1D5VA

Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11 (s12)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
b'MLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S12 TRANSCRIPTION FACTOR (FKH-14)
publication title Solution structure and dynamics of the DNA-binding domain of the adipocyte-transcription factor FREAC-11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d5vA00
3NQOA 2EJRA 1W7PD 3I4PA 4BH9A 2HQRA 3Q9VA 2STTA 2OU2A 5HDNA 4GO1A 2CFXA 4BQAA 2PG4A 2Z33A 5LHGA 2DFIA 4IHTA 1D8JA 4UVAA 4UNOA 3GZ5A 4GXOA 1IW7F 4M9SA 3IKVA 3E5UA 3E6CC 4CDGA 1JHFA 2BV6A 3E6BA 1R1UA 4DNCA 1IN6A 3ZMUA 4HYEA 1TBXA 5HDGA 3K9TA 1G3SA 5ED4A 4KYWA 4A5NA 1LDKB 3NRVA 3QOPA 3COAC 2P7VB 1ZGJA 1ZHFA 2FBHA 3WTYC 3CLOA 1I1SA 2PJPA 2ZXJA 1USSA 5DDGA 2CSOA 3BZ6A 1R7JA 2DBBA 3ULQB 2QBYA 3FXUA 1ZRCA 1U5TB 2IA2A 5H20A 3DP7A 4LD5A 1CF7A 3KLOA 1G6NA 4G7HF 1EH7A 2L01A 4M72A 4BHCA 1PDNC 4RAZA 4AIKA 1IXCA 1SD5A 3VFZA 4I98B 1S29A 1KYWA 1YIOA 1B1BA 1FP1D 2EFWA 1W5SA 4G6QA 3MCZA 3BJ6A 4K2EA 3C7JA 1FY7A 2GIVA 1F4KA 4FX0A 2MBFA 2H94A 5JR3A 3MWMA 3LFKA 4HOBA 5ICFA 3M8EA 3WGIA 2RQPA 4RB3C 1TLHB 3I54A 4BAYA 1K78A 4P9FA 3FM3A 2DAOA 2P5LC 1OKRA 4KN7X 1ZREA 3WU1B 2IW5A 1HSTA 1BI0A 3H92A 4JBAA 2STWA 4ESBA 2P6TA 3FMRA 3P9CA 2F5EA 5D5XB 2P4WA 5HS9A 4A0ZA 2VBZA 3KEOA 3E97A 1OYIA 2ZKZA 2FXAA 2VT2A 3TO6A 4HF2A 3IKTA 1MJBA 3FHZA 3BDDA 2O8XA 1J9IA 2G9WA 4IRHA 4IRGA 3SQNA 2ZMEA 1FSHA 2E7WA 3GUDA 3RI4A 5D4RA 3VODA 4ESJA 2XVCA 5FLXZ 2LDUA 2L54A 5DUIA 1AOYA 5L3FA 2PN6A 3EUHA 1ZG3A 2X0LA 5D6FA 3R0JA 3TDUC 4XBFA 5HOOA 5TJJA 2CYYA 3JSPA 2A61A 1FSEA 2AS5F 2HKOA 3H3ZA 3RYRA 1FX7A 1RNLA 4A6EA 4XSZF 1J0RA 3HHGA 1U8RA 4CICA 3KCCA 3WG9A 5BOXA 4M6XA 1K79A 3M9AA 1WSUA 2EFNA 3I71A 2RGVA 4LB5A 1EV7A 4JK1X 3IC7A 4CYDA 2COMA 4PCQA 4WK8F 2J5PA 1KQ0A 2RNJA 4LJZF 2NNYA 3R61A 5F1RA 3GFMA 4I7HA 4EJVA 2VODA 3R6SA 3VEPA 1DP7P 2O0YA 2EWNA 1ZN2A 4UV8A 1P4AA 4YG2F 1W5TA 3F8BA 4U0YA 3E6MA 1BI2A 3DXJF 1IF1A 1BIBA 3K69A 4GYIA 1EH6A 3RJPA 4PGGA 2TDXA 2IRFG 1S7AA 1K6OA 3OOPA 4HX7A 3JTGA 3F8CA 4U7BA 3QPHA 3F8MA 1XMKA 3ZN1A 4PGHA 4P55A 1SFXA 4OINF 3ABUA 4HLXA 4IRIA 3HSRA 4WXDA 1FYLA 1ZGAA 2GA1A 4I0AA 3BJAA 1XSXA 1FBUA 2JZYA 4ENMA 5E1ZB 1CF7B 2A3SA 4LG0B 5LLQA 2GA2A 2IA0A 1BC8C 1J59A 3VOEA 1ZLJA 4O3MA 2FOKA 2D1HA 5BPIA 2WWYA 3TOBA 5BS6A 5D8KB 2PQ8A 2XV4S 4AIJA 3JSOA 1IN4A 1JXSA 1USTA 3V8LA 3K2ZA 4AVPA 4KA4A 5F64A 4L9JA 2V1XA 1B6AA 1E2XA 1XCBA 5FD5A 5AIPA 1K78B 1OYWA 5FFXA 4RS8A 3IRRA 3HTSB 1ZRFA 2M87A 1KA8A 2ADUA 4YIFA 2ACJA 2RKHA 3WGGA 1L0OC 5ILUA 1HKQA 2K86A 1OYYA 4M9XA 2VXZA 2IJLA 3ZMSA 3P7NA 3VB2A 2XHKA 4A2UA 4IF4A 3TO9A 1FLIA 4RGUA 2OZ6A 1HKTA 1FZPB 3S2WA 1QGPA 2FNAA 4OMZA 4Q4ZF 3FMSA 1BN5A 1BM9A 2P5VA 1U2WA 1FWZA 4BNCA 3ERED 4EQQA 4ZYDA 4LB6B 3KP2A 1T38A 4M6YA 1XDSA 5E17F 2K4BA 2FSWA 3P9KA 4CZZA 4HDVA 2JSCA 2JPCA 4ESFA 2ZO4A 3HOTA 3CO7C 1Z05A 1FNNA 1XN7A 1QZYA 4AWXB 2QM3A 3MAJA 2BYVE 2CGPA 4LMYA 2W25A 3AAFA 2GAUA 4B8XA 2DTRA 5DCFA 1XSDA 2XUBA 4L5IA 1O57A 3SFZA 5JI6A 1ZG1A 3J80K 1B9MA 1W7PB 1WKMA 3E6DA 3PQKA 1KQ8A 4IPAA 3F6VA 1B9NA 5LGNA 4ZZLA 2W84A 2KIFA 4ZYHA 1PP8F 3KP7A 5IT9Z 1W4MA 1GXPA 1WI9A 5DYMA 1YW7A 1ZH5A 4ENJA 2W57A 4UXNA 2FQ3A 4HV5A 3TO7A 2QQAA 3L2CA 3QP5A 1FP2A 5AIQA 3ECOA 3J7AO 3V4GA 4ZYGA 4UHTA 3FX3A 2O03A 3IWZA 1LEAA 5L3CA 1O7LA 3ML6A 5FO5A 3EYYA 3RYPA 5E20A 4WF2A 3ISPA 3F21A 4ZH4F 1R36A 3OV8A 2P8TA 4YIIA 3IL2A 1GHCA 1NHAA 4FT8A 4HX8A 2LF7A 2Z9OA 3QP6A 2R7FA 2A6EF 2AXLA 5H6RA 1FYMA 3ZMVA 1TQMA 1V4RA 1LB2A 4M9ZA 4XLPF 4EJUA 5LRRA 5DD4A 2R7DA 4A0YA 5D5VB 2VBYA 3FM5A 1IN8A 3F6OA 2RVCA 2IT0A 1BJAA 2VN2A 1F9NA 2CG4A 1YS6A 2HOEA 1UB9A 2L02A 4B09A 3U2RA 4HLYA 3V7RA 2H6CA 1JE8A 3HIFA 1YTYA 3FZVA 5DUKA 1I27A 2K7LA 1SMYF 5L3GA 4FX4A 3RDIA 3L09A 3CUQC 1KU2A 1C0WA 3JAMZ 1QQIA 3V7SA 1J7KA 1T0FA 5BMZA 3GEZA 2GQQA 1XDUA 3I64A 4QLCU 4HQEA 2NNNA 5HLIA 4YFNF 2IVMA 4LK0F 3WGHA 2V1UA 1R23A 3GWZA 4MTDA 4H0EA 2HKXA 4OU0A 5F6FA 2JTVA 2HWVA 1WQ2A 2LNBA 3WODF 3BROA 1WWXA 4L5JA 2XAGA 4G9YA 3KP6A 1EH8A 2OA4A 5L3DA 4U0VA 1REPC 5LRSA 1IZ1A 5JVTA 4TV7A 3IWFA 3J80Z 3R0AA 3FXQA 3SZPA 2G7UA 3WE2A 1RIOH 1GVJA 1HW2A 5A2QZ 2HYGD 3T0YA 4G94A 4HF1A 3M7GA 4HAMA 2UXNA 1HSJA 4I09A 1F1ZA 3KP4A 3LAPA 4M73A 3T1BA 5D5UB 3KZZA 4P96A 4Q47A 3G3ZA 3ZMZA 2L3DA 2RN7A 1ZLKA 3GFLA 1HBXG 3Q9SA 3FMQA 4O5VA 3FXRA 3O2PE 2DQLA 3BY6A 4EGZA 2HTJA 4L9TA 5D6EA 1HKSA 3HTUA 4HZFA 3EYIA 5HS7A 3ZMTA 4CHUA 1SFUA 1MGTA 3QU6A 5DCMA 3H3UA 2RDPA 3CJNA 4L0ZB 2G7HA 4RGRA 2C6YA 4G7OF 3T8RA 3GYHX 5CVVA 4NHJA 4OIOF 1U5TC 2ZFWA 2BE5F 4KDPA 1G3WA 5CLSA 4ENKA 5K1YA 1BC7C 3CO6C 1ULYA 3C1DA 2HYFA 3ZMDA 4ASNA 1RI7A 4WXHA 1XB4A 2D1VA 3O6BB 1TTYA 1U6GA 2EV6A 2E1CA 5TRDA 4FHTA 3KETA 4RGSA 4UV9A 3I59A 2UXXA 5FFZA 3GZ6A 1YLFA 1Z1DA 2RV8A 3G73A 1RUNA 2BGCA 2VOPA 2K27A 2E7XA 2EV0A 3FWEA 4O6JA 2GZWA 4RAYA 2EA2A 1J2XA 2KKOA 1STZA 3CUQA 2FBKA 3BP8A 2LF8A 1ZG5A 1A04A 1BI3A 1Y0UA 5DD8A 2WV0A 3QU3A 1B4AA 1G3TA 3R60A 1Z6RA 3QAHA 1P2FA 1SD4A 1TQPA 3V7CA 2PBIA 3GF2A 4S04A 2L4MA 3RPUA 1R1VA 1L3LA 2XKOA 3MZHA 1P4XA 1ZYRF 3T5XA 2V6CA 2QBYB 1VTNC 3HRMA 4QWQA 2OD5A 5K5QA 2Q0OA 2KIUA 3TQNA 1OPCA 1YG2A 1XGNA 4KMUX 2XROA 3DPTA 4HBLA 3WTWC 2DO7A 3RKXA 1XMAA 4KMFA 4L18B 4U7DA 2IP2A 4IJAA 5LBQA 2D2WA 3REOA 2H27A 3HRTA 2H6BA 4U88A 1DPUA 5BPDA 2ZNZA 1H9GA 1ON1A 3EQLF 1JHHA 4KUMA 5ICCA 5LHHA 1XGSA 2HTSA 2DPDA 4KICA 4LLGF 2DU9A 4CGZA 3JW4A 3W6JB 3WU0A 5ICEA 2EB7A 4LLNA 3K1NA 5ICGA 4OOIA 2YPRA 4N9HA 2K4JA 2QQBA 5ILVA 1R58A 2QZ8A 4Y15A 1SFEA 2A5YB 1DPRA 4UVBA 4A12A 2QYOA 1U5TA 5ILSA 3HYIA 3R4KA 3LWFA 3KLNA 2ZMEB 2FRHA 2FBIA 1R22A 2LKPA 4MEXF 1S6LA 3O3KA 3L9FA 4A6DA 2BBYA 2OBPA 4YFXF 1XGMA 1MD0A 5L3BA 5LHIA 2XAHA 4Q48A 4BHPA 1R5GA 4Y13A 1IXRC 4IHSA 2DK8A 4E70A 4ZZDA 4M74A 4D0PA 2MLGA 3DPLC 4A5MA 2CWEA 1ONVA 3ZP5A 1IXSB 4CO8A 2ISZA 1Z6TA 3GX4X 1P4WA 3DQVC 2IPQX 4RB0A 3TKYA 3K1MA 5E8GA 2J5OA 3CDHA 5K5RA 4NB5A 1FC3A 3NEUA 2VE9A 2YU3A 2EA4A 4A0XA 1O3RA 2VBWA 3I59B 4R79A 1D5VA 3FF5A 3ECHA 2Z99A 3N4MA 1FT9A 1G3YA 3GW2A 3TDZC 2DQRA 1Z7UA 3ELKA 4HV6A 1P6RA 3TGNA 1BOAA 2YX7A 2O6GE 1Z9CA 5CVRA 3E3VA 2F5FA 2MH2A 2EFOA 3B73A 2QLZA 5HS8A 3HRUA 3CUQB 2FA5A 3BPVA 2F5DA 3HOSA 1MKMA 3CTAA 3HUGA 3LA2A 3GFJA 4WXCA 1GXQA 2F2EA 3T8TA 1UFMA 2CW0F 2V1DA 5E18F 3LQRA 3MQ0A 3GFIA 2HDCA 3M1EA 3M8FA 4EJWA 3P9IA 4MHGA 3LAJA 1QPMA 3JTHA 5J8CA 1JGSA 5D8LB 1FBSA 1YS7A 1O3QA 2M8EA 4ON0A 2HS5A 2BEOA 1T6SA 1YFHA 4Y17A 1MDMA 4I02A 5HLHA 4MEYF 2XRNA 4OIPF 1IAWA 1AWCA 1QBJA 2XIGA 1FPQA 3MFKA 1LQ1A 6PAXA 1O7FA 4BYYA 1I5ZA 5K5OA 3HRSA 2HZTA 4WCGA 5FLXK 2OZUA 5JHUA 3C3WA 2A68F 1IUYA 1O3TA 3F23A 4YFKF 3GVAA 4UVCA 3WTZA 3GLXA 3GXOA 1LDJA 4XRFA 3D5LA 1E17A 1IN7A 1FOKA 1ODDA 4KNYA 4LK1F 4MQ9F 2P5KA 2EV5A 4Z2YA 4OIQF 5FB2A 1XCVA 1D8KA 2LSOA 3BPXA 4XLNF 2CQKA 5CVJA 1FBQA 3W6KB 2HQNA 2WC2A 2PLYA 2XAQA 4NQWA 4BXUA 3MZYA 2B0LA 1T39A 5HVQC 2YR2A 3V8KA 1KQ9A 2XASA 3LA7A 4EVIA 2MC3A 1U78A 3KP5A 2GXBA 4KIGA 3KP3A 4EM2A 2QUFA 1DUXC 2Z5UA 5E1WA 4ZYEA 3KE2A 4LG0A 3DF8A 5AONA 1UHWA 1UHMA 1R5HA 4Q5SF 1TNTA 2MA3A 4PDKA 2ELHA 4WWCA 3I53A 2JT1A 4I0BA 3F22A 3F8NA 4KN4X 2H09A 2VC0A 3SXYA 2GXGA 4UUVA 1F5TA 1V3FA 1LNWA 2DK5A 4MGRA 5DEQA 3LA3A 2V9VA 2M30A 3BJOA 3EETA 4P5OA 5E1XA 4KT5C 3DKWA 5H6QA 5D5WB 1I1GA 3V8JA 3J81K 3E5XA 1J75A 1J5YA 4RB1A 4EV0A 1TQIA 2VT3A 1S8NA 5EEGA 3ZN0A 2PI0A 3D0SA 2PFBA 5FD6A 3DFGA 2WTEA 4P9UA 1KYZA 1XD7A 2FMYA 4EMSA 2EFQA 5KK1A 1KGSA 1R00A 4M71A 4WX9A 3L00A 1XGOA 1DDNA 2XKPA 4JQFA 1LEBA 5BQTA 2DI3A 4DQ2A 2NS0A 1UCRA 5L3EA 4RGXA 4HDUA 3L7WA 2KRFA 2KJCA 5E8IA 2FU4A 2GWRA 2A69F 3RKYA 1MJ9A 4KIBA 2OQGA 4HF0A 3KEQA 2FF4A 3QPTA 2ZCWA 3K1PA 2UZKA 2A6HF 2NRAC 3IHUA 1HQCA 3F72A 1SMTA 3RPQA 1K7AA 2UWMA 1XSVA 2KIMA 1IRFA 5D4SA 2JPBA 4CXFA 1MDMB 1RUOA 2EFPA 3EDPA 4U0WA 1SAXA 1QZZA 3HSFA 2ESHA 3GO5A 2XAFA 5DV5A 2QQ9A 5LGTA 2PMUA 3WTUC 2PEXA 2ETHA 2QVOA 5JFRA 4R8HA 4AIHA 1W7PA 3Q5FA 2DW4A 3PFIA 1S7OA 2DLLA 3WE3A 2QENA 1YYVA 4GYGA 4LFUA 2FMLA 5HLGA 2A07F 2FEZA 3IRQA 1QO0D 2MD5A 2ZBKA 4G7ZF 5CYVA 4G8XA 3F3XA 1SD7A 1TW3A 2M45A 2O3FA 1YW8A 2QWWA 1D3YA 3HHHA 4S05A 2CO5A 1Z91A 4IVNA 3QRFF 2R3SA 3I58A 2FNPA 2VBXA 2ZJ2A 4HX4A 4L0YB 2O61A 2MLKA 1ON2A 2NAZA 4ETSA 2HGCA 5IT9K 1BI1A 2VOOA 3ZQ7A 2L4AA 2ZNYA 3B02A 3PQJA 1LVAA 5FGMA 1B59A 4EGYA 2YSRA 4ENNA 3J81Z 5J8FA 1YW9A 4IXAA 3WTSC 2HFHA 2FE3A 3CUOA 4N9IA 4N0BA 4I2OA 1QNTA 5LEKA 1OMIA 4GCVA 4HA8A 4R1HA 4KIFA 1SD6A 4LLLA 1YO5C 1IRGA 2MH9A 2DT5A 4L9VA 4HQMA 2HR3A 1O3SA 1H9TA 2P7CB 4XSXF 2P6SA 2XGXA 1OR7A 2W85A 3N97A 1KU7A 1KU9A 2VE8A 2Q8KA 4EM1A 2M1BA 3HSEA 3RKWA 1MZBA 2HEOA 2OQRA 3WTVC 5LGUA 1TW2A 1MJAA 1H0MA 4HW0A 2IA1A 2Z3YA 2W24A 1ZAOA 4MTEA 4EJOA 1S3JA 3U9GA 3WTTC 4PZJA 1ZARA 4MNUA 3I5UA 3RIRA 3C18A 5DCMB 4GGGA 2NYXA 5CVIA 3SHFA 1PP7U 2Y0MA 3SZTA 4OIRF 3ROUA 3DEUA 4I01A 2JRTA 4G6DA 3BWGA 3JAMK 5CVUA 5HDKA 3F8FA 3I0TA 2ESNA 3LQQA 5J6XA 1R1TA 4EM0B 3KZYA 2EK5A 3ZPLA 3DV8A 2ISYA 1T2KA 2D45A 1P92A 5KVRA 1LDDA 4RB2C 1WRJA 1FYKA 1HW1A 2Q2EA 1YQAA 4BHBA 1IN5A 3U1DA 2M5WA 4AD9A 2VONA 1HW5A 5CJ9A 1Q1HA 2F5CA 1ZRDA 3ABTA 4MQVA 5IT3A 3K0LA 1CGPA 2E1NA 1BIAA 5A2QK 2RC4A 2X4HA 3KFWX 3BOQA 2PMHA 1U3EM 1T98A 2XAJA 2DPUA 4EJTA 1BBYA 3RTRA 1KU3A 1RZ4A 2OAZA 3LSTA 2Y75A 4F7ZA 4L9NA 1TNSA 2K02A 1I6XA 5EEHA 2Y48A 1PUEE 2VC1A 2YX4A 2KJBA 3TOAA 5LEJA 4KFCA 1X3UA 4OMYA 3MEXA 3WTXC 4LGWA 1LJ9A 5ERIA 2V79A 3E5QA 1G4DA 1HXDA
chains in the Genus database with same CATH superfamily
3J7YJ 3NQOA 2CQNA 2EJRA 4E7HA 1XS9A 3H5RA 3M07A 4I76A 1W7PD 3I4PA 4BH9A 2HQRA 2N8GA 4BS9A 1A5JA 1WJCA 5J1YA 3AKZA 4XLCA 1JGGA 3Q9VA 2STTA 2OU2A 5HDNA 4GO1A 3AG4H 4ZDOA 2VL8A 2XB0X 2CFXA 1SEUA 4BQAA 2PG4A 2Z33A 3K70C 3CMAI 5IP9J 5LHGA 1NK2P 2DFIA 4A3MJ 4IHTA 2K40A 1D8JA 4UVAA 2WADA 3ZCOA 3RQIA 4UNOA 3GZ5A 4DZPA 4GXOA 5EGOB 5FROA 1WJAA 1IW7F 4M9SA 4M3EA 2CRGA 3IKVA 2RREA 3H0GJ 4V2FA 3E5UA 5F0CA 3OYEA 2OC6A 3PUFA 3E6CC 1U8BA 4CDGA 1MBEA 3ZQIA 1JHFA 1X1BA 4LIUA 2BV6A 3E6BA 1R1UA 3OYDA 4DNCA 4M3DA 1IN6A 2F6CA 3ZMUA 5CQEA 3ONQA 4HYEA 1YRNB 1TBXA 1AKHA 5HDGA 3K9TA 3LL7A 3A0HC 1G3SA 1YITI 5ED4A 4KYWA 4A5NA 1LDKB 2R0QC 1WVRA 2M7BA 3NRVA 3QOPA 2Z16A 2VJ5A 3COAC 1MBGA 2P7VB 1ZGJA 1ZHFA 3K4NA 2IS4A 2FBHA 3K2AA 3CLOA 3LSMA 4Y33A 5BNGA 3WTYC 1JKPC 1I1SA 2R7RA 2PJPA 1KZHA 2ZXJA 1USSA 5DDGA 3B6AA 4CCKA 2CSOA 3BZ6A 1Y56A 1R7JA 2DBBA 3ULQB 2QBYA 3FXUA 1ZRCA 1Q1VA 1Z0XA 2QF7A 1U5TB 2IA2A 5H20A 3DP7A 2IBDA 4LD5A 1TL8A 1CF7A 3KLOA 3UR3C 1G6NA 1WPKA 1X3ZB 4G7HF 3HZJA 4Y7NJ 1R9TJ 1EH7A 1Z67A 2L01A 2ZSIB 4M72A 4BHCA 3E5QA 4RAZA 2HQAA 4AIKA 1PDNC 1IXCA 1SD5A 3VFZA 4I98B 1S29A 2WY8Q 1KYWA 1EA3A 1YIOA 1B1BA 2DA3A 1FP1D 4NUBA 5IYBJ 1OQYA 2EFWA 3E0JB 5KHDA 2E1OA 1IRZA 1W5SA 4G6QA 3MCZA 3BJ6A 3BG7A 3S1MJ 1E3HA 4K2EA 3GTOJ 3LSRA 3TEDA 3C7JA 1FY7A 5F04A 3CCYA 1XG1A 2GIVA 1F4KA 3FK6A 4FX0A 5LFAA 2MBFA 2H94A 4M6VA 5JR3A 3MWMA 2O8KA 3A02A 3LFKA 5EYRA 4HOBA 5ICFA 2BY2A 2ECCA 3M8EA 3WGIA 2RQPA 2LG4A 2DA4A 3CDLA 4RB3C 1YJWI 1TLHB 3I54A 2NOGA 3PSFA 4V19K 4BAYA 1K78A 4P9FA 3FM3A 4E7JA 3VDXA 3B6CA 2DAOA 2P5LC 4PFOA 1OKRA 3QODA 4U87A 1ETVA 4KN7X 4RAFA 4XN3A 1ZREA 3WU1B 2IW5A 2DFHA 3HOYJ 1HSTA 1YX3A 1BI0A 1LFPA 3RCOA 3CC2I 3H92A 4JBAA 4XN0A 2STWA 4ESBA 3K7AJ 2TRTA 5EJCA 4N4OB 2Q2EB 3BG3A 3CD6I 1VQ9I 2P6TA 1E0EA 4YEJA 3FMRA 3P9CA 1O4XA 2F5EA 5D5XB 2P4WA 1MMDA 5HS9A 4A0ZA 3W2AA 2M8GX 4ZJZA 5F1JA 1PUFB 4XKBA 2VBZA 5F0FA 2ZJRF 3KEOA 3E97A 1OYIA 2ZKZA 3ZRGA 3I3LA 2FXAA 2VT2A 2DOEA 5IP7J 3TO6A 4HF2A 5J1UA 2VQHA 3IKTA 1MJBA 3FHZA 2K3PA 3OIPA 3BDDA 2O8XA 1J9IA 2G9WA 4IRHA 4IRGA 3SQNA 2L7FP 2ZMEA 2JMWA 1FSHA 2E7WA 3WHBA 4E6KG 1UMQA 3GUDA 3RI4A 5D4RA 3VODA 4ESJA 2XVCA 1U9NA 5FLXZ 4IQ4A 2LDUA 2HOTA 2L54A 5DUIA 1AOYA 5L3FA 5GPAA 1DP3A 2PN6A 3EUHA 1ZG3A 2QSFX 1QZEA 4E7ZA 2X0LA 5D6FA 1JI8A 3R0JA 1RPWA 1QPIA 3TDUC 4XBFA 3DBLB 5HOOA 5TJJA 4PFPA 2ZXWH 2EZHA 2CYYA 3JSPA 2A61A 4DJAA 1FSEA 1N78A 2AS5F 2HKOA 2LVSA 2ZJQF 1KONA 3H3ZA 3RYRA 2HDDA 3W2VA 1IV8A 4MFDA 4IHYA 2DMUA 2VKDA 3JRIA 1FX7A 1RNLA 4A6EA 1ITYA 2V9KA 4XSZF 1J0RA 3HHGA 1U8RA 4CICA 2HDWA 3KCCA 3WG9A 1GT0C 2Z2SB 1HC8A 4XIDA 4M6XA 5BOXA 1K79A 2JSPA 1D0YA 3M9AA 2LYCA 1WSUA 4XLHA 2E2IJ 1FMVA 2EFNA 3I71A 2RGVA 4X1EA 2NS8A 4XKWA 5J40A 4LB5A 2LBFB 1G59A 1EV7A 4JK1X 3S14J 3IC7A 1WFXA 3HEFA 4CYDA 3FHNA 1OISA 2COMA 3PNTA 5B3SH 4PCQA 4WK8F 1MH4A 2DA5A 4CCOA 5TGTA 2MSYA 4Y4RA 3BTCA 2J5PA 1KQ0A 2RNJA 4LJZF 3OYNA 2E71A 2NNYA 1TP4A 3R61A 5F1RA 2VJIA 3GFMA 4B1RA 2JUCA 1MNDA 2KQRA 2XGDA 5F27A 4I7HA 4EJVA 4IL6C 2ZJPF 2VODA 3R6SA 3VEPA 2EIKH 4FISA 1DP7P 2O0YA 4DYRA 2EWNA 1ZN2A 4UV8A 2VQCA 4GRIA 1P4AA 1Y0NA 4B48A 2DOAA 2QA4I 2DA1A 1E3PA 4PUSA 2JVGA 3HOVJ 4YG2F 3OR2C 1W5TA 3F8BA 3BTIA 4BE2A 2UV1A 4U0YA 2A05A 3E6MA 1BI2A 3DXJF 1TWAJ 1X19A 1X3WB 1FMWA 2ICWG 1BIBA 5GP9A 1IF1A 3K69A 4GYIA 1EH6A 3DU5A 3RJPA 4PGGA 2TDXA 2IRFG 1WCMJ 1S7AA 2YS9A 1K6OA 3OOPA 4HX7A 3VYUB 4DGWB 4IHXA 1RKWA 3JTGA 1GV5A 3F8CA 3FXOA 1RETA 4U7BA 3QPHA 3F8MA 1XMKA 3ZN1A 4NQWB 4PGHA 4P55A 1SFXA 2NS7A 3FXLA 3PM1A 3S3NA 4OINF 3K4JA 3ABUA 1K6YA 4HLXA 4IRIA 3HSRA 4WXDA 4NC7A 1FYLA 1ZGAA 3MMYB 2GA1A 4I0AA 3BJAA 1XSXA 4QIWN 2PJRA 3BQZA 2OV7A 1LVKA 3K4LA 1RR7A 4KT6A 1FBUA 1SFKA 3BG9A 2JZYA 3JRGA 4BEHB 3FBNB 5E1ZB 4ENMA 1CF7B 1FOYA 2A3SA 4LG0B 1SANA 5LLQA 1XX5A 5M5YJ 2GBYA 3OYIA 3ZQQA 1QVUA 2GA2A 2IA0A 1V5FA 3NWSA 4A3IJ 1BC8C 2JJ7A 1J59A 3VOEA 1ZLJA 5K7HA 3HDDA 2KIQA 2EQRA 4XNFA 2FOKA 4O3MA 2D1HA 5BPIA 2WWYA 3TOBA 1ZELA 4HSTA 5BS6A 1WZ2A 2BY1A 5D8KB 2PQ8A 2XF7A 2KDOA 2XV4S 4AIJA 3CC4I 3JSOA 1IN4A 3WHCA 2W1OA 2LOOA 9ANTA 3IAS2 2EIJH 2E5NA 1JXSA 3S3MA 2B7EA 1IG7A 1USTA 4IO9F 3V8LA 3BG5A 3K2ZA 4BE0A 1VQOI 2NVTJ 2M2EA 2PMZA 4AVPA 4KA4A 2V9PA 1Y1VJ 5F64A 4L9JA 2V1XA 2D5VA 1B6AA 1E2XA 5HODA 1XCBA 5FD5A 1F36A 5AIPA 1K78B 1OYWA 3ABLH 5FFXA 2L5QA 4RS8A 3IRRA 3HTSB 1ZRFA 4BQOA 2M87A 2E2HJ 1KA8A 2ADUA 4YIFA 3CCVI 4FE7A 2ACJA 2RKHA 3WGGA 2WAEA 4BBRJ 1L0OC 5ILUA 5M3FJ 2WAQA 1HKQA 2K86A 4BE1A 3AG2H 3LSKA 4LG3A 1OYYA 3OYCA 4M9XA 2VXZA 2IJLA 3ZMSA 3P7NA 3VB2A 2XHKA 2JRMA 1AU7A 5EEAA 2M3AA 2VKVA 1T0FC 4A2UA 3VYTB 4IEJA 4IF4A 3TO9A 3ZR8X 1FLIA 1RRJA 5DS9A 1MIJA 3ZXSA 4E7LA 4RGUA 2OZ6A 5H2FC 4I6ZA 3H9QA 2R7WA 1HKTA 4RDUA 1HF0A 1FZPB 5LD2C 4I99C 3U21A 3S2WA 2L9SA 1HOMA 2O5RA 4F55A 1N77A 1QGPA 4B3XA 4XR6A 2FNAA 2LH9A 4OMZA 4Q4ZF 1HCRA 3FMSA 4MFEA 4XICA 1BN5A 4BACA 1Y6IA 1GLNA 5M3MJ 2AXTC 2P5VA 1BM9A 2BY0A 1U2WA 1FWZA 2CW7A 4XORA 4UY8I 4BNCA 3ERED 4EQQA 4ZYDA 1MSEC 2CU7A 4LB6B 3KP2A 1T38A 4M6YA 4B44A 1XDSA 5E17F 3HBLA 2K4BA 2FSWA 3IUOA 3P9KA 4GDFA 4CZZA 3MZ8A 2HOSA 4HDVA 2JSCA 2QSGX 2JPCA 3S2DJ 4ESFA 3HOXJ 1OCOH 4IX7A 5IYDJ 2ZO4A 4DBRA 3HOTA 3TL4X 1Z05A 5IOZA 3CO7C 2R5YB 2K9SA 2FQ4A 1FNNA 2VASA 1XN7A 3FBIB 3FK7A 2ELJA 1QZYA 4AWXB 2QM3A 3MAJA 3IH3A 3SYTA 2BYVE 4A69C 1P7JA 2HZDA 2CGPA 1X2MA 4LMYA 3JRAA 2W25A 3AAFA 2GXAA 2I10A 2GAUA 1V55H 2MW8A 4B8XA 1HDDC 2DTRA 1BJZA 5DCFA 1XSDA 2XUBA 2FUG2 4L5IA 4B47A 4HNUA 4ZTFA 1O57A 3SFZA 5JI6A 5GAGJ 1ZG1A 3J80K 4C2TA 1UG0A 2EZLA 2O9LA 1B9MA 1W7PB 1WKMA 3WG7H 1JKQC 1WJ5A 3E6DA 3PQKA 1KQ8A 4JOMA 4IPAA 4PJ0C 2ME0A 3F6VA 4IQJA 2R4GA 1B9NA 2ECBA 5LGNA 4NBQA 2W84A 4ZZLA 2KIFA 2E1MC 3OL3A 4UUSB 4ZYHA 1PP8F 3KP7A 5IT9Z 1NH3A 1W4MA 4E7IA 1GXPA 2JA7J 1WI9A 2VLAA 1Y39A 5DYMA 5EF6A 1YW7A 1ZH5A 4ENJA 2W57A 4UXNA 2FQ3A 2TCTA 4HV5A 3TO7A 2KPMA 1F43A 2QQAA 3L2CA 3QP5A 4II2A 1FP2A 5CPRB 2X1EA 3H9GA 5AIQA 1UELB 1IRXA 3ECOA 3J7AO 3V4GA 2R7OA 4ZYGA 4UHTA 3FX3A 2O03A 3LFUA 3IWZA 1LEAA 5L3CA 1O7LA 2K9LA 3QQAA 2M4KA 4UB6C 3ML6A 5FO5A 1ETQA 3EYYA 1FJLA 3W6VA 1U9OA 3RYPA 5E20A 2RAEA 4BY7J 2NOJB 1R4NB 3HC7A 4WF2A 3AL0B 1VQ8I 1D1CA 3ISPA 4XLEA 4ZH4F 1R36A 3A01B 3OV8A 3F21A 2P8TA 1Y8QB 2BVMA 4CUGA 4YIIA 3IL2A 3EUHC 4J19A 4M3FA 1GHCA 1H89C 4RLFA 1NHAA 2DA2A 1VI0A 3SDGA 1V54H 3MKWB 4FT8A 3ZQFA 1NG6A 4HX8A 2LF7A 4RLQA 2Z9OA 2EZKA 1FTZA 3QP6A 2XC7A 3V42A 2R7FA 2R92J 2A6EF 2AXLA 3BTLA 3OWTA 5H6RA 4PJJA 3ZMVA 1FYMA 1N75A 1TQMA 4FTHA 3RZOJ 1V4RA 1LB2A 4M9ZA 1IUFA 3MKYB 5JLXA 3JRDA 2BXZA 4RBOA 1VNDA 4XLPF 4EJUA 5LRRA 4EEFG 5DD4A 4RM2A 2LLKA 2R7DA 1LUJB 1TT5B 4A0YA 5D5VB 3OYGA 5GAEJ 2Y69H 2VBYA 3GBGA 3FM5A 4XRSA 3OYAA 1IN8A 3CMEI 3F6OA 2RVCA 2IT0A 1Z21A 3J7AY 1BJAA 2VN2A 1F9NA 2CG4A 2XF6A 1YS6A 5J3LA 2HOEA 1UB9A 1PYVA 3I4NJ 2JA8J 2L02A 4ZTJA 4B09A 1DU0A 3U2RA 4HLYA 1UHSA 3BR5A 3V7RA 2NVUB 2NVYJ 2H6CA 1JE8A 2L7MP 3HIFA 2K9NA 1YTYA 3FZVA 5DUKA 5K7FA 1I27A 2K7LA 3S17J 3CMMA 3H1CA 2MFZA 1SMYF 2G0EA 3ZQCA 5L3GA 4D7MA 4FX4A 3RDIA 4HEA2 3L09A 3CUQC 1KU2A 1C0WA 3JAMZ 1QQIA 3V7SA 1J7KA 1T0FA 3EPZA 1TT0A 4B3AA 5BMZA 3H35A 1FTTA 1MBKA 3GEZA 4A3GJ 2GQQA 2HNHA 1XDUA 2KT0A 4XOPA 3I64A 4QLCU 1SAUA 4HQEA 3DCFA 2NNNA 2QKLB 5HLIA 4YFNF 2IVMA 4LK0F 4JX5A 3WGHA 2O7OA 1AHDP 2V1UA 1R23A 3GWZA 4MTDA 4H0EA 2HKXA 2GIZA 4OU0A 5F6FA 2JTVA 2CS3A 2HWVA 1WQ2A 2LNBA 3GTLJ 3WODF 2BHZA 3BROA 1WWXA 2AHQA 4L5JA 2PMZN 3S93A 2LREA 2XAGA 2VJJA 4G9YA 2MC4A 3KP6A 5B1BH 3GMEA 1EH8A 2E36A 2OA4A 5L3DA 4U0VA 4XLFA 1REPC 5LRSA 1JUPA 3M4OJ 1IZ1A 5JVTA 3LSJA 1MNEA 1T8IA 2LRDA 4LITA 4TV7A 1EKEA 2R7UA 3IWFA 3J80Z 3R0AA 4F92B 3FXQA 3VWBA 1MMNA 3SFIA 3SZPA 2G7UA 3WE2A 4F91B 1GVJA 1JTYA 3DTIA 1RIOH 1HW2A 3DPUA 1FIAA 2L9VA 5A2QZ 2HYGD 3T0YA 4G94A 4HF1A 3M7GA 4HAMA 3DLLF 1WHUA 2UXNA 2HXOA 1HSJA 3CF5F 4I09A 2CJJA 3G6EI 3S8PA 1F1ZA 3KP4A 4FETA 3LAPA 2W7NA 3S15J 2H8RA 4M73A 4HRIA 5M5WJ 4RM3A 3HOWJ 3T1BA 5D5UB 3KZZA 4P96A 4Q47A 1D0ZA 1ETWA 2JK3A 3G3ZA 4H4KC 3ZMZA 2L3DA 2RN7A 2XB5A 2HQ5A 1ZLKA 2LP0A 3GFLA 1HBXG 3KYLA 3Q9SA 2QSHX 4BBSJ 3FMQA 2DTZA 4O5VA 3FXRA 3I4MJ 2RQQA 2P81A 2BZTA 4QPOA 3O2PE 2DQLA 2W00A 2E34A 1OCPA 3BZKA 2ZFUA 2ZB9A 3BY6A 3J7ZI 4EGZA 2HTJA 1GVDA 4CH7A 4L9TA 3G4SI 3DTKA 5D6EA 4BKXA 3BR6A 3F9KA 3W2WA 1HKSA 3HTUA 4HZFA 4CYCA 3EYIA 5HS7A 3BCAA 5J4YA 3ZMTA 3OL4A 3Q0VA 4CHUA 4XM3A 3ZQHA 1SFUA 1MGTA 3QU6A 3BT9A 3LSIA 5DCMA 3H3UA 4XQFA 3NAUA 4JP0A 2RDPA 1JUSA 3CJNA 4L0ZB 2G7HA 4RGRA 5EG0A 2WY7Q 2C6YA 4G7OF 3T8RA 3GYHX 5CVVA 4NHJA 3U1KA 4OIOF 1U5TC 2X48A 2CV0A 2ZFWA 4G12A 1ACIA 2R5ZB 2BE5F 4BXFA 4KDPA 2X9DA 1G3WA 5CLSA 4ENKA 3KYCB 2Z1DA 3CQZJ 5K1YA 1BC7C 4HPQA 3S2HJ 1M1EB 1QHHD 2M9HA 5GAHJ 3CO6C 1Z77A 2IGMA 3EUAA 1ULYA 3C1DA 2K85A 2HYFA 2X1DA 1WH5A 3ZMDA 4ASNA 3LSGA 2ID6A 1RI7A 1D0XA 2LD5A 4WXHA 1XB4A 1ETKA 2D1VA 3O6BB 1TTYA 1U6GA 2EV6A 2E1CA 3D1NI 3JRBA 5TRDA 2ZSHB 4OAZA 4B4CA 5JLWA 2KHMA 4XRMA 2PX9A 2XSDC 4FHTA 5KCMA 3HJEA 4CA0A 3KETA 1OCRH 4AIDA 4RGSA 1VQLI 4CSWA 4UV9A 1I3QJ 1S9HA 2GLOA 3DBRB 3FDYA 1YIJI 3I59A 2UXXA 5FFZA 3GZ6A 1SVLA 1YLFA 2RV8A 1Z1DA 2F48A 3X2QH 3G73A 1RUNA 2OTJI 2BGCA 3DEWA 2VOPA 1JKRC 2DDBA 3SEZA 2K27A 2E7XA 2EV0A 3FWEA 2Y30A 2K9MA 4O6JA 2GZWA 4J01A 2ELKA 4RAYA 1NK3P 2EA2A 1MSFC 3OS0A 2HVSA 1J2XA 1TWHJ 2X85A 3MKLA 2KKOA 5KAIC 2HYJA 3CCSI 1STZA 3CUQA 2FBKA 2Q1ZB 3BP8A 2E35A 2LF8A 1ZG5A 3CLQA 2V6EA 1A04A 1BI3A 1Y0UA 2VQLA 5DD8A 2E5ZA 3Q0WA 1BW5A 1YX5A 3ZOBA 2WV0A 3QU3A 1AKHB 3TMOA 1B4AA 3CCMI 1WJEA 4A3EJ 1G3TA 3R60A 4G6TB 4JX4A 2FD5A 1Z6RA 2BVLA 3SDBA 4BQNA 3JRCA 3QAHA 3SZGA 3LOCA 2LTPA 4RA2A 4II3A 1P2FA 2LY2A 1SD4A 3OYLA 1TQPA 3V7CA 2PBIA 3GF2A 3CP2A 1X2NA 1R71A 4S04A 5C4XJ 2M0CA 2L4MA 3RPUA 2DXIA 1R1VA 3K4KA 4BJTA 1L3LA 4D5CA 2XKOA 2VKHA 3BR3A 3H9JA 1P4XA 3MZHA 1ZYRF 3HKZA 3T5XA 2CFOA 3IAM2 4C9YA 2DOFA 2V6CA 2QBYB 4KITB 1VTNC 5IOYA 3HRMA 2DODA 1IGNA 2OTLI 1FOWA 1YJNI 1W0TA 4QWQA 2OD5A 2Y2ZA 5K5QA 2H8WA 5B66C 4PK4A 2Q0OA 2KIUA 2XDVA 4A3LJ 3TQNA 1OPCA 2H1LA 1YG2A 1XGNA 1T08B 4DBQA 1OLTA 4KMUX 2Y9ZA 2XROA 2F4IA 3EUKL 3DPTA 4HBLA 3WTWC 2DO7A 3RKXA 4B43A 3OSFA 1XMAA 4OAYA 3IP4B 2W4SA 3E1SA 4KMFA 4L18B 3C2HA 5IYCJ 1FIPA 2IGOA 1S72I 4U7DA 2IP2A 4IJAA 5LBQA 2D2WA 3REOA 3MN2A 2H27A 3H0DA 2IEKA 3HRTA 1K4TA 3L2VA 2H6BA 2DMQA 1EF4A 2NVXJ 3OYHA 4U88A 4LIVA 4CZCA 2NXNB 5J4VA 1DPUA 5FRNA 4Z6YA 4BDYA 3ZGKA 5BPDA 1K61A 3O8HA 4QPQA 1H8AC 5DM7F 5E3LA 2CUJA 2ZNZA 1H9GA 1ON1A 3AG1H 3EQLF 1JHHA 4KUMA 5ICCA 5LHHA 1ETXA 3FXJA 1ETYA 1XGSA 2HTSA 4XKVA 2DPDA 2KFDA 4KICA 4LLGF 1MMGA 1YRNA 3BTJA 2DU9A 3DU6A 3JW4A 4CGZA 1DU6A 3W6JB 5F0HA 3MD2A 1J09A 3WU0A 1IV6A 1W36D 4A3CJ 1P7IA 5E79C 5ICEA 1V5EA 2K9QA 1VQ4I 2EB7A 3SJMA 2E1MB 4LLNA 4F52A 1OCCH 3K1NA 5ICGA 4OOIA 2YPRA 4N9HA 2K4JA 3ASNH 1I50J 2QQBA 3JREA 4RMNA 1IO2A 5ILVA 2JN6A 4AVZA 3HOUJ 1R58A 1JJ8C 2DDAA 2QZ8A 3G1LA 2QKMB 5TISC 4Y15A 1MMSA 2IS2A 4KJZA 1SFEA 4CYCB 2A5YB 3OIQA 1DPRA 4UVBA 4A12A 4XONA 1R49A 1G2HA 1JTXA 1Z3YA 2QYOA 1U5TA 5ILSA 1W36C 3HYIA 2R7SA 1TWCJ 1X1PA 3R4KA 2JQ7A 2V26A 3FISA 3KPHA 3DKXA 3LWFA 3KLNA 2ZMEB 3Q0UA 1XMXA 2FRHA 2FBIA 1R22A 2LKPA 4IZZA 4MEXF 1S6LA 4C2MJ 2WA0A 3O3KA 1NG7A 4JX6A 3HOZJ 3L9FA 4A6DA 2BBYA 2OBPA 4YFXF 1XGMA 4BUPA 1QU3A 1MD0A 5L3BA 2GOMA 5CQGA 5LHIA 2B63J 3GTQJ 1X1CA 2XAHA 4Q48A 4BHPA 1R5GA 4DW6A 4Y13A 3PIOF 2OCEA 1IXRC 4IHSA 1ZK8A 2DK8A 4E70A 4ZZDA 3TP3A 5GTIC 4M74A 4D0PA 3AFHA 4DOZA 2MLGA 3DPLC 4A5MA 2CWEA 1ONVA 3ZP5A 4DYQA 1IXSB 3CJQB 4CO8A 1S7EA 2ISZA 1Z6TA 3GX4X 2EZIA 1P4WA 1QRYA 3FXMA 3DQVC 2COBA 2IPQX 2HU9A 4RB0A 3TKYA 1VFCA 4ZDPA 1A6QA 3K1MA 3KEYA 5E8GA 2J5OA 5FRMA 3JRFA 2BW3A 3CDHA 5K5RA 4YRVA 1RKTA 2ZXHA 3ERMA 4QSHA 3QYBA 4NB5A 1FC3A 3NEUA 2VE9A 2YU3A 2E2JJ 3CCRI 2EA4A 4A0XA 1T56A 4IOAF 1O3RA 3CCLI 2VBWA 3I59B 4R79A 1D5VA 4BQQA 3FF5A 3FKIJ 3ECHA 2Z99A 3N4MA 3HGYA 1FT9A 3OMYA 1G3YA 1APLC 2V1NA 3GW2A 2MYSA 1ENHA 1I3AA 2F4OB 3TDZC 2DQRA 5C4JJ 1Z7UA 3KYDB 3ELKA 4HV6A 2DFFA 2Y31A 2DMNA 4C3IJ 3BLYA 1P6RA 3TGNA 2M7AA 3MKZA 3PJRA 1W5CC 1BOAA 3K10A 2YX7A 1UJ8A 2O6GE 2EBIA 4C3JJ 1Z9CA 5CVRA 3E3VA 1X1AA 1P9QC 2F5FA 2MH2A 2EFOA 2QCOA 3B73A 2QLZA 5HS8A 3HRUA 1LFBA 3CUQB 2XPVA 4F93B 2VPLA 1PJRA 5FKMA 1BL0A 2FA5A 5KNLA 3BPVA 2L9NA 2F5DA 3ASOH 3HOSA 1MKMA 4BGDA 4IOCF 3CTAA 5JVGF 3D5SC 4AU7A 3HUGA 3LA2A 2KISA 1OCZH 3GFJA 2JVHA 4NNJA 4WXCA 1GXQA 2F2EA 3T8TA 1UFMA 1LE8B 4A3DJ 1MW7A 2CW0F 3CCQI 2V1DA 5E18F 3LQRA 2R7XA 3O8GA 1X4OA 4P1WA 4X0GA 2AQEA 3IH4A 1VQKI 3MQ0A 2VUMJ 3GFIA 4LOCA 1E3OC 2HDCA 2JA5J 3M1EA 3M8FA 2KZVA 1SC7A 1A35A 3CDIA 4EJWA 3P9IA 4MHGA 3LAJA 2ME6A 1ZR2A 1QPMA 3JTHA 4HG2A 1Y1WJ 5J8CA 2PJRB 1JGSA 5D8LB 3ABMH 1FBSA 3A03A 1DGRM 4CCNA 5FLMJ 2ZC2A 1IDYA 1YS7A 5CKTA 4BDZA 1O3QA 2IS6A 5FKOA 1JT6A 3FIWA 2M8EA 4ON0A 2HS5A 2BEOA 3TBIA 1YI2I 1T6SA 4PJLA 3E7LA 1YFHA 3CP8A 3JR9A 3NARA 4Y17A 1MDMA 4I02A 4E7SA 1X1DA 4MEYF 5HLHA 1TZLA 2XRNA 1GUUA 3OY9A 2X6YA 4OIPF 1IAWA 1AWCA 1QBJA 2XIGA 1QVTA 1EJ9A 5B1AH 1D1AA 2E60A 2LBFA 1FPQA 3MFKA 1LQ1A 6PAXA 1O7FA 4BYYA 2DFEA 1BR4A 1I5ZA 2CH0A 4NDLA 5K5OA 3HRSA 2HZTA 2YU9J 4FQGA 4WCGA 5FLXK 1K83J 2OZUA 5JHUA 3L2UA 5GADJ 3C3WA 2A68F 1IUYA 1BR2A 2EIMH 1O3TA 3OSGA 3F23A 4IKFA 1WI3A 2JA2A 3GVAA 4YFKF 3DBHB 4UVCA 3WTZA 3IV5A 3GLXA 3K4MA 3GXOA 1LDJA 1R6RA 4XRFA 4ANJA 3D5LA 1E17A 4RAGA 3PNYA 3HKZN 2RNGA 2VI6A 1BOBA 1IN7A 2VB6A 1FOKA 1ODDA 2CW8A 2CUZA 2QQ8A 3BR0A 3MVPA 4PJNA 1VQ6I 4AM3A 4KNYA 4LK1F 4MQ9F 3BZCA 3QPLA 5HNFA 1GDTA 2CQXA 2P5KA 3K4CA 2VPRA 3RPUD 2EV5A 4Z2YA 2P0WA 2EILH 3I55I 4GFBA 1X58A 4OIQF 3A0BC 5FB2A 3CMYA 1YJ9I 1XCVA 1D8KA 2LSOA 3KX2A 3RQ4A 3BPXA 4XLNF 2CQKA 3CCJI 5CVJA 1FBQA 3W6KB 2XF5A 2HQNA 2WC2A 1ZKGA 2CUFA 4D7NA 3P5JA 4FE4A 2PLYA 2DYSH 2DA7A 2XAQA 4NQWA 4BXUA 3MZYA 2B0LA 1T39A 5B5EC 5HVQC 2YR2A 3GTMJ 3OIOA 3V8KA 2B9SA 4HSRA 3H5AA 3VSLA 4FASD 2BY3A 1XC5A 1KQ9A 2XASA 3LA7A 4EVIA 2MC3A 3DWLE 1T33A 3LMMA 4ZC3A 1U78A 4D9JA 1UAAA 3KP5A 3VYRB 2GXBA 3K6GA 2CQ7A 2HOAA 4KIGA 3AL0C 3KP3A 2W48A 4EATA 4YELA 4EM2A 4BEHA 5FKNA 2QUFA 1DUXC 4BU2A 5K7ZA 2Z5UA 5E1WA 4ZYEA 3BQYA 3KE2A 4LG0A 3H36A 3DF8A 4DZJA 5AONA 2XAUA 3BG6A 1UHWA 2W82A 2DYRH 4A3FJ 1UHMA 1R5HA 4Q5SF 1TNTA 2MA3A 4PDKA 2ELHA 4WWCA 3I53A 3SEQA 3L2WA 2JT1A 4I0BA 4N4NB 5EZGA 3JRHA 3OYBA 3S1QJ 3F22A 2CMPA 3F8NA 4KN4X 3UNGC 1FOXA 3GLLA 4AYBA 4XOTA 2NVQJ 2H09A 2VC0A 3SXYA 2DN0A 2GXGA 2WAQN 1VQMI 4UUVA 5FKLA 1F5TA 2YUSA 2JA6J 1V3FA 2HXIA 2MG4A 1LNWA 2DK5A 4HNVA 3S3OA 1ZGWA 3WU2C 1HLVA 1R4MB 2GOXB 4MGRA 5DEQA 3LA3A 2V9VA 2M30A 1HDPA 2I8DA 3BJOA 2WAFA 2UUZA 2KRCA 5E3NA 2JWTA 2HPIA 3EETA 3QWLA 4P5OA 5E1XA 4KT5C 2XGEA 4XLAA 1ETOA 1OCTC 2BW3B 1LPQA 3DKWA 5H6QA 5D5WB 3W3CA 2MD0A 1I1GA 3NWTA 2LMDA 3V8JA 3J81K 3E5XA 3BR2A 1J75A 1J5YA 4RB1A 1WJFA 1T95A 4EV0A 1D5YA 3CF2A 1MBFA 1V5GA 3HPGA 1TQIA 1OR7C 2VT3A 1RC9A 1S8NA 4ZDLA 5EEGA 3ZN0A 3TW7A 2PI0A 2Y9YA 3D0SA 4PSWA 1CQTA 2PFBA 3LSHA 3M3YJ 5FD6A 3DFGA 2WTEA 3VPRA 2DJIA 2CV2A 4P9UA 1KYZA 3GTJJ 1XD7A 2FMYA 2L0KA 4EMSA 2EFQA 5KK1A 1ORKA 1KGSA 2DA6A 2KLOA 1R00A 2LKXA 2OJED 2FOWA 4M71A 4A3KJ 1IJWC 4CCJA 2Y0SA 3IH2A 3L2RA 5F08A 3Q3SA 4WX9A 3L00A 1XGOA 1DDNA 1B8IA 2XKPA 4JQFA 3VSKA 1Z3XA 1LEBA 5BQTA 2DI3A 4PJMA 4DQ2A 3G1OA 2NS0A 1XTAA 3PIPF 2EPFA 3M8JA 3HUGB 1B72A 3CESA 1DQUA 1SVMA 1UCRA 5L3EA 1W0UA 4RGXA 1LFUP 2F5VA 4HDUA 3L7WA 3JCUC 2KRFA 2KJCA 5E8IA 1U0JA 2FU4A 2GWRA 2KZGA 3ABKH 2A69F 3CJRB 4BJ5C 3RKYA 1MJ9A 4KIBA 2OQGA 4HF0A 3KEQA 2FF4A 3QPTA 2LR8A 3BCBA 2M4GA 1IC8A 4A3BJ 2ZCWA 1VZ0A 3K1PA 2UZKA 2A6HF 1HA8A 2NRAC 1JKOC 3IHUA 1HQCA 3F72A 1SMTA 3PFYA 3RPQA 2R5YA 1K7AA 4MLOA 5JHFA 2UWMA 5E3OA 1DGWY 2L9RA 1XSVA 1TWFJ 2KIMA 1IRFA 2K3FA 2QGUA 2VXDA 5D4SA 3OYJA 2BXYA 1UG2A 1BA5A 2X51A 2IGNA 2JPBA 4CXFA 1MDMB 2WB1A 1OFCX 2QEXI 1RUOA 2VIXA 4A3JJ 2EFPA 3EDPA 4U0WA 3GTGJ 1W1WE 2LFBA 1SAXA 1QZZA 3HSFA 3PUBA 2ESHA 2LY9A 3GO5A 2XAFA 5DV5A 2QQ9A 5LGTA 2PMUA 3RKQA 3GTKJ 3FKJA 3WTUC 3GCMA 2PEXA 2ETHA 2DMTA 2QVOA 1RESA 4ITVA 5FKKA 1A31A 5JFRA 4R8HA 4AIHA 1W7PA 3S16J 3BC8A 3Q5FA 2VJ4A 4BY1J 1Y8RB 3C2BA 5DTDA 2VQGA 4M3GA 5C44J 2KDZA 2DW4A 3OS2A 2DMPA 1D1BA 2OUMA 3PFIA 4UUSA 5FJ8J 1I39A 1POGA 1H88C 2EINH 1S7OA 2DLLA 3WE3A 2HPMA 2QENA 1YYVA 4GYGA 4DYCA 1QA6A 4LFUA 2FMLA 4C3HJ 5HLGA 1I6HJ 1BR1A 2A07F 2FEZA 3G2BA 1Z7LA 3IRQA 3OYKA 1QO0D 2MD5A 5KAFC 4J00A 2WV1A 2ZBKA 4G7ZF 5CYVA 1ZQ3P 1MH3A 4G8XA 2R93J 4OWRB 3F3XA 3HL2A 2LC2A 2X6WA 3S32A 1SD7A 3C2GA 5J1RA 3LSPA 1TW3A 3ZQGA 2M45A 4ABZA 2F4MB 1ERDA 3QYEA 5J47A 2DT6A 1YW8A 2O3FA 2QWWA 1ZTRA 1D3YA 3HHHA 1A6IA 3PO2J 3KIOA 4S05A 2CO5A 1Z91A 3CC7I 4IVNA 1IDZA 1SVOA 3AG3H 2IGKA 2FX0A 3I56I 4CCMA 1RR8C 3QRFF 1LE8A 4NC6A 2R3SA 3OYFA 3A01A 4KISA 1JJ6C 3I58A 2FNPA 2VBXA 1MMAA 2ZJ2A 4HX4A 2XSJC 2WBMA 1YOVB 1MNMC 4L0YB 1YE9A 2LK2A 4F3QA 2O61A 2MLKA 5GTHC 5IP6A 2E19A 5GPCA 1ON2A 2NAZA 4ETSA 5HNHA 2HGCA 4AC0A 3GZNB 5IT9K 1BI1A 3HPHA 2VOOA 3ZQ7A 1NTCA 2L4AA 3HGGA 2ZNYA 3B02A 3PQJA 1LVAA 2L7KA 4Y3OA 1B59A 5FGMA 4JYKA 3VYSB 3N05A 4EGYA 2YSRA 4ENNA 3J81Z 3RZDJ 5J8FA 2OCCH 1AA7A 3L2QA 1XPXA 1YW9A 4IXAA 3WTSC 4CCLA 5EDNA 2A5WA 2HFHA 2FE3A 2KP6A 3ZQLA 3CUOA 3ESWB 4N9IA 2X6OA 2OPTA 4N0BA 5DM6F 3A4CA 4I2OA 3RSNA 4XRSG 1QNTA 5LEKA 2L2OA 1G8XA 4UB8C 1OMIA 1WH7A 5EGOA 2MABA 4GCVA 4HA8A 4X6AJ 4M3BA 3PNVA 4R1HA 4KIFA 1SD6A 4LLLA 1YO5C 2KRHA 1ZR4A 1IRGA 2MH9A 2DT5A 3KZIC 4L9VA 3HB9A 4HQMA 2HR3A 1O3SA 4PSXA 1H9TA 2P7CB 2IS1A 2K5CA 4XSXF 1MBJA 2P6SA 4IHWA 3HG9A 4C30A 3QPSA 2XGXA 1OR7A 4BJ6C 5M5XJ 2BOLA 1BW6A 2W85A 3N97A 1KU7A 1KU9A 2VE8A 2Q8KA 4EM1A 2M1BA 4S0HB 3HSEA 3RKWA 1MZBA 1PVEA 2M34A 2OQRA 3K4BA 3WTVC 2HEOA 1VQNI 4E4HA 5LGUA 1TW2A 1MJAA 1H0MA 3PO3J 2DT7B 3CZ6A 4HW0A 4V2GA 2IA1A 1VQ5I 2Z3YA 2LKSA 2W24A 1ZAOA 4MTEA 2XGCA 4EJOA 3PL8A 3DTEA 4AYBN 1S3JA 3U9GA 1VQ7I 3WTTC 4PZJA 1ZARA 4XMYA 4MNUA 1JUMA 2VKEA 3QYFA 3I5UA 3RIRA 2MGQA 3C18A 3CCUI 2X6XA 5DCMB 4XL9A 2HVRA 4BXXJ 2LY1A 4FCYA 4GGGA 2BHYA 3S1RJ 2R7TA 2NYXA 5EG0B 2IXSA 3OYMA 1LKXA 5CVIA 3SHFA 2CQQA 1PP7U 2Y0MA 3SZTA 3BR1A 4OIRF 1B8IB 3ROUA 2DJNA 3DEUA 2XRLA 4I01A 1FEXA 4D1QA 2JRTA 2OF7A 4G6DA 4L5EA 2XPWA 3BWGA 1B72B 1WJBA 3H3VK 4XKCA 5E3MA 4IHVA 3JAMK 3A2KA 1SFOJ 2X1CA 3M1CA 4HNTA 3OS1A 4D5FA 2FJ1A 5CVUA 5HDKA 2HVQA 3F8FA 3I0TA 2CV1A 2ESNA 1GV2A 3LQQA 5J6XA 1R1TA 3DEEA 1X4PA 4EM0B 3H5NA 3KZYA 2EK5A 4QTRA 3OR1C 3ZPLA 3DV8A 5IY5H 2AQFA 4W1UA 3G1MA 1QHGA 1N25A 2ISYA 1T2KA 2D45A 1P92A 5KVRA 3I9V2 3TW6A 3A1YA 1LDDA 4RB2C 1WRJA 1FYKA 1HW1A 4MIMA 2HI3A 2Y0SN 3D5RC 3CCEI 5HLTA 2Q2EA 3HM5A 2V4JC 1YQAA 4BHBA 1IN5A 4BL0B 3U1DA 2M5WA 3GTPJ 1JT0A 2R7ZJ 4AD9A 2VONA 1HW5A 1UZCA 4Y52J 2GM4A 1R5ID 2R7VA 5CJ9A 1PUFA 3HXLA 1Q1HA 2R7QA 1WGXA 2F5CA 3F0CA 3PSIA 4ZYAA 3ABTA 4DIQA 1ZRDA 4A93J 4MQVA 3L1PA 3S1NJ 5IT3A 3K0LA 1CGPA 2E1NA 2KL4A 2L7ZA 2EH3A 4YIRX 2DCEA 5FLVA 1BIAA 1TC3C 5A2QK 2RC4A 2X4HA 2H1KA 3KFWX 1S5LC 3BOQA 2ID3A 2PMHA 1U3EM 1T98A 2I5UA 3CJTB 1MBHA 2XAJA 2DPUA 4EJTA 3OOUA 1BBYA 3DLAA 3RTRA 4C2UA 4AUXA 2XPUA 1KU3A 1RZ4A 2OAZA 3LSTA 2Y75A 5EZHA 4F7ZA 5IPAA 4L9NA 4W97A 2CUEA 2M0MA 1TNSA 2AO9A 2K02A 1I6XA 2R5ZA 1VQPI 3LNQA 2WB1N 4NC8A 5EEHA 4UUTA 2Y48A 1YHQI 1PUEE 1TWGJ 2YX4A 2VC1A 2ZMEC 3UKGA 1OJLA 2KJBA 1WJDA 3TOAA 4E7KA 4XK4A 5LEJA 4KFCA 1K4SA 3TP0A 1X3UA 4MO7A 4OMYA 3DKYA 2V7FA 3MEXA 3FXKA 3WTXC 2A6TA 4LGWA 1LJ9A 3QOEA 3K70D 3G71I 1A36A 2ZXIA 5ERIA 2JUGA 2V79A 5C3EJ 2IAIA 2KMUA 1VF9A 1G4DA 1HXDA
chains in the Genus database with same CATH topology
3NQOA 2EJRA 1W7PD 3I4PA 4BH9A 2HQRA 3Q9VA 2STTA 2OU2A 5HDNA 4GO1A 2CFXA 4BQAA 2PG4A 2Z33A 5LHGA 2DFIA 4IHTA 1D8JA 4UVAA 4UNOA 3GZ5A 4GXOA 1IW7F 4M9SA 3IKVA 3E5UA 3E6CC 4CDGA 1JHFA 2BV6A 3E6BA 1R1UA 4DNCA 1IN6A 3ZMUA 4HYEA 1TBXA 5HDGA 3K9TA 1G3SA 5ED4A 4KYWA 4A5NA 1LDKB 3NRVA 3QOPA 3COAC 2P7VB 1ZGJA 1ZHFA 2FBHA 3WTYC 3CLOA 1I1SA 2PJPA 2ZXJA 1USSA 5DDGA 2CSOA 3BZ6A 1R7JA 2DBBA 3ULQB 2QBYA 3FXUA 1ZRCA 1U5TB 2IA2A 5H20A 3DP7A 4LD5A 1CF7A 3KLOA 1G6NA 4G7HF 1EH7A 2L01A 4M72A 4BHCA 1PDNC 4RAZA 4AIKA 1IXCA 1SD5A 3VFZA 4I98B 1S29A 1KYWA 1YIOA 1B1BA 1FP1D 2EFWA 1W5SA 4G6QA 3MCZA 3BJ6A 4K2EA 3C7JA 1FY7A 2GIVA 1F4KA 4FX0A 2MBFA 2H94A 5JR3A 3MWMA 3LFKA 4HOBA 5ICFA 3M8EA 3WGIA 2RQPA 4RB3C 1TLHB 3I54A 4BAYA 1K78A 4P9FA 3FM3A 2DAOA 2P5LC 1OKRA 4KN7X 1ZREA 3WU1B 2IW5A 1HSTA 1BI0A 3H92A 4JBAA 2STWA 4ESBA 2P6TA 3FMRA 3P9CA 2F5EA 5D5XB 2P4WA 5HS9A 4A0ZA 2VBZA 3KEOA 3E97A 1OYIA 2ZKZA 2FXAA 2VT2A 3TO6A 4HF2A 3IKTA 1MJBA 3FHZA 3BDDA 2O8XA 1J9IA 2G9WA 4IRHA 4IRGA 3SQNA 2ZMEA 1FSHA 2E7WA 3GUDA 3RI4A 5D4RA 3VODA 4ESJA 2XVCA 5FLXZ 2LDUA 2L54A 5DUIA 1AOYA 5L3FA 2PN6A 3EUHA 1ZG3A 2X0LA 5D6FA 3R0JA 3TDUC 4XBFA 5HOOA 5TJJA 2CYYA 3JSPA 2A61A 1FSEA 2AS5F 2HKOA 3H3ZA 3RYRA 1FX7A 1RNLA 4A6EA 4XSZF 1J0RA 3HHGA 1U8RA 4CICA 3KCCA 3WG9A 5BOXA 4M6XA 1K79A 3M9AA 1WSUA 2EFNA 3I71A 2RGVA 4LB5A 1EV7A 4JK1X 3IC7A 4CYDA 2COMA 4PCQA 4WK8F 2J5PA 1KQ0A 2RNJA 4LJZF 2NNYA 3R61A 5F1RA 3GFMA 4I7HA 4EJVA 2VODA 3R6SA 3VEPA 1DP7P 2O0YA 2EWNA 1ZN2A 4UV8A 1P4AA 4YG2F 1W5TA 3F8BA 4U0YA 3E6MA 1BI2A 3DXJF 1IF1A 1BIBA 3K69A 4GYIA 1EH6A 3RJPA 4PGGA 2TDXA 2IRFG 1S7AA 1K6OA 3OOPA 4HX7A 3JTGA 3F8CA 4U7BA 3QPHA 3F8MA 1XMKA 3ZN1A 4PGHA 4P55A 1SFXA 4OINF 3ABUA 4HLXA 4IRIA 3HSRA 4WXDA 1FYLA 1ZGAA 2GA1A 4I0AA 3BJAA 1XSXA 1FBUA 2JZYA 4ENMA 5E1ZB 1CF7B 2A3SA 4LG0B 5LLQA 2GA2A 2IA0A 1BC8C 1J59A 3VOEA 1ZLJA 4O3MA 2FOKA 2D1HA 5BPIA 2WWYA 3TOBA 5BS6A 5D8KB 2PQ8A 2XV4S 4AIJA 3JSOA 1IN4A 1JXSA 1USTA 3V8LA 3K2ZA 4AVPA 4KA4A 5F64A 4L9JA 2V1XA 1B6AA 1E2XA 1XCBA 5FD5A 5AIPA 1K78B 1OYWA 5FFXA 4RS8A 3IRRA 3HTSB 1ZRFA 2M87A 1KA8A 2ADUA 4YIFA 2ACJA 2RKHA 3WGGA 1L0OC 5ILUA 1HKQA 2K86A 1OYYA 4M9XA 2VXZA 2IJLA 3ZMSA 3P7NA 3VB2A 2XHKA 4A2UA 4IF4A 3TO9A 1FLIA 4RGUA 2OZ6A 1HKTA 1FZPB 3S2WA 1QGPA 2FNAA 4OMZA 4Q4ZF 3FMSA 1BN5A 1BM9A 2P5VA 1U2WA 1FWZA 4BNCA 3ERED 4EQQA 4ZYDA 4LB6B 3KP2A 1T38A 4M6YA 1XDSA 5E17F 2K4BA 2FSWA 3P9KA 4CZZA 4HDVA 2JSCA 2JPCA 4ESFA 2ZO4A 3HOTA 3CO7C 1Z05A 1FNNA 1XN7A 1QZYA 4AWXB 2QM3A 3MAJA 2BYVE 2CGPA 4LMYA 2W25A 3AAFA 2GAUA 4B8XA 2DTRA 5DCFA 1XSDA 2XUBA 4L5IA 1O57A 3SFZA 5JI6A 1ZG1A 3J80K 1B9MA 1W7PB 1WKMA 3E6DA 3PQKA 1KQ8A 4IPAA 3F6VA 1B9NA 5LGNA 4ZZLA 2W84A 2KIFA 4ZYHA 1PP8F 3KP7A 5IT9Z 1W4MA 1GXPA 1WI9A 5DYMA 1YW7A 1ZH5A 4ENJA 2W57A 4UXNA 2FQ3A 4HV5A 3TO7A 2QQAA 3L2CA 3QP5A 1FP2A 5AIQA 3ECOA 3J7AO 3V4GA 4ZYGA 4UHTA 3FX3A 2O03A 3IWZA 1LEAA 5L3CA 1O7LA 3ML6A 5FO5A 3EYYA 3RYPA 5E20A 4WF2A 3ISPA 3F21A 4ZH4F 1R36A 3OV8A 2P8TA 4YIIA 3IL2A 1GHCA 1NHAA 4FT8A 4HX8A 2LF7A 2Z9OA 3QP6A 2R7FA 2A6EF 2AXLA 5H6RA 1FYMA 3ZMVA 1TQMA 1V4RA 1LB2A 4M9ZA 4XLPF 4EJUA 5LRRA 5DD4A 2R7DA 4A0YA 5D5VB 2VBYA 3FM5A 1IN8A 3F6OA 2RVCA 2IT0A 1BJAA 2VN2A 1F9NA 2CG4A 1YS6A 2HOEA 1UB9A 2L02A 4B09A 3U2RA 4HLYA 3V7RA 2H6CA 1JE8A 3HIFA 1YTYA 3FZVA 5DUKA 1I27A 2K7LA 1SMYF 5L3GA 4FX4A 3RDIA 3L09A 3CUQC 1KU2A 1C0WA 3JAMZ 1QQIA 3V7SA 1J7KA 1T0FA 5BMZA 3GEZA 2GQQA 1XDUA 3I64A 4QLCU 4HQEA 2NNNA 5HLIA 4YFNF 2IVMA 4LK0F 3WGHA 2V1UA 1R23A 3GWZA 4MTDA 4H0EA 2HKXA 4OU0A 5F6FA 2JTVA 2HWVA 1WQ2A 2LNBA 3WODF 3BROA 1WWXA 4L5JA 2XAGA 4G9YA 3KP6A 1EH8A 2OA4A 5L3DA 4U0VA 1REPC 5LRSA 1IZ1A 5JVTA 4TV7A 3IWFA 3J80Z 3R0AA 3FXQA 3SZPA 2G7UA 3WE2A 1RIOH 1GVJA 1HW2A 5A2QZ 2HYGD 3T0YA 4G94A 4HF1A 3M7GA 4HAMA 2UXNA 1HSJA 4I09A 1F1ZA 3KP4A 3LAPA 4M73A 3T1BA 5D5UB 3KZZA 4P96A 4Q47A 3G3ZA 3ZMZA 2L3DA 2RN7A 1ZLKA 3GFLA 1HBXG 3Q9SA 3FMQA 4O5VA 3FXRA 3O2PE 2DQLA 3BY6A 4EGZA 2HTJA 4L9TA 5D6EA 1HKSA 3HTUA 4HZFA 3EYIA 5HS7A 3ZMTA 4CHUA 1SFUA 1MGTA 3QU6A 5DCMA 3H3UA 2RDPA 3CJNA 4L0ZB 2G7HA 4RGRA 2C6YA 4G7OF 3T8RA 3GYHX 5CVVA 4NHJA 4OIOF 1U5TC 2ZFWA 2BE5F 4KDPA 1G3WA 5CLSA 4ENKA 5K1YA 1BC7C 3CO6C 1ULYA 3C1DA 2HYFA 3ZMDA 4ASNA 1RI7A 4WXHA 1XB4A 2D1VA 3O6BB 1TTYA 1U6GA 2EV6A 2E1CA 5TRDA 4FHTA 3KETA 4RGSA 4UV9A 3I59A 2UXXA 5FFZA 3GZ6A 1YLFA 1Z1DA 2RV8A 3G73A 1RUNA 2BGCA 2VOPA 2K27A 2E7XA 2EV0A 3FWEA 4O6JA 2GZWA 4RAYA 2EA2A 1J2XA 2KKOA 1STZA 3CUQA 2FBKA 3BP8A 2LF8A 1ZG5A 1A04A 1BI3A 1Y0UA 5DD8A 2WV0A 3QU3A 1B4AA 1G3TA 3R60A 1Z6RA 3QAHA 1P2FA 1SD4A 1TQPA 3V7CA 2PBIA 3GF2A 4S04A 2L4MA 3RPUA 1R1VA 1L3LA 2XKOA 3MZHA 1P4XA 1ZYRF 3T5XA 2V6CA 2QBYB 1VTNC 3HRMA 4QWQA 2OD5A 5K5QA 2Q0OA 2KIUA 3TQNA 1OPCA 1YG2A 1XGNA 4KMUX 2XROA 3DPTA 4HBLA 3WTWC 2DO7A 3RKXA 1XMAA 4KMFA 4L18B 4U7DA 2IP2A 4IJAA 5LBQA 2D2WA 3REOA 2H27A 3HRTA 2H6BA 4U88A 1DPUA 5BPDA 2ZNZA 1H9GA 1ON1A 3EQLF 1JHHA 4KUMA 5ICCA 5LHHA 1XGSA 2HTSA 2DPDA 4KICA 4LLGF 2DU9A 4CGZA 3JW4A 3W6JB 3WU0A 5ICEA 2EB7A 4LLNA 3K1NA 5ICGA 4OOIA 2YPRA 4N9HA 2K4JA 2QQBA 5ILVA 1R58A 2QZ8A 4Y15A 1SFEA 2A5YB 1DPRA 4UVBA 4A12A 2QYOA 1U5TA 5ILSA 3HYIA 3R4KA 3LWFA 3KLNA 2ZMEB 2FRHA 2FBIA 1R22A 2LKPA 4MEXF 1S6LA 3O3KA 3L9FA 4A6DA 2BBYA 2OBPA 4YFXF 1XGMA 1MD0A 5L3BA 5LHIA 2XAHA 4Q48A 4BHPA 1R5GA 4Y13A 1IXRC 4IHSA 2DK8A 4E70A 4ZZDA 4M74A 4D0PA 2MLGA 3DPLC 4A5MA 2CWEA 1ONVA 3ZP5A 1IXSB 4CO8A 2ISZA 1Z6TA 3GX4X 1P4WA 3DQVC 2IPQX 4RB0A 3TKYA 3K1MA 5E8GA 2J5OA 3CDHA 5K5RA 4NB5A 1FC3A 3NEUA 2VE9A 2YU3A 2EA4A 4A0XA 1O3RA 2VBWA 3I59B 4R79A 1D5VA 3FF5A 3ECHA 2Z99A 3N4MA 1FT9A 1G3YA 3GW2A 3TDZC 2DQRA 1Z7UA 3ELKA 4HV6A 1P6RA 3TGNA 1BOAA 2YX7A 2O6GE 1Z9CA 5CVRA 3E3VA 2F5FA 2MH2A 2EFOA 3B73A 2QLZA 5HS8A 3HRUA 3CUQB 2FA5A 3BPVA 2F5DA 3HOSA 1MKMA 3CTAA 3HUGA 3LA2A 3GFJA 4WXCA 1GXQA 2F2EA 3T8TA 1UFMA 2CW0F 2V1DA 5E18F 3LQRA 3MQ0A 3GFIA 2HDCA 3M1EA 3M8FA 4EJWA 3P9IA 4MHGA 3LAJA 1QPMA 3JTHA 5J8CA 1JGSA 5D8LB 1FBSA 1YS7A 1O3QA 2M8EA 4ON0A 2HS5A 2BEOA 1T6SA 1YFHA 4Y17A 1MDMA 4I02A 5HLHA 4MEYF 2XRNA 4OIPF 1IAWA 1AWCA 1QBJA 2XIGA 1FPQA 3MFKA 1LQ1A 6PAXA 1O7FA 4BYYA 1I5ZA 5K5OA 3HRSA 2HZTA 4WCGA 5FLXK 2OZUA 5JHUA 3C3WA 2A68F 1IUYA 1O3TA 3F23A 4YFKF 3GVAA 4UVCA 3WTZA 3GLXA 3GXOA 1LDJA 4XRFA 3D5LA 1E17A 1IN7A 1FOKA 1ODDA 4KNYA 4LK1F 4MQ9F 2P5KA 2EV5A 4Z2YA 4OIQF 5FB2A 1XCVA 1D8KA 2LSOA 3BPXA 4XLNF 2CQKA 5CVJA 1FBQA 3W6KB 2HQNA 2WC2A 2PLYA 2XAQA 4NQWA 4BXUA 3MZYA 2B0LA 1T39A 5HVQC 2YR2A 3V8KA 1KQ9A 2XASA 3LA7A 4EVIA 2MC3A 1U78A 3KP5A 2GXBA 4KIGA 3KP3A 4EM2A 2QUFA 1DUXC 2Z5UA 5E1WA 4ZYEA 3KE2A 4LG0A 3DF8A 5AONA 1UHWA 1UHMA 1R5HA 4Q5SF 1TNTA 2MA3A 4PDKA 2ELHA 4WWCA 3I53A 2JT1A 4I0BA 3F22A 3F8NA 4KN4X 2H09A 2VC0A 3SXYA 2GXGA 4UUVA 1F5TA 1V3FA 1LNWA 2DK5A 4MGRA 5DEQA 3LA3A 2V9VA 2M30A 3BJOA 3EETA 4P5OA 5E1XA 4KT5C 3DKWA 5H6QA 5D5WB 1I1GA 3V8JA 3J81K 3E5XA 1J75A 1J5YA 4RB1A 4EV0A 1TQIA 2VT3A 1S8NA 5EEGA 3ZN0A 2PI0A 3D0SA 2PFBA 5FD6A 3DFGA 2WTEA 4P9UA 1KYZA 1XD7A 2FMYA 4EMSA 2EFQA 5KK1A 1KGSA 1R00A 4M71A 4WX9A 3L00A 1XGOA 1DDNA 2XKPA 4JQFA 1LEBA 5BQTA 2DI3A 4DQ2A 2NS0A 1UCRA 5L3EA 4RGXA 4HDUA 3L7WA 2KRFA 2KJCA 5E8IA 2FU4A 2GWRA 2A69F 3RKYA 1MJ9A 4KIBA 2OQGA 4HF0A 3KEQA 2FF4A 3QPTA 2ZCWA 3K1PA 2UZKA 2A6HF 2NRAC 3IHUA 1HQCA 3F72A 1SMTA 3RPQA 1K7AA 2UWMA 1XSVA 2KIMA 1IRFA 5D4SA 2JPBA 4CXFA 1MDMB 1RUOA 2EFPA 3EDPA 4U0WA 1SAXA 1QZZA 3HSFA 2ESHA 3GO5A 2XAFA 5DV5A 2QQ9A 5LGTA 2PMUA 3WTUC 2PEXA 2ETHA 2QVOA 5JFRA 4R8HA 4AIHA 1W7PA 3Q5FA 2DW4A 3PFIA 1S7OA 2DLLA 3WE3A 2QENA 1YYVA 4GYGA 4LFUA 2FMLA 5HLGA 2A07F 2FEZA 3IRQA 1QO0D 2MD5A 2ZBKA 4G7ZF 5CYVA 4G8XA 3F3XA 1SD7A 1TW3A 2M45A 2O3FA 1YW8A 2QWWA 1D3YA 3HHHA 4S05A 2CO5A 1Z91A 4IVNA 3QRFF 2R3SA 3I58A 2FNPA 2VBXA 2ZJ2A 4HX4A 4L0YB 2O61A 2MLKA 1ON2A 2NAZA 4ETSA 2HGCA 5IT9K 1BI1A 2VOOA 3ZQ7A 2L4AA 2ZNYA 3B02A 3PQJA 1LVAA 5FGMA 1B59A 4EGYA 2YSRA 4ENNA 3J81Z 5J8FA 1YW9A 4IXAA 3WTSC 2HFHA 2FE3A 3CUOA 4N9IA 4N0BA 4I2OA 1QNTA 5LEKA 1OMIA 4GCVA 4HA8A 4R1HA 4KIFA 1SD6A 4LLLA 1YO5C 1IRGA 2MH9A 2DT5A 4L9VA 4HQMA 2HR3A 1O3SA 1H9TA 2P7CB 4XSXF 2P6SA 2XGXA 1OR7A 2W85A 3N97A 1KU7A 1KU9A 2VE8A 2Q8KA 4EM1A 2M1BA 3HSEA 3RKWA 1MZBA 2HEOA 2OQRA 3WTVC 5LGUA 1TW2A 1MJAA 1H0MA 4HW0A 2IA1A 2Z3YA 2W24A 1ZAOA 4MTEA 4EJOA 1S3JA 3U9GA 3WTTC 4PZJA 1ZARA 4MNUA 3I5UA 3RIRA 3C18A 5DCMB 4GGGA 2NYXA 5CVIA 3SHFA 1PP7U 2Y0MA 3SZTA 4OIRF 3ROUA 3DEUA 4I01A 2JRTA 4G6DA 3BWGA 3JAMK 5CVUA 5HDKA 3F8FA 3I0TA 2ESNA 3LQQA 5J6XA 1R1TA 4EM0B 3KZYA 2EK5A 3ZPLA 3DV8A 2ISYA 1T2KA 2D45A 1P92A 5KVRA 1LDDA 4RB2C 1WRJA 1FYKA 1HW1A 2Q2EA 1YQAA 4BHBA 1IN5A 3U1DA 2M5WA 4AD9A 2VONA 1HW5A 5CJ9A 1Q1HA 2F5CA 1ZRDA 3ABTA 4MQVA 5IT3A 3K0LA 1CGPA 2E1NA 1BIAA 5A2QK 2RC4A 2X4HA 3KFWX 3BOQA 2PMHA 1U3EM 1T98A 2XAJA 2DPUA 4EJTA 1BBYA 3RTRA 1KU3A 1RZ4A 2OAZA 3LSTA 2Y75A 4F7ZA 4L9NA 1TNSA 2K02A 1I6XA 5EEHA 2Y48A 1PUEE 2VC1A 2YX4A 2KJBA 3TOAA 5LEJA 4KFCA 1X3UA 4OMYA 3MEXA 3WTXC 4LGWA 1LJ9A 5ERIA 2V79A 3E5QA 1G4DA 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQO A;  2EJR A;  1W7P D;  3I4P A;  4BH9 A;  2HQR A;  3Q9V A;  2STT A;  2OU2 A;  5HDN A;  4GO1 A;  2CFX A;  4BQA A;  2PG4 A;  2Z33 A;  5LHG A;  2DFI A;  4IHT A;  1D8J A;  4UVA A;  4UNO A;  3GZ5 A;  4GXO A;  1IW7 F;  4M9S A;  3IKV A;  3E5U A;  3E6C C;  4CDG A;  1JHF A;  2BV6 A;  3E6B A;  1R1U A;  4DNC A;  1IN6 A;  3ZMU A;  4HYE A;  1TBX A;  5HDG A;  3K9T A;  1G3S A;  5ED4 A;  4KYW A;  4A5N A;  1LDK B;  3NRV A;  3QOP A;  3COA C;  2P7V B;  1ZGJ A;  1ZHF A;  2FBH A;  3WTY C;  3CLO A;  1I1S A;  2PJP A;  2ZXJ A;  1USS A;  5DDG A;  2CSO A;  3BZ6 A;  1R7J A;  2DBB A;  3ULQ B;  2QBY A;  3FXU A;  1ZRC A;  1U5T B;  2IA2 A;  5H20 A;  3DP7 A;  4LD5 A;  1CF7 A;  3KLO A;  1G6N A;  4G7H F;  1EH7 A;  2L01 A;  4M72 A;  4BHC A;  1PDN C;  4RAZ A;  4AIK A;  1IXC A;  1SD5 A;  3VFZ A;  4I98 B;  1S29 A;  1KYW A;  1YIO A;  1B1B A;  1FP1 D;  2EFW A;  1W5S A;  4G6Q A;  3MCZ A;  3BJ6 A;  4K2E A;  3C7J A;  1FY7 A;  2GIV A;  1F4K A;  4FX0 A;  2MBF A;  2H94 A;  5JR3 A;  3MWM A;  3LFK A;  4HOB A;  5ICF A;  3M8E A;  3WGI A;  2RQP A;  4RB3 C;  1TLH B;  3I54 A;  4BAY A;  1K78 A;  4P9F A;  3FM3 A;  2DAO A;  2P5L C;  1OKR A;  4KN7 X;  1ZRE A;  3WU1 B;  2IW5 A;  1HST A;  1BI0 A;  3H92 A;  4JBA A;  2STW A;  4ESB A;  2P6T A;  3FMR A;  3P9C A;  2F5E A;  5D5X B;  2P4W A;  5HS9 A;  4A0Z A;  2VBZ A;  3KEO A;  3E97 A;  1OYI A;  2ZKZ A;  2FXA A;  2VT2 A;  3TO6 A;  4HF2 A;  3IKT A;  1MJB A;  3FHZ A;  3BDD A;  2O8X A;  1J9I A;  2G9W A;  4IRH A;  4IRG A;  3SQN A;  2ZME A;  1FSH A;  2E7W A;  3GUD A;  3RI4 A;  5D4R A;  3VOD A;  4ESJ A;  2XVC A;  5FLX Z;  2LDU A;  2L54 A;  5DUI A;  1AOY A;  5L3F A;  2PN6 A;  3EUH A;  1ZG3 A;  2X0L A;  5D6F A;  3R0J A;  3TDU C;  4XBF A;  5HOO A;  5TJJ A;  2CYY A;  3JSP A;  2A61 A;  1FSE A;  2AS5 F;  2HKO A;  3H3Z A;  3RYR A;  1FX7 A;  1RNL A;  4A6E A;  4XSZ F;  1J0R A;  3HHG A;  1U8R A;  4CIC A;  3KCC A;  3WG9 A;  5BOX A;  4M6X A;  1K79 A;  3M9A A;  1WSU A;  2EFN A;  3I71 A;  2RGV A;  4LB5 A;  1EV7 A;  4JK1 X;  3IC7 A;  4CYD A;  2COM A;  4PCQ A;  4WK8 F;  2J5P A;  1KQ0 A;  2RNJ A;  4LJZ F;  2NNY A;  3R61 A;  5F1R A;  3GFM A;  4I7H A;  4EJV A;  2VOD A;  3R6S A;  3VEP A;  1DP7 P;  2O0Y A;  2EWN A;  1ZN2 A;  4UV8 A;  1P4A A;  4YG2 F;  1W5T A;  3F8B A;  4U0Y A;  3E6M A;  1BI2 A;  3DXJ F;  1IF1 A;  1BIB A;  3K69 A;  4GYI A;  1EH6 A;  3RJP A;  4PGG A;  2TDX A;  2IRF G;  1S7A A;  1K6O A;  3OOP A;  4HX7 A;  3JTG A;  3F8C A;  4U7B A;  3QPH A;  3F8M A;  1XMK A;  3ZN1 A;  4PGH A;  4P55 A;  1SFX A;  4OIN F;  3ABU A;  4HLX A;  4IRI A;  3HSR A;  4WXD A;  1FYL A;  1ZGA A;  2GA1 A;  4I0A A;  3BJA A;  1XSX A;  1FBU A;  2JZY A;  4ENM A;  5E1Z B;  1CF7 B;  2A3S A;  4LG0 B;  5LLQ A;  2GA2 A;  2IA0 A;  1BC8 C;  1J59 A;  3VOE A;  1ZLJ A;  4O3M A;  2FOK A;  2D1H A;  5BPI A;  2WWY A;  3TOB A;  5BS6 A;  5D8K B;  2PQ8 A;  2XV4 S;  4AIJ A;  3JSO A;  1IN4 A;  1JXS A;  1UST A;  3V8L A;  3K2Z A;  4AVP A;  4KA4 A;  5F64 A;  4L9J A;  2V1X A;  1B6A A;  1E2X A;  1XCB A;  5FD5 A;  5AIP A;  1K78 B;  1OYW A;  5FFX A;  4RS8 A;  3IRR A;  3HTS B;  1ZRF A;  2M87 A;  1KA8 A;  2ADU A;  4YIF A;  2ACJ A;  2RKH A;  3WGG A;  1L0O C;  5ILU A;  1HKQ A;  2K86 A;  1OYY A;  4M9X A;  2VXZ A;  2IJL A;  3ZMS A;  3P7N A;  3VB2 A;  2XHK A;  4A2U A;  4IF4 A;  3TO9 A;  1FLI A;  4RGU A;  2OZ6 A;  1HKT A;  1FZP B;  3S2W A;  1QGP A;  2FNA A;  4OMZ A;  4Q4Z F;  3FMS A;  1BN5 A;  1BM9 A;  2P5V A;  1U2W A;  1FWZ A;  4BNC A;  3ERE D;  4EQQ A;  4ZYD A;  4LB6 B;  3KP2 A;  1T38 A;  4M6Y A;  1XDS A;  5E17 F;  2K4B A;  2FSW A;  3P9K A;  4CZZ A;  4HDV A;  2JSC A;  2JPC A;  4ESF A;  2ZO4 A;  3HOT A;  3CO7 C;  1Z05 A;  1FNN A;  1XN7 A;  1QZY A;  4AWX B;  2QM3 A;  3MAJ A;  2BYV E;  2CGP A;  4LMY A;  2W25 A;  3AAF A;  2GAU A;  4B8X A;  2DTR A;  5DCF A;  1XSD A;  2XUB A;  4L5I A;  1O57 A;  3SFZ A;  5JI6 A;  1ZG1 A;  3J80 K;  1B9M A;  1W7P B;  1WKM A;  3E6D A;  3PQK A;  1KQ8 A;  4IPA A;  3F6V A;  1B9N A;  5LGN A;  4ZZL A;  2W84 A;  2KIF A;  4ZYH A;  1PP8 F;  3KP7 A;  5IT9 Z;  1W4M A;  1GXP A;  1WI9 A;  5DYM A;  1YW7 A;  1ZH5 A;  4ENJ A;  2W57 A;  4UXN A;  2FQ3 A;  4HV5 A;  3TO7 A;  2QQA A;  3L2C A;  3QP5 A;  1FP2 A;  5AIQ A;  3ECO A;  3J7A O;  3V4G A;  4ZYG A;  4UHT A;  3FX3 A;  2O03 A;  3IWZ A;  1LEA A;  5L3C A;  1O7L A;  3ML6 A;  5FO5 A;  3EYY A;  3RYP A;  5E20 A;  4WF2 A;  3ISP A;  3F21 A;  4ZH4 F;  1R36 A;  3OV8 A;  2P8T A;  4YII A;  3IL2 A;  1GHC A;  1NHA A;  4FT8 A;  4HX8 A;  2LF7 A;  2Z9O A;  3QP6 A;  2R7F A;  2A6E F;  2AXL A;  5H6R A;  1FYM A;  3ZMV A;  1TQM A;  1V4R A;  1LB2 A;  4M9Z A;  4XLP F;  4EJU A;  5LRR A;  5DD4 A;  2R7D A;  4A0Y A;  5D5V B;  2VBY A;  3FM5 A;  1IN8 A;  3F6O A;  2RVC A;  2IT0 A;  1BJA A;  2VN2 A;  1F9N A;  2CG4 A;  1YS6 A;  2HOE A;  1UB9 A;  2L02 A;  4B09 A;  3U2R A;  4HLY A;  3V7R A;  2H6C A;  1JE8 A;  3HIF A;  1YTY A;  3FZV A;  5DUK A;  1I27 A;  2K7L A;  1SMY F;  5L3G A;  4FX4 A;  3RDI A;  3L09 A;  3CUQ C;  1KU2 A;  1C0W A;  3JAM Z;  1QQI A;  3V7S A;  1J7K A;  1T0F A;  5BMZ A;  3GEZ A;  2GQQ A;  1XDU A;  3I64 A;  4QLC U;  4HQE A;  2NNN A;  5HLI A;  4YFN F;  2IVM A;  4LK0 F;  3WGH A;  2V1U A;  1R23 A;  3GWZ A;  4MTD A;  4H0E A;  2HKX A;  4OU0 A;  5F6F A;  2JTV A;  2HWV A;  1WQ2 A;  2LNB A;  3WOD F;  3BRO A;  1WWX A;  4L5J A;  2XAG A;  4G9Y A;  3KP6 A;  1EH8 A;  2OA4 A;  5L3D A;  4U0V A;  1REP C;  5LRS A;  1IZ1 A;  5JVT A;  4TV7 A;  3IWF A;  3J80 Z;  3R0A A;  3FXQ A;  3SZP A;  2G7U A;  3WE2 A;  1RIO H;  1GVJ A;  1HW2 A;  5A2Q Z;  2HYG D;  3T0Y A;  4G94 A;  4HF1 A;  3M7G A;  4HAM A;  2UXN A;  1HSJ A;  4I09 A;  1F1Z A;  3KP4 A;  3LAP A;  4M73 A;  3T1B A;  5D5U B;  3KZZ A;  4P96 A;  4Q47 A;  3G3Z A;  3ZMZ A;  2L3D A;  2RN7 A;  1ZLK A;  3GFL A;  1HBX G;  3Q9S A;  3FMQ A;  4O5V A;  3FXR A;  3O2P E;  2DQL A;  3BY6 A;  4EGZ A;  2HTJ A;  4L9T A;  5D6E A;  1HKS A;  3HTU A;  4HZF A;  3EYI A;  5HS7 A;  3ZMT A;  4CHU A;  1SFU A;  1MGT A;  3QU6 A;  5DCM A;  3H3U A;  2RDP A;  3CJN A;  4L0Z B;  2G7H A;  4RGR A;  2C6Y A;  4G7O F;  3T8R A;  3GYH X;  5CVV A;  4NHJ A;  4OIO F;  1U5T C;  2ZFW A;  2BE5 F;  4KDP A;  1G3W A;  5CLS A;  4ENK A;  5K1Y A;  1BC7 C;  3CO6 C;  1ULY A;  3C1D A;  2HYF A;  3ZMD A;  4ASN A;  1RI7 A;  4WXH A;  1XB4 A;  2D1V A;  3O6B B;  1TTY A;  1U6G A;  2EV6 A;  2E1C A;  5TRD A;  4FHT A;  3KET A;  4RGS A;  4UV9 A;  3I59 A;  2UXX A;  5FFZ A;  3GZ6 A;  1YLF A;  1Z1D A;  2RV8 A;  3G73 A;  1RUN A;  2BGC A;  2VOP A;  2K27 A;  2E7X A;  2EV0 A;  3FWE A;  4O6J A;  2GZW A;  4RAY A;  2EA2 A;  1J2X A;  2KKO A;  1STZ A;  3CUQ A;  2FBK A;  3BP8 A;  2LF8 A;  1ZG5 A;  1A04 A;  1BI3 A;  1Y0U A;  5DD8 A;  2WV0 A;  3QU3 A;  1B4A A;  1G3T A;  3R60 A;  1Z6R A;  3QAH A;  1P2F A;  1SD4 A;  1TQP A;  3V7C A;  2PBI A;  3GF2 A;  4S04 A;  2L4M A;  3RPU A;  1R1V A;  1L3L A;  2XKO A;  3MZH A;  1P4X A;  1ZYR F;  3T5X A;  2V6C A;  2QBY B;  1VTN C;  3HRM A;  4QWQ A;  2OD5 A;  5K5Q A;  2Q0O A;  2KIU A;  3TQN A;  1OPC A;  1YG2 A;  1XGN A;  4KMU X;  2XRO A;  3DPT A;  4HBL A;  3WTW C;  2DO7 A;  3RKX A;  1XMA A;  4KMF A;  4L18 B;  4U7D A;  2IP2 A;  4IJA A;  5LBQ A;  2D2W A;  3REO A;  2H27 A;  3HRT A;  2H6B A;  4U88 A;  1DPU A;  5BPD A;  2ZNZ A;  1H9G A;  1ON1 A;  3EQL F;  1JHH A;  4KUM A;  5ICC A;  5LHH A;  1XGS A;  2HTS A;  2DPD A;  4KIC A;  4LLG F;  2DU9 A;  4CGZ A;  3JW4 A;  3W6J B;  3WU0 A;  5ICE A;  2EB7 A;  4LLN A;  3K1N A;  5ICG A;  4OOI A;  2YPR A;  4N9H A;  2K4J A;  2QQB A;  5ILV A;  1R58 A;  2QZ8 A;  4Y15 A;  1SFE A;  2A5Y B;  1DPR A;  4UVB A;  4A12 A;  2QYO A;  1U5T A;  5ILS A;  3HYI A;  3R4K A;  3LWF A;  3KLN A;  2ZME B;  2FRH A;  2FBI A;  1R22 A;  2LKP A;  4MEX F;  1S6L A;  3O3K A;  3L9F A;  4A6D A;  2BBY A;  2OBP A;  4YFX F;  1XGM A;  1MD0 A;  5L3B A;  5LHI A;  2XAH A;  4Q48 A;  4BHP A;  1R5G A;  4Y13 A;  1IXR C;  4IHS A;  2DK8 A;  4E70 A;  4ZZD A;  4M74 A;  4D0P A;  2MLG A;  3DPL C;  4A5M A;  2CWE A;  1ONV A;  3ZP5 A;  1IXS B;  4CO8 A;  2ISZ A;  1Z6T A;  3GX4 X;  1P4W A;  3DQV C;  2IPQ X;  4RB0 A;  3TKY A;  3K1M A;  5E8G A;  2J5O A;  3CDH A;  5K5R A;  4NB5 A;  1FC3 A;  3NEU A;  2VE9 A;  2YU3 A;  2EA4 A;  4A0X A;  1O3R A;  2VBW A;  3I59 B;  4R79 A;  1D5V A;  3FF5 A;  3ECH A;  2Z99 A;  3N4M A;  1FT9 A;  1G3Y A;  3GW2 A;  3TDZ C;  2DQR A;  1Z7U A;  3ELK A;  4HV6 A;  1P6R A;  3TGN A;  1BOA A;  2YX7 A;  2O6G E;  1Z9C A;  5CVR A;  3E3V A;  2F5F A;  2MH2 A;  2EFO A;  3B73 A;  2QLZ A;  5HS8 A;  3HRU A;  3CUQ B;  2FA5 A;  3BPV A;  2F5D A;  3HOS A;  1MKM A;  3CTA A;  3HUG A;  3LA2 A;  3GFJ A;  4WXC A;  1GXQ A;  2F2E A;  3T8T A;  1UFM A;  2CW0 F;  2V1D A;  5E18 F;  3LQR A;  3MQ0 A;  3GFI A;  2HDC A;  3M1E A;  3M8F A;  4EJW A;  3P9I A;  4MHG A;  3LAJ A;  1QPM A;  3JTH A;  5J8C A;  1JGS A;  5D8L B;  1FBS A;  1YS7 A;  1O3Q A;  2M8E A;  4ON0 A;  2HS5 A;  2BEO A;  1T6S A;  1YFH A;  4Y17 A;  1MDM A;  4I02 A;  5HLH A;  4MEY F;  2XRN A;  4OIP F;  1IAW A;  1AWC A;  1QBJ A;  2XIG A;  1FPQ A;  3MFK A;  1LQ1 A;  6PAX A;  1O7F A;  4BYY A;  1I5Z A;  5K5O A;  3HRS A;  2HZT A;  4WCG A;  5FLX K;  2OZU A;  5JHU A;  3C3W A;  2A68 F;  1IUY A;  1O3T A;  3F23 A;  4YFK F;  3GVA A;  4UVC A;  3WTZ A;  3GLX A;  3GXO A;  1LDJ A;  4XRF A;  3D5L A;  1E17 A;  1IN7 A;  1FOK A;  1ODD A;  4KNY A;  4LK1 F;  4MQ9 F;  2P5K A;  2EV5 A;  4Z2Y A;  4OIQ F;  5FB2 A;  1XCV A;  1D8K A;  2LSO A;  3BPX A;  4XLN F;  2CQK A;  5CVJ A;  1FBQ A;  3W6K B;  2HQN A;  2WC2 A;  2PLY A;  2XAQ A;  4NQW A;  4BXU A;  3MZY A;  2B0L A;  1T39 A;  5HVQ C;  2YR2 A;  3V8K A;  1KQ9 A;  2XAS A;  3LA7 A;  4EVI A;  2MC3 A;  1U78 A;  3KP5 A;  2GXB A;  4KIG A;  3KP3 A;  4EM2 A;  2QUF A;  1DUX C;  2Z5U A;  5E1W A;  4ZYE A;  3KE2 A;  4LG0 A;  3DF8 A;  5AON A;  1UHW A;  1UHM A;  1R5H A;  4Q5S F;  1TNT A;  2MA3 A;  4PDK A;  2ELH A;  4WWC A;  3I53 A;  2JT1 A;  4I0B A;  3F22 A;  3F8N A;  4KN4 X;  2H09 A;  2VC0 A;  3SXY A;  2GXG A;  4UUV A;  1F5T A;  1V3F A;  1LNW A;  2DK5 A;  4MGR A;  5DEQ A;  3LA3 A;  2V9V A;  2M30 A;  3BJO A;  3EET A;  4P5O A;  5E1X A;  4KT5 C;  3DKW A;  5H6Q A;  5D5W B;  1I1G A;  3V8J A;  3J81 K;  3E5X A;  1J75 A;  1J5Y A;  4RB1 A;  4EV0 A;  1TQI A;  2VT3 A;  1S8N A;  5EEG A;  3ZN0 A;  2PI0 A;  3D0S A;  2PFB A;  5FD6 A;  3DFG A;  2WTE A;  4P9U A;  1KYZ A;  1XD7 A;  2FMY A;  4EMS A;  2EFQ A;  5KK1 A;  1KGS A;  1R00 A;  4M71 A;  4WX9 A;  3L00 A;  1XGO A;  1DDN A;  2XKP A;  4JQF A;  1LEB A;  5BQT A;  2DI3 A;  4DQ2 A;  2NS0 A;  1UCR A;  5L3E A;  4RGX A;  4HDU A;  3L7W A;  2KRF A;  2KJC A;  5E8I A;  2FU4 A;  2GWR A;  2A69 F;  3RKY A;  1MJ9 A;  4KIB A;  2OQG A;  4HF0 A;  3KEQ A;  2FF4 A;  3QPT A;  2ZCW A;  3K1P A;  2UZK A;  2A6H F;  2NRA C;  3IHU A;  1HQC A;  3F72 A;  1SMT A;  3RPQ A;  1K7A A;  2UWM A;  1XSV A;  2KIM A;  1IRF A;  5D4S A;  2JPB A;  4CXF A;  1MDM B;  1RUO A;  2EFP A;  3EDP A;  4U0W A;  1SAX A;  1QZZ A;  3HSF A;  2ESH A;  3GO5 A;  2XAF A;  5DV5 A;  2QQ9 A;  5LGT A;  2PMU A;  3WTU C;  2PEX A;  2ETH A;  2QVO A;  5JFR A;  4R8H A;  4AIH A;  1W7P A;  3Q5F A;  2DW4 A;  3PFI A;  1S7O A;  2DLL A;  3WE3 A;  2QEN A;  1YYV A;  4GYG A;  4LFU A;  2FML A;  5HLG A;  2A07 F;  2FEZ A;  3IRQ A;  1QO0 D;  2MD5 A;  2ZBK A;  4G7Z F;  5CYV A;  4G8X A;  3F3X A;  1SD7 A;  1TW3 A;  2M45 A;  2O3F A;  1YW8 A;  2QWW A;  1D3Y A;  3HHH A;  4S05 A;  2CO5 A;  1Z91 A;  4IVN A;  3QRF F;  2R3S A;  3I58 A;  2FNP A;  2VBX A;  2ZJ2 A;  4HX4 A;  4L0Y B;  2O61 A;  2MLK A;  1ON2 A;  2NAZ A;  4ETS A;  2HGC A;  5IT9 K;  1BI1 A;  2VOO A;  3ZQ7 A;  2L4A A;  2ZNY A;  3B02 A;  3PQJ A;  1LVA A;  5FGM A;  1B59 A;  4EGY A;  2YSR A;  4ENN A;  3J81 Z;  5J8F A;  1YW9 A;  4IXA A;  3WTS C;  2HFH A;  2FE3 A;  3CUO A;  4N9I A;  4N0B A;  4I2O A;  1QNT A;  5LEK A;  1OMI A;  4GCV A;  4HA8 A;  4R1H A;  4KIF A;  1SD6 A;  4LLL A;  1YO5 C;  1IRG A;  2MH9 A;  2DT5 A;  4L9V A;  4HQM A;  2HR3 A;  1O3S A;  1H9T A;  2P7C B;  4XSX F;  2P6S A;  2XGX A;  1OR7 A;  2W85 A;  3N97 A;  1KU7 A;  1KU9 A;  2VE8 A;  2Q8K A;  4EM1 A;  2M1B A;  3HSE A;  3RKW A;  1MZB A;  2HEO A;  2OQR A;  3WTV C;  5LGU A;  1TW2 A;  1MJA A;  1H0M A;  4HW0 A;  2IA1 A;  2Z3Y A;  2W24 A;  1ZAO A;  4MTE A;  4EJO A;  1S3J A;  3U9G A;  3WTT C;  4PZJ A;  1ZAR A;  4MNU A;  3I5U A;  3RIR A;  3C18 A;  5DCM B;  4GGG A;  2NYX A;  5CVI A;  3SHF A;  1PP7 U;  2Y0M A;  3SZT A;  4OIR F;  3ROU A;  3DEU A;  4I01 A;  2JRT A;  4G6D A;  3BWG A;  3JAM K;  5CVU A;  5HDK A;  3F8F A;  3I0T A;  2ESN A;  3LQQ A;  5J6X A;  1R1T A;  4EM0 B;  3KZY A;  2EK5 A;  3ZPL A;  3DV8 A;  2ISY A;  1T2K A;  2D45 A;  1P92 A;  5KVR A;  1LDD A;  4RB2 C;  1WRJ A;  1FYK A;  1HW1 A;  2Q2E A;  1YQA A;  4BHB A;  1IN5 A;  3U1D A;  2M5W A;  4AD9 A;  2VON A;  1HW5 A;  5CJ9 A;  1Q1H A;  2F5C A;  1ZRD A;  3ABT A;  4MQV A;  5IT3 A;  3K0L A;  1CGP A;  2E1N A;  1BIA A;  5A2Q K;  2RC4 A;  2X4H A;  3KFW X;  3BOQ A;  2PMH A;  1U3E M;  1T98 A;  2XAJ A;  2DPU A;  4EJT A;  1BBY A;  3RTR A;  1KU3 A;  1RZ4 A;  2OAZ A;  3LST A;  2Y75 A;  4F7Z A;  4L9N A;  1TNS A;  2K02 A;  1I6X A;  5EEH A;  2Y48 A;  1PUE E;  2VC1 A;  2YX4 A;  2KJB A;  3TOA A;  5LEJ A;  4KFC A;  1X3U A;  4OMY A;  3MEX A;  3WTX C;  4LGW A;  1LJ9 A;  5ERI A;  2V79 A;  3E5Q A;  1G4D A;  1HXD A; 
#chains in the Genus database with same CATH topology
 3J7Y J;  3NQO A;  2CQN A;  2EJR A;  4E7H A;  1XS9 A;  3H5R A;  3M07 A;  4I76 A;  1W7P D;  3I4P A;  4BH9 A;  2HQR A;  2N8G A;  4BS9 A;  1A5J A;  1WJC A;  5J1Y A;  3AKZ A;  4XLC A;  1JGG A;  3Q9V A;  2STT A;  2OU2 A;  5HDN A;  4GO1 A;  3AG4 H;  4ZDO A;  2VL8 A;  2XB0 X;  2CFX A;  1SEU A;  4BQA A;  2PG4 A;  2Z33 A;  3K70 C;  3CMA I;  5IP9 J;  5LHG A;  1NK2 P;  2DFI A;  4A3M J;  4IHT A;  2K40 A;  1D8J A;  4UVA A;  2WAD A;  3ZCO A;  3RQI A;  4UNO A;  3GZ5 A;  4DZP A;  4GXO A;  5EGO B;  5FRO A;  1WJA A;  1IW7 F;  4M9S A;  4M3E A;  2CRG A;  3IKV A;  2RRE A;  3H0G J;  4V2F A;  3E5U A;  5F0C A;  3OYE A;  2OC6 A;  3PUF A;  3E6C C;  1U8B A;  4CDG A;  1MBE A;  3ZQI A;  1JHF A;  1X1B A;  4LIU A;  2BV6 A;  3E6B A;  1R1U A;  3OYD A;  4DNC A;  4M3D A;  1IN6 A;  2F6C A;  3ZMU A;  5CQE A;  3ONQ A;  4HYE A;  1YRN B;  1TBX A;  1AKH A;  5HDG A;  3K9T A;  3LL7 A;  3A0H C;  1G3S A;  1YIT I;  5ED4 A;  4KYW A;  4A5N A;  1LDK B;  2R0Q C;  1WVR A;  2M7B A;  3NRV A;  3QOP A;  2Z16 A;  2VJ5 A;  3COA C;  1MBG A;  2P7V B;  1ZGJ A;  1ZHF A;  3K4N A;  2IS4 A;  2FBH A;  3K2A A;  3CLO A;  3LSM A;  4Y33 A;  5BNG A;  3WTY C;  1JKP C;  1I1S A;  2R7R A;  2PJP A;  1KZH A;  2ZXJ A;  1USS A;  5DDG A;  3B6A A;  4CCK A;  2CSO A;  3BZ6 A;  1Y56 A;  1R7J A;  2DBB A;  3ULQ B;  2QBY A;  3FXU A;  1ZRC A;  1Q1V A;  1Z0X A;  2QF7 A;  1U5T B;  2IA2 A;  5H20 A;  3DP7 A;  2IBD A;  4LD5 A;  1TL8 A;  1CF7 A;  3KLO A;  3UR3 C;  1G6N A;  1WPK A;  1X3Z B;  4G7H F;  3HZJ A;  4Y7N J;  1R9T J;  1EH7 A;  1Z67 A;  2L01 A;  2ZSI B;  4M72 A;  4BHC A;  3E5Q A;  4RAZ A;  2HQA A;  4AIK A;  1PDN C;  1IXC A;  1SD5 A;  3VFZ A;  4I98 B;  1S29 A;  2WY8 Q;  1KYW A;  1EA3 A;  1YIO A;  1B1B A;  2DA3 A;  1FP1 D;  4NUB A;  5IYB J;  1OQY A;  2EFW A;  3E0J B;  5KHD A;  2E1O A;  1IRZ A;  1W5S A;  4G6Q A;  3MCZ A;  3BJ6 A;  3BG7 A;  3S1M J;  1E3H A;  4K2E A;  3GTO J;  3LSR A;  3TED A;  3C7J A;  1FY7 A;  5F04 A;  3CCY A;  1XG1 A;  2GIV A;  1F4K A;  3FK6 A;  4FX0 A;  5LFA A;  2MBF A;  2H94 A;  4M6V A;  5JR3 A;  3MWM A;  2O8K A;  3A02 A;  3LFK A;  5EYR A;  4HOB A;  5ICF A;  2BY2 A;  2ECC A;  3M8E A;  3WGI A;  2RQP A;  2LG4 A;  2DA4 A;  3CDL A;  4RB3 C;  1YJW I;  1TLH B;  3I54 A;  2NOG A;  3PSF A;  4V19 K;  4BAY A;  1K78 A;  4P9F A;  3FM3 A;  4E7J A;  3VDX A;  3B6C A;  2DAO A;  2P5L C;  4PFO A;  1OKR A;  3QOD A;  4U87 A;  1ETV A;  4KN7 X;  4RAF A;  4XN3 A;  1ZRE A;  3WU1 B;  2IW5 A;  2DFH A;  3HOY J;  1HST A;  1YX3 A;  1BI0 A;  1LFP A;  3RCO A;  3CC2 I;  3H92 A;  4JBA A;  4XN0 A;  2STW A;  4ESB A;  3K7A J;  2TRT A;  5EJC A;  4N4O B;  2Q2E B;  3BG3 A;  3CD6 I;  1VQ9 I;  2P6T A;  1E0E A;  4YEJ A;  3FMR A;  3P9C A;  1O4X A;  2F5E A;  5D5X B;  2P4W A;  1MMD A;  5HS9 A;  4A0Z A;  3W2A A;  2M8G X;  4ZJZ A;  5F1J A;  1PUF B;  4XKB A;  2VBZ A;  5F0F A;  2ZJR F;  3KEO A;  3E97 A;  1OYI A;  2ZKZ A;  3ZRG A;  3I3L A;  2FXA A;  2VT2 A;  2DOE A;  5IP7 J;  3TO6 A;  4HF2 A;  5J1U A;  2VQH A;  3IKT A;  1MJB A;  3FHZ A;  2K3P A;  3OIP A;  3BDD A;  2O8X A;  1J9I A;  2G9W A;  4IRH A;  4IRG A;  3SQN A;  2L7F P;  2ZME A;  2JMW A;  1FSH A;  2E7W A;  3WHB A;  4E6K G;  1UMQ A;  3GUD A;  3RI4 A;  5D4R A;  3VOD A;  4ESJ A;  2XVC A;  1U9N A;  5FLX Z;  4IQ4 A;  2LDU A;  2HOT A;  2L54 A;  5DUI A;  1AOY A;  5L3F A;  5GPA A;  1DP3 A;  2PN6 A;  3EUH A;  1ZG3 A;  2QSF X;  1QZE A;  4E7Z A;  2X0L A;  5D6F A;  1JI8 A;  3R0J A;  1RPW A;  1QPI A;  3TDU C;  4XBF A;  3DBL B;  5HOO A;  5TJJ A;  4PFP A;  2ZXW H;  2EZH A;  2CYY A;  3JSP A;  2A61 A;  4DJA A;  1FSE A;  1N78 A;  2AS5 F;  2HKO A;  2LVS A;  2ZJQ F;  1KON A;  3H3Z A;  3RYR A;  2HDD A;  3W2V A;  1IV8 A;  4MFD A;  4IHY A;  2DMU A;  2VKD A;  3JRI A;  1FX7 A;  1RNL A;  4A6E A;  1ITY A;  2V9K A;  4XSZ F;  1J0R A;  3HHG A;  1U8R A;  4CIC A;  2HDW A;  3KCC A;  3WG9 A;  1GT0 C;  2Z2S B;  1HC8 A;  4XID A;  4M6X A;  5BOX A;  1K79 A;  2JSP A;  1D0Y A;  3M9A A;  2LYC A;  1WSU A;  4XLH A;  2E2I J;  1FMV A;  2EFN A;  3I71 A;  2RGV A;  4X1E A;  2NS8 A;  4XKW A;  5J40 A;  4LB5 A;  2LBF B;  1G59 A;  1EV7 A;  4JK1 X;  3S14 J;  3IC7 A;  1WFX A;  3HEF A;  4CYD A;  3FHN A;  1OIS A;  2COM A;  3PNT A;  5B3S H;  4PCQ A;  4WK8 F;  1MH4 A;  2DA5 A;  4CCO A;  5TGT A;  2MSY A;  4Y4R A;  3BTC A;  2J5P A;  1KQ0 A;  2RNJ A;  4LJZ F;  3OYN A;  2E71 A;  2NNY A;  1TP4 A;  3R61 A;  5F1R A;  2VJI A;  3GFM A;  4B1R A;  2JUC A;  1MND A;  2KQR A;  2XGD A;  5F27 A;  4I7H A;  4EJV A;  4IL6 C;  2ZJP F;  2VOD A;  3R6S A;  3VEP A;  2EIK H;  4FIS A;  1DP7 P;  2O0Y A;  4DYR A;  2EWN A;  1ZN2 A;  4UV8 A;  2VQC A;  4GRI A;  1P4A A;  1Y0N A;  4B48 A;  2DOA A;  2QA4 I;  2DA1 A;  1E3P A;  4PUS A;  2JVG A;  3HOV J;  4YG2 F;  3OR2 C;  1W5T A;  3F8B A;  3BTI A;  4BE2 A;  2UV1 A;  4U0Y A;  2A05 A;  3E6M A;  1BI2 A;  3DXJ F;  1TWA J;  1X19 A;  1X3W B;  1FMW A;  2ICW G;  1BIB A;  5GP9 A;  1IF1 A;  3K69 A;  4GYI A;  1EH6 A;  3DU5 A;  3RJP A;  4PGG A;  2TDX A;  2IRF G;  1WCM J;  1S7A A;  2YS9 A;  1K6O A;  3OOP A;  4HX7 A;  3VYU B;  4DGW B;  4IHX A;  1RKW A;  3JTG A;  1GV5 A;  3F8C A;  3FXO A;  1RET A;  4U7B A;  3QPH A;  3F8M A;  1XMK A;  3ZN1 A;  4NQW B;  4PGH A;  4P55 A;  1SFX A;  2NS7 A;  3FXL A;  3PM1 A;  3S3N A;  4OIN F;  3K4J A;  3ABU A;  1K6Y A;  4HLX A;  4IRI A;  3HSR A;  4WXD A;  4NC7 A;  1FYL A;  1ZGA A;  3MMY B;  2GA1 A;  4I0A A;  3BJA A;  1XSX A;  4QIW N;  2PJR A;  3BQZ A;  2OV7 A;  1LVK A;  3K4L A;  1RR7 A;  4KT6 A;  1FBU A;  1SFK A;  3BG9 A;  2JZY A;  3JRG A;  4BEH B;  3FBN B;  5E1Z B;  4ENM A;  1CF7 B;  1FOY A;  2A3S A;  4LG0 B;  1SAN A;  5LLQ A;  1XX5 A;  5M5Y J;  2GBY A;  3OYI A;  3ZQQ A;  1QVU A;  2GA2 A;  2IA0 A;  1V5F A;  3NWS A;  4A3I J;  1BC8 C;  2JJ7 A;  1J59 A;  3VOE A;  1ZLJ A;  5K7H A;  3HDD A;  2KIQ A;  2EQR A;  4XNF A;  2FOK A;  4O3M A;  2D1H A;  5BPI A;  2WWY A;  3TOB A;  1ZEL A;  4HST A;  5BS6 A;  1WZ2 A;  2BY1 A;  5D8K B;  2PQ8 A;  2XF7 A;  2KDO A;  2XV4 S;  4AIJ A;  3CC4 I;  3JSO A;  1IN4 A;  3WHC A;  2W1O A;  2LOO A;  9ANT A;  3IAS 2;  2EIJ H;  2E5N A;  1JXS A;  3S3M A;  2B7E A;  1IG7 A;  1UST A;  4IO9 F;  3V8L A;  3BG5 A;  3K2Z A;  4BE0 A;  1VQO I;  2NVT J;  2M2E A;  2PMZ A;  4AVP A;  4KA4 A;  2V9P A;  1Y1V J;  5F64 A;  4L9J A;  2V1X A;  2D5V A;  1B6A A;  1E2X A;  5HOD A;  1XCB A;  5FD5 A;  1F36 A;  5AIP A;  1K78 B;  1OYW A;  3ABL H;  5FFX A;  2L5Q A;  4RS8 A;  3IRR A;  3HTS B;  1ZRF A;  4BQO A;  2M87 A;  2E2H J;  1KA8 A;  2ADU A;  4YIF A;  3CCV I;  4FE7 A;  2ACJ A;  2RKH A;  3WGG A;  2WAE A;  4BBR J;  1L0O C;  5ILU A;  5M3F J;  2WAQ A;  1HKQ A;  2K86 A;  4BE1 A;  3AG2 H;  3LSK A;  4LG3 A;  1OYY A;  3OYC A;  4M9X A;  2VXZ A;  2IJL A;  3ZMS A;  3P7N A;  3VB2 A;  2XHK A;  2JRM A;  1AU7 A;  5EEA A;  2M3A A;  2VKV A;  1T0F C;  4A2U A;  3VYT B;  4IEJ A;  4IF4 A;  3TO9 A;  3ZR8 X;  1FLI A;  1RRJ A;  5DS9 A;  1MIJ A;  3ZXS A;  4E7L A;  4RGU A;  2OZ6 A;  5H2F C;  4I6Z A;  3H9Q A;  2R7W A;  1HKT A;  4RDU A;  1HF0 A;  1FZP B;  5LD2 C;  4I99 C;  3U21 A;  3S2W A;  2L9S A;  1HOM A;  2O5R A;  4F55 A;  1N77 A;  1QGP A;  4B3X A;  4XR6 A;  2FNA A;  2LH9 A;  4OMZ A;  4Q4Z F;  1HCR A;  3FMS A;  4MFE A;  4XIC A;  1BN5 A;  4BAC A;  1Y6I A;  1GLN A;  5M3M J;  2AXT C;  2P5V A;  1BM9 A;  2BY0 A;  1U2W A;  1FWZ A;  2CW7 A;  4XOR A;  4UY8 I;  4BNC A;  3ERE D;  4EQQ A;  4ZYD A;  1MSE C;  2CU7 A;  4LB6 B;  3KP2 A;  1T38 A;  4M6Y A;  4B44 A;  1XDS A;  5E17 F;  3HBL A;  2K4B A;  2FSW A;  3IUO A;  3P9K A;  4GDF A;  4CZZ A;  3MZ8 A;  2HOS A;  4HDV A;  2JSC A;  2QSG X;  2JPC A;  3S2D J;  4ESF A;  3HOX J;  1OCO H;  4IX7 A;  5IYD J;  2ZO4 A;  4DBR A;  3HOT A;  3TL4 X;  1Z05 A;  5IOZ A;  3CO7 C;  2R5Y B;  2K9S A;  2FQ4 A;  1FNN A;  2VAS A;  1XN7 A;  3FBI B;  3FK7 A;  2ELJ A;  1QZY A;  4AWX B;  2QM3 A;  3MAJ A;  3IH3 A;  3SYT A;  2BYV E;  4A69 C;  1P7J A;  2HZD A;  2CGP A;  1X2M A;  4LMY A;  3JRA A;  2W25 A;  3AAF A;  2GXA A;  2I10 A;  2GAU A;  1V55 H;  2MW8 A;  4B8X A;  1HDD C;  2DTR A;  1BJZ A;  5DCF A;  1XSD A;  2XUB A;  2FUG 2;  4L5I A;  4B47 A;  4HNU A;  4ZTF A;  1O57 A;  3SFZ A;  5JI6 A;  5GAG J;  1ZG1 A;  3J80 K;  4C2T A;  1UG0 A;  2EZL A;  2O9L A;  1B9M A;  1W7P B;  1WKM A;  3WG7 H;  1JKQ C;  1WJ5 A;  3E6D A;  3PQK A;  1KQ8 A;  4JOM A;  4IPA A;  4PJ0 C;  2ME0 A;  3F6V A;  4IQJ A;  2R4G A;  1B9N A;  2ECB A;  5LGN A;  4NBQ A;  2W84 A;  4ZZL A;  2KIF A;  2E1M C;  3OL3 A;  4UUS B;  4ZYH A;  1PP8 F;  3KP7 A;  5IT9 Z;  1NH3 A;  1W4M A;  4E7I A;  1GXP A;  2JA7 J;  1WI9 A;  2VLA A;  1Y39 A;  5DYM A;  5EF6 A;  1YW7 A;  1ZH5 A;  4ENJ A;  2W57 A;  4UXN A;  2FQ3 A;  2TCT A;  4HV5 A;  3TO7 A;  2KPM A;  1F43 A;  2QQA A;  3L2C A;  3QP5 A;  4II2 A;  1FP2 A;  5CPR B;  2X1E A;  3H9G A;  5AIQ A;  1UEL B;  1IRX A;  3ECO A;  3J7A O;  3V4G A;  2R7O A;  4ZYG A;  4UHT A;  3FX3 A;  2O03 A;  3LFU A;  3IWZ A;  1LEA A;  5L3C A;  1O7L A;  2K9L A;  3QQA A;  2M4K A;  4UB6 C;  3ML6 A;  5FO5 A;  1ETQ A;  3EYY A;  1FJL A;  3W6V A;  1U9O A;  3RYP A;  5E20 A;  2RAE A;  4BY7 J;  2NOJ B;  1R4N B;  3HC7 A;  4WF2 A;  3AL0 B;  1VQ8 I;  1D1C A;  3ISP A;  4XLE A;  4ZH4 F;  1R36 A;  3A01 B;  3OV8 A;  3F21 A;  2P8T A;  1Y8Q B;  2BVM A;  4CUG A;  4YII A;  3IL2 A;  3EUH C;  4J19 A;  4M3F A;  1GHC A;  1H89 C;  4RLF A;  1NHA A;  2DA2 A;  1VI0 A;  3SDG A;  1V54 H;  3MKW B;  4FT8 A;  3ZQF A;  1NG6 A;  4HX8 A;  2LF7 A;  4RLQ A;  2Z9O A;  2EZK A;  1FTZ A;  3QP6 A;  2XC7 A;  3V42 A;  2R7F A;  2R92 J;  2A6E F;  2AXL A;  3BTL A;  3OWT A;  5H6R A;  4PJJ A;  3ZMV A;  1FYM A;  1N75 A;  1TQM A;  4FTH A;  3RZO J;  1V4R A;  1LB2 A;  4M9Z A;  1IUF A;  3MKY B;  5JLX A;  3JRD A;  2BXZ A;  4RBO A;  1VND A;  4XLP F;  4EJU A;  5LRR A;  4EEF G;  5DD4 A;  4RM2 A;  2LLK A;  2R7D A;  1LUJ B;  1TT5 B;  4A0Y A;  5D5V B;  3OYG A;  5GAE J;  2Y69 H;  2VBY A;  3GBG A;  3FM5 A;  4XRS A;  3OYA A;  1IN8 A;  3CME I;  3F6O A;  2RVC A;  2IT0 A;  1Z21 A;  3J7A Y;  1BJA A;  2VN2 A;  1F9N A;  2CG4 A;  2XF6 A;  1YS6 A;  5J3L A;  2HOE A;  1UB9 A;  1PYV A;  3I4N J;  2JA8 J;  2L02 A;  4ZTJ A;  4B09 A;  1DU0 A;  3U2R A;  4HLY A;  1UHS A;  3BR5 A;  3V7R A;  2NVU B;  2NVY J;  2H6C A;  1JE8 A;  2L7M P;  3HIF A;  2K9N A;  1YTY A;  3FZV A;  5DUK A;  5K7F A;  1I27 A;  2K7L A;  3S17 J;  3CMM A;  3H1C A;  2MFZ A;  1SMY F;  2G0E A;  3ZQC A;  5L3G A;  4D7M A;  4FX4 A;  3RDI A;  4HEA 2;  3L09 A;  3CUQ C;  1KU2 A;  1C0W A;  3JAM Z;  1QQI A;  3V7S A;  1J7K A;  1T0F A;  3EPZ A;  1TT0 A;  4B3A A;  5BMZ A;  3H35 A;  1FTT A;  1MBK A;  3GEZ A;  4A3G J;  2GQQ A;  2HNH A;  1XDU A;  2KT0 A;  4XOP A;  3I64 A;  4QLC U;  1SAU A;  4HQE A;  3DCF A;  2NNN A;  2QKL B;  5HLI A;  4YFN F;  2IVM A;  4LK0 F;  4JX5 A;  3WGH A;  2O7O A;  1AHD P;  2V1U A;  1R23 A;  3GWZ A;  4MTD A;  4H0E A;  2HKX A;  2GIZ A;  4OU0 A;  5F6F A;  2JTV A;  2CS3 A;  2HWV A;  1WQ2 A;  2LNB A;  3GTL J;  3WOD F;  2BHZ A;  3BRO A;  1WWX A;  2AHQ A;  4L5J A;  2PMZ N;  3S93 A;  2LRE A;  2XAG A;  2VJJ A;  4G9Y A;  2MC4 A;  3KP6 A;  5B1B H;  3GME A;  1EH8 A;  2E36 A;  2OA4 A;  5L3D A;  4U0V A;  4XLF A;  1REP C;  5LRS A;  1JUP A;  3M4O J;  1IZ1 A;  5JVT A;  3LSJ A;  1MNE A;  1T8I A;  2LRD A;  4LIT A;  4TV7 A;  1EKE A;  2R7U A;  3IWF A;  3J80 Z;  3R0A A;  4F92 B;  3FXQ A;  3VWB A;  1MMN A;  3SFI A;  3SZP A;  2G7U A;  3WE2 A;  4F91 B;  1GVJ A;  1JTY A;  3DTI A;  1RIO H;  1HW2 A;  3DPU A;  1FIA A;  2L9V A;  5A2Q Z;  2HYG D;  3T0Y A;  4G94 A;  4HF1 A;  3M7G A;  4HAM A;  3DLL F;  1WHU A;  2UXN A;  2HXO A;  1HSJ A;  3CF5 F;  4I09 A;  2CJJ A;  3G6E I;  3S8P A;  1F1Z A;  3KP4 A;  4FET A;  3LAP A;  2W7N A;  3S15 J;  2H8R A;  4M73 A;  4HRI A;  5M5W J;  4RM3 A;  3HOW J;  3T1B A;  5D5U B;  3KZZ A;  4P96 A;  4Q47 A;  1D0Z A;  1ETW A;  2JK3 A;  3G3Z A;  4H4K C;  3ZMZ A;  2L3D A;  2RN7 A;  2XB5 A;  2HQ5 A;  1ZLK A;  2LP0 A;  3GFL A;  1HBX G;  3KYL A;  3Q9S A;  2QSH X;  4BBS J;  3FMQ A;  2DTZ A;  4O5V A;  3FXR A;  3I4M J;  2RQQ A;  2P81 A;  2BZT A;  4QPO A;  3O2P E;  2DQL A;  2W00 A;  2E34 A;  1OCP A;  3BZK A;  2ZFU A;  2ZB9 A;  3BY6 A;  3J7Z I;  4EGZ A;  2HTJ A;  1GVD A;  4CH7 A;  4L9T A;  3G4S I;  3DTK A;  5D6E A;  4BKX A;  3BR6 A;  3F9K A;  3W2W A;  1HKS A;  3HTU A;  4HZF A;  4CYC A;  3EYI A;  5HS7 A;  3BCA A;  5J4Y A;  3ZMT A;  3OL4 A;  3Q0V A;  4CHU A;  4XM3 A;  3ZQH A;  1SFU A;  1MGT A;  3QU6 A;  3BT9 A;  3LSI A;  5DCM A;  3H3U A;  4XQF A;  3NAU A;  4JP0 A;  2RDP A;  1JUS A;  3CJN A;  4L0Z B;  2G7H A;  4RGR A;  5EG0 A;  2WY7 Q;  2C6Y A;  4G7O F;  3T8R A;  3GYH X;  5CVV A;  4NHJ A;  3U1K A;  4OIO F;  1U5T C;  2X48 A;  2CV0 A;  2ZFW A;  4G12 A;  1ACI A;  2R5Z B;  2BE5 F;  4BXF A;  4KDP A;  2X9D A;  1G3W A;  5CLS A;  4ENK A;  3KYC B;  2Z1D A;  3CQZ J;  5K1Y A;  1BC7 C;  4HPQ A;  3S2H J;  1M1E B;  1QHH D;  2M9H A;  5GAH J;  3CO6 C;  1Z77 A;  2IGM A;  3EUA A;  1ULY A;  3C1D A;  2K85 A;  2HYF A;  2X1D A;  1WH5 A;  3ZMD A;  4ASN A;  3LSG A;  2ID6 A;  1RI7 A;  1D0X A;  2LD5 A;  4WXH A;  1XB4 A;  1ETK A;  2D1V A;  3O6B B;  1TTY A;  1U6G A;  2EV6 A;  2E1C A;  3D1N I;  3JRB A;  5TRD A;  2ZSH B;  4OAZ A;  4B4C A;  5JLW A;  2KHM A;  4XRM A;  2PX9 A;  2XSD C;  4FHT A;  5KCM A;  3HJE A;  4CA0 A;  3KET A;  1OCR H;  4AID A;  4RGS A;  1VQL I;  4CSW A;  4UV9 A;  1I3Q J;  1S9H A;  2GLO A;  3DBR B;  3FDY A;  1YIJ I;  3I59 A;  2UXX A;  5FFZ A;  3GZ6 A;  1SVL A;  1YLF A;  2RV8 A;  1Z1D A;  2F48 A;  3X2Q H;  3G73 A;  1RUN A;  2OTJ I;  2BGC A;  3DEW A;  2VOP A;  1JKR C;  2DDB A;  3SEZ A;  2K27 A;  2E7X A;  2EV0 A;  3FWE A;  2Y30 A;  2K9M A;  4O6J A;  2GZW A;  4J01 A;  2ELK A;  4RAY A;  1NK3 P;  2EA2 A;  1MSF C;  3OS0 A;  2HVS A;  1J2X A;  1TWH J;  2X85 A;  3MKL A;  2KKO A;  5KAI C;  2HYJ A;  3CCS I;  1STZ A;  3CUQ A;  2FBK A;  2Q1Z B;  3BP8 A;  2E35 A;  2LF8 A;  1ZG5 A;  3CLQ A;  2V6E A;  1A04 A;  1BI3 A;  1Y0U A;  2VQL A;  5DD8 A;  2E5Z A;  3Q0W A;  1BW5 A;  1YX5 A;  3ZOB A;  2WV0 A;  3QU3 A;  1AKH B;  3TMO A;  1B4A A;  3CCM I;  1WJE A;  4A3E J;  1G3T A;  3R60 A;  4G6T B;  4JX4 A;  2FD5 A;  1Z6R A;  2BVL A;  3SDB A;  4BQN A;  3JRC A;  3QAH A;  3SZG A;  3LOC A;  2LTP A;  4RA2 A;  4II3 A;  1P2F A;  2LY2 A;  1SD4 A;  3OYL A;  1TQP A;  3V7C A;  2PBI A;  3GF2 A;  3CP2 A;  1X2N A;  1R71 A;  4S04 A;  5C4X J;  2M0C A;  2L4M A;  3RPU A;  2DXI A;  1R1V A;  3K4K A;  4BJT A;  1L3L A;  4D5C A;  2XKO A;  2VKH A;  3BR3 A;  3H9J A;  1P4X A;  3MZH A;  1ZYR F;  3HKZ A;  3T5X A;  2CFO A;  3IAM 2;  4C9Y A;  2DOF A;  2V6C A;  2QBY B;  4KIT B;  1VTN C;  5IOY A;  3HRM A;  2DOD A;  1IGN A;  2OTL I;  1FOW A;  1YJN I;  1W0T A;  4QWQ A;  2OD5 A;  2Y2Z A;  5K5Q A;  2H8W A;  5B66 C;  4PK4 A;  2Q0O A;  2KIU A;  2XDV A;  4A3L J;  3TQN A;  1OPC A;  2H1L A;  1YG2 A;  1XGN A;  1T08 B;  4DBQ A;  1OLT A;  4KMU X;  2Y9Z A;  2XRO A;  2F4I A;  3EUK L;  3DPT A;  4HBL A;  3WTW C;  2DO7 A;  3RKX A;  4B43 A;  3OSF A;  1XMA A;  4OAY A;  3IP4 B;  2W4S A;  3E1S A;  4KMF A;  4L18 B;  3C2H A;  5IYC J;  1FIP A;  2IGO A;  1S72 I;  4U7D A;  2IP2 A;  4IJA A;  5LBQ A;  2D2W A;  3REO A;  3MN2 A;  2H27 A;  3H0D A;  2IEK A;  3HRT A;  1K4T A;  3L2V A;  2H6B A;  2DMQ A;  1EF4 A;  2NVX J;  3OYH A;  4U88 A;  4LIV A;  4CZC A;  2NXN B;  5J4V A;  1DPU A;  5FRN A;  4Z6Y A;  4BDY A;  3ZGK A;  5BPD A;  1K61 A;  3O8H A;  4QPQ A;  1H8A C;  5DM7 F;  5E3L A;  2CUJ A;  2ZNZ A;  1H9G A;  1ON1 A;  3AG1 H;  3EQL F;  1JHH A;  4KUM A;  5ICC A;  5LHH A;  1ETX A;  3FXJ A;  1ETY A;  1XGS A;  2HTS A;  4XKV A;  2DPD A;  2KFD A;  4KIC A;  4LLG F;  1MMG A;  1YRN A;  3BTJ A;  2DU9 A;  3DU6 A;  3JW4 A;  4CGZ A;  1DU6 A;  3W6J B;  5F0H A;  3MD2 A;  1J09 A;  3WU0 A;  1IV6 A;  1W36 D;  4A3C J;  1P7I A;  5E79 C;  5ICE A;  1V5E A;  2K9Q A;  1VQ4 I;  2EB7 A;  3SJM A;  2E1M B;  4LLN A;  4F52 A;  1OCC H;  3K1N A;  5ICG A;  4OOI A;  2YPR A;  4N9H A;  2K4J A;  3ASN H;  1I50 J;  2QQB A;  3JRE A;  4RMN A;  1IO2 A;  5ILV A;  2JN6 A;  4AVZ A;  3HOU J;  1R58 A;  1JJ8 C;  2DDA A;  2QZ8 A;  3G1L A;  2QKM B;  5TIS C;  4Y15 A;  1MMS A;  2IS2 A;  4KJZ A;  1SFE A;  4CYC B;  2A5Y B;  3OIQ A;  1DPR A;  4UVB A;  4A12 A;  4XON A;  1R49 A;  1G2H A;  1JTX A;  1Z3Y A;  2QYO A;  1U5T A;  5ILS A;  1W36 C;  3HYI A;  2R7S A;  1TWC J;  1X1P A;  3R4K A;  2JQ7 A;  2V26 A;  3FIS A;  3KPH A;  3DKX A;  3LWF A;  3KLN A;  2ZME B;  3Q0U A;  1XMX A;  2FRH A;  2FBI A;  1R22 A;  2LKP A;  4IZZ A;  4MEX F;  1S6L A;  4C2M J;  2WA0 A;  3O3K A;  1NG7 A;  4JX6 A;  3HOZ J;  3L9F A;  4A6D A;  2BBY A;  2OBP A;  4YFX F;  1XGM A;  4BUP A;  1QU3 A;  1MD0 A;  5L3B A;  2GOM A;  5CQG A;  5LHI A;  2B63 J;  3GTQ J;  1X1C A;  2XAH A;  4Q48 A;  4BHP A;  1R5G A;  4DW6 A;  4Y13 A;  3PIO F;  2OCE A;  1IXR C;  4IHS A;  1ZK8 A;  2DK8 A;  4E70 A;  4ZZD A;  3TP3 A;  5GTI C;  4M74 A;  4D0P A;  3AFH A;  4DOZ A;  2MLG A;  3DPL C;  4A5M A;  2CWE A;  1ONV A;  3ZP5 A;  4DYQ A;  1IXS B;  3CJQ B;  4CO8 A;  1S7E A;  2ISZ A;  1Z6T A;  3GX4 X;  2EZI A;  1P4W A;  1QRY A;  3FXM A;  3DQV C;  2COB A;  2IPQ X;  2HU9 A;  4RB0 A;  3TKY A;  1VFC A;  4ZDP A;  1A6Q A;  3K1M A;  3KEY A;  5E8G A;  2J5O A;  5FRM A;  3JRF A;  2BW3 A;  3CDH A;  5K5R A;  4YRV A;  1RKT A;  2ZXH A;  3ERM A;  4QSH A;  3QYB A;  4NB5 A;  1FC3 A;  3NEU A;  2VE9 A;  2YU3 A;  2E2J J;  3CCR I;  2EA4 A;  4A0X A;  1T56 A;  4IOA F;  1O3R A;  3CCL I;  2VBW A;  3I59 B;  4R79 A;  1D5V A;  4BQQ A;  3FF5 A;  3FKI J;  3ECH A;  2Z99 A;  3N4M A;  3HGY A;  1FT9 A;  3OMY A;  1G3Y A;  1APL C;  2V1N A;  3GW2 A;  2MYS A;  1ENH A;  1I3A A;  2F4O B;  3TDZ C;  2DQR A;  5C4J J;  1Z7U A;  3KYD B;  3ELK A;  4HV6 A;  2DFF A;  2Y31 A;  2DMN A;  4C3I J;  3BLY A;  1P6R A;  3TGN A;  2M7A A;  3MKZ A;  3PJR A;  1W5C C;  1BOA A;  3K10 A;  2YX7 A;  1UJ8 A;  2O6G E;  2EBI A;  4C3J J;  1Z9C A;  5CVR A;  3E3V A;  1X1A A;  1P9Q C;  2F5F A;  2MH2 A;  2EFO A;  2QCO A;  3B73 A;  2QLZ A;  5HS8 A;  3HRU A;  1LFB A;  3CUQ B;  2XPV A;  4F93 B;  2VPL A;  1PJR A;  5FKM A;  1BL0 A;  2FA5 A;  5KNL A;  3BPV A;  2L9N A;  2F5D A;  3ASO H;  3HOS A;  1MKM A;  4BGD A;  4IOC F;  3CTA A;  5JVG F;  3D5S C;  4AU7 A;  3HUG A;  3LA2 A;  2KIS A;  1OCZ H;  3GFJ A;  2JVH A;  4NNJ A;  4WXC A;  1GXQ A;  2F2E A;  3T8T A;  1UFM A;  1LE8 B;  4A3D J;  1MW7 A;  2CW0 F;  3CCQ I;  2V1D A;  5E18 F;  3LQR A;  2R7X A;  3O8G A;  1X4O A;  4P1W A;  4X0G A;  2AQE A;  3IH4 A;  1VQK I;  3MQ0 A;  2VUM J;  3GFI A;  4LOC A;  1E3O C;  2HDC A;  2JA5 J;  3M1E A;  3M8F A;  2KZV A;  1SC7 A;  1A35 A;  3CDI A;  4EJW A;  3P9I A;  4MHG A;  3LAJ A;  2ME6 A;  1ZR2 A;  1QPM A;  3JTH A;  4HG2 A;  1Y1W J;  5J8C A;  2PJR B;  1JGS A;  5D8L B;  3ABM H;  1FBS A;  3A03 A;  1DGR M;  4CCN A;  5FLM J;  2ZC2 A;  1IDY A;  1YS7 A;  5CKT A;  4BDZ A;  1O3Q A;  2IS6 A;  5FKO A;  1JT6 A;  3FIW A;  2M8E A;  4ON0 A;  2HS5 A;  2BEO A;  3TBI A;  1YI2 I;  1T6S A;  4PJL A;  3E7L A;  1YFH A;  3CP8 A;  3JR9 A;  3NAR A;  4Y17 A;  1MDM A;  4I02 A;  4E7S A;  1X1D A;  4MEY F;  5HLH A;  1TZL A;  2XRN A;  1GUU A;  3OY9 A;  2X6Y A;  4OIP F;  1IAW A;  1AWC A;  1QBJ A;  2XIG A;  1QVT A;  1EJ9 A;  5B1A H;  1D1A A;  2E60 A;  2LBF A;  1FPQ A;  3MFK A;  1LQ1 A;  6PAX A;  1O7F A;  4BYY A;  2DFE A;  1BR4 A;  1I5Z A;  2CH0 A;  4NDL A;  5K5O A;  3HRS A;  2HZT A;  2YU9 J;  4FQG A;  4WCG A;  5FLX K;  1K83 J;  2OZU A;  5JHU A;  3L2U A;  5GAD J;  3C3W A;  2A68 F;  1IUY A;  1BR2 A;  2EIM H;  1O3T A;  3OSG A;  3F23 A;  4IKF A;  1WI3 A;  2JA2 A;  3GVA A;  4YFK F;  3DBH B;  4UVC A;  3WTZ A;  3IV5 A;  3GLX A;  3K4M A;  3GXO A;  1LDJ A;  1R6R A;  4XRF A;  4ANJ A;  3D5L A;  1E17 A;  4RAG A;  3PNY A;  3HKZ N;  2RNG A;  2VI6 A;  1BOB A;  1IN7 A;  2VB6 A;  1FOK A;  1ODD A;  2CW8 A;  2CUZ A;  2QQ8 A;  3BR0 A;  3MVP A;  4PJN A;  1VQ6 I;  4AM3 A;  4KNY A;  4LK1 F;  4MQ9 F;  3BZC A;  3QPL A;  5HNF A;  1GDT A;  2CQX A;  2P5K A;  3K4C A;  2VPR A;  3RPU D;  2EV5 A;  4Z2Y A;  2P0W A;  2EIL H;  3I55 I;  4GFB A;  1X58 A;  4OIQ F;  3A0B C;  5FB2 A;  3CMY A;  1YJ9 I;  1XCV A;  1D8K A;  2LSO A;  3KX2 A;  3RQ4 A;  3BPX A;  4XLN F;  2CQK A;  3CCJ I;  5CVJ A;  1FBQ A;  3W6K B;  2XF5 A;  2HQN A;  2WC2 A;  1ZKG A;  2CUF A;  4D7N A;  3P5J A;  4FE4 A;  2PLY A;  2DYS H;  2DA7 A;  2XAQ A;  4NQW A;  4BXU A;  3MZY A;  2B0L A;  1T39 A;  5B5E C;  5HVQ C;  2YR2 A;  3GTM J;  3OIO A;  3V8K A;  2B9S A;  4HSR A;  3H5A A;  3VSL A;  4FAS D;  2BY3 A;  1XC5 A;  1KQ9 A;  2XAS A;  3LA7 A;  4EVI A;  2MC3 A;  3DWL E;  1T33 A;  3LMM A;  4ZC3 A;  1U78 A;  4D9J A;  1UAA A;  3KP5 A;  3VYR B;  2GXB A;  3K6G A;  2CQ7 A;  2HOA A;  4KIG A;  3AL0 C;  3KP3 A;  2W48 A;  4EAT A;  4YEL A;  4EM2 A;  4BEH A;  5FKN A;  2QUF A;  1DUX C;  4BU2 A;  5K7Z A;  2Z5U A;  5E1W A;  4ZYE A;  3BQY A;  3KE2 A;  4LG0 A;  3H36 A;  3DF8 A;  4DZJ A;  5AON A;  2XAU A;  3BG6 A;  1UHW A;  2W82 A;  2DYR H;  4A3F J;  1UHM A;  1R5H A;  4Q5S F;  1TNT A;  2MA3 A;  4PDK A;  2ELH A;  4WWC A;  3I53 A;  3SEQ A;  3L2W A;  2JT1 A;  4I0B A;  4N4N B;  5EZG A;  3JRH A;  3OYB A;  3S1Q J;  3F22 A;  2CMP A;  3F8N A;  4KN4 X;  3UNG C;  1FOX A;  3GLL A;  4AYB A;  4XOT A;  2NVQ J;  2H09 A;  2VC0 A;  3SXY A;  2DN0 A;  2GXG A;  2WAQ N;  1VQM I;  4UUV A;  5FKL A;  1F5T A;  2YUS A;  2JA6 J;  1V3F A;  2HXI A;  2MG4 A;  1LNW A;  2DK5 A;  4HNV A;  3S3O A;  1ZGW A;  3WU2 C;  1HLV A;  1R4M B;  2GOX B;  4MGR A;  5DEQ A;  3LA3 A;  2V9V A;  2M30 A;  1HDP A;  2I8D A;  3BJO A;  2WAF A;  2UUZ A;  2KRC A;  5E3N A;  2JWT A;  2HPI A;  3EET A;  3QWL A;  4P5O A;  5E1X A;  4KT5 C;  2XGE A;  4XLA A;  1ETO A;  1OCT C;  2BW3 B;  1LPQ A;  3DKW A;  5H6Q A;  5D5W B;  3W3C A;  2MD0 A;  1I1G A;  3NWT A;  2LMD A;  3V8J A;  3J81 K;  3E5X A;  3BR2 A;  1J75 A;  1J5Y A;  4RB1 A;  1WJF A;  1T95 A;  4EV0 A;  1D5Y A;  3CF2 A;  1MBF A;  1V5G A;  3HPG A;  1TQI A;  1OR7 C;  2VT3 A;  1RC9 A;  1S8N A;  4ZDL A;  5EEG A;  3ZN0 A;  3TW7 A;  2PI0 A;  2Y9Y A;  3D0S A;  4PSW A;  1CQT A;  2PFB A;  3LSH A;  3M3Y J;  5FD6 A;  3DFG A;  2WTE A;  3VPR A;  2DJI A;  2CV2 A;  4P9U A;  1KYZ A;  3GTJ J;  1XD7 A;  2FMY A;  2L0K A;  4EMS A;  2EFQ A;  5KK1 A;  1ORK A;  1KGS A;  2DA6 A;  2KLO A;  1R00 A;  2LKX A;  2OJE D;  2FOW A;  4M71 A;  4A3K J;  1IJW C;  4CCJ A;  2Y0S A;  3IH2 A;  3L2R A;  5F08 A;  3Q3S A;  4WX9 A;  3L00 A;  1XGO A;  1DDN A;  1B8I A;  2XKP A;  4JQF A;  3VSK A;  1Z3X A;  1LEB A;  5BQT A;  2DI3 A;  4PJM A;  4DQ2 A;  3G1O A;  2NS0 A;  1XTA A;  3PIP F;  2EPF A;  3M8J A;  3HUG B;  1B72 A;  3CES A;  1DQU A;  1SVM A;  1UCR A;  5L3E A;  1W0U A;  4RGX A;  1LFU P;  2F5V A;  4HDU A;  3L7W A;  3JCU C;  2KRF A;  2KJC A;  5E8I A;  1U0J A;  2FU4 A;  2GWR A;  2KZG A;  3ABK H;  2A69 F;  3CJR B;  4BJ5 C;  3RKY A;  1MJ9 A;  4KIB A;  2OQG A;  4HF0 A;  3KEQ A;  2FF4 A;  3QPT A;  2LR8 A;  3BCB A;  2M4G A;  1IC8 A;  4A3B J;  2ZCW A;  1VZ0 A;  3K1P A;  2UZK A;  2A6H F;  1HA8 A;  2NRA C;  1JKO C;  3IHU A;  1HQC A;  3F72 A;  1SMT A;  3PFY A;  3RPQ A;  2R5Y A;  1K7A A;  4MLO A;  5JHF A;  2UWM A;  5E3O A;  1DGW Y;  2L9R A;  1XSV A;  1TWF J;  2KIM A;  1IRF A;  2K3F A;  2QGU A;  2VXD A;  5D4S A;  3OYJ A;  2BXY A;  1UG2 A;  1BA5 A;  2X51 A;  2IGN A;  2JPB A;  4CXF A;  1MDM B;  2WB1 A;  1OFC X;  2QEX I;  1RUO A;  2VIX A;  4A3J J;  2EFP A;  3EDP A;  4U0W A;  3GTG J;  1W1W E;  2LFB A;  1SAX A;  1QZZ A;  3HSF A;  3PUB A;  2ESH A;  2LY9 A;  3GO5 A;  2XAF A;  5DV5 A;  2QQ9 A;  5LGT A;  2PMU A;  3RKQ A;  3GTK J;  3FKJ A;  3WTU C;  3GCM A;  2PEX A;  2ETH A;  2DMT A;  2QVO A;  1RES A;  4ITV A;  5FKK A;  1A31 A;  5JFR A;  4R8H A;  4AIH A;  1W7P A;  3S16 J;  3BC8 A;  3Q5F A;  2VJ4 A;  4BY1 J;  1Y8R B;  3C2B A;  5DTD A;  2VQG A;  4M3G A;  5C44 J;  2KDZ A;  2DW4 A;  3OS2 A;  2DMP A;  1D1B A;  2OUM A;  3PFI A;  4UUS A;  5FJ8 J;  1I39 A;  1POG A;  1H88 C;  2EIN H;  1S7O A;  2DLL A;  3WE3 A;  2HPM A;  2QEN A;  1YYV A;  4GYG A;  4DYC A;  1QA6 A;  4LFU A;  2FML A;  4C3H J;  5HLG A;  1I6H J;  1BR1 A;  2A07 F;  2FEZ A;  3G2B A;  1Z7L A;  3IRQ A;  3OYK A;  1QO0 D;  2MD5 A;  5KAF C;  4J00 A;  2WV1 A;  2ZBK A;  4G7Z F;  5CYV A;  1ZQ3 P;  1MH3 A;  4G8X A;  2R93 J;  4OWR B;  3F3X A;  3HL2 A;  2LC2 A;  2X6W A;  3S32 A;  1SD7 A;  3C2G A;  5J1R A;  3LSP A;  1TW3 A;  3ZQG A;  2M45 A;  4ABZ A;  2F4M B;  1ERD A;  3QYE A;  5J47 A;  2DT6 A;  1YW8 A;  2O3F A;  2QWW A;  1ZTR A;  1D3Y A;  3HHH A;  1A6I A;  3PO2 J;  3KIO A;  4S05 A;  2CO5 A;  1Z91 A;  3CC7 I;  4IVN A;  1IDZ A;  1SVO A;  3AG3 H;  2IGK A;  2FX0 A;  3I56 I;  4CCM A;  1RR8 C;  3QRF F;  1LE8 A;  4NC6 A;  2R3S A;  3OYF A;  3A01 A;  4KIS A;  1JJ6 C;  3I58 A;  2FNP A;  2VBX A;  1MMA A;  2ZJ2 A;  4HX4 A;  2XSJ C;  2WBM A;  1YOV B;  1MNM C;  4L0Y B;  1YE9 A;  2LK2 A;  4F3Q A;  2O61 A;  2MLK A;  5GTH C;  5IP6 A;  2E19 A;  5GPC A;  1ON2 A;  2NAZ A;  4ETS A;  5HNH A;  2HGC A;  4AC0 A;  3GZN B;  5IT9 K;  1BI1 A;  3HPH A;  2VOO A;  3ZQ7 A;  1NTC A;  2L4A A;  3HGG A;  2ZNY A;  3B02 A;  3PQJ A;  1LVA A;  2L7K A;  4Y3O A;  1B59 A;  5FGM A;  4JYK A;  3VYS B;  3N05 A;  4EGY A;  2YSR A;  4ENN A;  3J81 Z;  3RZD J;  5J8F A;  2OCC H;  1AA7 A;  3L2Q A;  1XPX A;  1YW9 A;  4IXA A;  3WTS C;  4CCL A;  5EDN A;  2A5W A;  2HFH A;  2FE3 A;  2KP6 A;  3ZQL A;  3CUO A;  3ESW B;  4N9I A;  2X6O A;  2OPT A;  4N0B A;  5DM6 F;  3A4C A;  4I2O A;  3RSN A;  4XRS G;  1QNT A;  5LEK A;  2L2O A;  1G8X A;  4UB8 C;  1OMI A;  1WH7 A;  5EGO A;  2MAB A;  4GCV A;  4HA8 A;  4X6A J;  4M3B A;  3PNV A;  4R1H A;  4KIF A;  1SD6 A;  4LLL A;  1YO5 C;  2KRH A;  1ZR4 A;  1IRG A;  2MH9 A;  2DT5 A;  3KZI C;  4L9V A;  3HB9 A;  4HQM A;  2HR3 A;  1O3S A;  4PSX A;  1H9T A;  2P7C B;  2IS1 A;  2K5C A;  4XSX F;  1MBJ A;  2P6S A;  4IHW A;  3HG9 A;  4C30 A;  3QPS A;  2XGX A;  1OR7 A;  4BJ6 C;  5M5X J;  2BOL A;  1BW6 A;  2W85 A;  3N97 A;  1KU7 A;  1KU9 A;  2VE8 A;  2Q8K A;  4EM1 A;  2M1B A;  4S0H B;  3HSE A;  3RKW A;  1MZB A;  1PVE A;  2M34 A;  2OQR A;  3K4B A;  3WTV C;  2HEO A;  1VQN I;  4E4H A;  5LGU A;  1TW2 A;  1MJA A;  1H0M A;  3PO3 J;  2DT7 B;  3CZ6 A;  4HW0 A;  4V2G A;  2IA1 A;  1VQ5 I;  2Z3Y A;  2LKS A;  2W24 A;  1ZAO A;  4MTE A;  2XGC A;  4EJO A;  3PL8 A;  3DTE A;  4AYB N;  1S3J A;  3U9G A;  1VQ7 I;  3WTT C;  4PZJ A;  1ZAR A;  4XMY A;  4MNU A;  1JUM A;  2VKE A;  3QYF A;  3I5U A;  3RIR A;  2MGQ A;  3C18 A;  3CCU I;  2X6X A;  5DCM B;  4XL9 A;  2HVR A;  4BXX J;  2LY1 A;  4FCY A;  4GGG A;  2BHY A;  3S1R J;  2R7T A;  2NYX A;  5EG0 B;  2IXS A;  3OYM A;  1LKX A;  5CVI A;  3SHF A;  2CQQ A;  1PP7 U;  2Y0M A;  3SZT A;  3BR1 A;  4OIR F;  1B8I B;  3ROU A;  2DJN A;  3DEU A;  2XRL A;  4I01 A;  1FEX A;  4D1Q A;  2JRT A;  2OF7 A;  4G6D A;  4L5E A;  2XPW A;  3BWG A;  1B72 B;  1WJB A;  3H3V K;  4XKC A;  5E3M A;  4IHV A;  3JAM K;  3A2K A;  1SFO J;  2X1C A;  3M1C A;  4HNT A;  3OS1 A;  4D5F A;  2FJ1 A;  5CVU A;  5HDK A;  2HVQ A;  3F8F A;  3I0T A;  2CV1 A;  2ESN A;  1GV2 A;  3LQQ A;  5J6X A;  1R1T A;  3DEE A;  1X4P A;  4EM0 B;  3H5N A;  3KZY A;  2EK5 A;  4QTR A;  3OR1 C;  3ZPL A;  3DV8 A;  5IY5 H;  2AQF A;  4W1U A;  3G1M A;  1QHG A;  1N25 A;  2ISY A;  1T2K A;  2D45 A;  1P92 A;  5KVR A;  3I9V 2;  3TW6 A;  3A1Y A;  1LDD A;  4RB2 C;  1WRJ A;  1FYK A;  1HW1 A;  4MIM A;  2HI3 A;  2Y0S N;  3D5R C;  3CCE I;  5HLT A;  2Q2E A;  3HM5 A;  2V4J C;  1YQA A;  4BHB A;  1IN5 A;  4BL0 B;  3U1D A;  2M5W A;  3GTP J;  1JT0 A;  2R7Z J;  4AD9 A;  2VON A;  1HW5 A;  1UZC A;  4Y52 J;  2GM4 A;  1R5I D;  2R7V A;  5CJ9 A;  1PUF A;  3HXL A;  1Q1H A;  2R7Q A;  1WGX A;  2F5C A;  3F0C A;  3PSI A;  4ZYA A;  3ABT A;  4DIQ A;  1ZRD A;  4A93 J;  4MQV A;  3L1P A;  3S1N J;  5IT3 A;  3K0L A;  1CGP A;  2E1N A;  2KL4 A;  2L7Z A;  2EH3 A;  4YIR X;  2DCE A;  5FLV A;  1BIA A;  1TC3 C;  5A2Q K;  2RC4 A;  2X4H A;  2H1K A;  3KFW X;  1S5L C;  3BOQ A;  2ID3 A;  2PMH A;  1U3E M;  1T98 A;  2I5U A;  3CJT B;  1MBH A;  2XAJ A;  2DPU A;  4EJT A;  3OOU A;  1BBY A;  3DLA A;  3RTR A;  4C2U A;  4AUX A;  2XPU A;  1KU3 A;  1RZ4 A;  2OAZ A;  3LST A;  2Y75 A;  5EZH A;  4F7Z A;  5IPA A;  4L9N A;  4W97 A;  2CUE A;  2M0M A;  1TNS A;  2AO9 A;  2K02 A;  1I6X A;  2R5Z A;  1VQP I;  3LNQ A;  2WB1 N;  4NC8 A;  5EEH A;  4UUT A;  2Y48 A;  1YHQ I;  1PUE E;  1TWG J;  2YX4 A;  2VC1 A;  2ZME C;  3UKG A;  1OJL A;  2KJB A;  1WJD A;  3TOA A;  4E7K A;  4XK4 A;  5LEJ A;  4KFC A;  1K4S A;  3TP0 A;  1X3U A;  4MO7 A;  4OMY A;  3DKY A;  2V7F A;  3MEX A;  3FXK A;  3WTX C;  2A6T A;  4LGW A;  1LJ9 A;  3QOE A;  3K70 D;  3G71 I;  1A36 A;  2ZXI A;  5ERI A;  2JUG A;  2V79 A;  5C3E J;  2IAI A;  2KMU A;  1VF9 A;  1G4D A;  1HXD A; 
#chains in the Genus database with same CATH homology
 3NQO A;  2EJR A;  1W7P D;  3I4P A;  4BH9 A;  2HQR A;  3Q9V A;  2STT A;  2OU2 A;  5HDN A;  4GO1 A;  2CFX A;  4BQA A;  2PG4 A;  2Z33 A;  5LHG A;  2DFI A;  4IHT A;  1D8J A;  4UVA A;  4UNO A;  3GZ5 A;  4GXO A;  1IW7 F;  4M9S A;  3IKV A;  3E5U A;  3E6C C;  4CDG A;  1JHF A;  2BV6 A;  3E6B A;  1R1U A;  4DNC A;  1IN6 A;  3ZMU A;  4HYE A;  1TBX A;  5HDG A;  3K9T A;  1G3S A;  5ED4 A;  4KYW A;  4A5N A;  1LDK B;  3NRV A;  3QOP A;  3COA C;  2P7V B;  1ZGJ A;  1ZHF A;  2FBH A;  3WTY C;  3CLO A;  1I1S A;  2PJP A;  2ZXJ A;  1USS A;  5DDG A;  2CSO A;  3BZ6 A;  1R7J A;  2DBB A;  3ULQ B;  2QBY A;  3FXU A;  1ZRC A;  1U5T B;  2IA2 A;  5H20 A;  3DP7 A;  4LD5 A;  1CF7 A;  3KLO A;  1G6N A;  4G7H F;  1EH7 A;  2L01 A;  4M72 A;  4BHC A;  1PDN C;  4RAZ A;  4AIK A;  1IXC A;  1SD5 A;  3VFZ A;  4I98 B;  1S29 A;  1KYW A;  1YIO A;  1B1B A;  1FP1 D;  2EFW A;  1W5S A;  4G6Q A;  3MCZ A;  3BJ6 A;  4K2E A;  3C7J A;  1FY7 A;  2GIV A;  1F4K A;  4FX0 A;  2MBF A;  2H94 A;  5JR3 A;  3MWM A;  3LFK A;  4HOB A;  5ICF A;  3M8E A;  3WGI A;  2RQP A;  4RB3 C;  1TLH B;  3I54 A;  4BAY A;  1K78 A;  4P9F A;  3FM3 A;  2DAO A;  2P5L C;  1OKR A;  4KN7 X;  1ZRE A;  3WU1 B;  2IW5 A;  1HST A;  1BI0 A;  3H92 A;  4JBA A;  2STW A;  4ESB A;  2P6T A;  3FMR A;  3P9C A;  2F5E A;  5D5X B;  2P4W A;  5HS9 A;  4A0Z A;  2VBZ A;  3KEO A;  3E97 A;  1OYI A;  2ZKZ A;  2FXA A;  2VT2 A;  3TO6 A;  4HF2 A;  3IKT A;  1MJB A;  3FHZ A;  3BDD A;  2O8X A;  1J9I A;  2G9W A;  4IRH A;  4IRG A;  3SQN A;  2ZME A;  1FSH A;  2E7W A;  3GUD A;  3RI4 A;  5D4R A;  3VOD A;  4ESJ A;  2XVC A;  5FLX Z;  2LDU A;  2L54 A;  5DUI A;  1AOY A;  5L3F A;  2PN6 A;  3EUH A;  1ZG3 A;  2X0L A;  5D6F A;  3R0J A;  3TDU C;  4XBF A;  5HOO A;  5TJJ A;  2CYY A;  3JSP A;  2A61 A;  1FSE A;  2AS5 F;  2HKO A;  3H3Z A;  3RYR A;  1FX7 A;  1RNL A;  4A6E A;  4XSZ F;  1J0R A;  3HHG A;  1U8R A;  4CIC A;  3KCC A;  3WG9 A;  5BOX A;  4M6X A;  1K79 A;  3M9A A;  1WSU A;  2EFN A;  3I71 A;  2RGV A;  4LB5 A;  1EV7 A;  4JK1 X;  3IC7 A;  4CYD A;  2COM A;  4PCQ A;  4WK8 F;  2J5P A;  1KQ0 A;  2RNJ A;  4LJZ F;  2NNY A;  3R61 A;  5F1R A;  3GFM A;  4I7H A;  4EJV A;  2VOD A;  3R6S A;  3VEP A;  1DP7 P;  2O0Y A;  2EWN A;  1ZN2 A;  4UV8 A;  1P4A A;  4YG2 F;  1W5T A;  3F8B A;  4U0Y A;  3E6M A;  1BI2 A;  3DXJ F;  1IF1 A;  1BIB A;  3K69 A;  4GYI A;  1EH6 A;  3RJP A;  4PGG A;  2TDX A;  2IRF G;  1S7A A;  1K6O A;  3OOP A;  4HX7 A;  3JTG A;  3F8C A;  4U7B A;  3QPH A;  3F8M A;  1XMK A;  3ZN1 A;  4PGH A;  4P55 A;  1SFX A;  4OIN F;  3ABU A;  4HLX A;  4IRI A;  3HSR A;  4WXD A;  1FYL A;  1ZGA A;  2GA1 A;  4I0A A;  3BJA A;  1XSX A;  1FBU A;  2JZY A;  4ENM A;  5E1Z B;  1CF7 B;  2A3S A;  4LG0 B;  5LLQ A;  2GA2 A;  2IA0 A;  1BC8 C;  1J59 A;  3VOE A;  1ZLJ A;  4O3M A;  2FOK A;  2D1H A;  5BPI A;  2WWY A;  3TOB A;  5BS6 A;  5D8K B;  2PQ8 A;  2XV4 S;  4AIJ A;  3JSO A;  1IN4 A;  1JXS A;  1UST A;  3V8L A;  3K2Z A;  4AVP A;  4KA4 A;  5F64 A;  4L9J A;  2V1X A;  1B6A A;  1E2X A;  1XCB A;  5FD5 A;  5AIP A;  1K78 B;  1OYW A;  5FFX A;  4RS8 A;  3IRR A;  3HTS B;  1ZRF A;  2M87 A;  1KA8 A;  2ADU A;  4YIF A;  2ACJ A;  2RKH A;  3WGG A;  1L0O C;  5ILU A;  1HKQ A;  2K86 A;  1OYY A;  4M9X A;  2VXZ A;  2IJL A;  3ZMS A;  3P7N A;  3VB2 A;  2XHK A;  4A2U A;  4IF4 A;  3TO9 A;  1FLI A;  4RGU A;  2OZ6 A;  1HKT A;  1FZP B;  3S2W A;  1QGP A;  2FNA A;  4OMZ A;  4Q4Z F;  3FMS A;  1BN5 A;  1BM9 A;  2P5V A;  1U2W A;  1FWZ A;  4BNC A;  3ERE D;  4EQQ A;  4ZYD A;  4LB6 B;  3KP2 A;  1T38 A;  4M6Y A;  1XDS A;  5E17 F;  2K4B A;  2FSW A;  3P9K A;  4CZZ A;  4HDV A;  2JSC A;  2JPC A;  4ESF A;  2ZO4 A;  3HOT A;  3CO7 C;  1Z05 A;  1FNN A;  1XN7 A;  1QZY A;  4AWX B;  2QM3 A;  3MAJ A;  2BYV E;  2CGP A;  4LMY A;  2W25 A;  3AAF A;  2GAU A;  4B8X A;  2DTR A;  5DCF A;  1XSD A;  2XUB A;  4L5I A;  1O57 A;  3SFZ A;  5JI6 A;  1ZG1 A;  3J80 K;  1B9M A;  1W7P B;  1WKM A;  3E6D A;  3PQK A;  1KQ8 A;  4IPA A;  3F6V A;  1B9N A;  5LGN A;  4ZZL A;  2W84 A;  2KIF A;  4ZYH A;  1PP8 F;  3KP7 A;  5IT9 Z;  1W4M A;  1GXP A;  1WI9 A;  5DYM A;  1YW7 A;  1ZH5 A;  4ENJ A;  2W57 A;  4UXN A;  2FQ3 A;  4HV5 A;  3TO7 A;  2QQA A;  3L2C A;  3QP5 A;  1FP2 A;  5AIQ A;  3ECO A;  3J7A O;  3V4G A;  4ZYG A;  4UHT A;  3FX3 A;  2O03 A;  3IWZ A;  1LEA A;  5L3C A;  1O7L A;  3ML6 A;  5FO5 A;  3EYY A;  3RYP A;  5E20 A;  4WF2 A;  3ISP A;  3F21 A;  4ZH4 F;  1R36 A;  3OV8 A;  2P8T A;  4YII A;  3IL2 A;  1GHC A;  1NHA A;  4FT8 A;  4HX8 A;  2LF7 A;  2Z9O A;  3QP6 A;  2R7F A;  2A6E F;  2AXL A;  5H6R A;  1FYM A;  3ZMV A;  1TQM A;  1V4R A;  1LB2 A;  4M9Z A;  4XLP F;  4EJU A;  5LRR A;  5DD4 A;  2R7D A;  4A0Y A;  5D5V B;  2VBY A;  3FM5 A;  1IN8 A;  3F6O A;  2RVC A;  2IT0 A;  1BJA A;  2VN2 A;  1F9N A;  2CG4 A;  1YS6 A;  2HOE A;  1UB9 A;  2L02 A;  4B09 A;  3U2R A;  4HLY A;  3V7R A;  2H6C A;  1JE8 A;  3HIF A;  1YTY A;  3FZV A;  5DUK A;  1I27 A;  2K7L A;  1SMY F;  5L3G A;  4FX4 A;  3RDI A;  3L09 A;  3CUQ C;  1KU2 A;  1C0W A;  3JAM Z;  1QQI A;  3V7S A;  1J7K A;  1T0F A;  5BMZ A;  3GEZ A;  2GQQ A;  1XDU A;  3I64 A;  4QLC U;  4HQE A;  2NNN A;  5HLI A;  4YFN F;  2IVM A;  4LK0 F;  3WGH A;  2V1U A;  1R23 A;  3GWZ A;  4MTD A;  4H0E A;  2HKX A;  4OU0 A;  5F6F A;  2JTV A;  2HWV A;  1WQ2 A;  2LNB A;  3WOD F;  3BRO A;  1WWX A;  4L5J A;  2XAG A;  4G9Y A;  3KP6 A;  1EH8 A;  2OA4 A;  5L3D A;  4U0V A;  1REP C;  5LRS A;  1IZ1 A;  5JVT A;  4TV7 A;  3IWF A;  3J80 Z;  3R0A A;  3FXQ A;  3SZP A;  2G7U A;  3WE2 A;  1RIO H;  1GVJ A;  1HW2 A;  5A2Q Z;  2HYG D;  3T0Y A;  4G94 A;  4HF1 A;  3M7G A;  4HAM A;  2UXN A;  1HSJ A;  4I09 A;  1F1Z A;  3KP4 A;  3LAP A;  4M73 A;  3T1B A;  5D5U B;  3KZZ A;  4P96 A;  4Q47 A;  3G3Z A;  3ZMZ A;  2L3D A;  2RN7 A;  1ZLK A;  3GFL A;  1HBX G;  3Q9S A;  3FMQ A;  4O5V A;  3FXR A;  3O2P E;  2DQL A;  3BY6 A;  4EGZ A;  2HTJ A;  4L9T A;  5D6E A;  1HKS A;  3HTU A;  4HZF A;  3EYI A;  5HS7 A;  3ZMT A;  4CHU A;  1SFU A;  1MGT A;  3QU6 A;  5DCM A;  3H3U A;  2RDP A;  3CJN A;  4L0Z B;  2G7H A;  4RGR A;  2C6Y A;  4G7O F;  3T8R A;  3GYH X;  5CVV A;  4NHJ A;  4OIO F;  1U5T C;  2ZFW A;  2BE5 F;  4KDP A;  1G3W A;  5CLS A;  4ENK A;  5K1Y A;  1BC7 C;  3CO6 C;  1ULY A;  3C1D A;  2HYF A;  3ZMD A;  4ASN A;  1RI7 A;  4WXH A;  1XB4 A;  2D1V A;  3O6B B;  1TTY A;  1U6G A;  2EV6 A;  2E1C A;  5TRD A;  4FHT A;  3KET A;  4RGS A;  4UV9 A;  3I59 A;  2UXX A;  5FFZ A;  3GZ6 A;  1YLF A;  1Z1D A;  2RV8 A;  3G73 A;  1RUN A;  2BGC A;  2VOP A;  2K27 A;  2E7X A;  2EV0 A;  3FWE A;  4O6J A;  2GZW A;  4RAY A;  2EA2 A;  1J2X A;  2KKO A;  1STZ A;  3CUQ A;  2FBK A;  3BP8 A;  2LF8 A;  1ZG5 A;  1A04 A;  1BI3 A;  1Y0U A;  5DD8 A;  2WV0 A;  3QU3 A;  1B4A A;  1G3T A;  3R60 A;  1Z6R A;  3QAH A;  1P2F A;  1SD4 A;  1TQP A;  3V7C A;  2PBI A;  3GF2 A;  4S04 A;  2L4M A;  3RPU A;  1R1V A;  1L3L A;  2XKO A;  3MZH A;  1P4X A;  1ZYR F;  3T5X A;  2V6C A;  2QBY B;  1VTN C;  3HRM A;  4QWQ A;  2OD5 A;  5K5Q A;  2Q0O A;  2KIU A;  3TQN A;  1OPC A;  1YG2 A;  1XGN A;  4KMU X;  2XRO A;  3DPT A;  4HBL A;  3WTW C;  2DO7 A;  3RKX A;  1XMA A;  4KMF A;  4L18 B;  4U7D A;  2IP2 A;  4IJA A;  5LBQ A;  2D2W A;  3REO A;  2H27 A;  3HRT A;  2H6B A;  4U88 A;  1DPU A;  5BPD A;  2ZNZ A;  1H9G A;  1ON1 A;  3EQL F;  1JHH A;  4KUM A;  5ICC A;  5LHH A;  1XGS A;  2HTS A;  2DPD A;  4KIC A;  4LLG F;  2DU9 A;  4CGZ A;  3JW4 A;  3W6J B;  3WU0 A;  5ICE A;  2EB7 A;  4LLN A;  3K1N A;  5ICG A;  4OOI A;  2YPR A;  4N9H A;  2K4J A;  2QQB A;  5ILV A;  1R58 A;  2QZ8 A;  4Y15 A;  1SFE A;  2A5Y B;  1DPR A;  4UVB A;  4A12 A;  2QYO A;  1U5T A;  5ILS A;  3HYI A;  3R4K A;  3LWF A;  3KLN A;  2ZME B;  2FRH A;  2FBI A;  1R22 A;  2LKP A;  4MEX F;  1S6L A;  3O3K A;  3L9F A;  4A6D A;  2BBY A;  2OBP A;  4YFX F;  1XGM A;  1MD0 A;  5L3B A;  5LHI A;  2XAH A;  4Q48 A;  4BHP A;  1R5G A;  4Y13 A;  1IXR C;  4IHS A;  2DK8 A;  4E70 A;  4ZZD A;  4M74 A;  4D0P A;  2MLG A;  3DPL C;  4A5M A;  2CWE A;  1ONV A;  3ZP5 A;  1IXS B;  4CO8 A;  2ISZ A;  1Z6T A;  3GX4 X;  1P4W A;  3DQV C;  2IPQ X;  4RB0 A;  3TKY A;  3K1M A;  5E8G A;  2J5O A;  3CDH A;  5K5R A;  4NB5 A;  1FC3 A;  3NEU A;  2VE9 A;  2YU3 A;  2EA4 A;  4A0X A;  1O3R A;  2VBW A;  3I59 B;  4R79 A;  1D5V A;  3FF5 A;  3ECH A;  2Z99 A;  3N4M A;  1FT9 A;  1G3Y A;  3GW2 A;  3TDZ C;  2DQR A;  1Z7U A;  3ELK A;  4HV6 A;  1P6R A;  3TGN A;  1BOA A;  2YX7 A;  2O6G E;  1Z9C A;  5CVR A;  3E3V A;  2F5F A;  2MH2 A;  2EFO A;  3B73 A;  2QLZ A;  5HS8 A;  3HRU A;  3CUQ B;  2FA5 A;  3BPV A;  2F5D A;  3HOS A;  1MKM A;  3CTA A;  3HUG A;  3LA2 A;  3GFJ A;  4WXC A;  1GXQ A;  2F2E A;  3T8T A;  1UFM A;  2CW0 F;  2V1D A;  5E18 F;  3LQR A;  3MQ0 A;  3GFI A;  2HDC A;  3M1E A;  3M8F A;  4EJW A;  3P9I A;  4MHG A;  3LAJ A;  1QPM A;  3JTH A;  5J8C A;  1JGS A;  5D8L B;  1FBS A;  1YS7 A;  1O3Q A;  2M8E A;  4ON0 A;  2HS5 A;  2BEO A;  1T6S A;  1YFH A;  4Y17 A;  1MDM A;  4I02 A;  5HLH A;  4MEY F;  2XRN A;  4OIP F;  1IAW A;  1AWC A;  1QBJ A;  2XIG A;  1FPQ A;  3MFK A;  1LQ1 A;  6PAX A;  1O7F A;  4BYY A;  1I5Z A;  5K5O A;  3HRS A;  2HZT A;  4WCG A;  5FLX K;  2OZU A;  5JHU A;  3C3W A;  2A68 F;  1IUY A;  1O3T A;  3F23 A;  4YFK F;  3GVA A;  4UVC A;  3WTZ A;  3GLX A;  3GXO A;  1LDJ A;  4XRF A;  3D5L A;  1E17 A;  1IN7 A;  1FOK A;  1ODD A;  4KNY A;  4LK1 F;  4MQ9 F;  2P5K A;  2EV5 A;  4Z2Y A;  4OIQ F;  5FB2 A;  1XCV A;  1D8K A;  2LSO A;  3BPX A;  4XLN F;  2CQK A;  5CVJ A;  1FBQ A;  3W6K B;  2HQN A;  2WC2 A;  2PLY A;  2XAQ A;  4NQW A;  4BXU A;  3MZY A;  2B0L A;  1T39 A;  5HVQ C;  2YR2 A;  3V8K A;  1KQ9 A;  2XAS A;  3LA7 A;  4EVI A;  2MC3 A;  1U78 A;  3KP5 A;  2GXB A;  4KIG A;  3KP3 A;  4EM2 A;  2QUF A;  1DUX C;  2Z5U A;  5E1W A;  4ZYE A;  3KE2 A;  4LG0 A;  3DF8 A;  5AON A;  1UHW A;  1UHM A;  1R5H A;  4Q5S F;  1TNT A;  2MA3 A;  4PDK A;  2ELH A;  4WWC A;  3I53 A;  2JT1 A;  4I0B A;  3F22 A;  3F8N A;  4KN4 X;  2H09 A;  2VC0 A;  3SXY A;  2GXG A;  4UUV A;  1F5T A;  1V3F A;  1LNW A;  2DK5 A;  4MGR A;  5DEQ A;  3LA3 A;  2V9V A;  2M30 A;  3BJO A;  3EET A;  4P5O A;  5E1X A;  4KT5 C;  3DKW A;  5H6Q A;  5D5W B;  1I1G A;  3V8J A;  3J81 K;  3E5X A;  1J75 A;  1J5Y A;  4RB1 A;  4EV0 A;  1TQI A;  2VT3 A;  1S8N A;  5EEG A;  3ZN0 A;  2PI0 A;  3D0S A;  2PFB A;  5FD6 A;  3DFG A;  2WTE A;  4P9U A;  1KYZ A;  1XD7 A;  2FMY A;  4EMS A;  2EFQ A;  5KK1 A;  1KGS A;  1R00 A;  4M71 A;  4WX9 A;  3L00 A;  1XGO A;  1DDN A;  2XKP A;  4JQF A;  1LEB A;  5BQT A;  2DI3 A;  4DQ2 A;  2NS0 A;  1UCR A;  5L3E A;  4RGX A;  4HDU A;  3L7W A;  2KRF A;  2KJC A;  5E8I A;  2FU4 A;  2GWR A;  2A69 F;  3RKY A;  1MJ9 A;  4KIB A;  2OQG A;  4HF0 A;  3KEQ A;  2FF4 A;  3QPT A;  2ZCW A;  3K1P A;  2UZK A;  2A6H F;  2NRA C;  3IHU A;  1HQC A;  3F72 A;  1SMT A;  3RPQ A;  1K7A A;  2UWM A;  1XSV A;  2KIM A;  1IRF A;  5D4S A;  2JPB A;  4CXF A;  1MDM B;  1RUO A;  2EFP A;  3EDP A;  4U0W A;  1SAX A;  1QZZ A;  3HSF A;  2ESH A;  3GO5 A;  2XAF A;  5DV5 A;  2QQ9 A;  5LGT A;  2PMU A;  3WTU C;  2PEX A;  2ETH A;  2QVO A;  5JFR A;  4R8H A;  4AIH A;  1W7P A;  3Q5F A;  2DW4 A;  3PFI A;  1S7O A;  2DLL A;  3WE3 A;  2QEN A;  1YYV A;  4GYG A;  4LFU A;  2FML A;  5HLG A;  2A07 F;  2FEZ A;  3IRQ A;  1QO0 D;  2MD5 A;  2ZBK A;  4G7Z F;  5CYV A;  4G8X A;  3F3X A;  1SD7 A;  1TW3 A;  2M45 A;  2O3F A;  1YW8 A;  2QWW A;  1D3Y A;  3HHH A;  4S05 A;  2CO5 A;  1Z91 A;  4IVN A;  3QRF F;  2R3S A;  3I58 A;  2FNP A;  2VBX A;  2ZJ2 A;  4HX4 A;  4L0Y B;  2O61 A;  2MLK A;  1ON2 A;  2NAZ A;  4ETS A;  2HGC A;  5IT9 K;  1BI1 A;  2VOO A;  3ZQ7 A;  2L4A A;  2ZNY A;  3B02 A;  3PQJ A;  1LVA A;  5FGM A;  1B59 A;  4EGY A;  2YSR A;  4ENN A;  3J81 Z;  5J8F A;  1YW9 A;  4IXA A;  3WTS C;  2HFH A;  2FE3 A;  3CUO A;  4N9I A;  4N0B A;  4I2O A;  1QNT A;  5LEK A;  1OMI A;  4GCV A;  4HA8 A;  4R1H A;  4KIF A;  1SD6 A;  4LLL A;  1YO5 C;  1IRG A;  2MH9 A;  2DT5 A;  4L9V A;  4HQM A;  2HR3 A;  1O3S A;  1H9T A;  2P7C B;  4XSX F;  2P6S A;  2XGX A;  1OR7 A;  2W85 A;  3N97 A;  1KU7 A;  1KU9 A;  2VE8 A;  2Q8K A;  4EM1 A;  2M1B A;  3HSE A;  3RKW A;  1MZB A;  2HEO A;  2OQR A;  3WTV C;  5LGU A;  1TW2 A;  1MJA A;  1H0M A;  4HW0 A;  2IA1 A;  2Z3Y A;  2W24 A;  1ZAO A;  4MTE A;  4EJO A;  1S3J A;  3U9G A;  3WTT C;  4PZJ A;  1ZAR A;  4MNU A;  3I5U A;  3RIR A;  3C18 A;  5DCM B;  4GGG A;  2NYX A;  5CVI A;  3SHF A;  1PP7 U;  2Y0M A;  3SZT A;  4OIR F;  3ROU A;  3DEU A;  4I01 A;  2JRT A;  4G6D A;  3BWG A;  3JAM K;  5CVU A;  5HDK A;  3F8F A;  3I0T A;  2ESN A;  3LQQ A;  5J6X A;  1R1T A;  4EM0 B;  3KZY A;  2EK5 A;  3ZPL A;  3DV8 A;  2ISY A;  1T2K A;  2D45 A;  1P92 A;  5KVR A;  1LDD A;  4RB2 C;  1WRJ A;  1FYK A;  1HW1 A;  2Q2E A;  1YQA A;  4BHB A;  1IN5 A;  3U1D A;  2M5W A;  4AD9 A;  2VON A;  1HW5 A;  5CJ9 A;  1Q1H A;  2F5C A;  1ZRD A;  3ABT A;  4MQV A;  5IT3 A;  3K0L A;  1CGP A;  2E1N A;  1BIA A;  5A2Q K;  2RC4 A;  2X4H A;  3KFW X;  3BOQ A;  2PMH A;  1U3E M;  1T98 A;  2XAJ A;  2DPU A;  4EJT A;  1BBY A;  3RTR A;  1KU3 A;  1RZ4 A;  2OAZ A;  3LST A;  2Y75 A;  4F7Z A;  4L9N A;  1TNS A;  2K02 A;  1I6X A;  5EEH A;  2Y48 A;  1PUE E;  2VC1 A;  2YX4 A;  2KJB A;  3TOA A;  5LEJ A;  4KFC A;  1X3U A;  4OMY A;  3MEX A;  3WTX C;  4LGW A;  1LJ9 A;  5ERI A;  2V79 A;  3E5Q A;  1G4D A;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...