;  3BJA A;  1S72 I;  4E4H A;  2DA5 A;  1YI2 I;  4MIM A;  4YG2 F;  3H0G J;  3WU2 C;  2CQK A;  3PSF A;  2VOO A;  2Y31 A;  3F9K A;  4IHT A;  4G9Y A;  1NG7 A;  3JRG A;  2V4J C;  1YRN A;  2VAS A;  5K5R A;  1X1B A;  4O5V A;  1VND A;  1ORK A;  1QZZ A;  2DA4 A;  5F6F A;  3OL3 A;  2IGM A;  3ONQ A;  2P5V A;  2ZSI B;  3FK7 A;  3OIO A;  4XOR A;  1WJB A;  5DUI A;  2DT5 A;  4XLP F;  2XKO A;  4GRI A;  2FA5 A;  3L09 A;  4KIG A;  4HST A;  3PUF A;  1JKR C;  2VLA A;  4QLC U;  2VL8 A;  2JPC A;  4BDZ A;  3T1B A;  1H8A C;  5F1J A;  3JW4 A;  3I59 A;  1I50 J;  1KZH A;  5IPA A;  2XAF A;  3GZN B;  3ERE D;  5HOO A;  4KN7 X;  1AKH B;  3DBR B;  1W5C C;  4M73 A;  1U78 A;  2V6E A;  1VQ8 I;  2P4W A;  5CKT A;  4PK4 A;  2EFQ A;  1YG2 A;  3VFZ A;  1E0E A;  1TQP A;  4PCQ A;  2F4I A;  2H1L A;  2XSJ C;  1ERD A;  3S1Q J;  3CCM I;  5E20 A;  4DZJ A;  4V19 K;  2UXX A;  3AL0 C;  5FKN A;  1KU9 A;  4PUS A;  2VOD A;  3LSI A;  2EFO A;  4OAZ A;  3B73 A;  2F5D A;  1AWC A;  1J75 A;  2HFH A;  3N05 A;  3EPZ A;  4RGX A;  4XRS G;  3FZV A;  1DDN A;  4KFC A;  4MFE A;  2HU9 A;  1XGO A;  2MAB A;  2D1H A;  2ID6 A;  4BJT A;  1IAW A;  1Z21 A;  2GOX B;  5K1Y A;  2ECC A;  2E1O A;  1JI8 A;  2XKP A;  4DJA A;  2FF4 A;  3ZQH A;  3K1N A;  2V1N A;  1MSE C;  3BOQ A;  1IN6 A;  2EA4 A;  1DP7 P;  2CGP A;  4CCJ A;  1GXP A;  4UUT A;  3TP0 A;  2QUF A;  2MW8 A;  2VC1 A;  1T95 A;  5KVR A;  1IXS B;  2R7T A;  4MLO A;  4XLH A;  3IRQ A;  2JT1 A;  4ZTJ A;  3B02 A;  5GAE J;  3PL8 A;  4QTR A;  2GOM A;  4ZZD A;  1WFX A;  2K7L A;  2E1C A;  2Y0M A;  3CUQ A;  3ASO H;  4XNF A;  3H3U A;  1QZY A;  3CCQ I;  4I01 A;  4LG3 A;  3K1P A;  4K2E A;  1FIP A;  4OWR B;  3GLL A;  3BTL A;  1SC7 A;  1QVT A;  3K4M A;  2KDZ A;  4MQV A;  2R93 J;  1DU0 A;  2LLK A;  2L7F P;  4NQW A;  2D5V A;  2IVM A;  3IWZ A;  5DD4 A;  3HZJ A;  1MNM C;  5TJJ A;  1STZ A;  3QYE A;  3G4S I;  3HOY J;  2RNJ A;  2PX9 A;  4IO9 F;  3RDI A;  3DKW A;  3NWT A;  3DEE A;  4AD9 A;  1FYM A;  3KP3 A;  4AUX A;  4XRS A;  4A3B J;  4NNJ A;  2E2H J;  2QZ8 A;  3IKV A;  1JKO C;  1GHC A;  4DBR A;  4HA8 A;  3F22 A;  4XM3 A;  3PIO F;  1ZGW A; 
#chains in the Genus database with same CATH homology
 2QQB A;  2ISY A;  1O57 A;  1QO0 D;  2ETH A;  5HDG A;  2F5E A;  1BN5 A;  5E1Z B;  3O3K A;  2PMU A;  2A6E F;  1WI9 A;  5DCF A;  2KIU A;  4I0B A;  1BI3 A;  1F5T A;  4Q5S F;  3K0L A;  1W7P B;  5CVI A;  3EET A;  4R8H A;  2M5W A;  4M9Z A;  3CLO A;  4ESJ A;  4I09 A;  2XHK A;  1XGM A;  3SZP A;  5E8I A;  3W6K B;  1O7L A;  3WU1 B;  1HSJ A;  3QPT A;  3SHF A;  1BIB A;  1IRG A;  2ZNY A;  4ESB A;  4Y13 A;  3F72 A;  3K2Z A;  3CDH A;  1P4W A;  2GXG A;  5AON A;  1JXS A;  1FT9 A;  2TDX A;  1HKS A;  3LWF A;  1OMI A;  3KZZ A;  1YW7 A;  2DQL A;  4HX8 A;  4KMU X;  5IT3 A;  3WGG A;  3G3Z A;  5BOX A;  3BY6 A;  5E8G A;  2Q0O A;  1R1T A;  1UHM A;  3R0A A;  2LSO A;  2ZME B;  2GQQ A;  2P5L C;  3V4G A;  2FEZ A;  3RKX A;  5LEK A;  2H6B A;  2WWY A;  2RDP A;  3T5X A;  3COA C;  2MLG A;  5CVJ A;  3OOP A;  4LLN A;  2HQN A;  2A61 A;  2V9V A;  4Q47 A;  5AIQ A;  1ZLK A;  4A6D A;  2QBY B;  2EV0 A;  3I54 A;  4KUM A;  2VE8 A;  1YYV A;  4RGR A;  2E7X A;  1K78 A;  2OQG A;  3J80 K;  2VT2 A;  4I0A A;  4KT5 C;  3EDP A;  2P6T A;  3FHZ A;  2FRH A;  2PJP A;  2ESH A;  4JQF A;  3RPU A;  4KMF A;  1HW2 A;  3CUQ B;  2AXL A;  2LNB A;  1IRF A;  4P9U A;  4GYG A;  3ZPL A;  3F8C A;  2OZ6 A;  1R23 A;  4OIO F;  2KIF A;  4ENK A;  4OIN F;  2ZJ2 A;  2VON A;  3V7S A;  1QGP A;  3ISP A;  4HZF A;  3MCZ A;  3KEQ A;  2B0L A;  3QOP A;  5D6F A;  1Z9C A;  2K02 A;  3P9K A;  2HR3 A;  4HW0 A;  1EH8 A;  3WTW C;  4UVB A;  3ULQ B;  1JGS A;  3HSE A;  4LMY A;  3MZY A;  2H09 A;  4ZYE A;  3GUD A;  3J81 Z;  2BEO A;  4CXF A;  3LFK A;  4Z2Y A;  3GWZ A;  2Z3Y A;  4YIF A;  3HRU A;  1OR7 A;  2LDU A;  3G73 A;  1ON1 A;  4A6E A;  2OQR A;  4RB1 A;  4ZYG A;  2DLL A;  4JK1 X;  1MD0 A;  3I53 A;  1W7P D;  4P9F A;  1DPU A;  1OYW A;  5HS8 A;  4KDP A;  3C1D A;  3ABU A;  2ISZ A;  2LF7 A;  2NAZ A;  5HDN A;  2OBP A;  4O6J A;  1S8N A;  1O3R A;  3JTH A;  4YFN F;  2P7C B;  2XIG A;  5ILS A;  1LNW A;  1CGP A;  4A0Y A;  1FY7 A;  2RQP A;  3E3V A;  5F64 A;  3TGN A;  3RYR A;  1P4A A;  3CJN A;  3HRT A;  1ONV A;  1TW2 A;  3RIR A;  3WU0 A;  2G7U A;  1XCB A;  3M9A A;  1O3S A;  4F7Z A;  1U6G A;  2PMH A;  2V1X A;  4M6Y A;  2VBZ A;  3ECH A;  3GZ5 A;  4A0Z A;  1XMA A;  1FSE A;  1Z6R A;  2CFX A;  4MTE A;  1SD5 A;  2YX7 A;  3DPT A;  1ODD A;  4CIC A;  2JPB A;  5HS7 A;  1UST A;  1L0O C;  2BYV E;  3VOE A;  2HYG D;  3DV8 A;  4U0W A;  4BQA A;  3PQJ A;  4HF1 A;  4JBA A;  1SD6 A;  2HKO A;  4HLX A;  3GXO A;  4GO1 A;  4EMS A;  3ZN0 A;  1TLH B;  4ZZL A;  1GVJ A;  1XD7 A;  4KNY A;  4HOB A;  5JVT A;  1CF7 B;  5CJ9 A;  1LEB A;  2QLZ A;  2FMY A;  3F6V A;  3V8L A;  5E1W A;  3RKW A;  3R60 A;  3TKY A;  2IA0 A;  4ON0 A;  2VE9 A;  4U88 A;  2ELH A;  4CHU A;  1Z05 A;  1CF7 A;  5L3C A;  2L02 A;  1UCR A;  3E97 A;  3J81 K;  5D5W B;  1G4D A;  4HF2 A;  3WE3 A;  1T2K A;  1QPM A;  2PLY A;  1TBX A;  1LB2 A;  4I2O A;  1T39 A;  3V8K A;  5BQT A;  5E1X A;  2V79 A;  3EYI A;  4XLN F;  1E2X A;  1YLF A;  5LEJ A;  4ENN A;  3KP2 A;  1HKT A;  1OKR A;  3TOA A;  2FBI A;  1I5Z A;  4CDG A;  4L9T A;  3C7J A;  4L5J A;  2O8X A;  2IRF G;  3Q5F A;  2QWW A;  1K6O A;  1B9M A;  5D5U B;  4I7H A;  1G6N A;  1R00 A;  5L3G A;  4P55 A;  3R4K A;  4G7H F;  2XAJ A;  4IF4 A;  1R7J A;  3E5U A;  5IT9 Z;  2O0Y A;  4E70 A;  2L01 A;  4ZYD A;  2NNN A;  1FP2 A;  2Q8K A;  3KEO A;  3TO7 A;  3IWF A;  5CLS A;  3WE2 A;  3E5Q A;  1FNN A;  2O6G E;  5JR3 A;  1H9G A;  2K4J A;  1FP1 D;  3RKY A;  1U2W A;  3P9C A;  4FX0 A;  3V7R A;  1ZG1 A;  1XGN A;  1T98 A;  3R6S A;  3DPL C;  3R0J A;  1E17 A;  3ZMS A;  3I64 A;  3MQ0 A;  2IW5 A;  3F8F A;  2VOP A;  3FM3 A;  2RGV A;  1Y0U A;  2UZK A;  3KLO A;  1I6X A;  4AVP A;  1Q1H A;  2FSW A;  3CUQ C;  2XUB A;  4Q4Z F;  3N4M A;  2F5C A;  3NQO A;  3ZMV A;  5JI6 A;  1BC7 C;  2V1D A;  4XBF A;  4AWX B;  1SD4 A;  2OAZ A;  3LAJ A;  4EV0 A;  4I98 B;  3KET A;  4AIK A;  1B4A A;  5HLI A;  2M30 A;  3BRO A;  3NRV A;  5FD5 A;  4N0B A;  3BJO A;  2DW4 A;  5HLG A;  4MEX F;  4HYE A;  3ZMU A;  1J7K A;  2DTR A;  3TO9 A;  1KQ9 A;  4A5M A;  3JAM Z;  5CVR A;  1UHW A;  1HBX G;  3TQN A;  1ZH5 A;  2DPU A;  2HOE A;  1KYZ A;  3R61 A;  1K79 A;  2XVC A;  5FD6 A;  1WKM A;  3HTS B;  2QYO A;  3LA2 A;  3O6B B;  4UHT A;  1TQI A;  5DV5 A;  2QM3 A;  3K69 A;  2L4A A;  2DO7 A;  1ZRE A;  1GXQ A;  3WTZ A;  2A6H F;  2VBY A;  2FE3 A;  3LQR A;  4P5O A;  2COM A;  4TV7 A;  5FO5 A;  3OV8 A;  3ZQ7 A;  3IL2 A;  1ZRC A;  1LVA A;  4LB5 A;  1R5H A;  1XB4 A;  1ZAR A;  2M1B A;  4ETS A;  4UNO A;  2OD5 A;  1R36 A;  1YS6 A;  1IN5 A;  3KP6 A;  3EYY A;  5IT9 K;  1Z1D A;  1YIO A;  3ECO A;  3GW2 A;  3M8F A;  1TNS A;  4H0E A;  4ZYH A;  2UXN A;  1ZG5 A;  1REP C;  1TW3 A;  4OOI A;  2EFP A;  2OA4 A;  4S05 A;  3HSR A;  3C3W A;  3HOT A;  1IN4 A;  3SFZ A;  1FSH A;  2ZNZ A;  5BPI A;  4EGY A;  1ON2 A;  2WC2 A;  2WV0 A;  5H6R A;  3TDZ C;  3QU6 A;  4G6Q A;  5D4R A;  1J2X A;  3WOD F;  3VB2 A;  2K86 A;  4A5N A;  5ICC A;  4ZH4 F;  1EV7 A;  2P8T A;  4OU0 A;  1BOA A;  1F4K A;  4A12 A;  1OYY A;  4DQ2 A;  2HTJ A;  5FFX A;  1MJ9 A;  1P4X A;  1FZP B;  1TNT A;  3L00 A;  1MZB A;  1AOY A;  5H20 A;  5A2Q K;  3ZP5 A;  3RYP A;  3VOD A;  4HV6 A;  1U3E M;  2IA1 A;  1QQI A;  5LBQ A;  2O3F A;  3MEX A;  4GYI A;  2ESN A;  4L0Z B;  4WX9 A;  1BC8 C;  2X4H A;  2EB7 A;  2P5K A;  2FNA A;  2PFB A;  2FNP A;  5FB2 A;  1OPC A;  1D3Y A;  1BI0 A;  4MGR A;  3BZ6 A;  1UB9 A;  3C18 A;  4EJV A;  1HKQ A;  3GYH X;  1RUN A;  3P9I A;  2VN2 A;  3GFL A;  3LA7 A;  3KP4 A;  1MJA A;  4AIH A;  4LGW A;  2DU9 A;  1IF1 A;  2NYX A;  3DXJ F;  3WTX C;  4L0Y B;  5FGM A;  4KIC A;  1WWX A;  5F1R A;  3IC7 A;  2J5O A;  1RUO A;  4LG0 B;  1FOK A;  3ZN1 A;  2QEN A;  1FLI A;  4Y17 A;  1OYI A;  4ENJ A;  2Y48 A;  3WTT C;  3REO A;  5ED4 A;  2KJC A;  1B1B A;  1S7A A;  1G3T A;  3WTS C;  1O3Q A;  2L4M A;  1T0F A;  5AIP A;  2IA2 A;  1W5S A;  2PI0 A;  3IKT A;  1R22 A;  1MGT A;  1ZN2 A;  2HS5 A;  5ICG A;  4B09 A;  2W84 A;  2Z99 A;  3AAF A;  1RI7 A;  1BI2 A;  2J5P A;  2RKH A;  3GFM A;  3V8J A;  4OMY A;  3MAJ A;  1XMK A;  2F2E A;  3SZT A;  3FXQ A;  4G7Z F;  2QBY A;  2VC0 A;  1XCV A;  4A2U A;  3I59 B;  3ZMT A;  1QBJ A;  5DUK A;  2MLK A;  2QQ9 A;  5E17 F;  1FBS A;  2FBH A;  1S29 A;  4LLG F;  3E6C C;  2R7D A;  2PQ8 A;  1HW1 A;  2F5F A;  2FQ3 A;  5D6E A;  2D1V A;  2ZBK A;  4CZZ A;  3T0Y A;  1YO5 C;  3WTV C;  2GWR A;  3VEP A;  5H6Q A;  1JHH A;  4L9J A;  4M9S A;  5D5X B;  3WG9 A;  2ZME A;  4HX7 A;  2K4B A;  4EM1 A;  3RPQ A;  2MH9 A;  2G9W A;  5LRR A;  3FXU A;  3KZY A;  4KA4 A;  2EV5 A;  3U1D A;  4DNC A;  1S3J A;  3I0T A;  3HSF A;  4M74 A;  1ZYR F;  1MKM A;  1W4M A;  2EFN A;  3KCC A;  5KK1 A;  5HLH A;  1U8R A;  3HUG A;  4RAY A;  1SD7 A;  4O3M A;  4LK0 F;  1Z6T A;  3FXR A;  1DPR A;  2PG4 A;  2RV8 A;  1I1S A;  4L9N A;  4RAZ A;  3Q9S A;  4EJU A;  4G94 A;  3NEU A;  3E6M A;  1Z91 A;  3D0S A;  1C0W A;  1BIA A;  1H0M A;  4EM2 A;  4BHP A;  1ZLJ A;  5DD8 A;  4LD5 A;  2MH2 A;  4EJT A;  3MZH A;  5LLQ A;  3QRF F;  3DEU A;  2STW A;  4RB2 C;  2ZFW A;  3ELK A;  3WGH A;  1D5V A;  3HRS A;  4OMZ A;  2W24 A;  2A69 F;  3KP5 A;  5CVV A;  4LK1 F;  1HQC A;  2LKP A;  3BP8 A;  4GCV A;  3HOS A;  1V4R A;  1IN8 A;  2HQR A;  4IHS A;  1R1U A;  1IUY A;  2QQA A;  2KJB A;  5LGN A;  2YR2 A;  2Z9O A;  2WTE A;  4KIB A;  1BJA A;  1U5T B;  2V1U A;  2GZW A;  5L3B A;  2EK5 A;  2Z5U A;  4HV5 A;  3DFG A;  2JZY A;  1TTY A;  1H9T A;  1J59 A;  2FXA A;  4NB5 A;  5JFR A;  4BYY A;  3F23 A;  1R5G A;  4IJA A;  3Q9V A;  5J6X A;  2ZO4 A;  3GF2 A;  4YII A;  3SQN A;  2E7W A;  1G3Y A;  1IXR C;  2M8E A;  2O03 A;  2E1N A;  1SMY F;  3BPX A;  4WF2 A;  3GX4 X;  2XAS A;  3WTY C;  2EV6 A;  3KE2 A;  5A2Q Z;  3DF8 A;  4HQM A;  4OIQ F;  3DP7 A;  1A04 A;  1ZAO A;  1IXC A;  2RVC A;  4KYW A;  3FMQ A;  1T38 A;  5CVU A;  2H27 A;  4BH9 A;  3ZMD A;  5ERI A;  3SXY A;  2IJL A;  3F3X A;  3HRM A;  2P7V B;  3M1E A;  2DI3 A;  4Q48 A;  5BPD A;  2RC4 A;  2H94 A;  1L3L A;  2HWV A;  4P96 A;  3TDU C;  4YFK F;  2CG4 A;  4U0V A;  3CTA A;  3L9F A;  2W85 A;  4N9H A;  1FPQ A;  4I02 A;  3J7A O;  1B6A A;  2K27 A;  5CYV A;  2XGX A;  3TOB A;  6PAX A;  3KLN A;  1XGS A;  4BAY A;  4WWC A;  4HF0 A;  3LAP A;  1RIO H;  4IVN A;  1KGS A;  2MD5 A;  4PZJ A;  5EEH A;  2JTV A;  1EH6 A;  1K7A A;  2KKO A;  4LLL A;  1FX7 A;  1PUE E;  4U0Y A;  3DQV C;  3D5L A;  3W6J B;  4NHJ A;  1F1Z A;  1WQ2 A;  2EA2 A;  2GA2 A;  4LFU A;  3F8N A;  5FFZ A;  2W57 A;  2W25 A;  2Z33 A;  3QP5 A;  2OU2 A;  3JTG A;  1SFX A;  4LB6 B;  3HHH A;  2XAH A;  2M45 A;  1DUX C;  2XRO A;  2A3S A;  2PN6 A;  2DAO A;  3H3Z A;  1J9I A;  5L3D A;  3K9T A;  1U5T C;  2ADU A;  3GZ6 A;  1PP7 U;  1ZHF A;  3FMS A;  1JHF A;  1HXD A;  2LF8 A;  3L7W A;  2VBW A;  4OIP F;  2CSO A;  4PGH A;  4EJO A;  3EQL F;  1KQ0 A;  3GLX A;  2DK8 A;  1TQM A;  3GEZ A;  1SFU A;  3F21 A;  2EFW A;  2L54 A;  1KYW A;  1MDM A;  1KU3 A;  2HGC A;  5L3E A;  3RJP A;  5J8C A;  5EEG A;  4R1H A;  3RI4 A;  4CYD A;  4HDV A;  2DBB A;  3T8T A;  4AIJ A;  2BGC A;  1KU7 A;  2HTS A;  2R3S A;  5FLX K;  3WTU C;  4QWQ A;  2XV4 S;  2HZT A;  3M8E A;  1QNT A;  4CO8 A;  5K5O A;  5J8F A;  1FWZ A;  5L3F A;  4EGZ A;  5ICF A;  1F9N A;  3E6D A;  2AS5 F;  1XSX A;  4XSX F;  4G7O F;  1FBQ A;  4UV8 A;  4LJZ F;  2BE5 F;  5ILU A;  5HS9 A;  4ESF A;  1XSD A;  2HKX A;  1T6S A;  2UWM A;  1G3S A;  5HDK A;  1WRJ A;  5LGT A;  1FBU A;  2D2W A;  1HW5 A;  2STT A;  4M6X A;  3ZMZ A;  4EQQ A;  3O2P E;  5FLX Z;  3FF5 A;  2CYY A;  2A5Y B;  2KIM A;  3HYI A;  4WK8 F;  3ML6 A;  4N9I A;  4Y15 A;  1G3W A;  1SFE A;  3U2R A;  3H92 A;  4OIR F;  1S6L A;  3P7N A;  3CO7 C;  3GO5 A;  1KA8 A;  2MA3 A;  1FYK A;  3F6O A;  3CO6 C;  4UVC A;  4YFX F;  4HLY A;  1YTY A;  1P92 A;  5JHU A;  3LST A;  5DDG A;  4MHG A;  4MNU A;  4LG0 A;  3I58 A;  2C6Y A;  2YPR A;  3N97 A;  2EWN A;  3M7G A;  3V7C A;  2MC3 A;  3E6B A;  3JAM K;  1USS A;  1LJ9 A;  2ACJ A;  3MWM A;  2JRT A;  4ASN A;  1J5Y A;  1BM9 A;  3BDD A;  1ZGJ A;  3QP6 A;  1YQA A;  2OZU A;  3LQQ A;  5LGU A;  2A68 F;  4BXU A;  4B8X A;  2PEX A;  1RNL A;  4BHC A;  5DYM A;  3K1M A;  4M9X A;  1SAX A;  1IW7 F;  1KQ8 A;  4M71 A;  4UUV A;  2EJR A;  4IRI A;  2PBI A;  3QAH A;  2L3D A;  4GGG A;  1D8K A;  4WXH A;  4UXN A;  3KP7 A;  4U7D A;  1YFH A;  1MDM B;  2DQR A;  1YS7 A;  2KRF A;  3JSO A;  1K78 B;  3BPV A;  3HTU A;  4HDU A;  4HQE A;  4IRH A;  4EVI A;  4FT8 A;  2NNY A;  1YW8 A;  2Q2E A;  3E5X A;  4BNC A;  1IN7 A;  2VT3 A;  1IZ1 A;  5D5V B;  1V3F A;  1WSU A;  3TO6 A;  4UV9 A;  4ENM A;  5HVQ C;  2A07 F;  4FHT A;  1MJB A;  5DCM B;  4WXC A;  1W5T A;  3I71 A;  2IT0 A;  4G6D A;  3I5U A;  1R1V A;  5LHH A;  5D4S A;  4PDK A;  5DCM A;  1UFM A;  1ZGA A;  1I27 A;  3PFI A;  3FX3 A;  2BV6 A;  2ZKZ A;  2FBK A;  4GXO A;  3EUH A;  2VBX A;  2ZCW A;  3IHU A;  5LRS A;  2FOK A;  1LDK B;  1X3U A;  5LHI A;  2G7H A;  4BHB A;  1XDS A;  2IP2 A;  3BJ6 A;  4IRG A;  2YU3 A;  1KU2 A;  4RB0 A;  1HST A;  2O61 A;  1J0R A;  3FMR A;  1LDJ A;  1JE8 A;  2GAU A;  3U9G A;  2CWE A;  4XRF A;  4L9V A;  1I1G A;  4PGG A;  2GIV A;  2XRN A;  5ILV A;  3LA3 A;  2QVO A;  2H6C A;  2M87 A;  2VXZ A;  1BBY A;  4EJW A;  1P2F A;  3ROU A;  1P6R A;  2RN7 A;  4IPA A;  2MBF A;  4M72 A;  1W7P A;  2NS0 A;  4A0X A;  3ABT A;  2HEO A;  4XSZ F;  2YSR A;  1O7F A;  2X0L A;  3QU3 A;  4MEY F;  2FU4 A;  5ICE A;  1LDD A;  1NHA A;  1U5T A;  4IXA A;  2YX4 A;  3S2W A;  3T8R A;  3GFJ A;  1YW9 A;  1B59 A;  2GXB A;  1SMT A;  2CO5 A;  2XAQ A;  2DK5 A;  1B9N A;  4R79 A;  2R7F A;  1BI1 A;  3L2C A;  2XAG A;  1PDN C;  4WXD A;  3JSP A;  1XDU A;  2HYF A;  5BS6 A;  3KFW X;  4HX4 A;  3WGI A;  4G8X A;  2JSC A;  4L5I A;  2P6S A;  5DEQ A;  1FC3 A;  1LEA A;  4MQ9 F;  4EM0 B;  2DFI A;  1PP8 F;  2CW0 F;  3GFI A;  4FX4 A;  1ZRF A;  3IRR A;  2ZXJ A;  4RS8 A;  1ULY A;  2V6C A;  4L18 B;  1LQ1 A;  3HIF A;  1Z7U A;  5TRD A;  4D0P A;  2D45 A;  4HAM A;  1EH7 A;  3FWE A;  3FM5 A;  2BBY A;  4CGZ A;  3HHG A;  5D8K B;  2IPQ X;  3GVA A;  5LHG A;  3PQK A;  1R58 A;  1ZRD A;  4S04 A;  3BWG A;  2DPD A;  1ZG3 A;  4RB3 C;  2GA1 A;  5K5Q A;  1RZ4 A;  1XN7 A;  3QPH A;  4MTD A;  4WCG A;  2NRA C;  3CUO A;  1S7O A;  4RGU A;  5E18 F;  3F8B A;  4KIF A;  2Y75 A;  1O3T A;  4KN4 X;  4U7B A;  3MFK A;  3F8M A;  3J80 Z;  4UVA A;  4RGS A;  1FYL A;  1VTN C;  5BMZ A;  3I4P A;  1XSV A;  1D8J A;  2HDC A;  3RTR A;  5D8L B;  4HBL A;  2FML A;  3BJA A;  4YG2 F;  2CQK A;  2VOO A;  4IHT A;  4G9Y A;  5K5R A;  4O5V A;  1QZZ A;  5F6F A;  2P5V A;  5DUI A;  2DT5 A;  4XLP F;  2XKO A;  2FA5 A;  3L09 A;  4KIG A;  4QLC U;  2JPC A;  3T1B A;  3JW4 A;  3I59 A;  2XAF A;  3ERE D;  5HOO A;  4KN7 X;  1U78 A;  4M73 A;  2P4W A;  2EFQ A;  1YG2 A;  3VFZ A;  1TQP A;  4PCQ A;  5E20 A;  2UXX A;  1KU9 A;  2VOD A;  2EFO A;  3B73 A;  2F5D A;  1AWC A;  1J75 A;  2HFH A;  4RGX A;  3FZV A;  1DDN A;  4KFC A;  1XGO A;  2D1H A;  1IAW A;  5K1Y A;  2XKP A;  2FF4 A;  3K1N A;  3BOQ A;  1IN6 A;  2EA4 A;  1DP7 P;  2CGP A;  1GXP A;  2QUF A;  2VC1 A;  5KVR A;  1IXS B;  3IRQ A;  2JT1 A;  3B02 A;  4ZZD A;  2K7L A;  2E1C A;  2Y0M A;  3CUQ A;  3H3U A;  1QZY A;  4I01 A;  3K1P A;  4K2E A;  4MQV A;  4NQW A;  2IVM A;  3IWZ A;  5DD4 A;  5TJJ A;  1STZ A;  2RNJ A;  3RDI A;  3DKW A;  4AD9 A;  1FYM A;  3KP3 A;  2QZ8 A;  3IKV A;  1GHC A;  4HA8 A;  3F22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...