1D5VA

Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11 (s12)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
MLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the DNA-binding domain of the adipocyte-transcription factor FREAC-11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords S12 TRANSCRIPTION FACTOR (FKH-14)
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d5vA00
4E70A 2RVCA 5LGUA 2V6CA 4A5MA 1FC3A 2XUBA 1HKQA 4F7ZA 2NYXA 3L2CA 1FPQA 2DAOA 4RB1A 2AXLA 2K27A 5L3BA 4R8HA 1HKTA 4M9ZA 4JK1X 3LA7A 3KE2A 1YO5C 1K7AA 2W24A 1BJAA 2JT1A 3FXRA 3NEUA 5E18F 4IRHA 3KLNA 2P7VB 4CO8A 3MAJA 2D2WA 4A2UA 1SD5A 3JTHA 1ZG1A 2Z3YA 2KIFA 4UXNA 3ISPA 2FOKA 2MLGA 4ZZLA 1JHHA 2J5OA 1U3EM 4A6EA 1LVAA 1Z05A 3ZMVA 3MZHA 1IXCA 2A68F 2AS5F 4EVIA 2BBYA 3T8RA 3MEXA 2H94A 4KDPA 1PP7U 4RGRA 4LG0B 4AD9A 1DDNA 1PDNC 2BV6A 3IC7A 1F5TA 3V8KA 4IHSA 1B9NA 2DLLA 1SMYF 1TNSA 4OIRF 3F8CA 3CO7C 2FA5A 2EV0A 1BM9A 2OU2A 3TKYA 1TQPA 2DU9A 4HQMA 2EA4A 1G3WA 1Y0UA 2E1CA 1Z1DA 2IP2A 2VT2A 5LRRA 2NAZA 3C1DA 4L9NA 5HLIA 2BE5F 2JPCA 1J5YA 3RIRA 1O7LA 2E7WA 4I98B 4L9JA 3C18A 2YX7A 4KT5C 2XAQA 2A6HF 4EJVA 1F9NA 1DUXC 1MJ9A 4Y15A 3WGGA 2X4HA 4HLYA 4M72A 3BJ6A 3CUQB 1S3JA 1ULYA 3OV8A 4L5IA 2DT5A 5D6EA 2WTEA 3FM5A 1QNTA 2ZXJA 2FEZA 3WTUC 4WF2A 4GGGA 3B73A 1BI2A 3HOTA 1ZRFA 1GHCA 4PZJA 2GQQA 2Z9OA 1MKMA 1U5TA 5K5OA 1OR7A 1LEBA 5CJ9A 3RKYA 3B02A 1KU3A 1TBXA 2VBYA 1UB9A 2EB7A 3HRUA 1YQAA 3WTYC 3P9KA 1UCRA 2K02A 2VOPA 5ED4A 3ZMUA 4HZFA 2A07F 2LSOA 2W85A 3R6SA 2GXBA 4EMSA 1XGNA 2ZMEB 2JSCA 5L3DA 4ENMA 2ZNZA 2YX4A 1IN6A 2X0LA 1LDJA 3WTSC 4JBAA 1SFUA 2P4WA 3LAJA 1OPCA 3CUQC 1H0MA 2OZ6A 3NQOA 3EUHA 5ICCA 2O61A 2ZNYA 3WTVC 1RI7A 4YIFA 2HR3A 2XGXA 5BS6A 3DF8A 2Q2EA 2IJLA 2F2EA 3BPXA 4MEYF 5FLXZ 1D3YA 3K2ZA 4AVPA 1T39A 2F5DA 5TJJA 2YU3A 4N0BA 4A0YA 5H6QA 4G6DA 2KIUA 1P4AA 5DCMB 5DD8A 2H27A 4EM2A 2L4AA 3GFIA 3R4KA 3E5QA 1GXPA 2ZFWA 5J8FA 1SD6A 2KJBA 4XRFA 4LLGF 3RPUA 3F6OA 5FGMA 2XV4S 5ICEA 2HZTA 3ABUA 4Y17A 1O7FA 2D1HA 2R7FA 2UWMA 3PQJA 1YYVA 2LF7A 5LEJA 3ZN0A 3E6DA 4HX8A 2M45A 5L3FA 4HX7A 2A3SA 3LA3A 3IL2A 1P4WA 2M5WA 3L09A 1W5TA 2CO5A 4RGSA 1WKMA 3WGHA 3D5LA 3FM3A 3GEZA 2A61A 5JFRA 1KQ0A 4LLNA 4DQ2A 3F22A 4KN7X 2Q8KA 6PAXA 2Z5UA 5JI6A 3WGIA 2EFQA 3LQRA 5IT9Z 2HFHA 1FBSA 3I53A 2L3DA 3T1BA 3HYIA 2Z99A 1PP8F 2O8XA 3C3WA 3WTTC 2Z33A 4K2EA 4RS8A 3P9IA 2FNAA 2V9VA 2EK5A 3HTUA 2HKXA 3F72A 2HEOA 2O6GE 3V8JA 4WX9A 1T0FA 2H6CA 4S04A 1HW2A 2M87A 2DBBA 5DCFA 5LLQA 4PCQA 3DPLC 1KGSA 3KP7A 2IVMA 1BOAA 4O6JA 1S7OA 1S7AA 2GAUA 5K5QA 4BNCA 2RQPA 3JAMZ 1FNNA 1MZBA 3QU6A 5E1ZB 2ISYA 4HX4A 4MQVA 2RKHA 5IT9K 2GWRA 5DEQA 3VB2A 5FO5A 2VBZA 3E6MA 1R1TA 3KZYA 3DP7A 2IW5A 5BQTA 2LNBA 4I0AA 4MGRA 2FU4A 5D8LB 3RYPA 1YFHA 4UVBA 2LF8A 4UUVA 1IRFA 2Y75A 2P5VA 2Y0MA 4KA4A 4L0ZB 4DNCA 4KFCA 3JSPA 4CYDA 4AIHA 3LFKA 3MQ0A 3MWMA 4LJZF 1LEAA 1ZRCA 4PGGA 2FF4A 1ZH5A 4M6YA 4JQFA 2VOOA 3R0AA 2BGCA 2HWVA 3R61A 2A69F 2EFPA 3JTGA 1UHMA 1KQ9A 4P9UA 1BN5A 5E1WA 1TTYA 1ODDA 2QUFA 1R5HA 1BIAA 1REPC 3CUQA 2FQ3A 2OQRA 3GWZA 1BBYA 4BQAA 3F23A 3FX3A 2P7CB 1FWZA 5AIQA 3H92A 1TLHB 3K1NA 4QWQA 1KA8A 1ZLKA 5J6XA 1RIOH 5DUIA 2K4BA 2EJRA 2QWWA 2PMHA 2RN7A 1QO0D 3KFWX 2XROA 1W4MA 3RI4A 2XAFA 4ESFA 2GA2A 3W6KB 4IJAA 3REOA 4G9YA 3FMQA 4FX4A 1IZ1A 4LMYA 3I59B 4OMYA 4RAZA 3U1DA 2ZO4A 1U5TB 1Z6TA 3KCCA 3J81Z 1EH8A 2RDPA 2DTRA 3BY6A 3GFMA 2O3FA 2L02A 2HTJA 3DXJF 3SHFA 2P5LC 3CTAA 1CF7A 2LDUA 3TQNA 3COAC 2HOEA 1H9TA 1D5VA 2Q0OA 1J59A 1MJAA 2CG4A 4U7DA 4HW0A 1ZARA 3FXUA 3E6BA 1SAXA 4MQ9F 3F8FA 1QGPA 3NRVA 4HA8A 4MHGA 2VBXA 1FYMA 4LK1F 5DD4A 1LNWA 2XRNA 5CVVA 2STTA 3M7GA 4RB0A 5EEGA 1P6RA 3BJAA 3DPTA 2MD5A 4A0XA 1B6AA 3WE3A 4KMFA 2P8TA 3E97A 1FLIA 5LEKA 1ZG3A 5HDGA 4CXFA 2OBPA 1U8RA 4EV0A 1HBXG 4KNYA 3MFKA 1R22A 4KIBA 3K9TA 4RB2C 1A04A 1ZAOA 2LKPA 1Q1HA 4KN4X 2MH2A 3JW4A 2W57A 4ZYGA 4U0WA 4A12A 1J9IA 3QPHA 1FBUA 1HSTA 3GLXA 1G4DA 3BDDA 5ICGA 1FZPB 1UHWA 4FT8A 1XSDA 3BOQA 3D0SA 2PG4A 3LSTA 3TOBA 1I5ZA 4IXAA 1FY7A 5J8CA 1LDDA 1XN7A 3L9FA 2V79A 5CVJA 4HLXA 4ENKA 4O3MA 1IN4A 5LGTA 1PUEE 2FBIA 3GUDA 2W84A 1O3TA 5AONA 1IN7A 3IRQA 3N4MA 2IRFG 1U5TC 1LB2A 3CO6C 3BROA 5HS8A 3I71A 1YLFA 5LHGA 4XLNF 1XGOA 1L0OC 3T5XA 2XIGA 3O2PE 3KP3A 4OIOF 5HLHA 3QPTA 4UNOA 3Q5FA 3KLOA 2KJCA 4HF0A 4B09A 4BH9A 1ZHFA 1OYWA 1J7KA 5L3CA 1F1ZA 3ZP5A 2L01A 1G3SA 2UZKA 4LFUA 3O3KA 4AWXB 2DQLA 2RGVA 2JPBA 4MTDA 5D8KB 1IN8A 5H20A 3E5XA 4R1HA 1CF7B 4HYEA 3RDIA 3I58A 3DFGA 3M1EA 3ROUA 2WV0A 5HS7A 2QM3A 3L00A 3MCZA 3RKWA 2VC0A 5DUKA 2PI0A 4L18B 2XAGA 2DPDA 1XCBA 2IPQX 4GCVA 1ZRDA 3V7SA 3DKWA 3QU3A 4OMZA 1WRJA 2ETHA 3V7CA 4CDGA 1TW2A 2PMUA 2KRFA 1RNLA 3CJNA 4P96A 3WTWC 5D5XB 2MH9A 2NNNA 3M8FA 2HDCA 4CICA 1TQIA 5ICFA 3TDUC 2MLKA 2UXXA 3IRRA 4LGWA 3GF2A 1IRGA 4HDVA 4H0EA 1G6NA 1JE8A 4L5JA 4ENNA 1XGMA 1TW3A 4M9SA 3ULQB 1GVJA 2JZYA 2CFXA 2J5PA 5D6FA 2RV8A 1YW7A 4Q48A 1D8KA 1ZG5A 5FD5A 1R7JA 2ZJ2A 3QOPA 1AOYA 3VFZA 4P9FA 1IF1A 3GXOA 5DCMA 1FP2A 4L0YB 4NQWA 4I02A 2VC1A 2FMLA 4XLPF 2VXZA 5HLGA 4FHTA 1HXDA 2ISZA 2COMA 3HRTA 4OINF 1B9MA 4GO1A 1J0RA 4HDUA 4I2OA 2QZ8A 4LB5A 1R5GA 5ILSA 3QP5A 5ERIA 4M6XA 4HAMA 1T98A 4HOBA 4EM0B 5CLSA 3K69A 3KP2A 1AWCA 4AIKA 3G73A 2VE9A 1LQ1A 4B8XA 4U7BA 3HSRA 2HYFA 3QP6A 1BI0A 1C0WA 4IVNA 1ON2A 4M71A 2G7HA 4TV7A 4LB6B 3K0LA 1E17A 5L3GA 1G3YA 1YG2A 5LHIA 3RJPA 3K1PA 2FBHA 4HV5A 2L4MA 5EEHA 1I1GA 3J80K 4YIIA 1K78A 4RGXA 1BI3A 3DEUA 1RZ4A 1FT9A 3TO7A 2O0YA 2PJPA 3GO5A 2XVCA 4BAYA 3W6JB 1YW8A 2E7XA 4UV9A 4I01A 2NRAC 4ZYHA 1HKSA 3EQLF 4GYIA 3U9GA 4NB5A 5HDNA 1SFXA 4ZZDA 3BP8A 1QBJA 3J81K 2ZCWA 1U78A 1WQ2A 4G94A 1BC7C 3L7WA 1IXSB 1XMKA 1YS6A 2M1BA 4L9TA 1IXRC 1TQMA 3CDHA 3CLOA 5H6RA 3GZ5A 1U2WA 2QVOA 4HF1A 1KU7A 4ZYDA 3H3UA 1WSUA 1U6GA 2PEXA 4YFKF 4GXOA 3KP5A 2ACJA 1T6SA 1XDUA 4PGHA 1Z6RA 4UHTA 1S29A 4CZZA 3TGNA 2ZBKA 3IKTA 2DW4A 4G7OF 3FWEA 5JVTA 4D0PA 5KVRA 2XKPA 5FB2A 4G6QA 4YFXF 3ZMDA 2O03A 1QZZA 4OOIA 1V4RA 3EETA 2DK8A 3J80Z 3HIFA 1P4XA 3JAMK 2QQBA 3I4PA 3I64A 4L9VA 2CQKA 1X3UA 5CVIA 5E1XA 4A0ZA 2HS5A 2CWEA 4ENJA 2BEOA 4KYWA 5F6FA 3TO9A 3WU1B 1FP1D 3VEPA 3MZYA 2PN6A 4XBFA 1ZGAA 3GW2A 2WC2A 1G3TA 1BI1A 5BMZA 1XCVA 2OQGA 3RYRA 2VBWA 2IA0A 5E17F 1YIOA 2EWNA 4HF2A 3LQQA 2E1NA 1MJBA 2XKOA 1W7PB 3TDZC 1YS7A 3F8NA 2D1VA 1OYYA 5E8GA 2ESHA 4AIJA 2BYVE 3R60A 4U0VA 1JXSA 1LJ9A 4G7ZF 4G7HF 3ECOA 2R7DA 4Q47A 4KIFA 1MDMA 1O3RA 3DV8A 3SQNA 2QENA 1F4KA 4EQQA 2RNJA 5K5RA 3KETA 4CGZA 3Q9VA 3P9CA 1UFMA 4U88A 2ESNA 3M9AA 3V4GA 2R3SA 1P2FA 4G8XA 4WK8F 1J75A 2JRTA 2P6TA 3WODF 4A5NA 1B1BA 2H6BA 4BHBA 1QPMA 3FHZA 2FBKA 1SMTA 2W25A 4M9XA 3PQKA 4ESBA 5ILUA 4RAYA 1R23A 2XHKA 3F8MA 4M73A 3HUGA 2XASA 4WXDA 5CVRA 3LAPA 5JHUA 5L3EA 2P6SA 1JGSA 1IUYA 1TNTA 1ZYRF 3IKVA 1KQ8A 2TDXA 2GXGA 5LRSA 5HS9A 3ML6A 4I7HA 5HOOA 3IWZA 1YW9A 3GVAA 2HQNA 2B0LA 2GZWA 2YPRA 2K4JA 3ZMZA 2DFIA 1T2KA 3ECHA 3EYIA 4MTEA 4RB3C 2OA4A 3HRSA 3KZZA 1OYIA 1CGPA 2VT3A 3QAHA 4N9HA 3T8TA 3ABTA 2OD5A 2KIMA 3GFLA 1B4AA 1MGTA 3RTRA 1WWXA 1DPUA 5BPIA 1V3FA 2A6EF 3HHHA 5CYVA 5DYMA 4Q5SF 4EJWA 4GYGA 4EGZA 4CHUA 2OAZA 1K79A 2G7UA 1S6LA 2UXNA 2HYGD 5FLXK 2HQRA 3HSFA 2HGCA 5HVQC 4MEXF 3ZPLA 4R79A 3TO6A 2M30A 2EA2A 1K6OA 3S2WA 4XSZF 3P7NA 5CVUA 4LG0A 1ZLJA 3WTXC 2DK5A 4OU0A 4WWCA 1BC8C 1IN5A 2FMYA 1I1SA 2F5EA 3KEOA 1H9GA 1Z9CA 1KU9A 2GA1A 4ETSA 3HRMA 3WE2A 3HTSB 4FX0A 2FXAA 5FD6A 3E3VA 5D5WB 1E2XA 4KIGA 4HBLA 1USTA 4NHJA 1IW7F 2YR2A 1EH6A 4QLCU 1Z7UA 3ZMSA 1NHAA 3I54A 3GYHX 3IWFA 3GFJA 1USSA 4P5OA 1VTNC 3CUOA 3BJOA 1R1VA 1EV7A 1W7PA 3SFZA 3FMRA 1FSHA 1JHFA 1W5SA 4WXCA 5BPDA 2F5CA 1Z91A 1KYWA 3SXYA 5D5UB 4UV8A 5AIPA 3F3XA 1EH7A 5ILVA 1HSJA 4IRGA 4LK0F 5LGNA 1DP7P 1FYKA 1SFEA 4OIPF 3VODA 3KP6A 5A2QZ 5FFXA 3GX4X 4ZYEA 5D4RA 2IA2A 1OKRA 3F6VA 1RUNA 2EV6A 2CYYA 4ASNA 1FBQA 3DQVC 4A6DA 1P92A 2HKOA 2V1DA 1MDMB 2MBFA 4WXHA 1GXQA 2MC3A 1HQCA 3HHGA 4N9IA 2G9WA 2VN2A 3GZ6A 4PDKA 2KKOA 2D45A 2ZKZA 4YFNF 3ZQ7A 4M74A 4IHTA 1T38A 3ELKA 2ADUA 3O6BB 4EJUA 1KU2A 2XAHA 5E20A 2QYOA 3FMSA 3WTZA 3ZN1A 3V8LA 5IT3A 1ZN2A 3HOSA 4XSXF 4BHCA 1DPRA 2DPUA 1MD0A 2WWYA 1STZA 3QRFF 1HW5A 4BYYA 1QZYA 1SD4A 2VE8A 2K86A 2VONA 1SD7A 2STWA 4EJOA 4WCGA 2QQAA 2NS0A 5TRDA 2IA1A 2H09A 2QQ9A 4HQEA 4UVAA 5KK1A 2VODA 4KMUX 2C6YA 2V1XA 1FOKA 1D8JA 1R00A 1XGSA 3E5UA 3BWGA 4ON0A 1J2XA 1XSVA 4IRIA 3LA2A 3F21A 3VOEA 1OMIA 2CGPA 2FSWA 1O3SA 3FF5A 4S05A 1R1UA 4P55A 4Z2YA 1ONVA 3RKXA 2DO7A 1BIBA 3EYYA 3T0YA 3R0JA 1FSEA 3ERED 3WG9A 4KUMA 4EJTA 1XD7A 5DV5A 3KP4A 2EFNA 2HTSA 3TOAA 1XMAA 2ELHA 3KEQA 1R36A 3I5UA 3Q9SA 2FNPA 3IHUA 2M8EA 5LHHA 3BZ6A 2EFOA 4LLLA 3FXQA 5HDKA 3I59A 4MNUA 1LDKB 2FRHA 3AAFA 1YTYA 3V7RA 4IPAA 2CSOA 4I0BA 2ZMEA 2EV5A 1IAWA 5JR3A 1XDSA 1ON1A 1R58A 3U2RA 3N97A 1ZGJA 1XB4A 1KYZA 4O5VA 5F64A 4EGYA 2EFWA 2PLYA 2F5FA 2RC4A 2PQ8A 5D5VB 2V1UA 2QBYA 3H3ZA 3BPVA 1FX7A 2IT0A 2FE3A 4ESJA 2MA3A 3SZPA 3J7AO 3F8BA 4Y13A 2QLZA 3SZTA 1B59A 3C7JA 3G3ZA 4YG2F 4LD5A 3ZMTA 5A2QK 1O57A 5D4SA 1I27A 2NNYA 4Q4ZF 4BXUA 4IF4A 5F1RA 5K1YA 1FYLA 2DQRA 4BHPA 3EDPA 1W7PD 4OIQF 3LWFA 1L3LA 1HW1A 3FZVA 3K1MA 1XSXA 2PBIA 1K78B 2PFBA 1RUOA 4UVCA 4HV6A 2P5KA 3E6CC 2GIVA 3WU0A 1I6XA 5LBQA 2QBYB 4KICA 2OZUA 3PFIA 1QQIA 3JSOA 4U0YA 5FFZA 2K7LA 2YSRA 3I0TA 2DI3A 2L54A 5DDGA 4ZH4F 2Y48A 5E8IA 4EM1A 3M8EA 1ZREA 3RPQA 3HSEA 3OOPA 1WI9A 2A5YB 1S8NA 4RGUA 2CW0F 1O3QA 5BOXA 2JTVA 4I09A 2XAJA
chains in the Genus database with same CATH superfamily
4E70A 4DOZA 1S72I 2RVCA 5LGUA 4DYCA 2MYSA 2V6CA 4A5MA 1NK3P 3CCUI 4XKCA 5KAIC 4II2A 5IP7J 1FC3A 3FXMA 2XUBA 2R5YA 3M07A 1HKQA 4GRIA 4F7ZA 4E7KA 2JVHA 2NYXA 3L2CA 1FPQA 1RETA 2DAOA 1LVKA 4RB1A 2AXLA 2K27A 2P0WA 2DFEA 2NVTJ 5FKKA 5L3BA 4R8HA 1HKTA 2QQ8A 3IUOA 4Y3OA 3LNQA 1GLNA 2M7BA 1WGXA 4M9ZA 5GP9A 4JK1X 1MBJA 3LA7A 3KE2A 1YO5C 1K7AA 4Y7NJ 2W24A 3OSGA 1BJAA 2JT1A 5GAGJ 3FXRA 3NEUA 5E18F 3HOYJ 4AC0A 4IRHA 3KLNA 2KFDA 2P7VB 1XMXA 4CO8A 2JA5J 3MAJA 4XQFA 2R7VA 2D2WA 4A2UA 1SD5A 3CMMA 3JTHA 1ZG1A 2Z3YA 1Y0NA 2KIFA 4UXNA 3ISPA 2FOKA 3OYKA 4PJJA 3AG2H 2MLGA 4ZZLA 1JHHA 3GTMJ 2J5OA 1E3PA 3VYSB 1U3EM 4A6EA 5B66C 1UELB 2QEXI 1LVAA 1Z05A 3ZMVA 3MZHA 3H1CA 2KRHA 3MMYB 1IXCA 2A68F 1A35A 4X1EA 4EVIA 2AS5F 2BBYA 1X2NA 3JR9A 3T8RA 3MEXA 2H94A 4KDPA 3G71I 1PP7U 4CCOA 2X6YA 4RGRA 4LG0B 4AD9A 1ZK8A 1DDNA 1PDNC 2BV6A 3IC7A 1NTCA 1TL8A 1F5TA 1RC9A 3DU5A 3V8KA 4IHSA 1B9NA 2DLLA 1SMYF 5M3MJ 2Y2ZA 1TNSA 4OIRF 3F8CA 3CO7C 2FA5A 2EV0A 1OISA 4UUTA 1BM9A 2OU2A 1QA6A 4PFOA 3TKYA 4YEJA 1TQPA 2DU9A 4HQMA 2EA4A 1G2HA 4MO7A 4M3BA 2JA8J 1G3WA 1Y0UA 1FTTA 1JTXA 2E1CA 3S1RJ 1Z1DA 2IP2A 2CU7A 2V26A 2VT2A 4NDLA 4HEA2 5LRRA 2NAZA 3C1DA 4L9NA 4NC8A 5HLIA 2BE5F 3S15J 2JPCA 1J5YA 3SDBA 3RIRA 1O7LA 4A3CJ 3NWTA 2DOAA 2CQXA 2E7WA 4I98B 4L9JA 3U21A 4DGWB 3C18A 2Y9ZA 2ZFUA 1Z77A 2YX7A 2KMUA 4KT5C 2XAQA 3BCBA 2A6HF 3GLLA 4EJVA 5EDNA 1F9NA 4ZTJA 5C4JJ 1DUXC 1X1PA 5TISC 2R7RA 1MJ9A 2HQ5A 3BQZA 2ZSHB 4Y15A 3S16J 1NG6A 3WGGA 1LFPA 2X4HA 3S32A 4HLYA 3QYEA 3VYTB 2R5ZB 4BUPA 4BS9A 2OTJI 4M72A 1FJLA 4BGDA 4ZTFA 3JRHA 3CCQI 3OOUA 5HLTA 4CH7A 1ETYA 3BJ6A 5C3EJ 3CUQB 2M4GA 1YJWI 1S3JA 1ULYA 3OV8A 1B8IB 4L5IA 2DT5A 5D6EA 5FLVA 3QYFA 2WTEA 3FM5A 1YIJI 1QNTA 2ZXJA 1GV2A 2LREA 2FEZA 3JREA 4FE7A 3OIOA 3WTUC 4IEJA 3HOVJ 4WF2A 2VXDA 4GGGA 1D1AA 3B73A 1BI2A 3HOTA 1ZRFA 1GHCA 4PZJA 2GQQA 5J47A 2Z9OA 1MKMA 2WADA 2MC4A 1U5TA 5K5OA 3KPHA 2FX0A 1OR7A 1LEBA 1VQNI 5CJ9A 3RKYA 3B02A 1KU3A 1TBXA 3S3OA 2VBYA 4OAZA 1UB9A 5F04A 1QPIA 2LP0A 2EZLA 3HZJA 2EB7A 3HRUA 1F36A 5IPAA 1YQAA 2BHYA 2DMUA 3WTYC 3P9KA 1UCRA 2H1LA 2K02A 4XRSA 2VOPA 3ZQGA 1OLTA 2HZDA 5ED4A 3K4CA 4PSXA 4HZFA 3ZMUA 2A07F 2LSOA 2BY2A 2W85A 3O8HA 3R6SA 2LC2A 1ETKA 4XN3A 2GXBA 3CDIA 1JUMA 4EMSA 1XGNA 2ZMEB 3CJQB 1GT0C 5J1UA 2JSCA 5L3DA 4ENMA 2B63J 4HG2A 1YRNA 1MNMC 2ZNZA 2YX4A 4A69C 1IN6A 2X0LA 1SFOJ 4BE1A 4MFEA 1LDJA 3TMOA 1MW7A 1RKTA 1WJDA 5EEAA 3L2QA 2NVXJ 4J00A 3WTSC 4JBAA 1SFUA 2P4WA 4RLFA 2EZIA 3LSKA 3LAJA 5F27A 1OPCA 2LOOA 1RR8C 2Y69H 2KLOA 3CUQC 1H0MA 2OZ6A 3NQOA 2R7WA 4A3EJ 3EUHA 2HNHA 1Y39A 5ICCA 3KYLA 3ASNH 2O61A 1EKEA 3ZOBA 2ZNYA 3WTVC 3CF2A 1RI7A 3OYAA 4YIFA 2HR3A 3HM5A 3L2UA 1HF0A 2E2HJ 2XGXA 5BS6A 1Y1WJ 2DDBA 3DF8A 2Q2EA 1AA7A 2IJLA 2F2EA 3BPXA 3CC7I 4MEYF 5FLXZ 1QHHD 1X4OA 2M0MA 1D3YA 3K2ZA 4AVPA 1T39A 3PM1A 4D7NA 2F5DA 1YJNI 1OJLA 2XF7A 3HBLA 4W97A 5TJJA 2YU3A 4N0BA 3W3CA 4A0YA 1I3AA 5H6QA 4RBOA 1R49A 3ZQLA 4G6DA 2KIUA 3GTLJ 3PNTA 1P4AA 4XR6A 2FUG2 5DCMB 5DD8A 2H27A 2NS8A 4EM2A 2L4AA 3ABLH 3GFIA 3R4KA 3E5QA 1GXPA 2ZFWA 3PO2J 1U0JA 2KL4A 4M3DA 3I9V2 3NAUA 4PUSA 3O8GA 1UZCA 2W48A 3OIPA 3V42A 5J8FA 1SD6A 2KJBA 4XMYA 2E2JJ 1G8XA 4BL0B 2VKEA 3ABMH 4XRFA 4N4NB 4LLGF 3RPUA 3F6OA 3KIOA 2KIQA 3CMAI 5FGMA 3I4NJ 2M0CA 2Y30A 2XV4S 3G2BA 1UHSA 2CUEA 3OS2A 5ICEA 2HZTA 3ABUA 5LFAA 4Y17A 2EIKH 2VQCA 1PUFA 2VJ4A 1O7FA 2D1HA 2R7FA 2VKDA 2PJRB 2UWMA 2V4JC 3S1QJ 1Z67A 1Z3XA 3WHBA 1RRJA 3PQJA 3HPHA 4C2TA 2X85A 2EZHA 1YYVA 1X1BA 2LF7A 2XPVA 5LEJA 4DBRA 2DMNA 3ZN0A 2JRMA 3E6DA 3VDXA 1HOMA 4HX8A 4CYCA 1JTYA 2M45A 4M3GA 5L3FA 2NVUB 1RESA 2A3SA 3LA3A 4HX7A 5JLWA 3IL2A 4DBQA 3BR5A 1ZTRA 2LLKA 1P4WA 2M5WA 3EPZA 3L09A 1W5TA 2CO5A 4RGSA 1WKMA 3WGHA 5LD2C 4UY8I 2L7FP 3DTKA 4CZCA 3D5LA 3OYMA 3FM3A 1TP4A 1VF9A 3GEZA 1T56A 2A61A 5JFRA 1KQ0A 2R5ZA 4LLNA 2X6OA 4DQ2A 1PUFB 5KAFC 3F22A 3HOWJ 4KN7X 2Q8KA 4BDZA 4IHYA 3KX2A 4D7MA 6PAXA 2Z5UA 5JI6A 3WGIA 2EFQA 3LQRA 5IT9Z 2HFHA 1FBSA 2L9SA 3I53A 2L3DA 4C2MJ 3T1BA 4XK4A 3HYIA 1SVLA 2COBA 2Z99A 2X6XA 2DOEA 1PP8F 2O8XA 1VQ8I 3C3WA 1X2MA 1K6YA 3WTTC 1MBFA 4YELA 2Z33A 5KHDA 4Y4RA 3H9GA 3DWLE 1D1CA 4FQGA 2MGQA 4K2EA 4RS8A 3P9IA 3A4CA 2FNAA 2V9VA 2EK5A 3S3NA 1X19A 2FQ4A 3HTUA 2HKXA 4A3DJ 3F72A 2HEOA 1FMWA 2O6GE 3V8JA 2QSHX 1A6QA 4WX9A 1T0FA 2H6CA 4S04A 1HW2A 2M87A 1LFUP 1MMAA 5C4XJ 2DBBA 1H8AC 2YUSA 3BG5A 2E36A 4RLQA 5DCFA 5LLQA 2B9SA 4PCQA 3DPLC 3K4NA 1KGSA 3OL3A 2LTPA 1S9HA 3KP7A 4FETA 2IVMA 1EF4A 1BOAA 4O6JA 1I50J 1S7OA 5B1AH 3A01A 2E5ZA 1S7AA 2GAUA 3HG9A 4XLHA 5K5QA 1MIJA 4BNCA 2RQPA 3JAMZ 1FNNA 1MZBA 1FIPA 3QU6A 5E1ZB 5K7HA 1BW6A 2ISYA 3K10A 3LSIA 4HX4A 1MMSA 4MQVA 2RKHA 4B48A 1U8BA 1IUFA 5IT9K 3CCYA 2DT7B 2GWRA 2IXSA 1ZR4A 5GPAA 5DEQA 5GADJ 5FKOA 3VB2A 2E71A 2ECCA 3IAS2 5FO5A 2VBZA 3E6MA 1R1TA 3KZYA 4BQOA 1ZELA 3DP7A 2IW5A 5BQTA 3M3YJ 2JJ7A 2LNBA 4I0AA 4UUSA 4MGRA 4ANJA 4DZPA 2FU4A 5D8LB 2OF7A 3RYPA 2R92J 1VQ5I 2G0EA 1JJ6C 1YFHA 4UVBA 2AHQA 2CW8A 2LF8A 4UUVA 1IRFA 2MG4A 2Y75A 4FE4A 2P5VA 2Y0MA 2D5VA 4KA4A 2BY3A 3OYBA 2XF5A 2M34A 4L0ZB 5K7FA 4DNCA 3HOUJ 4KFCA 1IV6A 3JSPA 4C3IJ 3CC4I 4CYDA 3AL0B 1Y56A 4AIHA 2LY1A 2KPMA 4NC6A 5GPCA 1RPWA 3LFKA 2ZXWH 3MQ0A 3MWMA 1VNDA 4LJZF 3VYRB 2VB6A 1LEAA 1IRXA 1ZRCA 4PGGA 2IS4A 3RPUD 2FF4A 1ZH5A 4M6YA 2X48A 4JQFA 2VOOA 3DLLF 1TWGJ 1SC7A 4B47A 3R0AA 3G6EI 3SEZA 5IOYA 2BGCA 2DFHA 2HWVA 3OIQA 3R61A 2A69F 2EFPA 2Z2SB 3JTGA 3RSNA 1UHMA 1KQ9A 5HNHA 1YX3A 4P9UA 1BN5A 2R5YB 2V6EA 5KCMA 5E1WA 4IKFA 1AKHB 1TTYA 1ODDA 2QUFA 1R5HA 1BIAA 1W36C 4RMNA 3S8PA 1REPC 2VASA 4FASD 2CFOA 2F4MB 3S1MJ 3CUQA 1APLC 2FQ3A 2OQRA 3GWZA 1BBYA 4RDUA 4BQAA 3F23A 4BXFA 3M4OJ 3H9QA 3PO3J 1QU3A 1FMVA 3FX3A 4XLFA 3GTKJ 2P7CB 2A05A 4RM3A 1FWZA 5AIQA 1YHQI 3H92A 2Q2EB 1TLHB 3K1NA 4QWQA 5H2FC 1KA8A 1ZLKA 3KYCB 5J6XA 5GTHC 1RIOH 2HDDA 5DUIA 2HXOA 2K4BA 2DOFA 2EJRA 3C2HA 2QWWA 2PMHA 3CCSI 2RN7A 5TGTA 2F6CA 1QO0D 3H0GJ 2JA7J 3KFWX 4PJMA 2XROA 1W4MA 3J7ZI 3RI4A 1X1DA 3TL4X 4A3GJ 3SYTA 2E19A 2XAFA 3W2WA 1OCRH 4XLAA 4ESFA 2GA2A 3EUKL 3W6KB 4M6VA 2IEKA 4IJAA 3REOA 1T95A 4G9YA 3FMQA 1XS9A 4LIUA 1OCZH 1IZ1A 4FX4A 4LMYA 3I59B 4OMYA 4RAZA 3U1DA 2ZO4A 1U5TB 1Z6TA 5IP9J 4IQJA 3A0HC 2XDVA 4NQWB 3KCCA 1BR2A 3F0CA 5B1BH 3HOXJ 1BJZA 3J81Z 3BCAA 1EH8A 1P7JA 2DTRA 2RDPA 3GFMA 3BY6A 4JYKA 3WHCA 2O3FA 2L02A 5EYRA 2HTJA 3DXJF 3SHFA 2R0QC 4Y52J 2P5LC 3UKGA 3CTAA 3JRCA 1OCCH 4D5FA 2DODA 1CF7A 2N8GA 1ETVA 2LDUA 3TQNA 3PFYA 4BBSJ 3LMMA 3COAC 2HOEA 1H9TA 1D5VA 4F52A 2Q0OA 1J59A 3OYFA 1BA5A 1WCMJ 1MJAA 2CG4A 3HPGA 4U7DA 4HW0A 1ZARA 3FXUA 3E6BA 1MH3A 3CCRI 1IV8A 5FRNA 1SAXA 1IGNA 2E34A 4MQ9F 3S2DJ 3F8FA 1QGPA 2QA4I 3NRVA 1ETOA 4HA8A 2K40A 1NK2P 4BE0A 4MHGA 2VBXA 1FYMA 4CCJA 4LK1F 4A3LJ 4I76A 3FK7A 3CJTB 1UJ8A 2KRCA 1AU7A 1N25A 5DD4A 4CYCB 1LNWA 2LK2A 2XRNA 3C2BA 5CVVA 4CSWA 3OYGA 2STTA 3HL2A 3DTIA 3M7GA 3TBIA 4RB0A 1J09A 5EEGA 1P6RA 3BJAA 3DPTA 2MD5A 3CP2A 4A0XA 3LSRA 3GTGJ 2EILH 1B6AA 3WE3A 4KMFA 4PFPA 1B72A 3GTOJ 3JRFA 2P8TA 2LRDA 3E97A 1FLIA 3W6VA 5LEKA 1ZG3A 5HDGA 2CUZA 3GBGA 4CXFA 2VKHA 3SJMA 4PJ0C 1BOBA 2OBPA 1U8RA 3EUAA 4EV0A 1HBXG 4KNYA 3MFKA 1R22A 1R4MB 3QOEA 4KIBA 4LIVA 1QVUA 1DU0A 1X1CA 3K9TA 1N77A 2JA2A 2HOSA 3H35A 2JK3A 4XKWA 4RB2C 1A04A 1ZAOA 2LKPA 2K9MA 1Q1HA 4KN4X 2MH2A 4V2FA 3VSLA 2WV1A 3JW4A 2L5QA 2W57A 4ZYGA 3EUHC 2DTZA 4XICA 4A3MJ 3QPSA 4U0WA 4A12A 1J9IA 3QPHA 2LFBA 3TW6A 2ZXIA 1FBUA 2MSYA 3GLXA 1HSTA 1YX5A 3DBRB 2X51A 3OS1A 1G4DA 1A31A 3ERMA 3BDDA 5ICGA 1FZPB 3PNVA 3PIOF 4ZJZA 1QRYA 2XGDA 2M3AA 1UHWA 4FT8A 1XSDA 4XM3A 3BOQA 3D0SA 4E7JA 3VYUB 4DYQA 2PG4A 2ZMEC 2Y0SN 3LSTA 3TOBA 4AYBN 3K7AJ 1I5ZA 4IXAA 1WH5A 3X2QH 1FY7A 2KZVA 5J8CA 1K4TA 4IOAF 1A5JA 1B8IA 1LDDA 4L5EA 5GAEJ 2CQ7A 1PJRA 1XN7A 1F43A 1QZEA 3CCMI 3L9FA 3L2WA 1E3HA 4MFDA 4BEHB 3FBIB 2V79A 5CVJA 4HLXA 4XRMA 3BTLA 4B43A 4ENKA 1V55H 3RKQA 1FOWA 2E1MB 3NARA 4O3MA 1IN4A 2ZB9A 4NUBA 5LGTA 1PUEE 2FBIA 2K3FA 3GUDA 2W84A 1O3TA 5AONA 1IN7A 2L7ZA 3IRQA 2IGKA 3N4MA 2OTLI 1YRNB 2IRFG 1E0EA 2PMZA 1U5TC 1LB2A 3CO6C 3BROA 5HS8A 3I71A 1K83J 1YLFA 5LHGA 4XLNF 1XGOA 5FKNA 1WJBA 1L0OC 3T5XA 2XIGA 3O2PE 4P1WA 3KP3A 1MSFC 3DLAA 4OIOF 1GUUA 4H4KC 3ZR8X 5HLHA 3QPTA 4QSHA 4UNOA 3Q5FA 2R7TA 3KLOA 3VPRA 2KJCA 3UNGC 4HF0A 4B09A 1BL0A 1X3WB 3I56I 4BH9A 2HU9A 1ZHFA 1OYWA 1QVTA 5EG0A 3VWBA 1J7KA 4XLCA 3FISA 1VQ6I 5L3CA 3DEWA 1F1ZA 4RAFA 3ZP5A 1JI8A 2L01A 1DU6A 1G3SA 4PJNA 2UZKA 4LFUA 4D9JA 1D1BA 4F3QA 3G4SI 4HPQA 5JLXA 3PIPF 3O3KA 4AWXB 2DQLA 2RGVA 5E3OA 2JPBA 4MTDA 4B1RA 1SVOA 5D8KB 4E7IA 1IN8A 5H20A 3E5XA 3ZGKA 3K2AA 4R1HA 1LE8B 1CF7B 4HYEA 2IS2A 3RDIA 3I58A 1X4PA 3DFGA 3M1EA 3ROUA 2WV0A 5HS7A 2K9SA 2QM3A 3L00A 3MCZA 4LOCA 3RKWA 1D0ZA 2VC0A 4A3IJ 5DUKA 2PI0A 3CDLA 4L18B 2XAGA 2DPDA 1X1AA 1XCBA 2IPQX 1T0FC 4GCVA 3FHNA 1ZRDA 4LG3A 3AG3H 3V7SA 1JKOC 2Y0SA 4HRIA 3DKWA 4BXXJ 3QU3A 2LBFA 4UB8C 5FJ8J 4OMZA 1WRJA 2ETHA 3V7CA 4CDGA 3BG6A 2CS3A 4E4HA 1TW2A 2GBYA 2PMUA 2ZXHA 2KRFA 2QCOA 1RNLA 5F08A 1JT6A 3CJNA 4P96A 3WTWC 1WHUA 5D5XB 2MH9A 2NNNA 3M8FA 2HDCA 4GDFA 3LOCA 2R7UA 4CICA 1TQIA 5ICFA 4C30A 3TDUC 1EJ9A 4JX4A 2MLKA 2UXXA 3IRRA 2R7XA 4LGWA 3DEEA 3GF2A 1IRGA 1WZ2A 3UR3C 4HDVA 4EATA 1FEXA 1WJFA 4H0EA 1V5FA 1G6NA 2BXYA 3H0DA 1JE8A 4XOTA 1WPKA 2IS6A 4L5JA 4ENNA 1ENHA 5DTDA 1XGMA 1TW3A 4M9SA 3ULQB 1GVJA 3S17J 2JZYA 1EA3A 3A02A 3SDGA 4KJZA 2CFXA 2EH3A 2J5PA 5D6FA 2RV8A 1YW7A 1JGGA 1JT0A 3G1LA 2M4KA 2VJIA 4Q48A 1D8KA 2VIXA 3QYBA 3BZCA 1ZG5A 5FD5A 1R7JA 2ZJ2A 3MZ8A 3QOPA 3K4LA 1AOYA 2BOLA 3VFZA 4P9FA 1IF1A 3GXOA 3FXKA 4YRVA 3RCOA 3D5RC 5DCMA 3ZQHA 2XSJC 1FP2A 4L0YB 3FDYA 4NQWA 4E7HA 4I02A 1ORKA 3LFUA 5K7ZA 2CV0A 2VC1A 2FMLA 4A3BJ 2VXZA 4XLPF 5HLGA 1O4XA 1MSEC 4FHTA 4B4CA 2VI6A 1HXDA 4CCLA 2ID6A 2CQQA 2ISZA 2COMA 3HRTA 3A1YA 3OWTA 4OINF 1X3ZB 1B9MA 2ICWG 2XPUA 2Y9YA 2K3PA 3AG4H 3WG7H 4GO1A 1J0RA 4HDUA 4I2OA 3VSKA 3KEYA 1VQLI 2QZ8A 4LB5A 1HC8A 1BR1A 1R5GA 5ILSA 3QP5A 5ERIA 4XNFA 4M6XA 2ELJA 4HAMA 1T98A 4HOBA 3S93A 4EM0B 2ZJRF 5CLSA 4CCNA 4KISA 3K69A 4ZDLA 3KP2A 2XRLA 4IZZA 3OYCA 2FD5A 5CKTA 1AWCA 4AIKA 2AXTC 4XKBA 3G73A 2QKLB 2VE9A 3AG1H 1LQ1A 2IGMA 4B8XA 4U7BA 3HSRA 2HYFA 2JVGA 4FCYA 3QP6A 1BI0A 1C0WA 4IVNA 4C2UA 2QGUA 2CW7A 1ON2A 4M71A 2EBIA 2G7HA 4TV7A 4LB6B 3K0LA 1E17A 1P7IA 5L3GA 4CUGA 1G3YA 1YG2A 3HOZJ 1K61A 5LHIA 3RJPA 3K1PA 2FBHA 3BC8A 1RKWA 4HV5A 2L4MA 4BDYA 5EEHA 2O5RA 1R9TJ 1NH3A 1I1GA 1ZQ3P 3J80K 3QODA 2XB5A 4JX5A 4OWRB 4YIIA 1K78A 3Q0WA 2VUMJ 5HODA 4IHWA 1RR7A 1XG1A 4RGXA 3OYIA 1CQTA 1BI3A 3Q0UA 2WAQN 1S7EA 1UG0A 3DEUA 1RZ4A 1FT9A 3TO7A 2O0YA 1B72B 2PJPA 2EPFA 3GO5A 2XVCA 4BAYA 2XF6A 1MBGA 1GV5A 1YW8A 2K5CA 3W6JB 2E7XA 3CMYA 4X0GA 3BR3A 4UV9A 4I01A 2NRAC 3D5SC 2DA5A 3LSJA 4ZYHA 3LL7A 1HKSA 2VKVA 3EQLF 4GYIA 1HDPA 1SANA 2MABA 1ZGWA 2W82A 3U9GA 3MN2A 3FXJA 4NB5A 3ZQIA 5HDNA 1SFXA 5EZGA 4ZZDA 1HLVA 4GFBA 2X6WA 3OYNA 2QSFX 3BP8A 1QBJA 3H9JA 3J81K 2ZCWA 1U78A 3K70C 3S14J 3ZQCA 3LSGA 1WQ2A 1TWFJ 2NS7A 4IHXA 3CMEI 2DT6A 4G94A 2W00A 1OFCX 3JRIA 1BC7C 3L7WA 1W1WE 3DCFA 1IXSB 1GDTA 2M9HA 1XMKA 1PVEA 1U9NA 1YS6A 2M1BA 1IXRC 4L9TA 3ZCOA 5GAHJ 1TQMA 3CDHA 3CLOA 1HDDC 5H6RA 3GZ5A 1U2WA 3IH2A 2R7OA 3CF5F 2QVOA 4FISA 4HF1A 3LSMA 2X9DA 3CCLI 3FBNB 4ZYDA 1KU7A 3H3UA 4B3AA 1WSUA 3S1NJ 1SAUA 3RZDJ 1U6GA 2OUMA 1WI3A 2WAEA 2PEXA 4RM2A 5IYBJ 4EEFG 4YFKF 4GXOA 5GTIC 3KP5A 2NOJB 4W1UA 2JQ7A 1K4SA 5EF6A 1WH7A 2BXZA 2DA4A 1T6SA 2ACJA 1XDUA 2DJNA 4PGHA 1Z6RA 4UHTA 2YU9J 1S29A 4CZZA 3TGNA 2ZBKA 3IKTA 4F92B 3J7AY 3K70D 2DW4A 4G7OF 3FWEA 2RREA 5JVTA 4D0PA 4DZJA 5KVRA 2XKPA 3E1SA 5FB2A 2V1NA 4G6QA 4YFXF 3ZMDA 2FOWA 2O03A 1QZZA 4OOIA 2VJJA 4QIWN 5JVGF 3Q0VA 1VQPI 1V4RA 3EETA 5IY5H 2DK8A 2GOMA 1AKHA 3J80Z 2QF7A 3HIFA 3M1CA 1P4XA 3JAMK 2QQBA 2L2OA 2R4GA 3I4PA 3BR1A 3I64A 2LVSA 2E1OA 4L9VA 4AU7A 3I3LA 1IO2A 2CQKA 2CH0A 1OCPA 1X3UA 3K4BA 5CVIA 4F91B 5E1XA 4A0ZA 1P9QC 3FKIJ 1JKPC 2HS5A 2DXIA 2CWEA 4ENJA 1WJAA 2BEOA 4XORA 4KYWA 5F6FA 3TO9A 2ME0A 3GZNB 3WU1B 1FP1D 3VEPA 3MZYA 2PN6A 4XBFA 4A3KJ 2AO9A 2VPLA 2HVQA 4KT6A 1ZGAA 3GW2A 4C3HJ 2WY7Q 3FXOA 1H89C 2WY8Q 4JP0A 2WC2A 3BT9A 3S3MA 1G3TA 1BI1A 5BMZA 2LR8A 4XKVA 4DIQA 3OYHA 1XCVA 2OQGA 2L9NA 2VBWA 3RYRA 4BKXA 2IA0A 2DN0A 5E17F 2HDWA 1YIOA 2EWNA 2XGCA 4HF2A 2ECBA 3CLQA 3LQQA 2PMZN 2E1NA 2AQFA 1MJBA 5CQGA 4ZDPA 2XKOA 2IAIA 1W7PB 3TDZC 2CUFA 3J7YJ 3BTIA 3KYDB 1YS7A 3F8NA 1IDYA 4CCKA 2D1VA 1OYYA 1W5CC 2LYCA 5E8GA 2ESHA 4AIJA 2DDAA 2BYVE 2MFZA 3R60A 3WU2C 1XPXA 4U0VA 4V2GA 1JXSA 2OV7A 1I39A 1LJ9A 4G7ZF 4G7HF 3ECOA 4BQNA 2R7DA 4Q47A 4KIFA 3D1NI 1HA8A 1MDMA 2VLAA 1O3RA 1W0TA 3DV8A 1MMDA 5J1RA 3SQNA 2QENA 4IO9F 3P5JA 2GM4A 4NNJA 2V9PA 1F4KA 4EQQA 1ETXA 2JMWA 2RNJA 4UB6C 4II3A 5K5RA 3KETA 4CGZA 3Q9VA 4V19K 3P9CA 2KZGA 1UFMA 4U88A 5B5EC 2KT0A 1MMGA 3G1MA 3LSPA 2ESNA 4XL9A 1JUPA 4BJ5C 4HNVA 5IP6A 3M9AA 3V4GA 2R3SA 5CPRB 1SFKA 1P2FA 1R5ID 1Z21A 4G8XA 3QPLA 4D5CA 4WK8F 1J75A 3CZ6A 2JUCA 3FXLA 2JRTA 2P6TA 3WODF 5FLMJ 3L2RA 2CUJA 2CQNA 2B7EA 2GLOA 2EQRA 1BR4A 1UG2A 2JA6J 2R7ZJ 2R93J 2O8KA 4A5NA 3GCMA 2IBDA 1B1BA 2H6BA 4BHBA 1QPMA 2KDOA 5EGOA 2NVYJ 4Z6YA 3FHZA 3DBLB 5J1YA 2FBKA 3BQYA 1SMTA 2W25A 2WB1N 2HOAA 2WAQA 4M9XA 1VQKI 3PQKA 2YS9A 2ZSIB 4ITVA 4ESBA 5ILUA 4RAYA 1R23A 1MBHA 4KITB 4I09A 5E79C 2XHKA 3H36A 3DU6A 3F8MA 3BTCA 2M7AA 4M73A 2VQHA 3HUGA 1YITI 5FRMA 1N75A 2XASA 4WXDA 5CVRA 3LAPA 5JHUA 2MD0A 2AQEA 5L3EA 2E2IJ 2P6SA 1JGSA 2A6TA 2MW8A 1TNTA 1ZYRF 3IKVA 1IUYA 2TDXA 1KQ8A 2HPIA 2LG4A 2GXGA 4XIDA 2DA6A 5LRSA 3A01B 3K4JA 3BG9A 2EIJH 2I10A 2OJED 2Q1ZB 5HS9A 4J19A 3ML6A 4I7HA 1FIAA 3ZXSA 5HOOA 3IWZA 1YW9A 5F0FA 2X1CA 3GVAA 3MKZA 3H5NA 2HQNA 4HSTA 2LBFB 4RA2A 3RQ4A 2B0LA 1UMQA 1Z7LA 2ELKA 2GZWA 2K4JA 2YPRA 3TP3A 4XRSG 3ZMZA 2DFIA 2K85A 1T2KA 5IYCJ 3ECHA 3EYIA 4E7ZA 4MTEA 4RB3C 1W0UA 2OA4A 1AHDP 1IRZA 2EZKA 3HRSA 3KZZA 1OYIA 1CGPA 2VT3A 2L9RA 3QAHA 4B44A 4N9HA 1M1EB 3RQIA 3T8TA 3ABTA 4E7SA 2X1DA 2OD5A 3CD6I 2XB0X 3PNYA 3OYJA 2KIMA 3GFLA 1S5LC 1B4AA 1MGTA 4ZYAA 3RTRA 2DYRH 1WWXA 3GTPJ 2DA3A 1DPUA 2HQAA 1VZ0A 5BPIA 1V3FA 2M8GX 1VFCA 2A6EF 1WVRA 3CJRB 4JX6A 3HHHA 5CYVA 5DYMA 4Q5SF 2CV1A 4EJWA 4GYGA 3DKXA 3N05A 4EGZA 4CHUA 2V9KA 2CV2A 2OAZA 1K79A 4U87A 4BQQA 2G7UA 1S6LA 3GTJJ 2UXNA 2HYGD 2HYJA 5FLXK 2HQRA 4BE2A 3HSFA 4G12A 4OAYA 2HGCA 4AYBA 5HVQC 2W7NA 1IJWC 4MEXF 3K6GA 2CRGA 3FK6A 3TW7A 1N78A 4E6KG 3ZPLA 2A5WA 2F4IA 4R79A 3TO6A 2M30A 1HCRA 2EA2A 1K6OA 3S2WA 2IGOA 3BR0A 4XSZF 3P7NA 5CVUA 4QPQA 2R7SA 2HVRA 4LG0A 1ZLJA 2F5VA 3WTXC 2DK5A 3Q3SA 2RAEA 1TT5B 3DTEA 4OU0A 4WWCA 1KONA 3QQAA 1BC8C 5JHFA 1IN5A 2FMYA 3H3VK 1I1SA 2BHZA 2F5EA 3KEOA 2VPRA 1H9GA 1Z9CA 3OMYA 2L7MP 1KU9A 2GA1A 1TT0A 3B6AA 4ETSA 3HRMA 3WE2A 3HTSB 1XX5A 2E60A 4FX0A 3HKZA 2CJJA 2FXAA 1SVMA 5FD6A 3E3VA 5D5WB 3BG3A 1E2XA 4KIGA 5J40A 4HBLA 2VQLA 1USTA 4NHJA 3I4MJ 1IW7F 2YR2A 3AL0C 5HNFA 3W2VA 4I6ZA 4RAGA 3OYDA 1JJ8C 1EH6A 2KQRA 4QLCU 1Z7UA 3HB9A 3KZIC 3ZMSA 1NHAA 3I54A 2BZTA 4AIDA 3GYHX 3E7LA 4AVZA 3IWFA 3GFJA 2KISA 4YIRX 1USSA 4ABZA 4P5OA 1LPQA 4BY7J 1VTNC 1H88C 3OL4A 2DCEA 5M5YJ 5CQEA 2WA0A 3HC7A 3PUBA 3A2KA 3CUOA 2BY1A 3BJOA 1R1VA 4MLOA 1EV7A 4BJTA 1W7PA 4BBRJ 3PUFA 3TEDA 2DA2A 4BU2A 3CCJI 4XONA 2BVMA 3SFZA 3FMRA 1FSHA 5J3LA 3ZQFA 1YE9A 1JHFA 1W5SA 4WXCA 5BPDA 1OR7C 2F5CA 1Z91A 2TCTA 1KYWA 5F0HA 3SXYA 5D5UB 1V5EA 4UV8A 3IV5A 5AIPA 1ZKGA 1LE8A 2DMTA 3F3XA 1EH7A 1D0XA 5ILVA 1HSJA 1MMNA 2UUZA 1IDZA 3HJEA 1GVDA 2LD5A 4IRGA 2DYSH 4BJ6C 2P81A 3E0JB 3BLYA 4LK0F 4UUSB 5LGNA 1DP7P 1FYKA 1SFEA 4D1QA 4OIPF 3DBHB 3L2VA 2I8DA 3VODA 2BVLA 3KP6A 4X6AJ 5A2QZ 3JRAA 5FFXA 4M3EA 2DMPA 3GX4X 2EINH 2LY2A 4ZYEA 2QKMB 5D4RA 4HNTA 2EIMH 2IA2A 1OKRA 1E3OC 3F6VA 1RUNA 2EV6A 2ME6A 2CYYA 4ASNA 1FBQA 3BR6A 1VQMI 3A0BC 2L9VA 3DQVC 1R6RA 4A6DA 2DMQA 1P92A 2HKOA 2V1DA 3DPUA 1MDMB 2MBFA 1D5YA 2NVQJ 2JN6A 4WXHA 1GXQA 1JUSA 2MC3A 1HQCA 2XGEA 3HHGA 5M3FJ 2H8WA 4J01A 4CCMA 3HUGB 5E3LA 3H5RA 4N9IA 5FROA 2G9WA 2VN2A 3M8JA 1MNDA 3GZ6A 2OC6A 4IL6C 1Y8RB 3MKYB 3MVPA 4IX7A 1WJEA 1UAAA 5E3MA 4PDKA 2E35A 2KKOA 1MBEA 2D45A 2ZKZA 4YFNF 3OYLA 2V7FA 3ZQ7A 4M3FA 1ETQA 1WJ5A 4M74A 4IHTA 2VL8A 2O7OA 2LH9A 1YJ9I 1JKRC 1T38A 3ELKA 2ADUA 3K4MA 4DYRA 1X58A 3O6BB 3ABKH 3SFIA 4EJUA 1KU2A 4DJAA 2WAFA 2ZC2A 2XAHA 5E20A 1OCOH 4XN0A 2HI3A 2QYOA 3FMSA 3WTZA 3ZN1A 3V8LA 5IT3A 1ZN2A 4C3JJ 3HOSA 4XSXF 4BHCA 1ZR2A 1DPRA 2WB1A 1MD0A 2DPUA 4A3JJ 3OYEA 1QHGA 2FJ1A 2BW3B 2WWYA 5EGOB 1OCTC 1STZA 3S2HJ 5F1JA 1HW5A 5C44J 3QRFF 4BYYA 4DW6A 1QZYA 1SD4A 2ZJPF 2ID3A 2VE8A 2H8RA 2K86A 3JRDA 3OY9A 2VONA 1ETWA 1SD7A 3GMEA 3IAM2 2Z16A 2STWA 4EJOA 2W4SA 4WCGA 2QQAA 1OQYA 2NS0A 1SEUA 5TRDA 1LFBA 3JRBA 5DM7F 2IA1A 2H09A 2QQ9A 4HQEA 1ERDA 4UVAA 5KK1A 1I6HJ 3ESWB 2VODA 3BZKA 4KMUX 2C6YA 2V1XA 1FOKA 2GXAA 5FKMA 3PL8A 1R00A 1ACIA 1D8JA 3PSIA 1XGSA 3E5UA 5DM6F 1T08B 3K4KA 3I55I 3BWGA 2H1KA 1XTAA 2CMPA 5E3NA 1WFXA 3CESA 2VJ5A 4B3XA 1ITYA 1YOVB 5EZHA 4ON0A 2K9LA 1J2XA 1XSVA 1Y1VJ 1T8IA 4ZC3A 5KNLA 4IRIA 3LA2A 1VQ9I 4JOMA 1TC3C 3LSHA 1TWCJ 3F21A 3VOEA 1OMIA 2CGPA 2FSWA 2JSPA 1O3SA 1WJCA 3FF5A 4S05A 2IGNA 1R1UA 2OPTA 9ANTA 3GTQJ 4P55A 4Z2YA 1V54H 3HEFA 5F0CA 1ONVA 3RKXA 2DO7A 1R71A 1BIBA 2PJRA 2K9QA 3EYYA 3T0YA 1FOXA 5M5XJ 3CCVI 3R0JA 2DJIA 1YI2I 2M2EA 1FSEA 1Y8QB 1TZLA 2F48A 1DGRM 4BEHA 3ERED 4F55A 3A03A 3WG9A 4KUMA 4EJTA 1XD7A 5DV5A 5BNGA 2KHMA 1POGA 3SEQA 1LUJB 3FIWA 3KP4A 2KDZA 2EFNA 2HTSA 3TOAA 1XMAA 2ELHA 2WBMA 3MKLA 3KEQA 3QWLA 1R36A 3I5UA 2W1OA 4IOCF 3SZGA 3ZRGA 3Q9SA 4Y33A 2FNPA 3IHUA 1DP3A 3BTJA 2M8EA 1FTZA 5LHHA 3IH3A 2DA7A 4QPOA 3BZ6A 2L7KA 2O9LA 2EFOA 4LLLA 4ZDOA 1I3QJ 2F4OB 3FXQA 2E1MC 5HDKA 3CQZJ 1MBKA 1NG7A 3I59A 4MNUA 2K9NA 3OS0A 1LDKB 3H5AA 2FRHA 3AAFA 4PK4A 3V7RA 1YTYA 2HPMA 5EG0B 5J4YA 4XLEA 1G59A 1TWAJ 2GOXB 2DA1A 4IPAA 2LKXA 1A36A 1A6IA 2CSOA 4I0BA 4E7LA 2OCCH 2ZMEA 2EV5A 1IG7A 1IAWA 5JR3A 4S0HB 4BACA 1XDSA 3C2GA 4LITA 3CCEI 1ON1A 1R58A 3U2RA 3BR2A 3N97A 2Y31A 1ZGJA 1XB4A 1KYZA 4F93B 3AKZA 2XSDC 4O5VA 5F64A 1MH4A 3PSFA 3OR2C 4EGYA 2EFWA 1KZHA 2NOGA 4BY1J 3OSFA 2PLYA 2F5FA 4HSRA 2RC4A 2PQ8A 5D5VB 2XC7A 4PSWA 4IHVA 3L1PA 2L0KA 2V1UA 2HVSA 3MD2A 5J4VA 2QBYA 1W36D 3H3ZA 3BPVA 3JRGA 1FX7A 3U1KA 2IS1A 3NWSA 3IP4B 2IT0A 4N4OB 2FE3A 3RZOJ 4IQ4A 4ESJA 2MA3A 3SZPA 3J7AO 3F8BA 4Y13A 1BW5A 2HXIA 1FOYA 2QLZA 2QSGX 1PYVA 3SZTA 1B59A 1LKXA 3C7JA 1V5GA 3G3ZA 1Y6IA 5IYDJ 1Q1VA 3JCUC 2I5UA 4XOPA 4YG2F 4LD5A 3PJRA 3ZMTA 4PJLA 5A2QK 3OR1C 4AUXA 1O57A 5D4SA 4HNUA 1I27A 1TWHJ 2PX9A 2NNYA 4Q4ZF 2BW3A 4BXUA 4IF4A 3IH4A 3ONQA 2TRTA 5F1RA 3G1OA 5K1YA 2JWTA 2DQRA 4BHPA 3EDPA 1FYLA 4FTHA 1VQOI 4CA0A 1W7PD 4OIQF 3TP0A 4G6TB 4C9YA 5IOZA 4A3FJ 1T33A 2LKSA 3LWFA 3CC2I 1L3LA 1HW1A 2NXNB 3FZVA 3HGGA 2R7QA 3HGYA 3K1MA 2X1EA 2HOTA 2E5NA 1XSXA 2XPWA 4NC7A 2PBIA 2DFFA 4NBQA 2ZJQF 1K78B 2PFBA 1MNEA 3HKZN 1RUOA 2OCEA 3DKYA 4HV6A 4UVCA 5DS9A 2XAUA 2VQGA 2P5KA 3MKWB 3FKJA 3E6CC 2GIVA 3WU0A 1I6XA 3B6CA 5LBQA 3HXLA 2LMDA 1Z3YA 2KP6A 4KICA 2QBYB 2OZUA 1VQ4I 3PFIA 5EJCA 3F9KA 1QQIA 2UV1A 2RQQA 1DGWY 3JSOA 5M5WJ 5B3SH 1XC5A 4U0YA 3BG7A 5FFZA 2JUGA 2BY0A 2K7LA 4I99C 1JKQC 1VI0A 2YSRA 3I0TA 2DI3A 2L54A 3ZQQA 5DDGA 2GIZA 4ZH4F 2Y48A 5E8IA 1D0YA 4EM1A 3M8EA 2LY9A 1IC8A 3RPQA 1ZREA 4MIMA 2Z1DA 1Z0XA 1U9OA 3HSEA 3OOPA 1DQUA 2RNGA 5FKLA 3HDDA 1WI9A 3CP8A 2A5YB 4QTRA 3W2AA 1S8NA 4RGUA 4AM3A 2CW0F 1O3QA 1VQ7I 1R4NB 2JTVA 3AFHA 5BOXA 2XAJA 4A93J 3ASOH
chains in the Genus database with same CATH topology
4E70A 2RVCA 5LGUA 2V6CA 4A5MA 1FC3A 2XUBA 1HKQA 4F7ZA 2NYXA 3L2CA 1FPQA 2DAOA 4RB1A 2AXLA 2K27A 5L3BA 4R8HA 1HKTA 4M9ZA 4JK1X 3LA7A 3KE2A 1YO5C 1K7AA 2W24A 1BJAA 2JT1A 3FXRA 3NEUA 5E18F 4IRHA 3KLNA 2P7VB 4CO8A 3MAJA 2D2WA 4A2UA 1SD5A 3JTHA 1ZG1A 2Z3YA 2KIFA 4UXNA 3ISPA 2FOKA 2MLGA 4ZZLA 1JHHA 2J5OA 1U3EM 4A6EA 1LVAA 1Z05A 3ZMVA 3MZHA 1IXCA 2A68F 2AS5F 4EVIA 2BBYA 3T8RA 3MEXA 2H94A 4KDPA 1PP7U 4RGRA 4LG0B 4AD9A 1DDNA 1PDNC 2BV6A 3IC7A 1F5TA 3V8KA 4IHSA 1B9NA 2DLLA 1SMYF 1TNSA 4OIRF 3F8CA 3CO7C 2FA5A 2EV0A 1BM9A 2OU2A 3TKYA 1TQPA 2DU9A 4HQMA 2EA4A 1G3WA 1Y0UA 2E1CA 1Z1DA 2IP2A 2VT2A 5LRRA 2NAZA 3C1DA 4L9NA 5HLIA 2BE5F 2JPCA 1J5YA 3RIRA 1O7LA 2E7WA 4I98B 4L9JA 3C18A 2YX7A 4KT5C 2XAQA 2A6HF 4EJVA 1F9NA 1DUXC 1MJ9A 4Y15A 3WGGA 2X4HA 4HLYA 4M72A 3BJ6A 3CUQB 1S3JA 1ULYA 3OV8A 4L5IA 2DT5A 5D6EA 2WTEA 3FM5A 1QNTA 2ZXJA 2FEZA 3WTUC 4WF2A 4GGGA 3B73A 1BI2A 3HOTA 1ZRFA 1GHCA 4PZJA 2GQQA 2Z9OA 1MKMA 1U5TA 5K5OA 1OR7A 1LEBA 5CJ9A 3RKYA 3B02A 1KU3A 1TBXA 2VBYA 1UB9A 2EB7A 3HRUA 1YQAA 3WTYC 3P9KA 1UCRA 2K02A 2VOPA 5ED4A 3ZMUA 4HZFA 2A07F 2LSOA 2W85A 3R6SA 2GXBA 4EMSA 1XGNA 2ZMEB 2JSCA 5L3DA 4ENMA 2ZNZA 2YX4A 1IN6A 2X0LA 1LDJA 3WTSC 4JBAA 1SFUA 2P4WA 3LAJA 1OPCA 3CUQC 1H0MA 2OZ6A 3NQOA 3EUHA 5ICCA 2O61A 2ZNYA 3WTVC 1RI7A 4YIFA 2HR3A 2XGXA 5BS6A 3DF8A 2Q2EA 2IJLA 2F2EA 3BPXA 4MEYF 5FLXZ 1D3YA 3K2ZA 4AVPA 1T39A 2F5DA 5TJJA 2YU3A 4N0BA 4A0YA 5H6QA 4G6DA 2KIUA 1P4AA 5DCMB 5DD8A 2H27A 4EM2A 2L4AA 3GFIA 3R4KA 3E5QA 1GXPA 2ZFWA 5J8FA 1SD6A 2KJBA 4XRFA 4LLGF 3RPUA 3F6OA 5FGMA 2XV4S 5ICEA 2HZTA 3ABUA 4Y17A 1O7FA 2D1HA 2R7FA 2UWMA 3PQJA 1YYVA 2LF7A 5LEJA 3ZN0A 3E6DA 4HX8A 2M45A 5L3FA 4HX7A 2A3SA 3LA3A 3IL2A 1P4WA 2M5WA 3L09A 1W5TA 2CO5A 4RGSA 1WKMA 3WGHA 3D5LA 3FM3A 3GEZA 2A61A 5JFRA 1KQ0A 4LLNA 4DQ2A 3F22A 4KN7X 2Q8KA 6PAXA 2Z5UA 5JI6A 3WGIA 2EFQA 3LQRA 5IT9Z 2HFHA 1FBSA 3I53A 2L3DA 3T1BA 3HYIA 2Z99A 1PP8F 2O8XA 3C3WA 3WTTC 2Z33A 4K2EA 4RS8A 3P9IA 2FNAA 2V9VA 2EK5A 3HTUA 2HKXA 3F72A 2HEOA 2O6GE 3V8JA 4WX9A 1T0FA 2H6CA 4S04A 1HW2A 2M87A 2DBBA 5DCFA 5LLQA 4PCQA 3DPLC 1KGSA 3KP7A 2IVMA 1BOAA 4O6JA 1S7OA 1S7AA 2GAUA 5K5QA 4BNCA 2RQPA 3JAMZ 1FNNA 1MZBA 3QU6A 5E1ZB 2ISYA 4HX4A 4MQVA 2RKHA 5IT9K 2GWRA 5DEQA 3VB2A 5FO5A 2VBZA 3E6MA 1R1TA 3KZYA 3DP7A 2IW5A 5BQTA 2LNBA 4I0AA 4MGRA 2FU4A 5D8LB 3RYPA 1YFHA 4UVBA 2LF8A 4UUVA 1IRFA 2Y75A 2P5VA 2Y0MA 4KA4A 4L0ZB 4DNCA 4KFCA 3JSPA 4CYDA 4AIHA 3LFKA 3MQ0A 3MWMA 4LJZF 1LEAA 1ZRCA 4PGGA 2FF4A 1ZH5A 4M6YA 4JQFA 2VOOA 3R0AA 2BGCA 2HWVA 3R61A 2A69F 2EFPA 3JTGA 1UHMA 1KQ9A 4P9UA 1BN5A 5E1WA 1TTYA 1ODDA 2QUFA 1R5HA 1BIAA 1REPC 3CUQA 2FQ3A 2OQRA 3GWZA 1BBYA 4BQAA 3F23A 3FX3A 2P7CB 1FWZA 5AIQA 3H92A 1TLHB 3K1NA 4QWQA 1KA8A 1ZLKA 5J6XA 1RIOH 5DUIA 2K4BA 2EJRA 2QWWA 2PMHA 2RN7A 1QO0D 3KFWX 2XROA 1W4MA 3RI4A 2XAFA 4ESFA 2GA2A 3W6KB 4IJAA 3REOA 4G9YA 3FMQA 4FX4A 1IZ1A 4LMYA 3I59B 4OMYA 4RAZA 3U1DA 2ZO4A 1U5TB 1Z6TA 3KCCA 3J81Z 1EH8A 2RDPA 2DTRA 3BY6A 3GFMA 2O3FA 2L02A 2HTJA 3DXJF 3SHFA 2P5LC 3CTAA 1CF7A 2LDUA 3TQNA 3COAC 2HOEA 1H9TA 1D5VA 2Q0OA 1J59A 1MJAA 2CG4A 4U7DA 4HW0A 1ZARA 3FXUA 3E6BA 1SAXA 4MQ9F 3F8FA 1QGPA 3NRVA 4HA8A 4MHGA 2VBXA 1FYMA 4LK1F 5DD4A 1LNWA 2XRNA 5CVVA 2STTA 3M7GA 4RB0A 5EEGA 1P6RA 3BJAA 3DPTA 2MD5A 4A0XA 1B6AA 3WE3A 4KMFA 2P8TA 3E97A 1FLIA 5LEKA 1ZG3A 5HDGA 4CXFA 2OBPA 1U8RA 4EV0A 1HBXG 4KNYA 3MFKA 1R22A 4KIBA 3K9TA 4RB2C 1A04A 1ZAOA 2LKPA 1Q1HA 4KN4X 2MH2A 3JW4A 2W57A 4ZYGA 4U0WA 4A12A 1J9IA 3QPHA 1FBUA 1HSTA 3GLXA 1G4DA 3BDDA 5ICGA 1FZPB 1UHWA 4FT8A 1XSDA 3BOQA 3D0SA 2PG4A 3LSTA 3TOBA 1I5ZA 4IXAA 1FY7A 5J8CA 1LDDA 1XN7A 3L9FA 2V79A 5CVJA 4HLXA 4ENKA 4O3MA 1IN4A 5LGTA 1PUEE 2FBIA 3GUDA 2W84A 1O3TA 5AONA 1IN7A 3IRQA 3N4MA 2IRFG 1U5TC 1LB2A 3CO6C 3BROA 5HS8A 3I71A 1YLFA 5LHGA 4XLNF 1XGOA 1L0OC 3T5XA 2XIGA 3O2PE 3KP3A 4OIOF 5HLHA 3QPTA 4UNOA 3Q5FA 3KLOA 2KJCA 4HF0A 4B09A 4BH9A 1ZHFA 1OYWA 1J7KA 5L3CA 1F1ZA 3ZP5A 2L01A 1G3SA 2UZKA 4LFUA 3O3KA 4AWXB 2DQLA 2RGVA 2JPBA 4MTDA 5D8KB 1IN8A 5H20A 3E5XA 4R1HA 1CF7B 4HYEA 3RDIA 3I58A 3DFGA 3M1EA 3ROUA 2WV0A 5HS7A 2QM3A 3L00A 3MCZA 3RKWA 2VC0A 5DUKA 2PI0A 4L18B 2XAGA 2DPDA 1XCBA 2IPQX 4GCVA 1ZRDA 3V7SA 3DKWA 3QU3A 4OMZA 1WRJA 2ETHA 3V7CA 4CDGA 1TW2A 2PMUA 2KRFA 1RNLA 3CJNA 4P96A 3WTWC 5D5XB 2MH9A 2NNNA 3M8FA 2HDCA 4CICA 1TQIA 5ICFA 3TDUC 2MLKA 2UXXA 3IRRA 4LGWA 3GF2A 1IRGA 4HDVA 4H0EA 1G6NA 1JE8A 4L5JA 4ENNA 1XGMA 1TW3A 4M9SA 3ULQB 1GVJA 2JZYA 2CFXA 2J5PA 5D6FA 2RV8A 1YW7A 4Q48A 1D8KA 1ZG5A 5FD5A 1R7JA 2ZJ2A 3QOPA 1AOYA 3VFZA 4P9FA 1IF1A 3GXOA 5DCMA 1FP2A 4L0YB 4NQWA 4I02A 2VC1A 2FMLA 4XLPF 2VXZA 5HLGA 4FHTA 1HXDA 2ISZA 2COMA 3HRTA 4OINF 1B9MA 4GO1A 1J0RA 4HDUA 4I2OA 2QZ8A 4LB5A 1R5GA 5ILSA 3QP5A 5ERIA 4M6XA 4HAMA 1T98A 4HOBA 4EM0B 5CLSA 3K69A 3KP2A 1AWCA 4AIKA 3G73A 2VE9A 1LQ1A 4B8XA 4U7BA 3HSRA 2HYFA 3QP6A 1BI0A 1C0WA 4IVNA 1ON2A 4M71A 2G7HA 4TV7A 4LB6B 3K0LA 1E17A 5L3GA 1G3YA 1YG2A 5LHIA 3RJPA 3K1PA 2FBHA 4HV5A 2L4MA 5EEHA 1I1GA 3J80K 4YIIA 1K78A 4RGXA 1BI3A 3DEUA 1RZ4A 1FT9A 3TO7A 2O0YA 2PJPA 3GO5A 2XVCA 4BAYA 3W6JB 1YW8A 2E7XA 4UV9A 4I01A 2NRAC 4ZYHA 1HKSA 3EQLF 4GYIA 3U9GA 4NB5A 5HDNA 1SFXA 4ZZDA 3BP8A 1QBJA 3J81K 2ZCWA 1U78A 1WQ2A 4G94A 1BC7C 3L7WA 1IXSB 1XMKA 1YS6A 2M1BA 4L9TA 1IXRC 1TQMA 3CDHA 3CLOA 5H6RA 3GZ5A 1U2WA 2QVOA 4HF1A 1KU7A 4ZYDA 3H3UA 1WSUA 1U6GA 2PEXA 4YFKF 4GXOA 3KP5A 2ACJA 1T6SA 1XDUA 4PGHA 1Z6RA 4UHTA 1S29A 4CZZA 3TGNA 2ZBKA 3IKTA 2DW4A 4G7OF 3FWEA 5JVTA 4D0PA 5KVRA 2XKPA 5FB2A 4G6QA 4YFXF 3ZMDA 2O03A 1QZZA 4OOIA 1V4RA 3EETA 2DK8A 3J80Z 3HIFA 1P4XA 3JAMK 2QQBA 3I4PA 3I64A 4L9VA 2CQKA 1X3UA 5CVIA 5E1XA 4A0ZA 2HS5A 2CWEA 4ENJA 2BEOA 4KYWA 5F6FA 3TO9A 3WU1B 1FP1D 3VEPA 3MZYA 2PN6A 4XBFA 1ZGAA 3GW2A 2WC2A 1G3TA 1BI1A 5BMZA 1XCVA 2OQGA 3RYRA 2VBWA 2IA0A 5E17F 1YIOA 2EWNA 4HF2A 3LQQA 2E1NA 1MJBA 2XKOA 1W7PB 3TDZC 1YS7A 3F8NA 2D1VA 1OYYA 5E8GA 2ESHA 4AIJA 2BYVE 3R60A 4U0VA 1JXSA 1LJ9A 4G7ZF 4G7HF 3ECOA 2R7DA 4Q47A 4KIFA 1MDMA 1O3RA 3DV8A 3SQNA 2QENA 1F4KA 4EQQA 2RNJA 5K5RA 3KETA 4CGZA 3Q9VA 3P9CA 1UFMA 4U88A 2ESNA 3M9AA 3V4GA 2R3SA 1P2FA 4G8XA 4WK8F 1J75A 2JRTA 2P6TA 3WODF 4A5NA 1B1BA 2H6BA 4BHBA 1QPMA 3FHZA 2FBKA 1SMTA 2W25A 4M9XA 3PQKA 4ESBA 5ILUA 4RAYA 1R23A 2XHKA 3F8MA 4M73A 3HUGA 2XASA 4WXDA 5CVRA 3LAPA 5JHUA 5L3EA 2P6SA 1JGSA 1IUYA 1TNTA 1ZYRF 3IKVA 1KQ8A 2TDXA 2GXGA 5LRSA 5HS9A 3ML6A 4I7HA 5HOOA 3IWZA 1YW9A 3GVAA 2HQNA 2B0LA 2GZWA 2YPRA 2K4JA 3ZMZA 2DFIA 1T2KA 3ECHA 3EYIA 4MTEA 4RB3C 2OA4A 3HRSA 3KZZA 1OYIA 1CGPA 2VT3A 3QAHA 4N9HA 3T8TA 3ABTA 2OD5A 2KIMA 3GFLA 1B4AA 1MGTA 3RTRA 1WWXA 1DPUA 5BPIA 1V3FA 2A6EF 3HHHA 5CYVA 5DYMA 4Q5SF 4EJWA 4GYGA 4EGZA 4CHUA 2OAZA 1K79A 2G7UA 1S6LA 2UXNA 2HYGD 5FLXK 2HQRA 3HSFA 2HGCA 5HVQC 4MEXF 3ZPLA 4R79A 3TO6A 2M30A 2EA2A 1K6OA 3S2WA 4XSZF 3P7NA 5CVUA 4LG0A 1ZLJA 3WTXC 2DK5A 4OU0A 4WWCA 1BC8C 1IN5A 2FMYA 1I1SA 2F5EA 3KEOA 1H9GA 1Z9CA 1KU9A 2GA1A 4ETSA 3HRMA 3WE2A 3HTSB 4FX0A 2FXAA 5FD6A 3E3VA 5D5WB 1E2XA 4KIGA 4HBLA 1USTA 4NHJA 1IW7F 2YR2A 1EH6A 4QLCU 1Z7UA 3ZMSA 1NHAA 3I54A 3GYHX 3IWFA 3GFJA 1USSA 4P5OA 1VTNC 3CUOA 3BJOA 1R1VA 1EV7A 1W7PA 3SFZA 3FMRA 1FSHA 1JHFA 1W5SA 4WXCA 5BPDA 2F5CA 1Z91A 1KYWA 3SXYA 5D5UB 4UV8A 5AIPA 3F3XA 1EH7A 5ILVA 1HSJA 4IRGA 4LK0F 5LGNA 1DP7P 1FYKA 1SFEA 4OIPF 3VODA 3KP6A 5A2QZ 5FFXA 3GX4X 4ZYEA 5D4RA 2IA2A 1OKRA 3F6VA 1RUNA 2EV6A 2CYYA 4ASNA 1FBQA 3DQVC 4A6DA 1P92A 2HKOA 2V1DA 1MDMB 2MBFA 4WXHA 1GXQA 2MC3A 1HQCA 3HHGA 4N9IA 2G9WA 2VN2A 3GZ6A 4PDKA 2KKOA 2D45A 2ZKZA 4YFNF 3ZQ7A 4M74A 4IHTA 1T38A 3ELKA 2ADUA 3O6BB 4EJUA 1KU2A 2XAHA 5E20A 2QYOA 3FMSA 3WTZA 3ZN1A 3V8LA 5IT3A 1ZN2A 3HOSA 4XSXF 4BHCA 1DPRA 2DPUA 1MD0A 2WWYA 1STZA 3QRFF 1HW5A 4BYYA 1QZYA 1SD4A 2VE8A 2K86A 2VONA 1SD7A 2STWA 4EJOA 4WCGA 2QQAA 2NS0A 5TRDA 2IA1A 2H09A 2QQ9A 4HQEA 4UVAA 5KK1A 2VODA 4KMUX 2C6YA 2V1XA 1FOKA 1D8JA 1R00A 1XGSA 3E5UA 3BWGA 4ON0A 1J2XA 1XSVA 4IRIA 3LA2A 3F21A 3VOEA 1OMIA 2CGPA 2FSWA 1O3SA 3FF5A 4S05A 1R1UA 4P55A 4Z2YA 1ONVA 3RKXA 2DO7A 1BIBA 3EYYA 3T0YA 3R0JA 1FSEA 3ERED 3WG9A 4KUMA 4EJTA 1XD7A 5DV5A 3KP4A 2EFNA 2HTSA 3TOAA 1XMAA 2ELHA 3KEQA 1R36A 3I5UA 3Q9SA 2FNPA 3IHUA 2M8EA 5LHHA 3BZ6A 2EFOA 4LLLA 3FXQA 5HDKA 3I59A 4MNUA 1LDKB 2FRHA 3AAFA 1YTYA 3V7RA 4IPAA 2CSOA 4I0BA 2ZMEA 2EV5A 1IAWA 5JR3A 1XDSA 1ON1A 1R58A 3U2RA 3N97A 1ZGJA 1XB4A 1KYZA 4O5VA 5F64A 4EGYA 2EFWA 2PLYA 2F5FA 2RC4A 2PQ8A 5D5VB 2V1UA 2QBYA 3H3ZA 3BPVA 1FX7A 2IT0A 2FE3A 4ESJA 2MA3A 3SZPA 3J7AO 3F8BA 4Y13A 2QLZA 3SZTA 1B59A 3C7JA 3G3ZA 4YG2F 4LD5A 3ZMTA 5A2QK 1O57A 5D4SA 1I27A 2NNYA 4Q4ZF 4BXUA 4IF4A 5F1RA 5K1YA 1FYLA 2DQRA 4BHPA 3EDPA 1W7PD 4OIQF 3LWFA 1L3LA 1HW1A 3FZVA 3K1MA 1XSXA 2PBIA 1K78B 2PFBA 1RUOA 4UVCA 4HV6A 2P5KA 3E6CC 2GIVA 3WU0A 1I6XA 5LBQA 2QBYB 4KICA 2OZUA 3PFIA 1QQIA 3JSOA 4U0YA 5FFZA 2K7LA 2YSRA 3I0TA 2DI3A 2L54A 5DDGA 4ZH4F 2Y48A 5E8IA 4EM1A 3M8EA 1ZREA 3RPQA 3HSEA 3OOPA 1WI9A 2A5YB 1S8NA 4RGUA 2CW0F 1O3QA 5BOXA 2JTVA 4I09A 2XAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E70 A;  2RVC A;  5LGU A;  2V6C A;  4A5M A;  1FC3 A;  2XUB A;  1HKQ A;  4F7Z A;  2NYX A;  3L2C A;  1FPQ A;  2DAO A;  4RB1 A;  2AXL A;  2K27 A;  5L3B A;  4R8H A;  1HKT A;  4M9Z A;  4JK1 X;  3LA7 A;  3KE2 A;  1YO5 C;  1K7A A;  2W24 A;  1BJA A;  2JT1 A;  3FXR A;  3NEU A;  5E18 F;  4IRH A;  3KLN A;  2P7V B;  4CO8 A;  3MAJ A;  2D2W A;  4A2U A;  1SD5 A;  3JTH A;  1ZG1 A;  2Z3Y A;  2KIF A;  4UXN A;  3ISP A;  2FOK A;  2MLG A;  4ZZL A;  1JHH A;  2J5O A;  1U3E M;  4A6E A;  1LVA A;  1Z05 A;  3ZMV A;  3MZH A;  1IXC A;  2A68 F;  2AS5 F;  4EVI A;  2BBY A;  3T8R A;  3MEX A;  2H94 A;  4KDP A;  1PP7 U;  4RGR A;  4LG0 B;  4AD9 A;  1DDN A;  1PDN C;  2BV6 A;  3IC7 A;  1F5T A;  3V8K A;  4IHS A;  1B9N A;  2DLL A;  1SMY F;  1TNS A;  4OIR F;  3F8C A;  3CO7 C;  2FA5 A;  2EV0 A;  1BM9 A;  2OU2 A;  3TKY A;  1TQP A;  2DU9 A;  4HQM A;  2EA4 A;  1G3W A;  1Y0U A;  2E1C A;  1Z1D A;  2IP2 A;  2VT2 A;  5LRR A;  2NAZ A;  3C1D A;  4L9N A;  5HLI A;  2BE5 F;  2JPC A;  1J5Y A;  3RIR A;  1O7L A;  2E7W A;  4I98 B;  4L9J A;  3C18 A;  2YX7 A;  4KT5 C;  2XAQ A;  2A6H F;  4EJV A;  1F9N A;  1DUX C;  1MJ9 A;  4Y15 A;  3WGG A;  2X4H A;  4HLY A;  4M72 A;  3BJ6 A;  3CUQ B;  1S3J A;  1ULY A;  3OV8 A;  4L5I A;  2DT5 A;  5D6E A;  2WTE A;  3FM5 A;  1QNT A;  2ZXJ A;  2FEZ A;  3WTU C;  4WF2 A;  4GGG A;  3B73 A;  1BI2 A;  3HOT A;  1ZRF A;  1GHC A;  4PZJ A;  2GQQ A;  2Z9O A;  1MKM A;  1U5T A;  5K5O A;  1OR7 A;  1LEB A;  5CJ9 A;  3RKY A;  3B02 A;  1KU3 A;  1TBX A;  2VBY A;  1UB9 A;  2EB7 A;  3HRU A;  1YQA A;  3WTY C;  3P9K A;  1UCR A;  2K02 A;  2VOP A;  5ED4 A;  3ZMU A;  4HZF A;  2A07 F;  2LSO A;  2W85 A;  3R6S A;  2GXB A;  4EMS A;  1XGN A;  2ZME B;  2JSC A;  5L3D A;  4ENM A;  2ZNZ A;  2YX4 A;  1IN6 A;  2X0L A;  1LDJ A;  3WTS C;  4JBA A;  1SFU A;  2P4W A;  3LAJ A;  1OPC A;  3CUQ C;  1H0M A;  2OZ6 A;  3NQO A;  3EUH A;  5ICC A;  2O61 A;  2ZNY A;  3WTV C;  1RI7 A;  4YIF A;  2HR3 A;  2XGX A;  5BS6 A;  3DF8 A;  2Q2E A;  2IJL A;  2F2E A;  3BPX A;  4MEY F;  5FLX Z;  1D3Y A;  3K2Z A;  4AVP A;  1T39 A;  2F5D A;  5TJJ A;  2YU3 A;  4N0B A;  4A0Y A;  5H6Q A;  4G6D A;  2KIU A;  1P4A A;  5DCM B;  5DD8 A;  2H27 A;  4EM2 A;  2L4A A;  3GFI A;  3R4K A;  3E5Q A;  1GXP A;  2ZFW A;  5J8F A;  1SD6 A;  2KJB A;  4XRF A;  4LLG F;  3RPU A;  3F6O A;  5FGM A;  2XV4 S;  5ICE A;  2HZT A;  3ABU A;  4Y17 A;  1O7F A;  2D1H A;  2R7F A;  2UWM A;  3PQJ A;  1YYV A;  2LF7 A;  5LEJ A;  3ZN0 A;  3E6D A;  4HX8 A;  2M45 A;  5L3F A;  4HX7 A;  2A3S A;  3LA3 A;  3IL2 A;  1P4W A;  2M5W A;  3L09 A;  1W5T A;  2CO5 A;  4RGS A;  1WKM A;  3WGH A;  3D5L A;  3FM3 A;  3GEZ A;  2A61 A;  5JFR A;  1KQ0 A;  4LLN A;  4DQ2 A;  3F22 A;  4KN7 X;  2Q8K A;  6PAX A;  2Z5U A;  5JI6 A;  3WGI A;  2EFQ A;  3LQR A;  5IT9 Z;  2HFH A;  1FBS A;  3I53 A;  2L3D A;  3T1B A;  3HYI A;  2Z99 A;  1PP8 F;  2O8X A;  3C3W A;  3WTT C;  2Z33 A;  4K2E A;  4RS8 A;  3P9I A;  2FNA A;  2V9V A;  2EK5 A;  3HTU A;  2HKX A;  3F72 A;  2HEO A;  2O6G E;  3V8J A;  4WX9 A;  1T0F A;  2H6C A;  4S04 A;  1HW2 A;  2M87 A;  2DBB A;  5DCF A;  5LLQ A;  4PCQ A;  3DPL C;  1KGS A;  3KP7 A;  2IVM A;  1BOA A;  4O6J A;  1S7O A;  1S7A A;  2GAU A;  5K5Q A;  4BNC A;  2RQP A;  3JAM Z;  1FNN A;  1MZB A;  3QU6 A;  5E1Z B;  2ISY A;  4HX4 A;  4MQV A;  2RKH A;  5IT9 K;  2GWR A;  5DEQ A;  3VB2 A;  5FO5 A;  2VBZ A;  3E6M A;  1R1T A;  3KZY A;  3DP7 A;  2IW5 A;  5BQT A;  2LNB A;  4I0A A;  4MGR A;  2FU4 A;  5D8L B;  3RYP A;  1YFH A;  4UVB A;  2LF8 A;  4UUV A;  1IRF A;  2Y75 A;  2P5V A;  2Y0M A;  4KA4 A;  4L0Z B;  4DNC A;  4KFC A;  3JSP A;  4CYD A;  4AIH A;  3LFK A;  3MQ0 A;  3MWM A;  4LJZ F;  1LEA A;  1ZRC A;  4PGG A;  2FF4 A;  1ZH5 A;  4M6Y A;  4JQF A;  2VOO A;  3R0A A;  2BGC A;  2HWV A;  3R61 A;  2A69 F;  2EFP A;  3JTG A;  1UHM A;  1KQ9 A;  4P9U A;  1BN5 A;  5E1W A;  1TTY A;  1ODD A;  2QUF A;  1R5H A;  1BIA A;  1REP C;  3CUQ A;  2FQ3 A;  2OQR A;  3GWZ A;  1BBY A;  4BQA A;  3F23 A;  3FX3 A;  2P7C B;  1FWZ A;  5AIQ A;  3H92 A;  1TLH B;  3K1N A;  4QWQ A;  1KA8 A;  1ZLK A;  5J6X A;  1RIO H;  5DUI A;  2K4B A;  2EJR A;  2QWW A;  2PMH A;  2RN7 A;  1QO0 D;  3KFW X;  2XRO A;  1W4M A;  3RI4 A;  2XAF A;  4ESF A;  2GA2 A;  3W6K B;  4IJA A;  3REO A;  4G9Y A;  3FMQ A;  4FX4 A;  1IZ1 A;  4LMY A;  3I59 B;  4OMY A;  4RAZ A;  3U1D A;  2ZO4 A;  1U5T B;  1Z6T A;  3KCC A;  3J81 Z;  1EH8 A;  2RDP A;  2DTR A;  3BY6 A;  3GFM A;  2O3F A;  2L02 A;  2HTJ A;  3DXJ F;  3SHF A;  2P5L C;  3CTA A;  1CF7 A;  2LDU A;  3TQN A;  3COA C;  2HOE A;  1H9T A;  1D5V A;  2Q0O A;  1J59 A;  1MJA A;  2CG4 A;  4U7D A;  4HW0 A;  1ZAR A;  3FXU A;  3E6B A;  1SAX A;  4MQ9 F;  3F8F A;  1QGP A;  3NRV A;  4HA8 A;  4MHG A;  2VBX A;  1FYM A;  4LK1 F;  5DD4 A;  1LNW A;  2XRN A;  5CVV A;  2STT A;  3M7G A;  4RB0 A;  5EEG A;  1P6R A;  3BJA A;  3DPT A;  2MD5 A;  4A0X A;  1B6A A;  3WE3 A;  4KMF A;  2P8T A;  3E97 A;  1FLI A;  5LEK A;  1ZG3 A;  5HDG A;  4CXF A;  2OBP A;  1U8R A;  4EV0 A;  1HBX G;  4KNY A;  3MFK A;  1R22 A;  4KIB A;  3K9T A;  4RB2 C;  1A04 A;  1ZAO A;  2LKP A;  1Q1H A;  4KN4 X;  2MH2 A;  3JW4 A;  2W57 A;  4ZYG A;  4U0W A;  4A12 A;  1J9I A;  3QPH A;  1FBU A;  1HST A;  3GLX A;  1G4D A;  3BDD A;  5ICG A;  1FZP B;  1UHW A;  4FT8 A;  1XSD A;  3BOQ A;  3D0S A;  2PG4 A;  3LST A;  3TOB A;  1I5Z A;  4IXA A;  1FY7 A;  5J8C A;  1LDD A;  1XN7 A;  3L9F A;  2V79 A;  5CVJ A;  4HLX A;  4ENK A;  4O3M A;  1IN4 A;  5LGT A;  1PUE E;  2FBI A;  3GUD A;  2W84 A;  1O3T A;  5AON A;  1IN7 A;  3IRQ A;  3N4M A;  2IRF G;  1U5T C;  1LB2 A;  3CO6 C;  3BRO A;  5HS8 A;  3I71 A;  1YLF A;  5LHG A;  4XLN F;  1XGO A;  1L0O C;  3T5X A;  2XIG A;  3O2P E;  3KP3 A;  4OIO F;  5HLH A;  3QPT A;  4UNO A;  3Q5F A;  3KLO A;  2KJC A;  4HF0 A;  4B09 A;  4BH9 A;  1ZHF A;  1OYW A;  1J7K A;  5L3C A;  1F1Z A;  3ZP5 A;  2L01 A;  1G3S A;  2UZK A;  4LFU A;  3O3K A;  4AWX B;  2DQL A;  2RGV A;  2JPB A;  4MTD A;  5D8K B;  1IN8 A;  5H20 A;  3E5X A;  4R1H A;  1CF7 B;  4HYE A;  3RDI A;  3I58 A;  3DFG A;  3M1E A;  3ROU A;  2WV0 A;  5HS7 A;  2QM3 A;  3L00 A;  3MCZ A;  3RKW A;  2VC0 A;  5DUK A;  2PI0 A;  4L18 B;  2XAG A;  2DPD A;  1XCB A;  2IPQ X;  4GCV A;  1ZRD A;  3V7S A;  3DKW A;  3QU3 A;  4OMZ A;  1WRJ A;  2ETH A;  3V7C A;  4CDG A;  1TW2 A;  2PMU A;  2KRF A;  1RNL A;  3CJN A;  4P96 A;  3WTW C;  5D5X B;  2MH9 A;  2NNN A;  3M8F A;  2HDC A;  4CIC A;  1TQI A;  5ICF A;  3TDU C;  2MLK A;  2UXX A;  3IRR A;  4LGW A;  3GF2 A;  1IRG A;  4HDV A;  4H0E A;  1G6N A;  1JE8 A;  4L5J A;  4ENN A;  1XGM A;  1TW3 A;  4M9S A;  3ULQ B;  1GVJ A;  2JZY A;  2CFX A;  2J5P A;  5D6F A;  2RV8 A;  1YW7 A;  4Q48 A;  1D8K A;  1ZG5 A;  5FD5 A;  1R7J A;  2ZJ2 A;  3QOP A;  1AOY A;  3VFZ A;  4P9F A;  1IF1 A;  3GXO A;  5DCM A;  1FP2 A;  4L0Y B;  4NQW A;  4I02 A;  2VC1 A;  2FML A;  4XLP F;  2VXZ A;  5HLG A;  4FHT A;  1HXD A;  2ISZ A;  2COM A;  3HRT A;  4OIN F;  1B9M A;  4GO1 A;  1J0R A;  4HDU A;  4I2O A;  2QZ8 A;  4LB5 A;  1R5G A;  5ILS A;  3QP5 A;  5ERI A;  4M6X A;  4HAM A;  1T98 A;  4HOB A;  4EM0 B;  5CLS A;  3K69 A;  3KP2 A;  1AWC A;  4AIK A;  3G73 A;  2VE9 A;  1LQ1 A;  4B8X A;  4U7B A;  3HSR A;  2HYF A;  3QP6 A;  1BI0 A;  1C0W A;  4IVN A;  1ON2 A;  4M71 A;  2G7H A;  4TV7 A;  4LB6 B;  3K0L A;  1E17 A;  5L3G A;  1G3Y A;  1YG2 A;  5LHI A;  3RJP A;  3K1P A;  2FBH A;  4HV5 A;  2L4M A;  5EEH A;  1I1G A;  3J80 K;  4YII A;  1K78 A;  4RGX A;  1BI3 A;  3DEU A;  1RZ4 A;  1FT9 A;  3TO7 A;  2O0Y A;  2PJP A;  3GO5 A;  2XVC A;  4BAY A;  3W6J B;  1YW8 A;  2E7X A;  4UV9 A;  4I01 A;  2NRA C;  4ZYH A;  1HKS A;  3EQL F;  4GYI A;  3U9G A;  4NB5 A;  5HDN A;  1SFX A;  4ZZD A;  3BP8 A;  1QBJ A;  3J81 K;  2ZCW A;  1U78 A;  1WQ2 A;  4G94 A;  1BC7 C;  3L7W A;  1IXS B;  1XMK A;  1YS6 A;  2M1B A;  4L9T A;  1IXR C;  1TQM A;  3CDH A;  3CLO A;  5H6R A;  3GZ5 A;  1U2W A;  2QVO A;  4HF1 A;  1KU7 A;  4ZYD A;  3H3U A;  1WSU A;  1U6G A;  2PEX A;  4YFK F;  4GXO A;  3KP5 A;  2ACJ A;  1T6S A;  1XDU A;  4PGH A;  1Z6R A;  4UHT A;  1S29 A;  4CZZ A;  3TGN A;  2ZBK A;  3IKT A;  2DW4 A;  4G7O F;  3FWE A;  5JVT A;  4D0P A;  5KVR A;  2XKP A;  5FB2 A;  4G6Q A;  4YFX F;  3ZMD A;  2O03 A;  1QZZ A;  4OOI A;  1V4R A;  3EET A;  2DK8 A;  3J80 Z;  3HIF A;  1P4X A;  3JAM K;  2QQB A;  3I4P A;  3I64 A;  4L9V A;  2CQK A;  1X3U A;  5CVI A;  5E1X A;  4A0Z A;  2HS5 A;  2CWE A;  4ENJ A;  2BEO A;  4KYW A;  5F6F A;  3TO9 A;  3WU1 B;  1FP1 D;  3VEP A;  3MZY A;  2PN6 A;  4XBF A;  1ZGA A;  3GW2 A;  2WC2 A;  1G3T A;  1BI1 A;  5BMZ A;  1XCV A;  2OQG A;  3RYR A;  2VBW A;  2IA0 A;  5E17 F;  1YIO A;  2EWN A;  4HF2 A;  3LQQ A;  2E1N A;  1MJB A;  2XKO A;  1W7P B;  3TDZ C;  1YS7 A;  3F8N A;  2D1V A;  1OYY A;  5E8G A;  2ESH A;  4AIJ A;  2BYV E;  3R60 A;  4U0V A;  1JXS A;  1LJ9 A;  4G7Z F;  4G7H F;  3ECO A;  2R7D A;  4Q47 A;  4KIF A;  1MDM A;  1O3R A;  3DV8 A;  3SQN A;  2QEN A;  1F4K A;  4EQQ A;  2RNJ A;  5K5R A;  3KET A;  4CGZ A;  3Q9V A;  3P9C A;  1UFM A;  4U88 A;  2ESN A;  3M9A A;  3V4G A;  2R3S A;  1P2F A;  4G8X A;  4WK8 F;  1J75 A;  2JRT A;  2P6T A;  3WOD F;  4A5N A;  1B1B A;  2H6B A;  4BHB A;  1QPM A;  3FHZ A;  2FBK A;  1SMT A;  2W25 A;  4M9X A;  3PQK A;  4ESB A;  5ILU A;  4RAY A;  1R23 A;  2XHK A;  3F8M A;  4M73 A;  3HUG A;  2XAS A;  4WXD A;  5CVR A;  3LAP A;  5JHU A;  5L3E A;  2P6S A;  1JGS A;  1IUY A;  1TNT A;  1ZYR F;  3IKV A;  1KQ8 A;  2TDX A;  2GXG A;  5LRS A;  5HS9 A;  3ML6 A;  4I7H A;  5HOO A;  3IWZ A;  1YW9 A;  3GVA A;  2HQN A;  2B0L A;  2GZW A;  2YPR A;  2K4J A;  3ZMZ A;  2DFI A;  1T2K A;  3ECH A;  3EYI A;  4MTE A;  4RB3 C;  2OA4 A;  3HRS A;  3KZZ A;  1OYI A;  1CGP A;  2VT3 A;  3QAH A;  4N9H A;  3T8T A;  3ABT A;  2OD5 A;  2KIM A;  3GFL A;  1B4A A;  1MGT A;  3RTR A;  1WWX A;  1DPU A;  5BPI A;  1V3F A;  2A6E F;  3HHH A;  5CYV A;  5DYM A;  4Q5S F;  4EJW A;  4GYG A;  4EGZ A;  4CHU A;  2OAZ A;  1K79 A;  2G7U A;  1S6L A;  2UXN A;  2HYG D;  5FLX K;  2HQR A;  3HSF A;  2HGC A;  5HVQ C;  4MEX F;  3ZPL A;  4R79 A;  3TO6 A;  2M30 A;  2EA2 A;  1K6O A;  3S2W A;  4XSZ F;  3P7N A;  5CVU A;  4LG0 A;  1ZLJ A;  3WTX C;  2DK5 A;  4OU0 A;  4WWC A;  1BC8 C;  1IN5 A;  2FMY A;  1I1S A;  2F5E A;  3KEO A;  1H9G A;  1Z9C A;  1KU9 A;  2GA1 A;  4ETS A;  3HRM A;  3WE2 A;  3HTS B;  4FX0 A;  2FXA A;  5FD6 A;  3E3V A;  5D5W B;  1E2X A;  4KIG A;  4HBL A;  1UST A;  4NHJ A;  1IW7 F;  2YR2 A;  1EH6 A;  4QLC U;  1Z7U A;  3ZMS A;  1NHA A;  3I54 A;  3GYH X;  3IWF A;  3GFJ A;  1USS A;  4P5O A;  1VTN C;  3CUO A;  3BJO A;  1R1V A;  1EV7 A;  1W7P A;  3SFZ A;  3FMR A;  1FSH A;  1JHF A;  1W5S A;  4WXC A;  5BPD A;  2F5C A;  1Z91 A;  1KYW A;  3SXY A;  5D5U B;  4UV8 A;  5AIP A;  3F3X A;  1EH7 A;  5ILV A;  1HSJ A;  4IRG A;  4LK0 F;  5LGN A;  1DP7 P;  1FYK A;  1SFE A;  4OIP F;  3VOD A;  3KP6 A;  5A2Q Z;  5FFX A;  3GX4 X;  4ZYE A;  5D4R A;  2IA2 A;  1OKR A;  3F6V A;  1RUN A;  2EV6 A;  2CYY A;  4ASN A;  1FBQ A;  3DQV C;  4A6D A;  1P92 A;  2HKO A;  2V1D A;  1MDM B;  2MBF A;  4WXH A;  1GXQ A;  2MC3 A;  1HQC A;  3HHG A;  4N9I A;  2G9W A;  2VN2 A;  3GZ6 A;  4PDK A;  2KKO A;  2D45 A;  2ZKZ A;  4YFN F;  3ZQ7 A;  4M74 A;  4IHT A;  1T38 A;  3ELK A;  2ADU A;  3O6B B;  4EJU A;  1KU2 A;  2XAH A;  5E20 A;  2QYO A;  3FMS A;  3WTZ A;  3ZN1 A;  3V8L A;  5IT3 A;  1ZN2 A;  3HOS A;  4XSX F;  4BHC A;  1DPR A;  2DPU A;  1MD0 A;  2WWY A;  1STZ A;  3QRF F;  1HW5 A;  4BYY A;  1QZY A;  1SD4 A;  2VE8 A;  2K86 A;  2VON A;  1SD7 A;  2STW A;  4EJO A;  4WCG A;  2QQA A;  2NS0 A;  5TRD A;  2IA1 A;  2H09 A;  2QQ9 A;  4HQE A;  4UVA A;  5KK1 A;  2VOD A;  4KMU X;  2C6Y A;  2V1X A;  1FOK A;  1D8J A;  1R00 A;  1XGS A;  3E5U A;  3BWG A;  4ON0 A;  1J2X A;  1XSV A;  4IRI A;  3LA2 A;  3F21 A;  3VOE A;  1OMI A;  2CGP A;  2FSW A;  1O3S A;  3FF5 A;  4S05 A;  1R1U A;  4P55 A;  4Z2Y A;  1ONV A;  3RKX A;  2DO7 A;  1BIB A;  3EYY A;  3T0Y A;  3R0J A;  1FSE A;  3ERE D;  3WG9 A;  4KUM A;  4EJT A;  1XD7 A;  5DV5 A;  3KP4 A;  2EFN A;  2HTS A;  3TOA A;  1XMA A;  2ELH A;  3KEQ A;  1R36 A;  3I5U A;  3Q9S A;  2FNP A;  3IHU A;  2M8E A;  5LHH A;  3BZ6 A;  2EFO A;  4LLL A;  3FXQ A;  5HDK A;  3I59 A;  4MNU A;  1LDK B;  2FRH A;  3AAF A;  1YTY A;  3V7R A;  4IPA A;  2CSO A;  4I0B A;  2ZME A;  2EV5 A;  1IAW A;  5JR3 A;  1XDS A;  1ON1 A;  1R58 A;  3U2R A;  3N97 A;  1ZGJ A;  1XB4 A;  1KYZ A;  4O5V A;  5F64 A;  4EGY A;  2EFW A;  2PLY A;  2F5F A;  2RC4 A;  2PQ8 A;  5D5V B;  2V1U A;  2QBY A;  3H3Z A;  3BPV A;  1FX7 A;  2IT0 A;  2FE3 A;  4ESJ A;  2MA3 A;  3SZP A;  3J7A O;  3F8B A;  4Y13 A;  2QLZ A;  3SZT A;  1B59 A;  3C7J A;  3G3Z A;  4YG2 F;  4LD5 A;  3ZMT A;  5A2Q K;  1O57 A;  5D4S A;  1I27 A;  2NNY A;  4Q4Z F;  4BXU A;  4IF4 A;  5F1R A;  5K1Y A;  1FYL A;  2DQR A;  4BHP A;  3EDP A;  1W7P D;  4OIQ F;  3LWF A;  1L3L A;  1HW1 A;  3FZV A;  3K1M A;  1XSX A;  2PBI A;  1K78 B;  2PFB A;  1RUO A;  4UVC A;  4HV6 A;  2P5K A;  3E6C C;  2GIV A;  3WU0 A;  1I6X A;  5LBQ A;  2QBY B;  4KIC A;  2OZU A;  3PFI A;  1QQI A;  3JSO A;  4U0Y A;  5FFZ A;  2K7L A;  2YSR A;  3I0T A;  2DI3 A;  2L54 A;  5DDG A;  4ZH4 F;  2Y48 A;  5E8I A;  4EM1 A;  3M8E A;  1ZRE A;  3RPQ A;  3HSE A;  3OOP A;  1WI9 A;  2A5Y B;  1S8N A;  4RGU A;  2CW0 F;  1O3Q A;  5BOX A;  2JTV A;  4I09 A;  2XAJ A; 
#chains in the Genus database with same CATH topology
 4E70 A;  4DOZ A;  1S72 I;  2RVC A;  5LGU A;  4DYC A;  2MYS A;  2V6C A;  4A5M A;  1NK3 P;  3CCU I;  4XKC A;  5KAI C;  4II2 A;  5IP7 J;  1FC3 A;  3FXM A;  2XUB A;  2R5Y A;  3M07 A;  1HKQ A;  4GRI A;  4F7Z A;  4E7K A;  2JVH A;  2NYX A;  3L2C A;  1FPQ A;  1RET A;  2DAO A;  1LVK A;  4RB1 A;  2AXL A;  2K27 A;  2P0W A;  2DFE A;  2NVT J;  5FKK A;  5L3B A;  4R8H A;  1HKT A;  2QQ8 A;  3IUO A;  4Y3O A;  3LNQ A;  1GLN A;  2M7B A;  1WGX A;  4M9Z A;  5GP9 A;  4JK1 X;  1MBJ A;  3LA7 A;  3KE2 A;  1YO5 C;  1K7A A;  4Y7N J;  2W24 A;  3OSG A;  1BJA A;  2JT1 A;  5GAG J;  3FXR A;  3NEU A;  5E18 F;  3HOY J;  4AC0 A;  4IRH A;  3KLN A;  2KFD A;  2P7V B;  1XMX A;  4CO8 A;  2JA5 J;  3MAJ A;  4XQF A;  2R7V A;  2D2W A;  4A2U A;  1SD5 A;  3CMM A;  3JTH A;  1ZG1 A;  2Z3Y A;  1Y0N A;  2KIF A;  4UXN A;  3ISP A;  2FOK A;  3OYK A;  4PJJ A;  3AG2 H;  2MLG A;  4ZZL A;  1JHH A;  3GTM J;  2J5O A;  1E3P A;  3VYS B;  1U3E M;  4A6E A;  5B66 C;  1UEL B;  2QEX I;  1LVA A;  1Z05 A;  3ZMV A;  3MZH A;  3H1C A;  2KRH A;  3MMY B;  1IXC A;  2A68 F;  1A35 A;  4X1E A;  4EVI A;  2AS5 F;  2BBY A;  1X2N A;  3JR9 A;  3T8R A;  3MEX A;  2H94 A;  4KDP A;  3G71 I;  1PP7 U;  4CCO A;  2X6Y A;  4RGR A;  4LG0 B;  4AD9 A;  1ZK8 A;  1DDN A;  1PDN C;  2BV6 A;  3IC7 A;  1NTC A;  1TL8 A;  1F5T A;  1RC9 A;  3DU5 A;  3V8K A;  4IHS A;  1B9N A;  2DLL A;  1SMY F;  5M3M J;  2Y2Z A;  1TNS A;  4OIR F;  3F8C A;  3CO7 C;  2FA5 A;  2EV0 A;  1OIS A;  4UUT A;  1BM9 A;  2OU2 A;  1QA6 A;  4PFO A;  3TKY A;  4YEJ A;  1TQP A;  2DU9 A;  4HQM A;  2EA4 A;  1G2H A;  4MO7 A;  4M3B A;  2JA8 J;  1G3W A;  1Y0U A;  1FTT A;  1JTX A;  2E1C A;  3S1R J;  1Z1D A;  2IP2 A;  2CU7 A;  2V26 A;  2VT2 A;  4NDL A;  4HEA 2;  5LRR A;  2NAZ A;  3C1D A;  4L9N A;  4NC8 A;  5HLI A;  2BE5 F;  3S15 J;  2JPC A;  1J5Y A;  3SDB A;  3RIR A;  1O7L A;  4A3C J;  3NWT A;  2DOA A;  2CQX A;  2E7W A;  4I98 B;  4L9J A;  3U21 A;  4DGW B;  3C18 A;  2Y9Z A;  2ZFU A;  1Z77 A;  2YX7 A;  2KMU A;  4KT5 C;  2XAQ A;  3BCB A;  2A6H F;  3GLL A;  4EJV A;  5EDN A;  1F9N A;  4ZTJ A;  5C4J J;  1DUX C;  1X1P A;  5TIS C;  2R7R A;  1MJ9 A;  2HQ5 A;  3BQZ A;  2ZSH B;  4Y15 A;  3S16 J;  1NG6 A;  3WGG A;  1LFP A;  2X4H A;  3S32 A;  4HLY A;  3QYE A;  3VYT B;  2R5Z B;  4BUP A;  4BS9 A;  2OTJ I;  4M72 A;  1FJL A;  4BGD A;  4ZTF A;  3JRH A;  3CCQ I;  3OOU A;  5HLT A;  4CH7 A;  1ETY A;  3BJ6 A;  5C3E J;  3CUQ B;  2M4G A;  1YJW I;  1S3J A;  1ULY A;  3OV8 A;  1B8I B;  4L5I A;  2DT5 A;  5D6E A;  5FLV A;  3QYF A;  2WTE A;  3FM5 A;  1YIJ I;  1QNT A;  2ZXJ A;  1GV2 A;  2LRE A;  2FEZ A;  3JRE A;  4FE7 A;  3OIO A;  3WTU C;  4IEJ A;  3HOV J;  4WF2 A;  2VXD A;  4GGG A;  1D1A A;  3B73 A;  1BI2 A;  3HOT A;  1ZRF A;  1GHC A;  4PZJ A;  2GQQ A;  5J47 A;  2Z9O A;  1MKM A;  2WAD A;  2MC4 A;  1U5T A;  5K5O A;  3KPH A;  2FX0 A;  1OR7 A;  1LEB A;  1VQN I;  5CJ9 A;  3RKY A;  3B02 A;  1KU3 A;  1TBX A;  3S3O A;  2VBY A;  4OAZ A;  1UB9 A;  5F04 A;  1QPI A;  2LP0 A;  2EZL A;  3HZJ A;  2EB7 A;  3HRU A;  1F36 A;  5IPA A;  1YQA A;  2BHY A;  2DMU A;  3WTY C;  3P9K A;  1UCR A;  2H1L A;  2K02 A;  4XRS A;  2VOP A;  3ZQG A;  1OLT A;  2HZD A;  5ED4 A;  3K4C A;  4PSX A;  4HZF A;  3ZMU A;  2A07 F;  2LSO A;  2BY2 A;  2W85 A;  3O8H A;  3R6S A;  2LC2 A;  1ETK A;  4XN3 A;  2GXB A;  3CDI A;  1JUM A;  4EMS A;  1XGN A;  2ZME B;  3CJQ B;  1GT0 C;  5J1U A;  2JSC A;  5L3D A;  4ENM A;  2B63 J;  4HG2 A;  1YRN A;  1MNM C;  2ZNZ A;  2YX4 A;  4A69 C;  1IN6 A;  2X0L A;  1SFO J;  4BE1 A;  4MFE A;  1LDJ A;  3TMO A;  1MW7 A;  1RKT A;  1WJD A;  5EEA A;  3L2Q A;  2NVX J;  4J00 A;  3WTS C;  4JBA A;  1SFU A;  2P4W A;  4RLF A;  2EZI A;  3LSK A;  3LAJ A;  5F27 A;  1OPC A;  2LOO A;  1RR8 C;  2Y69 H;  2KLO A;  3CUQ C;  1H0M A;  2OZ6 A;  3NQO A;  2R7W A;  4A3E J;  3EUH A;  2HNH A;  1Y39 A;  5ICC A;  3KYL A;  3ASN H;  2O61 A;  1EKE A;  3ZOB A;  2ZNY A;  3WTV C;  3CF2 A;  1RI7 A;  3OYA A;  4YIF A;  2HR3 A;  3HM5 A;  3L2U A;  1HF0 A;  2E2H J;  2XGX A;  5BS6 A;  1Y1W J;  2DDB A;  3DF8 A;  2Q2E A;  1AA7 A;  2IJL A;  2F2E A;  3BPX A;  3CC7 I;  4MEY F;  5FLX Z;  1QHH D;  1X4O A;  2M0M A;  1D3Y A;  3K2Z A;  4AVP A;  1T39 A;  3PM1 A;  4D7N A;  2F5D A;  1YJN I;  1OJL A;  2XF7 A;  3HBL A;  4W97 A;  5TJJ A;  2YU3 A;  4N0B A;  3W3C A;  4A0Y A;  1I3A A;  5H6Q A;  4RBO A;  1R49 A;  3ZQL A;  4G6D A;  2KIU A;  3GTL J;  3PNT A;  1P4A A;  4XR6 A;  2FUG 2;  5DCM B;  5DD8 A;  2H27 A;  2NS8 A;  4EM2 A;  2L4A A;  3ABL H;  3GFI A;  3R4K A;  3E5Q A;  1GXP A;  2ZFW A;  3PO2 J;  1U0J A;  2KL4 A;  4M3D A;  3I9V 2;  3NAU A;  4PUS A;  3O8G A;  1UZC A;  2W48 A;  3OIP A;  3V42 A;  5J8F A;  1SD6 A;  2KJB A;  4XMY A;  2E2J J;  1G8X A;  4BL0 B;  2VKE A;  3ABM H;  4XRF A;  4N4N B;  4LLG F;  3RPU A;  3F6O A;  3KIO A;  2KIQ A;  3CMA I;  5FGM A;  3I4N J;  2M0C A;  2Y30 A;  2XV4 S;  3G2B A;  1UHS A;  2CUE A;  3OS2 A;  5ICE A;  2HZT A;  3ABU A;  5LFA A;  4Y17 A;  2EIK H;  2VQC A;  1PUF A;  2VJ4 A;  1O7F A;  2D1H A;  2R7F A;  2VKD A;  2PJR B;  2UWM A;  2V4J C;  3S1Q J;  1Z67 A;  1Z3X A;  3WHB A;  1RRJ A;  3PQJ A;  3HPH A;  4C2T A;  2X85 A;  2EZH A;  1YYV A;  1X1B A;  2LF7 A;  2XPV A;  5LEJ A;  4DBR A;  2DMN A;  3ZN0 A;  2JRM A;  3E6D A;  3VDX A;  1HOM A;  4HX8 A;  4CYC A;  1JTY A;  2M45 A;  4M3G A;  5L3F A;  2NVU B;  1RES A;  2A3S A;  3LA3 A;  4HX7 A;  5JLW A;  3IL2 A;  4DBQ A;  3BR5 A;  1ZTR A;  2LLK A;  1P4W A;  2M5W A;  3EPZ A;  3L09 A;  1W5T A;  2CO5 A;  4RGS A;  1WKM A;  3WGH A;  5LD2 C;  4UY8 I;  2L7F P;  3DTK A;  4CZC A;  3D5L A;  3OYM A;  3FM3 A;  1TP4 A;  1VF9 A;  3GEZ A;  1T56 A;  2A61 A;  5JFR A;  1KQ0 A;  2R5Z A;  4LLN A;  2X6O A;  4DQ2 A;  1PUF B;  5KAF C;  3F22 A;  3HOW J;  4KN7 X;  2Q8K A;  4BDZ A;  4IHY A;  3KX2 A;  4D7M A;  6PAX A;  2Z5U A;  5JI6 A;  3WGI A;  2EFQ A;  3LQR A;  5IT9 Z;  2HFH A;  1FBS A;  2L9S A;  3I53 A;  2L3D A;  4C2M J;  3T1B A;  4XK4 A;  3HYI A;  1SVL A;  2COB A;  2Z99 A;  2X6X A;  2DOE A;  1PP8 F;  2O8X A;  1VQ8 I;  3C3W A;  1X2M A;  1K6Y A;  3WTT C;  1MBF A;  4YEL A;  2Z33 A;  5KHD A;  4Y4R A;  3H9G A;  3DWL E;  1D1C A;  4FQG A;  2MGQ A;  4K2E A;  4RS8 A;  3P9I A;  3A4C A;  2FNA A;  2V9V A;  2EK5 A;  3S3N A;  1X19 A;  2FQ4 A;  3HTU A;  2HKX A;  4A3D J;  3F72 A;  2HEO A;  1FMW A;  2O6G E;  3V8J A;  2QSH X;  1A6Q A;  4WX9 A;  1T0F A;  2H6C A;  4S04 A;  1HW2 A;  2M87 A;  1LFU P;  1MMA A;  5C4X J;  2DBB A;  1H8A C;  2YUS A;  3BG5 A;  2E36 A;  4RLQ A;  5DCF A;  5LLQ A;  2B9S A;  4PCQ A;  3DPL C;  3K4N A;  1KGS A;  3OL3 A;  2LTP A;  1S9H A;  3KP7 A;  4FET A;  2IVM A;  1EF4 A;  1BOA A;  4O6J A;  1I50 J;  1S7O A;  5B1A H;  3A01 A;  2E5Z A;  1S7A A;  2GAU A;  3HG9 A;  4XLH A;  5K5Q A;  1MIJ A;  4BNC A;  2RQP A;  3JAM Z;  1FNN A;  1MZB A;  1FIP A;  3QU6 A;  5E1Z B;  5K7H A;  1BW6 A;  2ISY A;  3K10 A;  3LSI A;  4HX4 A;  1MMS A;  4MQV A;  2RKH A;  4B48 A;  1U8B A;  1IUF A;  5IT9 K;  3CCY A;  2DT7 B;  2GWR A;  2IXS A;  1ZR4 A;  5GPA A;  5DEQ A;  5GAD J;  5FKO A;  3VB2 A;  2E71 A;  2ECC A;  3IAS 2;  5FO5 A;  2VBZ A;  3E6M A;  1R1T A;  3KZY A;  4BQO A;  1ZEL A;  3DP7 A;  2IW5 A;  5BQT A;  3M3Y J;  2JJ7 A;  2LNB A;  4I0A A;  4UUS A;  4MGR A;  4ANJ A;  4DZP A;  2FU4 A;  5D8L B;  2OF7 A;  3RYP A;  2R92 J;  1VQ5 I;  2G0E A;  1JJ6 C;  1YFH A;  4UVB A;  2AHQ A;  2CW8 A;  2LF8 A;  4UUV A;  1IRF A;  2MG4 A;  2Y75 A;  4FE4 A;  2P5V A;  2Y0M A;  2D5V A;  4KA4 A;  2BY3 A;  3OYB A;  2XF5 A;  2M34 A;  4L0Z B;  5K7F A;  4DNC A;  3HOU J;  4KFC A;  1IV6 A;  3JSP A;  4C3I J;  3CC4 I;  4CYD A;  3AL0 B;  1Y56 A;  4AIH A;  2LY1 A;  2KPM A;  4NC6 A;  5GPC A;  1RPW A;  3LFK A;  2ZXW H;  3MQ0 A;  3MWM A;  1VND A;  4LJZ F;  3VYR B;  2VB6 A;  1LEA A;  1IRX A;  1ZRC A;  4PGG A;  2IS4 A;  3RPU D;  2FF4 A;  1ZH5 A;  4M6Y A;  2X48 A;  4JQF A;  2VOO A;  3DLL F;  1TWG J;  1SC7 A;  4B47 A;  3R0A A;  3G6E I;  3SEZ A;  5IOY A;  2BGC A;  2DFH A;  2HWV A;  3OIQ A;  3R61 A;  2A69 F;  2EFP A;  2Z2S B;  3JTG A;  3RSN A;  1UHM A;  1KQ9 A;  5HNH A;  1YX3 A;  4P9U A;  1BN5 A;  2R5Y B;  2V6E A;  5KCM A;  5E1W A;  4IKF A;  1AKH B;  1TTY A;  1ODD A;  2QUF A;  1R5H A;  1BIA A;  1W36 C;  4RMN A;  3S8P A;  1REP C;  2VAS A;  4FAS D;  2CFO A;  2F4M B;  3S1M J;  3CUQ A;  1APL C;  2FQ3 A;  2OQR A;  3GWZ A;  1BBY A;  4RDU A;  4BQA A;  3F23 A;  4BXF A;  3M4O J;  3H9Q A;  3PO3 J;  1QU3 A;  1FMV A;  3FX3 A;  4XLF A;  3GTK J;  2P7C B;  2A05 A;  4RM3 A;  1FWZ A;  5AIQ A;  1YHQ I;  3H92 A;  2Q2E B;  1TLH B;  3K1N A;  4QWQ A;  5H2F C;  1KA8 A;  1ZLK A;  3KYC B;  5J6X A;  5GTH C;  1RIO H;  2HDD A;  5DUI A;  2HXO A;  2K4B A;  2DOF A;  2EJR A;  3C2H A;  2QWW A;  2PMH A;  3CCS I;  2RN7 A;  5TGT A;  2F6C A;  1QO0 D;  3H0G J;  2JA7 J;  3KFW X;  4PJM A;  2XRO A;  1W4M A;  3J7Z I;  3RI4 A;  1X1D A;  3TL4 X;  4A3G J;  3SYT A;  2E19 A;  2XAF A;  3W2W A;  1OCR H;  4XLA A;  4ESF A;  2GA2 A;  3EUK L;  3W6K B;  4M6V A;  2IEK A;  4IJA A;  3REO A;  1T95 A;  4G9Y A;  3FMQ A;  1XS9 A;  4LIU A;  1OCZ H;  1IZ1 A;  4FX4 A;  4LMY A;  3I59 B;  4OMY A;  4RAZ A;  3U1D A;  2ZO4 A;  1U5T B;  1Z6T A;  5IP9 J;  4IQJ A;  3A0H C;  2XDV A;  4NQW B;  3KCC A;  1BR2 A;  3F0C A;  5B1B H;  3HOX J;  1BJZ A;  3J81 Z;  3BCA A;  1EH8 A;  1P7J A;  2DTR A;  2RDP A;  3GFM A;  3BY6 A;  4JYK A;  3WHC A;  2O3F A;  2L02 A;  5EYR A;  2HTJ A;  3DXJ F;  3SHF A;  2R0Q C;  4Y52 J;  2P5L C;  3UKG A;  3CTA A;  3JRC A;  1OCC H;  4D5F A;  2DOD A;  1CF7 A;  2N8G A;  1ETV A;  2LDU A;  3TQN A;  3PFY A;  4BBS J;  3LMM A;  3COA C;  2HOE A;  1H9T A;  1D5V A;  4F52 A;  2Q0O A;  1J59 A;  3OYF A;  1BA5 A;  1WCM J;  1MJA A;  2CG4 A;  3HPG A;  4U7D A;  4HW0 A;  1ZAR A;  3FXU A;  3E6B A;  1MH3 A;  3CCR I;  1IV8 A;  5FRN A;  1SAX A;  1IGN A;  2E34 A;  4MQ9 F;  3S2D J;  3F8F A;  1QGP A;  2QA4 I;  3NRV A;  1ETO A;  4HA8 A;  2K40 A;  1NK2 P;  4BE0 A;  4MHG A;  2VBX A;  1FYM A;  4CCJ A;  4LK1 F;  4A3L J;  4I76 A;  3FK7 A;  3CJT B;  1UJ8 A;  2KRC A;  1AU7 A;  1N25 A;  5DD4 A;  4CYC B;  1LNW A;  2LK2 A;  2XRN A;  3C2B A;  5CVV A;  4CSW A;  3OYG A;  2STT A;  3HL2 A;  3DTI A;  3M7G A;  3TBI A;  4RB0 A;  1J09 A;  5EEG A;  1P6R A;  3BJA A;  3DPT A;  2MD5 A;  3CP2 A;  4A0X A;  3LSR A;  3GTG J;  2EIL H;  1B6A A;  3WE3 A;  4KMF A;  4PFP A;  1B72 A;  3GTO J;  3JRF A;  2P8T A;  2LRD A;  3E97 A;  1FLI A;  3W6V A;  5LEK A;  1ZG3 A;  5HDG A;  2CUZ A;  3GBG A;  4CXF A;  2VKH A;  3SJM A;  4PJ0 C;  1BOB A;  2OBP A;  1U8R A;  3EUA A;  4EV0 A;  1HBX G;  4KNY A;  3MFK A;  1R22 A;  1R4M B;  3QOE A;  4KIB A;  4LIV A;  1QVU A;  1DU0 A;  1X1C A;  3K9T A;  1N77 A;  2JA2 A;  2HOS A;  3H35 A;  2JK3 A;  4XKW A;  4RB2 C;  1A04 A;  1ZAO A;  2LKP A;  2K9M A;  1Q1H A;  4KN4 X;  2MH2 A;  4V2F A;  3VSL A;  2WV1 A;  3JW4 A;  2L5Q A;  2W57 A;  4ZYG A;  3EUH C;  2DTZ A;  4XIC A;  4A3M J;  3QPS A;  4U0W A;  4A12 A;  1J9I A;  3QPH A;  2LFB A;  3TW6 A;  2ZXI A;  1FBU A;  2MSY A;  3GLX A;  1HST A;  1YX5 A;  3DBR B;  2X51 A;  3OS1 A;  1G4D A;  1A31 A;  3ERM A;  3BDD A;  5ICG A;  1FZP B;  3PNV A;  3PIO F;  4ZJZ A;  1QRY A;  2XGD A;  2M3A A;  1UHW A;  4FT8 A;  1XSD A;  4XM3 A;  3BOQ A;  3D0S A;  4E7J A;  3VYU B;  4DYQ A;  2PG4 A;  2ZME C;  2Y0S N;  3LST A;  3TOB A;  4AYB N;  3K7A J;  1I5Z A;  4IXA A;  1WH5 A;  3X2Q H;  1FY7 A;  2KZV A;  5J8C A;  1K4T A;  4IOA F;  1A5J A;  1B8I A;  1LDD A;  4L5E A;  5GAE J;  2CQ7 A;  1PJR A;  1XN7 A;  1F43 A;  1QZE A;  3CCM I;  3L9F A;  3L2W A;  1E3H A;  4MFD A;  4BEH B;  3FBI B;  2V79 A;  5CVJ A;  4HLX A;  4XRM A;  3BTL A;  4B43 A;  4ENK A;  1V55 H;  3RKQ A;  1FOW A;  2E1M B;  3NAR A;  4O3M A;  1IN4 A;  2ZB9 A;  4NUB A;  5LGT A;  1PUE E;  2FBI A;  2K3F A;  3GUD A;  2W84 A;  1O3T A;  5AON A;  1IN7 A;  2L7Z A;  3IRQ A;  2IGK A;  3N4M A;  2OTL I;  1YRN B;  2IRF G;  1E0E A;  2PMZ A;  1U5T C;  1LB2 A;  3CO6 C;  3BRO A;  5HS8 A;  3I71 A;  1K83 J;  1YLF A;  5LHG A;  4XLN F;  1XGO A;  5FKN A;  1WJB A;  1L0O C;  3T5X A;  2XIG A;  3O2P E;  4P1W A;  3KP3 A;  1MSF C;  3DLA A;  4OIO F;  1GUU A;  4H4K C;  3ZR8 X;  5HLH A;  3QPT A;  4QSH A;  4UNO A;  3Q5F A;  2R7T A;  3KLO A;  3VPR A;  2KJC A;  3UNG C;  4HF0 A;  4B09 A;  1BL0 A;  1X3W B;  3I56 I;  4BH9 A;  2HU9 A;  1ZHF A;  1OYW A;  1QVT A;  5EG0 A;  3VWB A;  1J7K A;  4XLC A;  3FIS A;  1VQ6 I;  5L3C A;  3DEW A;  1F1Z A;  4RAF A;  3ZP5 A;  1JI8 A;  2L01 A;  1DU6 A;  1G3S A;  4PJN A;  2UZK A;  4LFU A;  4D9J A;  1D1B A;  4F3Q A;  3G4S I;  4HPQ A;  5JLX A;  3PIP F;  3O3K A;  4AWX B;  2DQL A;  2RGV A;  5E3O A;  2JPB A;  4MTD A;  4B1R A;  1SVO A;  5D8K B;  4E7I A;  1IN8 A;  5H20 A;  3E5X A;  3ZGK A;  3K2A A;  4R1H A;  1LE8 B;  1CF7 B;  4HYE A;  2IS2 A;  3RDI A;  3I58 A;  1X4P A;  3DFG A;  3M1E A;  3ROU A;  2WV0 A;  5HS7 A;  2K9S A;  2QM3 A;  3L00 A;  3MCZ A;  4LOC A;  3RKW A;  1D0Z A;  2VC0 A;  4A3I J;  5DUK A;  2PI0 A;  3CDL A;  4L18 B;  2XAG A;  2DPD A;  1X1A A;  1XCB A;  2IPQ X;  1T0F C;  4GCV A;  3FHN A;  1ZRD A;  4LG3 A;  3AG3 H;  3V7S A;  1JKO C;  2Y0S A;  4HRI A;  3DKW A;  4BXX J;  3QU3 A;  2LBF A;  4UB8 C;  5FJ8 J;  4OMZ A;  1WRJ A;  2ETH A;  3V7C A;  4CDG A;  3BG6 A;  2CS3 A;  4E4H A;  1TW2 A;  2GBY A;  2PMU A;  2ZXH A;  2KRF A;  2QCO A;  1RNL A;  5F08 A;  1JT6 A;  3CJN A;  4P96 A;  3WTW C;  1WHU A;  5D5X B;  2MH9 A;  2NNN A;  3M8F A;  2HDC A;  4GDF A;  3LOC A;  2R7U A;  4CIC A;  1TQI A;  5ICF A;  4C30 A;  3TDU C;  1EJ9 A;  4JX4 A;  2MLK A;  2UXX A;  3IRR A;  2R7X A;  4LGW A;  3DEE A;  3GF2 A;  1IRG A;  1WZ2 A;  3UR3 C;  4HDV A;  4EAT A;  1FEX A;  1WJF A;  4H0E A;  1V5F A;  1G6N A;  2BXY A;  3H0D A;  1JE8 A;  4XOT A;  1WPK A;  2IS6 A;  4L5J A;  4ENN A;  1ENH A;  5DTD A;  1XGM A;  1TW3 A;  4M9S A;  3ULQ B;  1GVJ A;  3S17 J;  2JZY A;  1EA3 A;  3A02 A;  3SDG A;  4KJZ A;  2CFX A;  2EH3 A;  2J5P A;  5D6F A;  2RV8 A;  1YW7 A;  1JGG A;  1JT0 A;  3G1L A;  2M4K A;  2VJI A;  4Q48 A;  1D8K A;  2VIX A;  3QYB A;  3BZC A;  1ZG5 A;  5FD5 A;  1R7J A;  2ZJ2 A;  3MZ8 A;  3QOP A;  3K4L A;  1AOY A;  2BOL A;  3VFZ A;  4P9F A;  1IF1 A;  3GXO A;  3FXK A;  4YRV A;  3RCO A;  3D5R C;  5DCM A;  3ZQH A;  2XSJ C;  1FP2 A;  4L0Y B;  3FDY A;  4NQW A;  4E7H A;  4I02 A;  1ORK A;  3LFU A;  5K7Z A;  2CV0 A;  2VC1 A;  2FML A;  4A3B J;  2VXZ A;  4XLP F;  5HLG A;  1O4X A;  1MSE C;  4FHT A;  4B4C A;  2VI6 A;  1HXD A;  4CCL A;  2ID6 A;  2CQQ A;  2ISZ A;  2COM A;  3HRT A;  3A1Y A;  3OWT A;  4OIN F;  1X3Z B;  1B9M A;  2ICW G;  2XPU A;  2Y9Y A;  2K3P A;  3AG4 H;  3WG7 H;  4GO1 A;  1J0R A;  4HDU A;  4I2O A;  3VSK A;  3KEY A;  1VQL I;  2QZ8 A;  4LB5 A;  1HC8 A;  1BR1 A;  1R5G A;  5ILS A;  3QP5 A;  5ERI A;  4XNF A;  4M6X A;  2ELJ A;  4HAM A;  1T98 A;  4HOB A;  3S93 A;  4EM0 B;  2ZJR F;  5CLS A;  4CCN A;  4KIS A;  3K69 A;  4ZDL A;  3KP2 A;  2XRL A;  4IZZ A;  3OYC A;  2FD5 A;  5CKT A;  1AWC A;  4AIK A;  2AXT C;  4XKB A;  3G73 A;  2QKL B;  2VE9 A;  3AG1 H;  1LQ1 A;  2IGM A;  4B8X A;  4U7B A;  3HSR A;  2HYF A;  2JVG A;  4FCY A;  3QP6 A;  1BI0 A;  1C0W A;  4IVN A;  4C2U A;  2QGU A;  2CW7 A;  1ON2 A;  4M71 A;  2EBI A;  2G7H A;  4TV7 A;  4LB6 B;  3K0L A;  1E17 A;  1P7I A;  5L3G A;  4CUG A;  1G3Y A;  1YG2 A;  3HOZ J;  1K61 A;  5LHI A;  3RJP A;  3K1P A;  2FBH A;  3BC8 A;  1RKW A;  4HV5 A;  2L4M A;  4BDY A;  5EEH A;  2O5R A;  1R9T J;  1NH3 A;  1I1G A;  1ZQ3 P;  3J80 K;  3QOD A;  2XB5 A;  4JX5 A;  4OWR B;  4YII A;  1K78 A;  3Q0W A;  2VUM J;  5HOD A;  4IHW A;  1RR7 A;  1XG1 A;  4RGX A;  3OYI A;  1CQT A;  1BI3 A;  3Q0U A;  2WAQ N;  1S7E A;  1UG0 A;  3DEU A;  1RZ4 A;  1FT9 A;  3TO7 A;  2O0Y A;  1B72 B;  2PJP A;  2EPF A;  3GO5 A;  2XVC A;  4BAY A;  2XF6 A;  1MBG A;  1GV5 A;  1YW8 A;  2K5C A;  3W6J B;  2E7X A;  3CMY A;  4X0G A;  3BR3 A;  4UV9 A;  4I01 A;  2NRA C;  3D5S C;  2DA5 A;  3LSJ A;  4ZYH A;  3LL7 A;  1HKS A;  2VKV A;  3EQL F;  4GYI A;  1HDP A;  1SAN A;  2MAB A;  1ZGW A;  2W82 A;  3U9G A;  3MN2 A;  3FXJ A;  4NB5 A;  3ZQI A;  5HDN A;  1SFX A;  5EZG A;  4ZZD A;  1HLV A;  4GFB A;  2X6W A;  3OYN A;  2QSF X;  3BP8 A;  1QBJ A;  3H9J A;  3J81 K;  2ZCW A;  1U78 A;  3K70 C;  3S14 J;  3ZQC A;  3LSG A;  1WQ2 A;  1TWF J;  2NS7 A;  4IHX A;  3CME I;  2DT6 A;  4G94 A;  2W00 A;  1OFC X;  3JRI A;  1BC7 C;  3L7W A;  1W1W E;  3DCF A;  1IXS B;  1GDT A;  2M9H A;  1XMK A;  1PVE A;  1U9N A;  1YS6 A;  2M1B A;  1IXR C;  4L9T A;  3ZCO A;  5GAH J;  1TQM A;  3CDH A;  3CLO A;  1HDD C;  5H6R A;  3GZ5 A;  1U2W A;  3IH2 A;  2R7O A;  3CF5 F;  2QVO A;  4FIS A;  4HF1 A;  3LSM A;  2X9D A;  3CCL I;  3FBN B;  4ZYD A;  1KU7 A;  3H3U A;  4B3A A;  1WSU A;  3S1N J;  1SAU A;  3RZD J;  1U6G A;  2OUM A;  1WI3 A;  2WAE A;  2PEX A;  4RM2 A;  5IYB J;  4EEF G;  4YFK F;  4GXO A;  5GTI C;  3KP5 A;  2NOJ B;  4W1U A;  2JQ7 A;  1K4S A;  5EF6 A;  1WH7 A;  2BXZ A;  2DA4 A;  1T6S A;  2ACJ A;  1XDU A;  2DJN A;  4PGH A;  1Z6R A;  4UHT A;  2YU9 J;  1S29 A;  4CZZ A;  3TGN A;  2ZBK A;  3IKT A;  4F92 B;  3J7A Y;  3K70 D;  2DW4 A;  4G7O F;  3FWE A;  2RRE A;  5JVT A;  4D0P A;  4DZJ A;  5KVR A;  2XKP A;  3E1S A;  5FB2 A;  2V1N A;  4G6Q A;  4YFX F;  3ZMD A;  2FOW A;  2O03 A;  1QZZ A;  4OOI A;  2VJJ A;  4QIW N;  5JVG F;  3Q0V A;  1VQP I;  1V4R A;  3EET A;  5IY5 H;  2DK8 A;  2GOM A;  1AKH A;  3J80 Z;  2QF7 A;  3HIF A;  3M1C A;  1P4X A;  3JAM K;  2QQB A;  2L2O A;  2R4G A;  3I4P A;  3BR1 A;  3I64 A;  2LVS A;  2E1O A;  4L9V A;  4AU7 A;  3I3L A;  1IO2 A;  2CQK A;  2CH0 A;  1OCP A;  1X3U A;  3K4B A;  5CVI A;  4F91 B;  5E1X A;  4A0Z A;  1P9Q C;  3FKI J;  1JKP C;  2HS5 A;  2DXI A;  2CWE A;  4ENJ A;  1WJA A;  2BEO A;  4XOR A;  4KYW A;  5F6F A;  3TO9 A;  2ME0 A;  3GZN B;  3WU1 B;  1FP1 D;  3VEP A;  3MZY A;  2PN6 A;  4XBF A;  4A3K J;  2AO9 A;  2VPL A;  2HVQ A;  4KT6 A;  1ZGA A;  3GW2 A;  4C3H J;  2WY7 Q;  3FXO A;  1H89 C;  2WY8 Q;  4JP0 A;  2WC2 A;  3BT9 A;  3S3M A;  1G3T A;  1BI1 A;  5BMZ A;  2LR8 A;  4XKV A;  4DIQ A;  3OYH A;  1XCV A;  2OQG A;  2L9N A;  2VBW A;  3RYR A;  4BKX A;  2IA0 A;  2DN0 A;  5E17 F;  2HDW A;  1YIO A;  2EWN A;  2XGC A;  4HF2 A;  2ECB A;  3CLQ A;  3LQQ A;  2PMZ N;  2E1N A;  2AQF A;  1MJB A;  5CQG A;  4ZDP A;  2XKO A;  2IAI A;  1W7P B;  3TDZ C;  2CUF A;  3J7Y J;  3BTI A;  3KYD B;  1YS7 A;  3F8N A;  1IDY A;  4CCK A;  2D1V A;  1OYY A;  1W5C C;  2LYC A;  5E8G A;  2ESH A;  4AIJ A;  2DDA A;  2BYV E;  2MFZ A;  3R60 A;  3WU2 C;  1XPX A;  4U0V A;  4V2G A;  1JXS A;  2OV7 A;  1I39 A;  1LJ9 A;  4G7Z F;  4G7H F;  3ECO A;  4BQN A;  2R7D A;  4Q47 A;  4KIF A;  3D1N I;  1HA8 A;  1MDM A;  2VLA A;  1O3R A;  1W0T A;  3DV8 A;  1MMD A;  5J1R A;  3SQN A;  2QEN A;  4IO9 F;  3P5J A;  2GM4 A;  4NNJ A;  2V9P A;  1F4K A;  4EQQ A;  1ETX A;  2JMW A;  2RNJ A;  4UB6 C;  4II3 A;  5K5R A;  3KET A;  4CGZ A;  3Q9V A;  4V19 K;  3P9C A;  2KZG A;  1UFM A;  4U88 A;  5B5E C;  2KT0 A;  1MMG A;  3G1M A;  3LSP A;  2ESN A;  4XL9 A;  1JUP A;  4BJ5 C;  4HNV A;  5IP6 A;  3M9A A;  3V4G A;  2R3S A;  5CPR B;  1SFK A;  1P2F A;  1R5I D;  1Z21 A;  4G8X A;  3QPL A;  4D5C A;  4WK8 F;  1J75 A;  3CZ6 A;  2JUC A;  3FXL A;  2JRT A;  2P6T A;  3WOD F;  5FLM J;  3L2R A;  2CUJ A;  2CQN A;  2B7E A;  2GLO A;  2EQR A;  1BR4 A;  1UG2 A;  2JA6 J;  2R7Z J;  2R93 J;  2O8K A;  4A5N A;  3GCM A;  2IBD A;  1B1B A;  2H6B A;  4BHB A;  1QPM A;  2KDO A;  5EGO A;  2NVY J;  4Z6Y A;  3FHZ A;  3DBL B;  5J1Y A;  2FBK A;  3BQY A;  1SMT A;  2W25 A;  2WB1 N;  2HOA A;  2WAQ A;  4M9X A;  1VQK I;  3PQK A;  2YS9 A;  2ZSI B;  4ITV A;  4ESB A;  5ILU A;  4RAY A;  1R23 A;  1MBH A;  4KIT B;  4I09 A;  5E79 C;  2XHK A;  3H36 A;  3DU6 A;  3F8M A;  3BTC A;  2M7A A;  4M73 A;  2VQH A;  3HUG A;  1YIT I;  5FRM A;  1N75 A;  2XAS A;  4WXD A;  5CVR A;  3LAP A;  5JHU A;  2MD0 A;  2AQE A;  5L3E A;  2E2I J;  2P6S A;  1JGS A;  2A6T A;  2MW8 A;  1TNT A;  1ZYR F;  3IKV A;  1IUY A;  2TDX A;  1KQ8 A;  2HPI A;  2LG4 A;  2GXG A;  4XID A;  2DA6 A;  5LRS A;  3A01 B;  3K4J A;  3BG9 A;  2EIJ H;  2I10 A;  2OJE D;  2Q1Z B;  5HS9 A;  4J19 A;  3ML6 A;  4I7H A;  1FIA A;  3ZXS A;  5HOO A;  3IWZ A;  1YW9 A;  5F0F A;  2X1C A;  3GVA A;  3MKZ A;  3H5N A;  2HQN A;  4HST A;  2LBF B;  4RA2 A;  3RQ4 A;  2B0L A;  1UMQ A;  1Z7L A;  2ELK A;  2GZW A;  2K4J A;  2YPR A;  3TP3 A;  4XRS G;  3ZMZ A;  2DFI A;  2K85 A;  1T2K A;  5IYC J;  3ECH A;  3EYI A;  4E7Z A;  4MTE A;  4RB3 C;  1W0U A;  2OA4 A;  1AHD P;  1IRZ A;  2EZK A;  3HRS A;  3KZZ A;  1OYI A;  1CGP A;  2VT3 A;  2L9R A;  3QAH A;  4B44 A;  4N9H A;  1M1E B;  3RQI A;  3T8T A;  3ABT A;  4E7S A;  2X1D A;  2OD5 A;  3CD6 I;  2XB0 X;  3PNY A;  3OYJ A;  2KIM A;  3GFL A;  1S5L C;  1B4A A;  1MGT A;  4ZYA A;  3RTR A;  2DYR H;  1WWX A;  3GTP J;  2DA3 A;  1DPU A;  2HQA A;  1VZ0 A;  5BPI A;  1V3F A;  2M8G X;  1VFC A;  2A6E F;  1WVR A;  3CJR B;  4JX6 A;  3HHH A;  5CYV A;  5DYM A;  4Q5S F;  2CV1 A;  4EJW A;  4GYG A;  3DKX A;  3N05 A;  4EGZ A;  4CHU A;  2V9K A;  2CV2 A;  2OAZ A;  1K79 A;  4U87 A;  4BQQ A;  2G7U A;  1S6L A;  3GTJ J;  2UXN A;  2HYG D;  2HYJ A;  5FLX K;  2HQR A;  4BE2 A;  3HSF A;  4G12 A;  4OAY A;  2HGC A;  4AYB A;  5HVQ C;  2W7N A;  1IJW C;  4MEX F;  3K6G A;  2CRG A;  3FK6 A;  3TW7 A;  1N78 A;  4E6K G;  3ZPL A;  2A5W A;  2F4I A;  4R79 A;  3TO6 A;  2M30 A;  1HCR A;  2EA2 A;  1K6O A;  3S2W A;  2IGO A;  3BR0 A;  4XSZ F;  3P7N A;  5CVU A;  4QPQ A;  2R7S A;  2HVR A;  4LG0 A;  1ZLJ A;  2F5V A;  3WTX C;  2DK5 A;  3Q3S A;  2RAE A;  1TT5 B;  3DTE A;  4OU0 A;  4WWC A;  1KON A;  3QQA A;  1BC8 C;  5JHF A;  1IN5 A;  2FMY A;  3H3V K;  1I1S A;  2BHZ A;  2F5E A;  3KEO A;  2VPR A;  1H9G A;  1Z9C A;  3OMY A;  2L7M P;  1KU9 A;  2GA1 A;  1TT0 A;  3B6A A;  4ETS A;  3HRM A;  3WE2 A;  3HTS B;  1XX5 A;  2E60 A;  4FX0 A;  3HKZ A;  2CJJ A;  2FXA A;  1SVM A;  5FD6 A;  3E3V A;  5D5W B;  3BG3 A;  1E2X A;  4KIG A;  5J40 A;  4HBL A;  2VQL A;  1UST A;  4NHJ A;  3I4M J;  1IW7 F;  2YR2 A;  3AL0 C;  5HNF A;  3W2V A;  4I6Z A;  4RAG A;  3OYD A;  1JJ8 C;  1EH6 A;  2KQR A;  4QLC U;  1Z7U A;  3HB9 A;  3KZI C;  3ZMS A;  1NHA A;  3I54 A;  2BZT A;  4AID A;  3GYH X;  3E7L A;  4AVZ A;  3IWF A;  3GFJ A;  2KIS A;  4YIR X;  1USS A;  4ABZ A;  4P5O A;  1LPQ A;  4BY7 J;  1VTN C;  1H88 C;  3OL4 A;  2DCE A;  5M5Y J;  5CQE A;  2WA0 A;  3HC7 A;  3PUB A;  3A2K A;  3CUO A;  2BY1 A;  3BJO A;  1R1V A;  4MLO A;  1EV7 A;  4BJT A;  1W7P A;  4BBR J;  3PUF A;  3TED A;  2DA2 A;  4BU2 A;  3CCJ I;  4XON A;  2BVM A;  3SFZ A;  3FMR A;  1FSH A;  5J3L A;  3ZQF A;  1YE9 A;  1JHF A;  1W5S A;  4WXC A;  5BPD A;  1OR7 C;  2F5C A;  1Z91 A;  2TCT A;  1KYW A;  5F0H A;  3SXY A;  5D5U B;  1V5E A;  4UV8 A;  3IV5 A;  5AIP A;  1ZKG A;  1LE8 A;  2DMT A;  3F3X A;  1EH7 A;  1D0X A;  5ILV A;  1HSJ A;  1MMN A;  2UUZ A;  1IDZ A;  3HJE A;  1GVD A;  2LD5 A;  4IRG A;  2DYS H;  4BJ6 C;  2P81 A;  3E0J B;  3BLY A;  4LK0 F;  4UUS B;  5LGN A;  1DP7 P;  1FYK A;  1SFE A;  4D1Q A;  4OIP F;  3DBH B;  3L2V A;  2I8D A;  3VOD A;  2BVL A;  3KP6 A;  4X6A J;  5A2Q Z;  3JRA A;  5FFX A;  4M3E A;  2DMP A;  3GX4 X;  2EIN H;  2LY2 A;  4ZYE A;  2QKM B;  5D4R A;  4HNT A;  2EIM H;  2IA2 A;  1OKR A;  1E3O C;  3F6V A;  1RUN A;  2EV6 A;  2ME6 A;  2CYY A;  4ASN A;  1FBQ A;  3BR6 A;  1VQM I;  3A0B C;  2L9V A;  3DQV C;  1R6R A;  4A6D A;  2DMQ A;  1P92 A;  2HKO A;  2V1D A;  3DPU A;  1MDM B;  2MBF A;  1D5Y A;  2NVQ J;  2JN6 A;  4WXH A;  1GXQ A;  1JUS A;  2MC3 A;  1HQC A;  2XGE A;  3HHG A;  5M3F J;  2H8W A;  4J01 A;  4CCM A;  3HUG B;  5E3L A;  3H5R A;  4N9I A;  5FRO A;  2G9W A;  2VN2 A;  3M8J A;  1MND A;  3GZ6 A;  2OC6 A;  4IL6 C;  1Y8R B;  3MKY B;  3MVP A;  4IX7 A;  1WJE A;  1UAA A;  5E3M A;  4PDK A;  2E35 A;  2KKO A;  1MBE A;  2D45 A;  2ZKZ A;  4YFN F;  3OYL A;  2V7F A;  3ZQ7 A;  4M3F A;  1ETQ A;  1WJ5 A;  4M74 A;  4IHT A;  2VL8 A;  2O7O A;  2LH9 A;  1YJ9 I;  1JKR C;  1T38 A;  3ELK A;  2ADU A;  3K4M A;  4DYR A;  1X58 A;  3O6B B;  3ABK H;  3SFI A;  4EJU A;  1KU2 A;  4DJA A;  2WAF A;  2ZC2 A;  2XAH A;  5E20 A;  1OCO H;  4XN0 A;  2HI3 A;  2QYO A;  3FMS A;  3WTZ A;  3ZN1 A;  3V8L A;  5IT3 A;  1ZN2 A;  4C3J J;  3HOS A;  4XSX F;  4BHC A;  1ZR2 A;  1DPR A;  2WB1 A;  1MD0 A;  2DPU A;  4A3J J;  3OYE A;  1QHG A;  2FJ1 A;  2BW3 B;  2WWY A;  5EGO B;  1OCT C;  1STZ A;  3S2H J;  5F1J A;  1HW5 A;  5C44 J;  3QRF F;  4BYY A;  4DW6 A;  1QZY A;  1SD4 A;  2ZJP F;  2ID3 A;  2VE8 A;  2H8R A;  2K86 A;  3JRD A;  3OY9 A;  2VON A;  1ETW A;  1SD7 A;  3GME A;  3IAM 2;  2Z16 A;  2STW A;  4EJO A;  2W4S A;  4WCG A;  2QQA A;  1OQY A;  2NS0 A;  1SEU A;  5TRD A;  1LFB A;  3JRB A;  5DM7 F;  2IA1 A;  2H09 A;  2QQ9 A;  4HQE A;  1ERD A;  4UVA A;  5KK1 A;  1I6H J;  3ESW B;  2VOD A;  3BZK A;  4KMU X;  2C6Y A;  2V1X A;  1FOK A;  2GXA A;  5FKM A;  3PL8 A;  1R00 A;  1ACI A;  1D8J A;  3PSI A;  1XGS A;  3E5U A;  5DM6 F;  1T08 B;  3K4K A;  3I55 I;  3BWG A;  2H1K A;  1XTA A;  2CMP A;  5E3N A;  1WFX A;  3CES A;  2VJ5 A;  4B3X A;  1ITY A;  1YOV B;  5EZH A;  4ON0 A;  2K9L A;  1J2X A;  1XSV A;  1Y1V J;  1T8I A;  4ZC3 A;  5KNL A;  4IRI A;  3LA2 A;  1VQ9 I;  4JOM A;  1TC3 C;  3LSH A;  1TWC J;  3F21 A;  3VOE A;  1OMI A;  2CGP A;  2FSW A;  2JSP A;  1O3S A;  1WJC A;  3FF5 A;  4S05 A;  2IGN A;  1R1U A;  2OPT A;  9ANT A;  3GTQ J;  4P55 A;  4Z2Y A;  1V54 H;  3HEF A;  5F0C A;  1ONV A;  3RKX A;  2DO7 A;  1R71 A;  1BIB A;  2PJR A;  2K9Q A;  3EYY A;  3T0Y A;  1FOX A;  5M5X J;  3CCV I;  3R0J A;  2DJI A;  1YI2 I;  2M2E A;  1FSE A;  1Y8Q B;  1TZL A;  2F48 A;  1DGR M;  4BEH A;  3ERE D;  4F55 A;  3A03 A;  3WG9 A;  4KUM A;  4EJT A;  1XD7 A;  5DV5 A;  5BNG A;  2KHM A;  1POG A;  3SEQ A;  1LUJ B;  3FIW A;  3KP4 A;  2KDZ A;  2EFN A;  2HTS A;  3TOA A;  1XMA A;  2ELH A;  2WBM A;  3MKL A;  3KEQ A;  3QWL A;  1R36 A;  3I5U A;  2W1O A;  4IOC F;  3SZG A;  3ZRG A;  3Q9S A;  4Y33 A;  2FNP A;  3IHU A;  1DP3 A;  3BTJ A;  2M8E A;  1FTZ A;  5LHH A;  3IH3 A;  2DA7 A;  4QPO A;  3BZ6 A;  2L7K A;  2O9L A;  2EFO A;  4LLL A;  4ZDO A;  1I3Q J;  2F4O B;  3FXQ A;  2E1M C;  5HDK A;  3CQZ J;  1MBK A;  1NG7 A;  3I59 A;  4MNU A;  2K9N A;  3OS0 A;  1LDK B;  3H5A A;  2FRH A;  3AAF A;  4PK4 A;  3V7R A;  1YTY A;  2HPM A;  5EG0 B;  5J4Y A;  4XLE A;  1G59 A;  1TWA J;  2GOX B;  2DA1 A;  4IPA A;  2LKX A;  1A36 A;  1A6I A;  2CSO A;  4I0B A;  4E7L A;  2OCC H;  2ZME A;  2EV5 A;  1IG7 A;  1IAW A;  5JR3 A;  4S0H B;  4BAC A;  1XDS A;  3C2G A;  4LIT A;  3CCE I;  1ON1 A;  1R58 A;  3U2R A;  3BR2 A;  3N97 A;  2Y31 A;  1ZGJ A;  1XB4 A;  1KYZ A;  4F93 B;  3AKZ A;  2XSD C;  4O5V A;  5F64 A;  1MH4 A;  3PSF A;  3OR2 C;  4EGY A;  2EFW A;  1KZH A;  2NOG A;  4BY1 J;  3OSF A;  2PLY A;  2F5F A;  4HSR A;  2RC4 A;  2PQ8 A;  5D5V B;  2XC7 A;  4PSW A;  4IHV A;  3L1P A;  2L0K A;  2V1U A;  2HVS A;  3MD2 A;  5J4V A;  2QBY A;  1W36 D;  3H3Z A;  3BPV A;  3JRG A;  1FX7 A;  3U1K A;  2IS1 A;  3NWS A;  3IP4 B;  2IT0 A;  4N4O B;  2FE3 A;  3RZO J;  4IQ4 A;  4ESJ A;  2MA3 A;  3SZP A;  3J7A O;  3F8B A;  4Y13 A;  1BW5 A;  2HXI A;  1FOY A;  2QLZ A;  2QSG X;  1PYV A;  3SZT A;  1B59 A;  1LKX A;  3C7J A;  1V5G A;  3G3Z A;  1Y6I A;  5IYD J;  1Q1V A;  3JCU C;  2I5U A;  4XOP A;  4YG2 F;  4LD5 A;  3PJR A;  3ZMT A;  4PJL A;  5A2Q K;  3OR1 C;  4AUX A;  1O57 A;  5D4S A;  4HNU A;  1I27 A;  1TWH J;  2PX9 A;  2NNY A;  4Q4Z F;  2BW3 A;  4BXU A;  4IF4 A;  3IH4 A;  3ONQ A;  2TRT A;  5F1R A;  3G1O A;  5K1Y A;  2JWT A;  2DQR A;  4BHP A;  3EDP A;  1FYL A;  4FTH A;  1VQO I;  4CA0 A;  1W7P D;  4OIQ F;  3TP0 A;  4G6T B;  4C9Y A;  5IOZ A;  4A3F J;  1T33 A;  2LKS A;  3LWF A;  3CC2 I;  1L3L A;  1HW1 A;  2NXN B;  3FZV A;  3HGG A;  2R7Q A;  3HGY A;  3K1M A;  2X1E A;  2HOT A;  2E5N A;  1XSX A;  2XPW A;  4NC7 A;  2PBI A;  2DFF A;  4NBQ A;  2ZJQ F;  1K78 B;  2PFB A;  1MNE A;  3HKZ N;  1RUO A;  2OCE A;  3DKY A;  4HV6 A;  4UVC A;  5DS9 A;  2XAU A;  2VQG A;  2P5K A;  3MKW B;  3FKJ A;  3E6C C;  2GIV A;  3WU0 A;  1I6X A;  3B6C A;  5LBQ A;  3HXL A;  2LMD A;  1Z3Y A;  2KP6 A;  4KIC A;  2QBY B;  2OZU A;  1VQ4 I;  3PFI A;  5EJC A;  3F9K A;  1QQI A;  2UV1 A;  2RQQ A;  1DGW Y;  3JSO A;  5M5W J;  5B3S H;  1XC5 A;  4U0Y A;  3BG7 A;  5FFZ A;  2JUG A;  2BY0 A;  2K7L A;  4I99 C;  1JKQ C;  1VI0 A;  2YSR A;  3I0T A;  2DI3 A;  2L54 A;  3ZQQ A;  5DDG A;  2GIZ A;  4ZH4 F;  2Y48 A;  5E8I A;  1D0Y A;  4EM1 A;  3M8E A;  2LY9 A;  1IC8 A;  3RPQ A;  1ZRE A;  4MIM A;  2Z1D A;  1Z0X A;  1U9O A;  3HSE A;  3OOP A;  1DQU A;  2RNG A;  5FKL A;  3HDD A;  1WI9 A;  3CP8 A;  2A5Y B;  4QTR A;  3W2A A;  1S8N A;  4RGU A;  4AM3 A;  2CW0 F;  1O3Q A;  1VQ7 I;  1R4N B;  2JTV A;  3AFH A;  5BOX A;  2XAJ A;  4A93 J;  3ASO H; 
#chains in the Genus database with same CATH homology
 4E70 A;  2RVC A;  5LGU A;  2V6C A;  4A5M A;  1FC3 A;  2XUB A;  1HKQ A;  4F7Z A;  2NYX A;  3L2C A;  1FPQ A;  2DAO A;  4RB1 A;  2AXL A;  2K27 A;  5L3B A;  4R8H A;  1HKT A;  4M9Z A;  4JK1 X;  3LA7 A;  3KE2 A;  1YO5 C;  1K7A A;  2W24 A;  1BJA A;  2JT1 A;  3FXR A;  3NEU A;  5E18 F;  4IRH A;  3KLN A;  2P7V B;  4CO8 A;  3MAJ A;  2D2W A;  4A2U A;  1SD5 A;  3JTH A;  1ZG1 A;  2Z3Y A;  2KIF A;  4UXN A;  3ISP A;  2FOK A;  2MLG A;  4ZZL A;  1JHH A;  2J5O A;  1U3E M;  4A6E A;  1LVA A;  1Z05 A;  3ZMV A;  3MZH A;  1IXC A;  2A68 F;  2AS5 F;  4EVI A;  2BBY A;  3T8R A;  3MEX A;  2H94 A;  4KDP A;  1PP7 U;  4RGR A;  4LG0 B;  4AD9 A;  1DDN A;  1PDN C;  2BV6 A;  3IC7 A;  1F5T A;  3V8K A;  4IHS A;  1B9N A;  2DLL A;  1SMY F;  1TNS A;  4OIR F;  3F8C A;  3CO7 C;  2FA5 A;  2EV0 A;  1BM9 A;  2OU2 A;  3TKY A;  1TQP A;  2DU9 A;  4HQM A;  2EA4 A;  1G3W A;  1Y0U A;  2E1C A;  1Z1D A;  2IP2 A;  2VT2 A;  5LRR A;  2NAZ A;  3C1D A;  4L9N A;  5HLI A;  2BE5 F;  2JPC A;  1J5Y A;  3RIR A;  1O7L A;  2E7W A;  4I98 B;  4L9J A;  3C18 A;  2YX7 A;  4KT5 C;  2XAQ A;  2A6H F;  4EJV A;  1F9N A;  1DUX C;  1MJ9 A;  4Y15 A;  3WGG A;  2X4H A;  4HLY A;  4M72 A;  3BJ6 A;  3CUQ B;  1S3J A;  1ULY A;  3OV8 A;  4L5I A;  2DT5 A;  5D6E A;  2WTE A;  3FM5 A;  1QNT A;  2ZXJ A;  2FEZ A;  3WTU C;  4WF2 A;  4GGG A;  3B73 A;  1BI2 A;  3HOT A;  1ZRF A;  1GHC A;  4PZJ A;  2GQQ A;  2Z9O A;  1MKM A;  1U5T A;  5K5O A;  1OR7 A;  1LEB A;  5CJ9 A;  3RKY A;  3B02 A;  1KU3 A;  1TBX A;  2VBY A;  1UB9 A;  2EB7 A;  3HRU A;  1YQA A;  3WTY C;  3P9K A;  1UCR A;  2K02 A;  2VOP A;  5ED4 A;  3ZMU A;  4HZF A;  2A07 F;  2LSO A;  2W85 A;  3R6S A;  2GXB A;  4EMS A;  1XGN A;  2ZME B;  2JSC A;  5L3D A;  4ENM A;  2ZNZ A;  2YX4 A;  1IN6 A;  2X0L A;  1LDJ A;  3WTS C;  4JBA A;  1SFU A;  2P4W A;  3LAJ A;  1OPC A;  3CUQ C;  1H0M A;  2OZ6 A;  3NQO A;  3EUH A;  5ICC A;  2O61 A;  2ZNY A;  3WTV C;  1RI7 A;  4YIF A;  2HR3 A;  2XGX A;  5BS6 A;  3DF8 A;  2Q2E A;  2IJL A;  2F2E A;  3BPX A;  4MEY F;  5FLX Z;  1D3Y A;  3K2Z A;  4AVP A;  1T39 A;  2F5D A;  5TJJ A;  2YU3 A;  4N0B A;  4A0Y A;  5H6Q A;  4G6D A;  2KIU A;  1P4A A;  5DCM B;  5DD8 A;  2H27 A;  4EM2 A;  2L4A A;  3GFI A;  3R4K A;  3E5Q A;  1GXP A;  2ZFW A;  5J8F A;  1SD6 A;  2KJB A;  4XRF A;  4LLG F;  3RPU A;  3F6O A;  5FGM A;  2XV4 S;  5ICE A;  2HZT A;  3ABU A;  4Y17 A;  1O7F A;  2D1H A;  2R7F A;  2UWM A;  3PQJ A;  1YYV A;  2LF7 A;  5LEJ A;  3ZN0 A;  3E6D A;  4HX8 A;  2M45 A;  5L3F A;  4HX7 A;  2A3S A;  3LA3 A;  3IL2 A;  1P4W A;  2M5W A;  3L09 A;  1W5T A;  2CO5 A;  4RGS A;  1WKM A;  3WGH A;  3D5L A;  3FM3 A;  3GEZ A;  2A61 A;  5JFR A;  1KQ0 A;  4LLN A;  4DQ2 A;  3F22 A;  4KN7 X;  2Q8K A;  6PAX A;  2Z5U A;  5JI6 A;  3WGI A;  2EFQ A;  3LQR A;  5IT9 Z;  2HFH A;  1FBS A;  3I53 A;  2L3D A;  3T1B A;  3HYI A;  2Z99 A;  1PP8 F;  2O8X A;  3C3W A;  3WTT C;  2Z33 A;  4K2E A;  4RS8 A;  3P9I A;  2FNA A;  2V9V A;  2EK5 A;  3HTU A;  2HKX A;  3F72 A;  2HEO A;  2O6G E;  3V8J A;  4WX9 A;  1T0F A;  2H6C A;  4S04 A;  1HW2 A;  2M87 A;  2DBB A;  5DCF A;  5LLQ A;  4PCQ A;  3DPL C;  1KGS A;  3KP7 A;  2IVM A;  1BOA A;  4O6J A;  1S7O A;  1S7A A;  2GAU A;  5K5Q A;  4BNC A;  2RQP A;  3JAM Z;  1FNN A;  1MZB A;  3QU6 A;  5E1Z B;  2ISY A;  4HX4 A;  4MQV A;  2RKH A;  5IT9 K;  2GWR A;  5DEQ A;  3VB2 A;  5FO5 A;  2VBZ A;  3E6M A;  1R1T A;  3KZY A;  3DP7 A;  2IW5 A;  5BQT A;  2LNB A;  4I0A A;  4MGR A;  2FU4 A;  5D8L B;  3RYP A;  1YFH A;  4UVB A;  2LF8 A;  4UUV A;  1IRF A;  2Y75 A;  2P5V A;  2Y0M A;  4KA4 A;  4L0Z B;  4DNC A;  4KFC A;  3JSP A;  4CYD A;  4AIH A;  3LFK A;  3MQ0 A;  3MWM A;  4LJZ F;  1LEA A;  1ZRC A;  4PGG A;  2FF4 A;  1ZH5 A;  4M6Y A;  4JQF A;  2VOO A;  3R0A A;  2BGC A;  2HWV A;  3R61 A;  2A69 F;  2EFP A;  3JTG A;  1UHM A;  1KQ9 A;  4P9U A;  1BN5 A;  5E1W A;  1TTY A;  1ODD A;  2QUF A;  1R5H A;  1BIA A;  1REP C;  3CUQ A;  2FQ3 A;  2OQR A;  3GWZ A;  1BBY A;  4BQA A;  3F23 A;  3FX3 A;  2P7C B;  1FWZ A;  5AIQ A;  3H92 A;  1TLH B;  3K1N A;  4QWQ A;  1KA8 A;  1ZLK A;  5J6X A;  1RIO H;  5DUI A;  2K4B A;  2EJR A;  2QWW A;  2PMH A;  2RN7 A;  1QO0 D;  3KFW X;  2XRO A;  1W4M A;  3RI4 A;  2XAF A;  4ESF A;  2GA2 A;  3W6K B;  4IJA A;  3REO A;  4G9Y A;  3FMQ A;  4FX4 A;  1IZ1 A;  4LMY A;  3I59 B;  4OMY A;  4RAZ A;  3U1D A;  2ZO4 A;  1U5T B;  1Z6T A;  3KCC A;  3J81 Z;  1EH8 A;  2RDP A;  2DTR A;  3BY6 A;  3GFM A;  2O3F A;  2L02 A;  2HTJ A;  3DXJ F;  3SHF A;  2P5L C;  3CTA A;  1CF7 A;  2LDU A;  3TQN A;  3COA C;  2HOE A;  1H9T A;  1D5V A;  2Q0O A;  1J59 A;  1MJA A;  2CG4 A;  4U7D A;  4HW0 A;  1ZAR A;  3FXU A;  3E6B A;  1SAX A;  4MQ9 F;  3F8F A;  1QGP A;  3NRV A;  4HA8 A;  4MHG A;  2VBX A;  1FYM A;  4LK1 F;  5DD4 A;  1LNW A;  2XRN A;  5CVV A;  2STT A;  3M7G A;  4RB0 A;  5EEG A;  1P6R A;  3BJA A;  3DPT A;  2MD5 A;  4A0X A;  1B6A A;  3WE3 A;  4KMF A;  2P8T A;  3E97 A;  1FLI A;  5LEK A;  1ZG3 A;  5HDG A;  4CXF A;  2OBP A;  1U8R A;  4EV0 A;  1HBX G;  4KNY A;  3MFK A;  1R22 A;  4KIB A;  3K9T A;  4RB2 C;  1A04 A;  1ZAO A;  2LKP A;  1Q1H A;  4KN4 X;  2MH2 A;  3JW4 A;  2W57 A;  4ZYG A;  4U0W A;  4A12 A;  1J9I A;  3QPH A;  1FBU A;  1HST A;  3GLX A;  1G4D A;  3BDD A;  5ICG A;  1FZP B;  1UHW A;  4FT8 A;  1XSD A;  3BOQ A;  3D0S A;  2PG4 A;  3LST A;  3TOB A;  1I5Z A;  4IXA A;  1FY7 A;  5J8C A;  1LDD A;  1XN7 A;  3L9F A;  2V79 A;  5CVJ A;  4HLX A;  4ENK A;  4O3M A;  1IN4 A;  5LGT A;  1PUE E;  2FBI A;  3GUD A;  2W84 A;  1O3T A;  5AON A;  1IN7 A;  3IRQ A;  3N4M A;  2IRF G;  1U5T C;  1LB2 A;  3CO6 C;  3BRO A;  5HS8 A;  3I71 A;  1YLF A;  5LHG A;  4XLN F;  1XGO A;  1L0O C;  3T5X A;  2XIG A;  3O2P E;  3KP3 A;  4OIO F;  5HLH A;  3QPT A;  4UNO A;  3Q5F A;  3KLO A;  2KJC A;  4HF0 A;  4B09 A;  4BH9 A;  1ZHF A;  1OYW A;  1J7K A;  5L3C A;  1F1Z A;  3ZP5 A;  2L01 A;  1G3S A;  2UZK A;  4LFU A;  3O3K A;  4AWX B;  2DQL A;  2RGV A;  2JPB A;  4MTD A;  5D8K B;  1IN8 A;  5H20 A;  3E5X A;  4R1H A;  1CF7 B;  4HYE A;  3RDI A;  3I58 A;  3DFG A;  3M1E A;  3ROU A;  2WV0 A;  5HS7 A;  2QM3 A;  3L00 A;  3MCZ A;  3RKW A;  2VC0 A;  5DUK A;  2PI0 A;  4L18 B;  2XAG A;  2DPD A;  1XCB A;  2IPQ X;  4GCV A;  1ZRD A;  3V7S A;  3DKW A;  3QU3 A;  4OMZ A;  1WRJ A;  2ETH A;  3V7C A;  4CDG A;  1TW2 A;  2PMU A;  2KRF A;  1RNL A;  3CJN A;  4P96 A;  3WTW C;  5D5X B;  2MH9 A;  2NNN A;  3M8F A;  2HDC A;  4CIC A;  1TQI A;  5ICF A;  3TDU C;  2MLK A;  2UXX A;  3IRR A;  4LGW A;  3GF2 A;  1IRG A;  4HDV A;  4H0E A;  1G6N A;  1JE8 A;  4L5J A;  4ENN A;  1XGM A;  1TW3 A;  4M9S A;  3ULQ B;  1GVJ A;  2JZY A;  2CFX A;  2J5P A;  5D6F A;  2RV8 A;  1YW7 A;  4Q48 A;  1D8K A;  1ZG5 A;  5FD5 A;  1R7J A;  2ZJ2 A;  3QOP A;  1AOY A;  3VFZ A;  4P9F A;  1IF1 A;  3GXO A;  5DCM A;  1FP2 A;  4L0Y B;  4NQW A;  4I02 A;  2VC1 A;  2FML A;  4XLP F;  2VXZ A;  5HLG A;  4FHT A;  1HXD A;  2ISZ A;  2COM A;  3HRT A;  4OIN F;  1B9M A;  4GO1 A;  1J0R A;  4HDU A;  4I2O A;  2QZ8 A;  4LB5 A;  1R5G A;  5ILS A;  3QP5 A;  5ERI A;  4M6X A;  4HAM A;  1T98 A;  4HOB A;  4EM0 B;  5CLS A;  3K69 A;  3KP2 A;  1AWC A;  4AIK A;  3G73 A;  2VE9 A;  1LQ1 A;  4B8X A;  4U7B A;  3HSR A;  2HYF A;  3QP6 A;  1BI0 A;  1C0W A;  4IVN A;  1ON2 A;  4M71 A;  2G7H A;  4TV7 A;  4LB6 B;  3K0L A;  1E17 A;  5L3G A;  1G3Y A;  1YG2 A;  5LHI A;  3RJP A;  3K1P A;  2FBH A;  4HV5 A;  2L4M A;  5EEH A;  1I1G A;  3J80 K;  4YII A;  1K78 A;  4RGX A;  1BI3 A;  3DEU A;  1RZ4 A;  1FT9 A;  3TO7 A;  2O0Y A;  2PJP A;  3GO5 A;  2XVC A;  4BAY A;  3W6J B;  1YW8 A;  2E7X A;  4UV9 A;  4I01 A;  2NRA C;  4ZYH A;  1HKS A;  3EQL F;  4GYI A;  3U9G A;  4NB5 A;  5HDN A;  1SFX A;  4ZZD A;  3BP8 A;  1QBJ A;  3J81 K;  2ZCW A;  1U78 A;  1WQ2 A;  4G94 A;  1BC7 C;  3L7W A;  1IXS B;  1XMK A;  1YS6 A;  2M1B A;  4L9T A;  1IXR C;  1TQM A;  3CDH A;  3CLO A;  5H6R A;  3GZ5 A;  1U2W A;  2QVO A;  4HF1 A;  1KU7 A;  4ZYD A;  3H3U A;  1WSU A;  1U6G A;  2PEX A;  4YFK F;  4GXO A;  3KP5 A;  2ACJ A;  1T6S A;  1XDU A;  4PGH A;  1Z6R A;  4UHT A;  1S29 A;  4CZZ A;  3TGN A;  2ZBK A;  3IKT A;  2DW4 A;  4G7O F;  3FWE A;  5JVT A;  4D0P A;  5KVR A;  2XKP A;  5FB2 A;  4G6Q A;  4YFX F;  3ZMD A;  2O03 A;  1QZZ A;  4OOI A;  1V4R A;  3EET A;  2DK8 A;  3J80 Z;  3HIF A;  1P4X A;  3JAM K;  2QQB A;  3I4P A;  3I64 A;  4L9V A;  2CQK A;  1X3U A;  5CVI A;  5E1X A;  4A0Z A;  2HS5 A;  2CWE A;  4ENJ A;  2BEO A;  4KYW A;  5F6F A;  3TO9 A;  3WU1 B;  1FP1 D;  3VEP A;  3MZY A;  2PN6 A;  4XBF A;  1ZGA A;  3GW2 A;  2WC2 A;  1G3T A;  1BI1 A;  5BMZ A;  1XCV A;  2OQG A;  3RYR A;  2VBW A;  2IA0 A;  5E17 F;  1YIO A;  2EWN A;  4HF2 A;  3LQQ A;  2E1N A;  1MJB A;  2XKO A;  1W7P B;  3TDZ C;  1YS7 A;  3F8N A;  2D1V A;  1OYY A;  5E8G A;  2ESH A;  4AIJ A;  2BYV E;  3R60 A;  4U0V A;  1JXS A;  1LJ9 A;  4G7Z F;  4G7H F;  3ECO A;  2R7D A;  4Q47 A;  4KIF A;  1MDM A;  1O3R A;  3DV8 A;  3SQN A;  2QEN A;  1F4K A;  4EQQ A;  2RNJ A;  5K5R A;  3KET A;  4CGZ A;  3Q9V A;  3P9C A;  1UFM A;  4U88 A;  2ESN A;  3M9A A;  3V4G A;  2R3S A;  1P2F A;  4G8X A;  4WK8 F;  1J75 A;  2JRT A;  2P6T A;  3WOD F;  4A5N A;  1B1B A;  2H6B A;  4BHB A;  1QPM A;  3FHZ A;  2FBK A;  1SMT A;  2W25 A;  4M9X A;  3PQK A;  4ESB A;  5ILU A;  4RAY A;  1R23 A;  2XHK A;  3F8M A;  4M73 A;  3HUG A;  2XAS A;  4WXD A;  5CVR A;  3LAP A;  5JHU A;  5L3E A;  2P6S A;  1JGS A;  1IUY A;  1TNT A;  1ZYR F;  3IKV A;  1KQ8 A;  2TDX A;  2GXG A;  5LRS A;  5HS9 A;  3ML6 A;  4I7H A;  5HOO A;  3IWZ A;  1YW9 A;  3GVA A;  2HQN A;  2B0L A;  2GZW A;  2YPR A;  2K4J A;  3ZMZ A;  2DFI A;  1T2K A;  3ECH A;  3EYI A;  4MTE A;  4RB3 C;  2OA4 A;  3HRS A;  3KZZ A;  1OYI A;  1CGP A;  2VT3 A;  3QAH A;  4N9H A;  3T8T A;  3ABT A;  2OD5 A;  2KIM A;  3GFL A;  1B4A A;  1MGT A;  3RTR A;  1WWX A;  1DPU A;  5BPI A;  1V3F A;  2A6E F;  3HHH A;  5CYV A;  5DYM A;  4Q5S F;  4EJW A;  4GYG A;  4EGZ A;  4CHU A;  2OAZ A;  1K79 A;  2G7U A;  1S6L A;  2UXN A;  2HYG D;  5FLX K;  2HQR A;  3HSF A;  2HGC A;  5HVQ C;  4MEX F;  3ZPL A;  4R79 A;  3TO6 A;  2M30 A;  2EA2 A;  1K6O A;  3S2W A;  4XSZ F;  3P7N A;  5CVU A;  4LG0 A;  1ZLJ A;  3WTX C;  2DK5 A;  4OU0 A;  4WWC A;  1BC8 C;  1IN5 A;  2FMY A;  1I1S A;  2F5E A;  3KEO A;  1H9G A;  1Z9C A;  1KU9 A;  2GA1 A;  4ETS A;  3HRM A;  3WE2 A;  3HTS B;  4FX0 A;  2FXA A;  5FD6 A;  3E3V A;  5D5W B;  1E2X A;  4KIG A;  4HBL A;  1UST A;  4NHJ A;  1IW7 F;  2YR2 A;  1EH6 A;  4QLC U;  1Z7U A;  3ZMS A;  1NHA A;  3I54 A;  3GYH X;  3IWF A;  3GFJ A;  1USS A;  4P5O A;  1VTN C;  3CUO A;  3BJO A;  1R1V A;  1EV7 A;  1W7P A;  3SFZ A;  3FMR A;  1FSH A;  1JHF A;  1W5S A;  4WXC A;  5BPD A;  2F5C A;  1Z91 A;  1KYW A;  3SXY A;  5D5U B;  4UV8 A;  5AIP A;  3F3X A;  1EH7 A;  5ILV A;  1HSJ A;  4IRG A;  4LK0 F;  5LGN A;  1DP7 P;  1FYK A;  1SFE A;  4OIP F;  3VOD A;  3KP6 A;  5A2Q Z;  5FFX A;  3GX4 X;  4ZYE A;  5D4R A;  2IA2 A;  1OKR A;  3F6V A;  1RUN A;  2EV6 A;  2CYY A;  4ASN A;  1FBQ A;  3DQV C;  4A6D A;  1P92 A;  2HKO A;  2V1D A;  1MDM B;  2MBF A;  4WXH A;  1GXQ A;  2MC3 A;  1HQC A;  3HHG A;  4N9I A;  2G9W A;  2VN2 A;  3GZ6 A;  4PDK A;  2KKO A;  2D45 A;  2ZKZ A;  4YFN F;  3ZQ7 A;  4M74 A;  4IHT A;  1T38 A;  3ELK A;  2ADU A;  3O6B B;  4EJU A;  1KU2 A;  2XAH A;  5E20 A;  2QYO A;  3FMS A;  3WTZ A;  3ZN1 A;  3V8L A;  5IT3 A;  1ZN2 A;  3HOS A;  4XSX F;  4BHC A;  1DPR A;  2DPU A;  1MD0 A;  2WWY A;  1STZ A;  3QRF F;  1HW5 A;  4BYY A;  1QZY A;  1SD4 A;  2VE8 A;  2K86 A;  2VON A;  1SD7 A;  2STW A;  4EJO A;  4WCG A;  2QQA A;  2NS0 A;  5TRD A;  2IA1 A;  2H09 A;  2QQ9 A;  4HQE A;  4UVA A;  5KK1 A;  2VOD A;  4KMU X;  2C6Y A;  2V1X A;  1FOK A;  1D8J A;  1R00 A;  1XGS A;  3E5U A;  3BWG A;  4ON0 A;  1J2X A;  1XSV A;  4IRI A;  3LA2 A;  3F21 A;  3VOE A;  1OMI A;  2CGP A;  2FSW A;  1O3S A;  3FF5 A;  4S05 A;  1R1U A;  4P55 A;  4Z2Y A;  1ONV A;  3RKX A;  2DO7 A;  1BIB A;  3EYY A;  3T0Y A;  3R0J A;  1FSE A;  3ERE D;  3WG9 A;  4KUM A;  4EJT A;  1XD7 A;  5DV5 A;  3KP4 A;  2EFN A;  2HTS A;  3TOA A;  1XMA A;  2ELH A;  3KEQ A;  1R36 A;  3I5U A;  3Q9S A;  2FNP A;  3IHU A;  2M8E A;  5LHH A;  3BZ6 A;  2EFO A;  4LLL A;  3FXQ A;  5HDK A;  3I59 A;  4MNU A;  1LDK B;  2FRH A;  3AAF A;  1YTY A;  3V7R A;  4IPA A;  2CSO A;  4I0B A;  2ZME A;  2EV5 A;  1IAW A;  5JR3 A;  1XDS A;  1ON1 A;  1R58 A;  3U2R A;  3N97 A;  1ZGJ A;  1XB4 A;  1KYZ A;  4O5V A;  5F64 A;  4EGY A;  2EFW A;  2PLY A;  2F5F A;  2RC4 A;  2PQ8 A;  5D5V B;  2V1U A;  2QBY A;  3H3Z A;  3BPV A;  1FX7 A;  2IT0 A;  2FE3 A;  4ESJ A;  2MA3 A;  3SZP A;  3J7A O;  3F8B A;  4Y13 A;  2QLZ A;  3SZT A;  1B59 A;  3C7J A;  3G3Z A;  4YG2 F;  4LD5 A;  3ZMT A;  5A2Q K;  1O57 A;  5D4S A;  1I27 A;  2NNY A;  4Q4Z F;  4BXU A;  4IF4 A;  5F1R A;  5K1Y A;  1FYL A;  2DQR A;  4BHP A;  3EDP A;  1W7P D;  4OIQ F;  3LWF A;  1L3L A;  1HW1 A;  3FZV A;  3K1M A;  1XSX A;  2PBI A;  1K78 B;  2PFB A;  1RUO A;  4UVC A;  4HV6 A;  2P5K A;  3E6C C;  2GIV A;  3WU0 A;  1I6X A;  5LBQ A;  2QBY B;  4KIC A;  2OZU A;  3PFI A;  1QQI A;  3JSO A;  4U0Y A;  5FFZ A;  2K7L A;  2YSR A;  3I0T A;  2DI3 A;  2L54 A;  5DDG A;  4ZH4 F;  2Y48 A;  5E8I A;  4EM1 A;  3M8E A;  1ZRE A;  3RPQ A;  3HSE A;  3OOP A;  1WI9 A;  2A5Y B;  1S8N A;  4RGU A;  2CW0 F;  1O3Q A;  5BOX A;  2JTV A;  4I09 A;  2XAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...