1D5VA

Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11 (s12)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
MLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S12 TRANSCRIPTION FACTOR (FKH-14)
publication title Solution structure and dynamics of the DNA-binding domain of the adipocyte-transcription factor FREAC-11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d5vA00
3CUQC 3WU0A 2NRAC 5L3CA 2R7DA 3HOSA 2V6CA 1ON1A 4GYIA 1GXPA 4OINF 1HBXG 3R0JA 1IXSB 4I01A 1YG2A 5ICFA 2CO5A 5KVRA 3QOPA 4EM0B 1U5TC 3RYRA 3GF2A 3GFMA 4HF1A 3K1NA 2M5WA 2PMUA 2ISZA 3JTGA 1FPQA 2EV6A 1QO0D 3CO6C 2W24A 1Y0UA 1K6OA 3KZYA 4HA8A 1B1BA 1YW9A 3DXJF 3K1MA 2VN2A 1RNLA 3HUGA 5FD5A 3LA7A 1LB2A 5LEJA 2WV0A 1I6XA 3T0YA 2HOEA 5HLIA 5FGMA 1YW7A 3HRMA 2K4JA 4EQQA 1BIBA 4M74A 3ZMZA 2YX4A 1W7PD 1LQ1A 4A6DA 5H6QA 2H27A 4D0PA 2EK5A 3EUHA 3RKWA 2LF7A 1CF7A 3KEQA 4UVCA 3ABTA 1B6AA 1FC3A 2XASA 3ISPA 1BIAA 4ESFA 3F23A 3ZMUA 1H9GA 4AD9A 2XV4S 2VBWA 3F6VA 1FYMA 1JHHA 3E5UA 3GZ5A 2XKOA 2QQAA 3LA2A 3OV8A 4I98B 2EV5A 1XGNA 4ESBA 5FLXZ 5H20A 1JE8A 3GWZA 1BI0A 2RVCA 3G3ZA 3ZQ7A 3SQNA 3CJNA 1W4MA 1MJAA 2XRNA 1IN4A 4EJWA 3MCZA 3OOPA 3KZZA 2CFXA 2EFQA 4XSZF 1REPC 2F5FA 4M6XA 3HHHA 1FYKA 3E5QA 1YIOA 3GO5A 3MZYA 5HVQC 2R3SA 4EJUA 2K4BA 5AONA 2DO7A 1FNNA 3MQ0A 3T1BA 1R5GA 1TW3A 1T98A 4LG0A 3BROA 1I27A 3AAFA 2Q2EA 2FU4A 4ASNA 1EH7A 4LLNA 3M8FA 2L02A 3KE2A 4ZYDA 5CVJA 3PQJA 2UWMA 4ZYHA 2V79A 4PCQA 3MAJA 2FBKA 2VOOA 3KLNA 5JHUA 1Z6RA 1R58A 2F5CA 2MH9A 5IT9K 2A68F 3HTSB 1TQMA 4U88A 4L5IA 3T8TA 4G6DA 4EMSA 2O0YA 1BBYA 3FWEA 3J81Z 3V8KA 3BP8A 3U2RA 5ERIA 4YIFA 4MQVA 1F9NA 3I64A 2K86A 4XSXF 3M1EA 1Z1DA 3VOEA 1R1TA 2MLGA 5F64A 3NRVA 4LD5A 4KNYA 3BY6A 5E17F 4TV7A 2FE3A 3MFKA 1BM9A 2YSRA 4M73A 2CW0F 2VE9A 5FB2A 3IWFA 1U8RA 3J7AO 2NNYA 3FMQA 1CGPA 5LHHA 5LLQA 4IJAA 1P2FA 2W85A 4ON0A 2MH2A 2EWNA 1XSVA 3QU6A 2B0LA 2NS0A 2XAHA 1UB9A 2TDXA 3WE3A 3FMRA 3HSFA 1U2WA 1LDKB 2MC3A 2YPRA 2DLLA 1J2XA 4O3MA 3DQVC 1DPUA 3QRFF 1F4KA 3V7SA 2F5DA 5TRDA 5E8IA 2XAJA 2LF8A 3ERED 2FNPA 1IXCA 2LDUA 2XAQA 3TGNA 2D2WA 1MJBA 4N0BA 4G9YA 5E1WA 1FP1D 4BXUA 2CQKA 5EEGA 4KDPA 4OIQF 3KEOA 2PJPA 2VONA 3LA3A 4E70A 5E20A 2ZFWA 3IRQA 4KT5C 3WTSC 2Y75A 1XGMA 2BBYA 2HEOA 2OBPA 4ZYGA 1HKTA 2EFOA 3GFIA 2EV0A 1QZYA 4OMZA 1W5SA 4A0XA 1SAXA 1BC7C 5CYVA 3QP6A 3WG9A 5HOOA 4HV6A 3Q9SA 3ZMDA 2H6CA 2BYVE 5BOXA 2DK8A 5BS6A 4PDKA 2HTSA 3R60A 4ZH4F 1ZAOA 1H9TA 2VC1A 1E17A 4WXCA 2W84A 2HR3A 3DEUA 1Z9CA 2J5PA 2VODA 2XIGA 3KP4A 4OIRF 1PP8F 1SFUA 5DYMA 4LLLA 1MKMA 2JPBA 2KIMA 3KP3A 1ULYA 2YX7A 3M7GA 4N9HA 1U6GA 3I5UA 2FBHA 3O6BB 2L4MA 3F3XA 3RYPA 3IC7A 1KQ9A 1LVAA 1YQAA 5DUKA 2RNJA 1FZPB 3ZPLA 1YS6A 1DUXC 2JPCA 4G7HF 1FBQA 2HYGD 4HYEA 2BEOA 1XCBA 2RKHA 2W25A 2PFBA 3J80Z 1USTA 5ILSA 5FFZA 3GX4X 1ZYRF 2EB7A 1S7AA 3I58A 4L0YB 2DTRA 1TW2A 3E97A 3B73A 2A61A 2M8EA 3DPLC 1ZG1A 4EJTA 2HYFA 2UXNA 1XMKA 4JBAA 3SFZA 2GXBA 4Y15A 3GW2A 1OYWA 4BHPA 5ILUA 3TOAA 2DAOA 2O61A 4HQEA 4A0YA 5DUIA 1HKQA 4EGZA 3GFLA 2YU3A 2H6BA 1D8JA 3ELKA 4FT8A 1ZHFA 5JR3A 1KU3A 3U9GA 1G6NA 3FZVA 1XD7A 3V8JA 4UHTA 4IRHA 2K02A 4HZFA 4UXNA 1ZRFA 2BGCA 2RN7A 3ECHA 5HDGA 3LAJA 1O7FA 2QENA 1W7PB 3I59A 4U7BA 1R00A 1IN5A 2P7CB 2ZCWA 4DNCA 5TJJA 5HS9A 1XDUA 3BZ6A 5DCMB 3K9TA 4UVAA 3MZHA 2DK5A 4JQFA 1HW2A 1KU2A 1BC8C 3GYHX 2BV6A 2CSOA 1ZG5A 3GLXA 5FFXA 5D5VB 1ZLJA 3K0LA 1Z6TA 3L2CA 2QWWA 4WXDA 3KP6A 4G7ZF 3GFJA 2FSWA 2LNBA 4G6QA 1OR7A 2FRHA 2EA2A 1WQ2A 4IHSA 1DP7P 1IN7A 2PMHA 3RI4A 1ZRCA 1L0OC 3DV8A 1R22A 4L9VA 1KYZA 5BPIA 3CUQA 3HRUA 4L9JA 2A3SA 3I71A 3HYIA 4CYDA 4I2OA 4S04A 1K78B 1DPRA 3WU1B 1LDJA 3C18A 5DCMA 2DU9A 5DV5A 4R1HA 2HDCA 2VE8A 3IKVA 2KJCA 1U5TA 2M87A 5ED4A 5BMZA 3GXOA 1WWXA 1P6RA 4GO1A 3P9CA 1SD7A 2V1XA 1O3QA 4XRFA 1J0RA 1TNSA 1T6SA 4A6EA 4AIHA 3SZPA 5D5XB 4BQAA 3F72A 4IVNA 2XKPA 3M9AA 3CO7C 3Q9VA 2O3FA 2STWA 4YG2F 1L3LA 4HBLA 4CZZA 2D45A 2IA0A 4G7OF 2A6EF 2PN6A 1SFXA 1B9MA 2FEZA 3H3UA 3F8FA 4BAYA 3RIRA 1WI9A 1QNTA 1IN6A 4NHJA 3C3WA 1MJ9A 3M8EA 3E6CC 1UHMA 1GHCA 1O3SA 2V9VA 1IAWA 1HSJA 1IW7F 2DW4A 3ZN0A 3JAMZ 1IRFA 1JGSA 3HHGA 3V7RA 2GAUA 4HF2A 3DP7A 1QQIA 3WODF 5J8FA 4RGXA 4ENJA 1G3YA 4ETSA 3QP5A 2ESNA 4HX8A 5HDNA 5JFRA 2P4WA 3RPUA 5CLSA 3F6OA 3W6JB 1ZREA 4M9XA 5ICGA 3J81K 5A2QZ 4BH9A 2VXZA 5LEKA 5D6FA 2HGCA 4RGUA 5LGUA 2ZMEB 2QBYB 2HQNA 2JZYA 2H94A 3H92A 2RGVA 1HQCA 4KMFA 3BPXA 1P92A 4EM2A 4ZYEA 4HLXA 2ZKZA 1FBUA 1S7OA 4GXOA 1Z91A 4RGRA 2P5LC 2OQRA 5D6EA 4AIJA 1GVJA 1V3FA 4HX7A 5HS7A 3L00A 2FMLA 1D3YA 2VOPA 4MTEA 5DDGA 1USSA 2JSCA 1J7KA 2XGXA 5E8GA 3WTWC 3G73A 1IUYA 2GXGA 1VTNC 1XGSA 4GYGA 4UV8A 5K5OA 4L18B 2Z33A 3BJOA 3FM3A 4EGYA 4H0EA 1BI3A 4A12A 1XMAA 4UV9A 2C6YA 4HOBA 5ICCA 5JVTA 3K2ZA 4MTDA 1TTYA 4AIKA 3F8BA 2GA1A 3EQLF 2CG4A 2WTEA 3KP5A 4NB5A 4XLPF 2PG4A 4R79A 5K5QA 1T38A 3KP7A 4IHTA 1FX7A 1BI2A 3L9FA 1YYVA 4DQ2A 1UCRA 5JI6A 2VC0A 3RPQA 3PQKA 2KIUA 1XB4A 4LB5A 2LKPA 1J9IA 3SZTA 2A5YB 1W5TA 4Y17A 4HF0A 4UVBA 2MLKA 3WTXC 2VBZA 2WC2A 3JSOA 2O8XA 4M71A 4FX0A 3DFGA 2ZNZA 4O6JA 1TNTA 1QPMA 3C7JA 1MDMB 2QLZA 1PUEE 4M9ZA 2DQLA 3R0AA 3ZMSA 2E7XA 1E2XA 3HTUA 3FXUA 3F8CA 3F8MA 1KYWA 1EH8A 2ZXJA 4HLYA 4ZZLA 4WX9A 4GGGA 5HS8A 3WGIA 2QZ8A 3VB2A 4Q5SF 1OMIA 5IT3A 5FO5A 5D8LB 4FHTA 5LRRA 4L0ZB 3J80K 4JK1X 3IHUA 4HDVA 3N4MA 2EFPA 1O3TA 1XSXA 4MEYF 2UXXA 3LWFA 4OOIA 4U0VA 5K1YA 5D8KB 4WWCA 3SHFA 1K79A 1IZ1A 4KICA 2ETHA 1WSUA 5D5UB 2OD5A 3WTVC 1U78A 1FYLA 2Y48A 3WTZA 4YIIA 4O5VA 4G8XA 2E1NA 4QLCU 3F22A 2G7HA 3E5XA 2GZWA 2XUBA 4EM1A 1Z05A 4KN4X 2DPDA 2ZJ2A 1RZ4A 1SD5A 4B8XA 3COAC 1SFEA 2MBFA 1DDNA 1FBSA 2OQGA 2AS5F 3ABUA 2O03A 3RTRA 4OIPF 1P4XA 2WWYA 3EYYA 3KFWX 2IT0A 3BPVA 2Z3YA 2PI0A 1AOYA 1S3JA 1RUNA 5L3GA 2NYXA 4G94A 5F6FA 3LQRA 2QVOA 1Q1HA 4EJOA 5DD4A 2F5EA 5L3FA 5CVVA 1U3EM 1ZH5A 2Y0MA 2EA4A 2FMYA 4RB0A 4XBFA 4KIFA 4YFKF 1HW1A 4HX4A 1O57A 4IRGA 5E1ZB 2KIFA 1EV7A 3NEUA 1O3RA 2L4AA 2JT1A 3E6BA 3IL2A 2HS5A 4M6YA 2KJBA 4L9TA 2RQPA 3R6SA 2D1HA 1ODDA 5LBQA 1TQIA 3QAHA 2DQRA 2ISYA 2CYYA 3WTUC 2IVMA 2OU2A 1FT9A 4KUMA 4P55A 1IXRC 3FX3A 1F5TA 3FHZA 2PLYA 2IA2A 4N9IA 2BE5F 3ECOA 2Z99A 5HLHA 1OPCA 4ENKA 3ZP5A 1TQPA 5LGTA 3BDDA 1ZRDA 3DKWA 4HQMA 3QPHA 3L09A 3VEPA 1AWCA 3K69A 4U0YA 2ZNYA 2EFNA 4EV0A 3WTTC 2P6SA 1MGTA 4PZJA 2DPUA 2G9WA 4KIGA 4RAZA 1XSDA 3R4KA 4CGZA 5KK1A 2XAFA 1ONVA 5D4SA 4UNOA 1D8KA 5D5WB 2DBBA 4LMYA 5LHIA 1OYIA 2UZKA 2VBYA 3BJAA 2COMA 1K7AA 3O3KA 3VFZA 1FLIA 4B09A 1IF1A 2IJLA 3ULQB 2G7UA 3F8NA 5L3EA 3E6DA 4CHUA 1JXSA 3EDPA 2QM3A 3FXQA 4BHCA 1W7PA 4RAYA 1R23A 1GXQA 2O6GE 1J5YA 2OZ6A 3B02A 1BOAA 4KFCA 1SMTA 4KIBA 1XDSA 4OIOF 1IRGA 3WTYC 4IF4A 2FOKA 1FOKA 2XVCA 4EJVA 2A6HF 1CF7B 3EYIA 4I02A 1PDNC 3IWZA 2JRTA 3JTHA 4UUVA 4K2EA 3O2PE 1G3WA 1YTYA 5LHGA 3I0TA 2IP2A 4BNCA 2PQ8A 5FLXK 1UHWA 2HQRA 4HV5A 1S6LA 4L9NA 5CVUA 2IPQX 1YLFA 5BQTA 4PGHA 5F1RA 3JAMK 5J6XA 1PP7U 4CO8A 3BJ6A 4BHBA 4M72A 4YFNF 1ZN2A 2XROA 3SXYA 3K1PA 3HRSA 1FSHA 3BOQA 1K78A 1STZA 1SMYF 2W57A 2ZO4A 3S2WA 1X3UA 3PFIA 5BPDA 4I09A 2M45A 2P6TA 2NNNA 1LJ9A 1KGSA 3GZ6A 5AIQA 4MNUA 3EETA 5A2QK 2QQBA 3CTAA 1RIOH 2HKXA 4P9UA 4LG0B 3TDZC 1KU7A 3REOA 4XLNF 3HRTA 2HZTA 1FWZA 2FXAA 1R1UA 4BYYA 2HWVA 5CVIA 1RI7A 2VBXA 4A5MA 2IW5A 3CLOA 4ZZDA 1T0FA 1FY7A 3E3VA 2CGPA 2ACJA 1BJAA 2L54A 3FMSA 1O7LA 2H09A 3C1DA 3ML6A 4RB3C 3TDUC 4I7HA 3P7NA 4U0WA 2Z5UA 2A69F 2ZBKA 1V4RA 3LQQA 3GUDA 3KLOA 2DI3A 1YS7A 3I54A 1I1GA 1G3SA 3E6MA 3CUOA 3R61A 2HKOA 1NHAA 4AVPA 3ROUA 4L5JA 3HOTA 4U7DA 4A5NA 1XCVA 1HKSA 4OU0A 4P9FA 4KYWA 4YFXF 4RGSA 3V4GA 1RUOA 1R36A 3MWMA 4RS8A 2QUFA 2E7WA 4MEXF 5E1XA 2M1BA 2KKOA 2OAZA 5D4RA 5ILVA 1ZLKA 3FXRA 3TQNA 4PGGA 4MQ9F 3TOBA 2LSOA 3WGHA 2DFIA 2ADUA 3TO9A 2P7VB 1J59A 1TLHB 4NQWA 2ZMEA 2D1VA 4MHGA 2QBYA 5DEQA 3HSRA 4P5OA 5AIPA 3ZN1A 4A2UA 1KQ0A 4Q4ZF 1ZGAA 1HSTA 1QGPA 4Z2YA 2PEXA 5L3DA 4KN7X 2Z9OA 2EFWA 2FF4A 2J5OA 1TBXA 3RKXA 1KQ8A 3ZMTA 5IT9Z 3TO7A 1B4AA 1G4DA 1OYYA 1SD4A 3LAPA 2L01A 1LEBA 4LK1F 5L3BA 4MGRA 1ZG3A 1P4AA 2ELHA 4A0ZA 2VT3A 3VODA 5CJ9A 1P4WA 4HW0A 4ESJA 1XGOA 1ZARA 4LK0F 2CWEA 5LGNA 5ICEA 1H0MA 2EJRA 1C0WA 1UFMA 2A07F 3HSEA 2QYOA 3WGGA 3ZMVA 1MD0A 4Q48A 1G3TA 4WF2A 4QWQA 2XHKA 2M30A 2Q0OA 4RB2C 3KETA 5E18F 5DD8A 2QQ9A 3D5LA 1ZGJA 5DCFA 2GA2A 1I5ZA 2DT5A 2RDPA 1R5HA 1LNWA 3LFKA 3RDIA 2X4HA 3BWGA 2OA4A 3TO6A 1EH6A 3WE2A 5J8CA 2GIVA 4F7ZA 1XN7A 1Z7UA 1JHFA 1T2KA 4OMYA 5LRSA 4RB1A 1R1VA 3P9IA 1LEAA 1IN8A 4CICA 3IKTA 1FP2A 2V1UA 3GEZA 2HTJA 1WKMA 1R7JA 2P5VA 5H6RA 1YFHA 5CVRA 1J75A 2XAGA 1MDMA 1YO5C 3JW4A 5K5RA 4S05A 3F21A 4LLGF 4R8HA 2K27A 4IRIA 2R7FA 3MEXA 4KA4A 4WK8F 5EEHA 4ENNA 3IRRA 2E1CA 3QU3A 4LJZF 2FA5A 2GQQA 3JSPA 4Q47A 3KP2A 3HIFA 2FQ3A 3W6KB 1FSEA 6PAXA 1KU9A 2OZUA 2ESHA 2Q8KA 1D5VA 1S29A 4LB6B 1KA8A 4I0BA 1SD6A 3Q5FA 4LGWA 3NQOA 1YW8A 3N97A 2HFHA 4HDUA 3H3ZA 2P8TA 3GVAA 3V8LA 1T39A 4CXFA 5FD6A 2YR2A 3L7WA 3RKYA 3LSTA 3KCCA 1MZBA 2FBIA 3U1DA 1B9NA 4I0AA 4WXHA 2V1DA 3CDHA 2NAZA 3I59B 2PBIA 1BI1A 2AXLA 4Y13A 3FF5A 2GWRA 4FX4A 3I4PA 1OKRA 4M9SA 1HXDA 3DPTA 1A04A 2F2EA 2RV8A 2MD5A 3P9KA 1QBJA 4ENMA 3V7CA 1LDDA 1B59A 1ON2A 3DF8A 2IA1A 1I1SA 3D0SA 4P96A 1BN5A 1QZZA 3RJPA 2X0LA 3QPTA 2STTA 2K7LA 4LFUA 4KMUX 4WCGA 3I53A 5HLGA 1S8NA 4GCVA 3CUQB 3FM5A 3T8RA 3T5XA 2VT2A 1WRJA 4IPAA 2IRFG 4CDGA 5HDKA 2JTVA 1F1ZA 4IXAA 2MA3A 4HAMA 4AWXB 2KRFA 2L3DA 2P5KA 2RC4A 2FNAA 4EVIA 3TKYA 1U5TB 1HW5A
chains in the Genus database with same CATH superfamily
3CUQC 4ZDLA 1J09A 3WU0A 2F48A 1JKRC 2NRAC 5L3CA 2R7DA 4C2MJ 5TGTA 3HOSA 2V6CA 1NK3P 4B1RA 1ON1A 4GYIA 5M5YJ 4OINF 1WVRA 4ZDPA 1GXPA 1HBXG 2EZHA 2XB5A 1D0XA 3R0JA 5CPRB 2OTLI 1IXSB 4I01A 1YG2A 3K4BA 3IH3A 5ICFA 2L7MP 2CO5A 1VQOI 5B5EC 5KVRA 1X1DA 3QOPA 4EM0B 2XC7A 5EG0A 1U5TC 3RYRA 2L9VA 2KP6A 2CW7A 3GF2A 4Y33A 4D9JA 3UKGA 2GXAA 3GFMA 4HF1A 3K1NA 4IQJA 2M5WA 2PMUA 1TWCJ 2ISZA 3JTGA 1FPQA 2EV6A 2R7VA 1QO0D 3CO6C 2W24A 1Y0UA 1K6OA 3KZYA 4XM3A 4HA8A 1B1BA 1SAUA 3TP0A 1YW9A 3DXJF 4FISA 3K1MA 2VN2A 3WU2C 1Y0NA 2F4OB 4CCNA 1RNLA 4X6AJ 3HUGA 3LSGA 1N75A 1PJRA 1OCZH 5FD5A 3GTPJ 2LVSA 3LA7A 4C2UA 3J7AY 1LB2A 1QHHD 5LEJA 3H5AA 3EUHC 2WV0A 1I6XA 2ZJQF 1K83J 3T0YA 1JKQC 5BNGA 2R7RA 5CQEA 2HOEA 1RR7A 5GAGJ 1PUFB 3D5SC 3E7LA 4HEA2 3TL4X 5HLIA 5FGMA 1YW7A 3K6GA 4HRIA 3HRMA 1DGWY 4A3LJ 1T08B 2K4JA 4EQQA 1BIBA 4M74A 3ZMZA 2DXIA 2HPIA 2YX4A 3KPHA 2LH9A 5IYCJ 1W7PD 3G4SI 1LQ1A 1KZHA 2L7ZA 4BGDA 2M0CA 4A6DA 5J4VA 4XOPA 4XONA 1D1BA 1YRNB 5HNFA 2TCTA 5H6QA 3P5JA 2ZXWH 2H27A 4D0PA 2EK5A 3EUHA 3RKWA 2LF7A 5EYRA 1NH3A 1CF7A 3KEQA 4M3GA 4UVCA 4NC8A 3S3NA 1BOBA 3BR3A 3MKZA 1IJWC 3ABTA 1B6AA 1FC3A 2L9SA 2XASA 5IP6A 3ISPA 1BIAA 1AU7A 4ESFA 3F23A 3ZMUA 1H9GA 3S32A 4AD9A 4BEHB 2XV4S 1WFXA 2VBWA 3MZ8A 2Q2EB 4OAZA 3F6VA 4AM3A 1FYMA 4HNVA 1WJCA 1JHHA 3E5UA 3GZ5A 2XKOA 1VQLI 2QQAA 3LA2A 3OV8A 4I98B 2EV5A 4F55A 1XGNA 4ESBA 5FLXZ 4DZPA 3OYJA 3BT9A 5H20A 3DLAA 4XICA 4DJAA 4ZJZA 5B1AH 1JE8A 2YUSA 3OYMA 2ECCA 3GWZA 1BI0A 4MLOA 2RVCA 3G3ZA 3ZQ7A 3SQNA 3CJNA 3A03A 5DM6F 1W4MA 2BHYA 4XRSG 1LE8A 2BY2A 2CV1A 3VPRA 1MJAA 4UUSB 2XRNA 1IN4A 4EJWA 3MCZA 3OOPA 3KZZA 2VJIA 1LFBA 3SEQA 2CFXA 2AQEA 2DA5A 4PUSA 1Y8RB 2EFQA 2MW8A 4XSZF 2WAQN 1JT0A 3LSHA 1REPC 2F5FA 4M6XA 3HHHA 1FYKA 3E5QA 4AIDA 1YIOA 3GO5A 3MZYA 4PK4A 2R7ZJ 5HVQC 2R3SA 1YITI 4QSHA 4EJUA 2K4BA 4Y3OA 5AONA 2DO7A 1FNNA 3MQ0A 3T1BA 2LR8A 2DFEA 3ZGKA 1B72A 2GM4A 1R5GA 1WPKA 1TW3A 2MGQA 1T98A 2IBDA 4LG0A 1MBKA 2JQ7A 3BROA 3CCLI 2L5QA 1I27A 1XX5A 3AAFA 2Q2EA 4FTHA 3S1NJ 2P81A 4D1QA 2FU4A 4ASNA 3FXJA 1EH7A 4LLNA 2CMPA 3RQ4A 3M8FA 2L02A 5GADJ 2QSGX 3KE2A 2KZGA 4ZYDA 5CVJA 3PQJA 2UWMA 4ZYHA 4QTRA 3LNQA 2V79A 1EKEA 1H8AC 1FEXA 4PCQA 3MAJA 2FBKA 2VOOA 3KLNA 1XTAA 5JHUA 1ZQ3P 1VQ6I 3ZXSA 3CC4I 1UG2A 3JRHA 4BY7J 1Z6RA 1R58A 1WH5A 2F5CA 4XIDA 2MH9A 1MMNA 3AG1H 5IT9K 2A68F 1ZKGA 3FXMA 3HTSB 1TQMA 4JYKA 4U88A 2LKSA 4PFOA 4L5IA 1N77A 3GTMJ 3T8TA 4Y4RA 2M9HA 3M8JA 2F5VA 4G6DA 4EMSA 2O0YA 1BBYA 3FWEA 3J81Z 5KHDA 4IL6C 3V8KA 4IHYA 1TL8A 2JA7J 2RREA 3BP8A 3U2RA 4AC0A 5ERIA 4YIFA 4MQVA 5TISC 2X1CA 1Y6IA 3M4OJ 1F9NA 3I64A 2K86A 4XSXF 3M1EA 1Z1DA 3L1PA 1MMDA 3VOEA 2LOOA 3RZOJ 1R1TA 2MLGA 1T8IA 5F64A 5IY5H 4UY8I 2BW3A 3NRVA 4BACA 2Y2ZA 4LD5A 4KNYA 3BY6A 4LIVA 3BG5A 4TV7A 5E17F 1AA7A 2FE3A 2FX0A 3MFKA 5C44J 1BM9A 2YSRA 3HOUJ 4M73A 2CW0F 3JRIA 3OIOA 5FB2A 2VE9A 3HOZJ 3S8PA 1M1EB 3PUFA 3IWFA 1CQTA 2X51A 1D1AA 1U8RA 3J7AO 2NNYA 3FMQA 1CGPA 3ABKH 2AHQA 4BQOA 5LHHA 2JSPA 1WJDA 3CF2A 5LLQA 4IJAA 1K4TA 2IS4A 2DA4A 5M5WJ 1TC3C 3H5RA 1P2FA 1ETQA 2W85A 3GBGA 4J19A 1WGXA 2H1LA 4UUTA 4ON0A 3H0DA 1NTCA 4BDZA 4PJLA 2MH2A 2EWNA 1XSVA 3QU6A 2B0LA 2NS0A 2XAHA 1UB9A 2COBA 2TDXA 4C30A 3WE3A 3FMRA 2DYRH 1Z67A 3DU5A 5FLMJ 1IG7A 3FHNA 2NOJB 3HSFA 1U2WA 1LDKB 2MC3A 2YPRA 1QVTA 2DLLA 4AVZA 1GUUA 4OAYA 5E3NA 1J2XA 4O3MA 1O4XA 3J7YJ 3DQVC 1DPUA 1F43A 2LLKA 3QRFF 1F4KA 3V7SA 2F5DA 2F6CA 4F3QA 5TRDA 4MFDA 5E8IA 2DYSH 2XAJA 2LF8A 3ERED 2FNPA 2Y9ZA 1IXCA 2LDUA 4IZZA 2XAQA 3TGNA 4D5CA 2D2WA 2LREA 1JTYA 4E4HA 2ME6A 1MJBA 4N0BA 4G9YA 2CUZA 5E1WA 3E1SA 1E0EA 4A69C 2R7OA 1FP1D 4GRIA 4BXUA 2CQKA 1TWHJ 5EEGA 2CV2A 4KDPA 2R7TA 1GDTA 4OIQF 3KEOA 1A6QA 2IS6A 2PJPA 2VONA 2MABA 1LKXA 3DTKA 3JRBA 3GTLJ 5GP9A 3LA3A 5FKKA 3ZQHA 1TP4A 4E70A 5E20A 2ZFWA 3IRQA 5J4YA 4KT5C 1PVEA 5K7ZA 3UR3C 4DBRA 2FQ4A 3WTSC 3CD6I 4BXXJ 2Y75A 1T95A 3OR1C 1HLVA 1XGMA 2BBYA 2HVQA 2HEOA 2OBPA 4ZYGA 3S16J 2EFOA 1HKTA 1VQ8I 1WI3A 4C3JJ 3GFIA 2EV0A 5E79C 1F36A 2XGEA 2V1NA 1I3QJ 1OISA 1QZYA 4OMZA 1W5SA 4A0XA 1SAXA 1BC7C 5CYVA 2EILH 4HSTA 4M3BA 2IGOA 3QP6A 3WG9A 5HOOA 4HV6A 3Q9SA 3ZMDA 2H6CA 4HNUA 2BYVE 3AG3H 3Q0VA 5BOXA 3A01A 2DK8A 5BS6A 1IO2A 2BOLA 4PDKA 2HTSA 3R60A 4ZH4F 3ZRGA 1ZAOA 1JJ8C 1H9TA 2HYJA 2WV1A 1VI0A 2VC1A 1E17A 3NWSA 3WHBA 1VQ5I 4WXCA 1YI2I 3SZGA 2W84A 3DEUA 2HR3A 2VJ5A 1FIPA 2XSJC 4CA0A 2K40A 1Z9CA 2J5PA 3DWLE 2VODA 2XIGA 3KP4A 4OIRF 2W7NA 1PP8F 1SFUA 5DYMA 2XDVA 4LLLA 3VYUB 3I55I 1MKMA 2XF7A 4AUXA 2JPBA 5H2FC 2KIMA 3KP3A 1ULYA 2YX7A 4BXFA 4E7SA 4BE2A 2DA6A 3SEZA 3M7GA 2LY2A 4N9HA 4B48A 3L2QA 1U6GA 3I5UA 2FBHA 3O6BB 2L4MA 3F3XA 5FKOA 3RYPA 5E3MA 3IC7A 2QF7A 1KQ9A 1LVAA 2WBMA 1YQAA 2HI3A 2VB6A 2B7EA 5DUKA 2RNJA 1FZPB 3ZPLA 1POGA 3VYTB 1YS6A 2K9NA 2JPCA 1DUXC 2QSHX 4G7HF 3N05A 3BZCA 2JVHA 1FBQA 2HYGD 3CZ6A 1YOVB 2BEOA 4HYEA 2CQ7A 1XCBA 2IGKA 2M3AA 3QPLA 2RKHA 2W25A 3CDIA 2PFBA 3J80Z 1USTA 5ILSA 5FFZA 5DTDA 3GX4X 4UB6C 3S15J 4Z6YA 1ZYRF 2EB7A 4XL9A 1S7AA 3I58A 1SVLA 4L0YB 2DTRA 5M3MJ 1QZEA 1TW2A 2Y69H 3E97A 3LOCA 3RCOA 9ANTA 3B73A 3F9KA 2A61A 2M8EA 4ITVA 4CCOA 2LKXA 3VYSB 5EF6A 3FIWA 5FRNA 1A36A 4B4CA 4FASD 1Y1VJ 3VSLA 3MKWB 3DPLC 1ZG1A 4EJTA 3DTIA 2CJJA 5HNHA 2HYFA 2UXNA 4HG2A 1XMKA 3A1YA 4JBAA 4XN0A 3SFZA 4BUPA 2CQQA 2GXBA 4KISA 3SYTA 2M2EA 4Y15A 5EJCA 3CDLA 3GW2A 1B8IA 1OYWA 4BHPA 5IPAA 3OYDA 2FJ1A 4A3MJ 3FK6A 5ILUA 4FE7A 3TOAA 4BY1J 2D5VA 2DAOA 2K9SA 2O61A 4HQEA 2IAIA 4A0YA 5DUIA 4ZTFA 1HKQA 1XPXA 4EGZA 3GFLA 2EQRA 2YU3A 2H6BA 3U1KA 1D8JA 3ELKA 4FT8A 1ZHFA 5JR3A 1KU3A 2QA4I 1R6RA 1Z7LA 2EIMH 4RLQA 3U9GA 2E5ZA 1FMVA 2F4IA 1G6NA 3FZVA 2TRTA 1XD7A 3V8JA 4UHTA 2IXSA 4IRHA 1VQ7I 2K02A 2CS3A 4HZFA 4UXNA 1ZRFA 2VASA 2RQQA 3D1NI 2BGCA 3HOXJ 4CYCA 2A05A 2RN7A 3ECHA 3OY9A 2K9MA 2V9PA 3C2GA 5HDGA 3LAJA 5J1RA 1O7FA 3G1OA 1MNMC 2V4JC 2M8GX 2QENA 1W7PB 3I59A 4U7BA 1R00A 3K10A 1IN5A 3KYCB 2P7CB 3CCUI 2ZCWA 1BW5A 2X9DA 3HKZA 4DNCA 5TJJA 4E7ZA 5HS9A 1XDUA 3LSIA 1AKHB 4L5EA 2X1DA 1K61A 3BZ6A 2X6OA 5DCMB 1JKOC 3K9TA 4UVAA 1S5LC 2DK5A 3MZHA 2HZDA 4JQFA 2CUEA 2Z1DA 5J47A 1HW2A 1KU2A 3FKIJ 3VDXA 3H9JA 1R5ID 2WA0A 3OSFA 1BC8C 3GYHX 4X1EA 4M6VA 2BV6A 5JVGF 2CSOA 1LUJB 1ZG5A 2AQFA 3DBLB 3GLXA 5FFXA 5D5VB 1ZLJA 3A0BC 1RESA 2QGUA 3K0LA 3S3MA 1DU6A 2DFFA 1X3WB 1Z6TA 3L2CA 1ETKA 2QWWA 4WXDA 3KP6A 4G7ZF 3GFJA 2BHZA 2FSWA 2LNBA 4G6QA 4NDLA 4BJTA 1OR7A 4DYQA 2FRHA 4GFBA 2Y0SN 2EA2A 3RSNA 1WQ2A 3OS2A 1JTXA 3OL3A 1Y39A 4IHSA 2CH0A 2JWTA 1DP7P 1IN7A 3BG6A 2PMHA 3RI4A 1ZRCA 3DEWA 1ETVA 2KFDA 1L0OC 3DV8A 4PSWA 3M3YJ 3K2AA 4XOTA 1R22A 4L9VA 3I9V2 1P9QC 1KYZA 2EBIA 5BPIA 3CUQA 3HRUA 4L9JA 2R7WA 2O7OA 2A3SA 4CSWA 4XR6A 3I71A 3HYIA 4CYDA 4I2OA 1UG0A 4P1WA 4IQ4A 2KIQA 2LBFB 4S04A 1K78B 1DPRA 5B1BH 2DOEA 3WU1B 1LDJA 2PMZN 1KONA 1Z21A 3C18A 5CQGA 2GLOA 3HOVJ 5DCMA 2DU9A 1JT6A 4BS9A 3HM5A 3OMYA 5HLTA 1Q1VA 1H88C 3ABMH 5DV5A 4R1HA 2DMTA 1ETOA 2GBYA 2VE8A 3BTJA 3IKVA 3OYAA 3JR9A 2KJCA 2HDCA 3H3VK 2WB1A 1U5TA 2M87A 5ED4A 2JA8J 5BMZA 3GXOA 3HPHA 1E3PA 1WWXA 1P6RA 4D7MA 3CCEI 4GO1A 3P9CA 4XLCA 1SD7A 2V1XA 2DDBA 1O3QA 4XRFA 1I6HJ 1J0RA 1TNSA 1T6SA 3LMMA 4RBOA 2HDDA 2OF7A 4A6EA 1K4SA 4AIHA 3SZPA 3OS1A 4J00A 2BVMA 2AO9A 5D5XB 1X19A 4BQAA 3F72A 4FQGA 2KZVA 4IVNA 2XKPA 2Y30A 3M9AA 4J01A 3CO7C 3Q9VA 2CV0A 2O3FA 2STWA 1A6IA 4E7LA 3DLLF 3S2HJ 4OWRB 2X48A 3KEYA 1Z3YA 4YG2F 1L3LA 2M0MA 3GZNB 4HBLA 4CZZA 2D45A 1X1AA 3NAUA 2IA0A 3EPZA 2OPTA 4G7OF 3VYRB 2A6EF 2PN6A 2LBFA 2CQNA 3CCRI 1SFXA 3OOUA 4DYCA 1B9MA 2FEZA 4HPQA 2LC2A 3H3UA 3F8FA 4BAYA 2DA7A 3RIRA 1WI9A 2DJNA 2H8RA 1EA3A 1QNTA 4H4KC 1IN6A 4NHJA 3C3WA 3AG2H 1W5CC 1MJ9A 1T0FC 1OCTC 3M8EA 3E6CC 1UHMA 1JUPA 2QQ8A 2R7UA 3QYFA 1GHCA 1O3SA 4AYBA 1V5GA 2V9VA 1SEUA 4NC6A 1IAWA 1HSJA 1OCRH 1PUFA 5JLWA 1IW7F 1JUSA 2DW4A 4E6KG 1MMAA 3ZN0A 2W48A 1SVOA 2Q1ZB 3JAMZ 1IRFA 1JGSA 3HHGA 1VQ4I 3V7RA 2GAUA 3GTOJ 5KNLA 4V19K 3S2DJ 2OTJI 4HF2A 1WJ5A 3DP7A 4F92B 1QQIA 4N4OB 3WODF 1YRNA 5J8FA 2PJRB 4RGXA 1UJ8A 4ENJA 1G3YA 4ETSA 3TP3A 4PJ0C 3QP5A 2ESNA 4HX8A 3ONQA 3FISA 5HDNA 2M34A 3OL4A 5JFRA 2P4WA 3RPUA 1Y8QB 5CLSA 3F6OA 3W6JB 1WCMJ 1ZREA 4M9XA 3KIOA 3DCFA 5ICGA 3IH4A 3J81K 2R5YB 3I56I 2VKDA 1FIAA 3H9QA 1S72I 4BEHA 1N25A 5A2QZ 1GT0C 4BH9A 2VXZA 5LEKA 5D6FA 2HGCA 4RGUA 2JUGA 2M7AA 5LGUA 3AL0B 4BBSJ 4NQWB 4E7IA 3BG3A 3TBIA 2ZMEB 2QBYB 2JA2A 4A3EJ 5FKLA 2HQNA 2JZYA 2H94A 4C3IJ 3H92A 2XPUA 4XKCA 3MKYB 2RGVA 1HQCA 5EGOB 3L2VA 4KMFA 3BPXA 1P92A 2ID3A 1LVKA 4EM2A 4ZYEA 4HLXA 2ZKZA 4V2GA 1FBUA 3G1LA 3JRCA 2VQLA 1S7OA 4GXOA 1Z91A 4RGRA 4BE0A 2P5LC 4LG3A 3DU6A 2OQRA 2HXOA 5D6EA 4AIJA 3E0JB 1GVJA 4UUSA 3PNYA 3SDGA 2X1EA 1V3FA 3B6AA 1TWFJ 4HX7A 1VQNI 5HS7A 3L00A 2DFHA 2FMLA 1JUMA 1D3YA 2KDZA 3AL0C 4C3HJ 2VOPA 4MTEA 2ZMEC 3JRGA 5DDGA 3DPUA 1USSA 1G2HA 2JSCA 1J7KA 4RAFA 1Z77A 2XGXA 5E8GA 2WAEA 3WTWC 3OYEA 3GLLA 2LD5A 2E19A 1T33A 3G73A 2E2HJ 1IUYA 1BR1A 2GXGA 2ICWG 1VTNC 4F93B 1XGSA 4GYGA 3KYDB 2VLAA 3CCQI 1RETA 1ZK8A 4ABZA 4UV8A 5K5OA 4L18B 4XLAA 2Z33A 2N8GA 3BJOA 3FM3A 4EGYA 2CFOA 4H0EA 1RR8C 1BI3A 4LOCA 5K7HA 2KMUA 1VFCA 4A12A 2CW8A 1XMAA 3K4MA 4UV9A 3ZQCA 3TEDA 2Y0SA 2C6YA 2KRHA 1ORKA 4HOBA 5GAEJ 5EZHA 5ICCA 5JVTA 2IS2A 1X3ZB 3K2ZA 1QA6A 1AHDP 4MTDA 2M7BA 2V6EA 1TTYA 3H1CA 4M3EA 4QPOA 1X1BA 1UHSA 4AIKA 3F8BA 1W1WE 2VI6A 3ESWB 2WY8Q 2GA1A 2XGDA 2VKHA 3JRDA 2YU9J 2VXDA 3QODA 3LSRA 1E3OC 3K4KA 5IOYA 3EQLF 2CG4A 2NVQJ 1IC8A 2WTEA 3KP5A 4NB5A 4XLPF 1FMWA 1OLTA 2EZIA 2PG4A 4R79A 5K5QA 1T38A 1VQPI 2VPLA 3KP7A 4IHTA 1FX7A 1JJ6C 1X2MA 2B9SA 1BI2A 2XF6A 5E3LA 1DQUA 1R4NB 1D0YA 2DMQA 3BCBA 3L9FA 3SDBA 1FOXA 2DODA 2G0EA 1YYVA 1UELB 3HGGA 2ZC2A 4G12A 4DQ2A 2Z2SB 4NNJA 1UCRA 4XKVA 5JI6A 1DGRM 3DKYA 5KCMA 2VC0A 3RPQA 5GAHJ 3PQKA 3BLYA 3CCMI 2KIUA 1XB4A 5FJ8J 3HDDA 4LB5A 3CJQB 2LKPA 1J9IA 3SZTA 2A5YB 3CCJI 1U0JA 2HXIA 4A3DJ 1VQMI 1W5TA 4Y17A 2DOAA 1X1CA 4HF0A 4UVBA 5B66C 1OJLA 2MLKA 4W97A 3WTXC 2R5ZB 2VBZA 2EPFA 4PJNA 1MNDA 2WC2A 4LIUA 3LFUA 3JSOA 2O8XA 4LITA 2E36A 4M71A 4FX0A 3DFGA 2ZNZA 4O6JA 2L9NA 1TNTA 1QPMA 5K7FA 4B43A 4JX6A 3DBRB 3C7JA 1MDMB 1LFPA 3G2BA 2QLZA 3H5NA 3CMEI 1PUEE 4M9ZA 2DQLA 2W00A 3R0AA 3BQZA 3OR2C 1FOWA 1WJFA 2E7XA 3ZMSA 1ZGWA 2PX9A 2VJ4A 3OWTA 1E2XA 3W2WA 1ETWA 4ZYAA 3HTUA 5J1UA 2WY7Q 3FXUA 1R71A 3UNGC 1WHUA 3NWTA 3F8CA 3F8MA 4MIMA 1KYWA 3RQIA 1EH8A 4IKFA 2I5UA 2ZXJA 4ZZLA 2DMUA 1QVUA 4HLYA 4WX9A 4GGGA 5HS8A 1TZLA 3WGIA 2QZ8A 4NBQA 3VB2A 4YRVA 2JK3A 4Q5SF 3HBLA 2E1OA 2FD5A 1OMIA 1VQ9I 2X85A 3L2WA 5IT3A 5FO5A 5DM7F 2DCEA 5D8LB 2BY0A 4FHTA 5LRRA 4BJ6C 3W6VA 4L0ZB 1OCOH 2VJJA 3J80K 4JK1X 3IHUA 3QQAA 2ZJPF 4HDVA 2YS9A 3N4MA 2EFPA 2ZSIB 1O3TA 2A6TA 4BL0B 1XSXA 4BQNA 4MEYF 2UXXA 3LWFA 4OOIA 4D7NA 2VQCA 4U0VA 5K1YA 5D8KB 2DA1A 3SHFA 4WWCA 1K79A 1MBEA 3SJMA 1IZ1A 2K9LA 4NC7A 3HOWJ 1OCCH 4KICA 4CCJA 2ETHA 1WSUA 5D5UB 2QSFX 4FETA 1H89C 1W0TA 2OD5A 2E2IJ 3WTVC 4PJJA 2VKVA 1U78A 2WAQA 1FYLA 2Y48A 2OCEA 5C3EJ 1IRZA 2EH3A 3WTZA 1ZELA 1BA5A 4YIIA 4O5VA 4G8XA 2E1NA 4QLCU 2ID6A 2L7KA 3F22A 1RKTA 2G7HA 3E5XA 2GZWA 4XLHA 4DGWB 2XUBA 4EM1A 3PL8A 3A2KA 1Z05A 1LPQA 4KN4X 3OYKA 2DPDA 4XMYA 3CLQA 3IV5A 5FRMA 2ZJ2A 3CMMA 1RZ4A 5B3SH 1SD5A 4B8XA 4CCLA 3COAC 1SFEA 2MBFA 3CCYA 3HXLA 1RC9A 2EZLA 1DDNA 2NXNB 1HOMA 1FBSA 4A93J 2GOXB 3D5RC 1MW7A 1VNDA 4QIWN 3HL2A 2OQGA 2AS5F 3ABUA 3HEFA 1DU0A 1UZCA 2O03A 3RTRA 2DTZA 4OIPF 3S3OA 1P4XA 1SANA 1U9NA 2WWYA 3EYYA 3KFWX 2QKLB 5F0FA 1ERDA 1SVMA 2IT0A 3VSKA 1V55H 3BPVA 1BW6A 2Z3YA 2PI0A 1AOYA 1GV5A 1S3JA 1RUNA 4A3BJ 4N4NB 5L3GA 2NYXA 3FXKA 2F4MB 2DT6A 1W36D 4G94A 5F6FA 4JP0A 3LQRA 1P7IA 2QVOA 1Q1HA 4EJOA 4KITB 5DD4A 2E35A 1MIJA 2F5EA 4IHVA 5L3FA 2CUJA 1A35A 5CVVA 4B3AA 5M3FJ 1SFOJ 1U3EM 2K5CA 2GIZA 4A3GJ 1ZH5A 2Y0MA 2EA4A 2FMYA 4RB0A 4XBFA 4KIFA 4YFKF 1HW1A 3W2VA 4HX4A 1O57A 4IRGA 1WZ2A 2H1KA 5E1ZB 4ZDOA 2HVSA 2KIFA 3OYCA 3Q0WA 3FKJA 3L2RA 1EV7A 3NEUA 2MC4A 4C9YA 3IP4B 1O3RA 4A3CJ 3CCSI 2L4AA 2JT1A 1S7EA 2XSDC 3E6BA 3IL2A 2Z16A 2LG4A 2HS5A 4M6YA 3RZDJ 2KJBA 1ZR4A 4L9TA 2RQPA 2DOFA 1SC7A 1IGNA 3R6SA 1I39A 2D1HA 1ODDA 5LBQA 1TQIA 3Q3SA 3QAHA 2DQRA 2ISYA 2CYYA 3WTUC 1YJNI 2IEKA 2KLOA 2IVMA 2ELKA 2OU2A 1FT9A 4RAGA 2O8KA 2LRDA 1HCRA 4KUMA 4P55A 1IXRC 2O9LA 3FX3A 3TW6A 2GOMA 1F5TA 2OV7A 1U8BA 3FHZA 2PLYA 2IA2A 4N9IA 4BQQA 3CQZJ 4ZTJA 2BE5F 1X2NA 3ECOA 2Z99A 4YEJA 5HLHA 1OPCA 4ENKA 3ZP5A 2NVYJ 1TQPA 2O5RA 5LGTA 5EG0B 1NG6A 3BDDA 1MBGA 1ZRDA 3DKWA 3PM1A 4HQMA 1P7JA 3L09A 3QPHA 3VEPA 1AWCA 3K69A 4U0YA 2ZNYA 3S1QJ 2EFNA 3OIQA 4EV0A 3WTTC 2P6SA 1MGTA 4PZJA 2DPUA 3Q0UA 4W1UA 5GTIC 2IS1A 2G9WA 4KIGA 4RAZA 1XSDA 1BR4A 5C4XJ 3R4KA 4CCMA 4CGZA 5KK1A 3GTQJ 3AFHA 2XAFA 1ONVA 5D4SA 4UNOA 3K4NA 2XB0X 4BKXA 4II3A 1D8KA 5D5WB 3PO2J 2NS7A 2BZTA 3OYIA 2DBBA 4LMYA 5LHIA 3GMEA 3ZQLA 1DP3A 1OQYA 2H8WA 1OYIA 4CCKA 2UZKA 2VBYA 4G6TB 3BJAA 3BG7A 3MKLA 3PJRA 1XMXA 2LMDA 2COMA 1K7AA 3O3KA 3FK7A 5GPAA 3VFZA 1FLIA 3DEEA 3JRAA 4B09A 1IF1A 2IJLA 3ULQB 2G7UA 1MMGA 5EZGA 3F8NA 3H9GA 5L3EA 3E6DA 5KAFC 1VQKI 2HQ5A 3EDPA 4CHUA 1JXSA 3ZQGA 2QM3A 3FXQA 5F08A 4BHCA 1XS9A 1OCPA 1W7PA 4RAYA 4RM2A 4DIQA 3OYHA 1R23A 1GXQA 2O6GE 1J5YA 3HJEA 2OZ6A 1GVDA 3B02A 1BOAA 2CRGA 4KFCA 1AKHA 1SMTA 4KIBA 1XDSA 1D0ZA 4OIOF 1IRGA 3WTYC 4IF4A 2FOKA 1Z3XA 2VQGA 2XVCA 4EJVA 1FOKA 2A6HF 1CF7B 3EYIA 4I02A 3CJRB 3IWZA 1PDNC 1HDDC 1YJWI 2JRTA 3JTHA 4UUVA 4CUGA 2QCOA 3S17J 1MMSA 2LY1A 4K2EA 4M3DA 3O2PE 1G3WA 2VL8A 2VQHA 1ETXA 1YTYA 5LHGA 3I0TA 4E7JA 3G71I 2B63J 3B6CA 2KHMA 1MSFC 2IP2A 1HDPA 5CKTA 4BNCA 2PQ8A 2EINH 5FLXK 2DN0A 5J40A 3GTGJ 4XLEA 1UHWA 2HQRA 2ZSHB 4HV5A 1S6LA 1LFUP 4L9NA 2V7FA 1FTZA 5CVUA 3X2QH 2IPQX 3PIPF 1RPWA 4GDFA 1YX5A 1YLFA 5BQTA 3C2HA 1JKPC 4PGHA 5F1RA 2UV1A 2XRLA 3JAMK 5J6XA 1PP7U 4CO8A 3CJTB 3BJ6A 3I3LA 4BHBA 1BJZA 2LK2A 4M72A 1HC8A 2WADA 2HOSA 1XG1A 4A3KJ 2WAFA 2M4KA 4YFNF 1LE8B 1ZN2A 2XROA 3SXYA 3K1PA 1WJBA 3HRSA 1FSHA 3MVPA 3BOQA 1K78A 2DT7B 1STZA 1SMYF 3HC7A 2W57A 3GTKJ 2ZO4A 1D1CA 1MBFA 2XF5A 3S2WA 3BCAA 1X3UA 3PFIA 5C4JJ 5BPDA 4MO7A 1VF9A 4IEJA 1GLNA 4I09A 1RRJA 4B44A 3KZIC 4II2A 2M45A 2P6TA 1G59A 1QHGA 1IDYA 2NNNA 1LJ9A 2W82A 1KGSA 3GZ6A 4QPQA 3BTLA 3ASNH 4MNUA 5AIQA 3EETA 5A2QK 2KDOA 3H35A 2QQBA 3CTAA 2HOAA 1RIOH 2E5NA 2HKXA 1B72B 1PYVA 4P9UA 4LG0B 3TDZC 1KU7A 3REOA 1FJLA 1MSEC 4XLNF 1QPIA 4XK4A 3HRTA 2HZTA 1FWZA 2Y9YA 2FXAA 1R1UA 4BYYA 1R49A 2DA3A 2KL4A 2HWVA 4KT6A 5CVIA 1RI7A 2VBXA 1YJ9I 2K9QA 4A5MA 4DBQA 3ABLH 2IW5A 3CLOA 4ZZDA 1T0FA 1FY7A 3E3VA 3MN2A 2CGPA 3JRFA 2ACJA 2R7XA 1BJAA 2HVRA 2JA5J 2L54A 1Z0XA 3FMSA 1O7LA 3ZQIA 2H09A 3C1DA 3ML6A 1TT0A 1TT5B 2HQAA 5FKMA 4RB3C 2A5WA 1I3AA 3TDUC 3ZOBA 5FLVA 4I7HA 1V5EA 2JRMA 3P7NA 4U0WA 4RMNA 2Z5UA 2K85A 4E7HA 2LFBA 3H0GJ 3PNTA 3QOEA 2V26A 3PSIA 4HNTA 1TWAJ 2A69F 2ZBKA 1V4RA 3PO3J 3LQQA 3GUDA 3BR0A 3KLOA 2DI3A 4HSRA 4C2TA 1YS7A 3K4JA 3ZCOA 3RKQA 3I54A 5KAIC 1I1GA 1G3SA 3E6MA 3OS0A 2E1MB 3L2UA 3CUOA 3R61A 2HKOA 1NHAA 1U9OA 4AVPA 3ROUA 3CC7I 3HOYJ 2BW3B 4L5JA 1ETYA 3HOTA 4U7DA 4A5NA 2JJ7A 1MBJA 2JN6A 1RKWA 1XCVA 3FXLA 2BY1A 1HKSA 4OU0A 4P9FA 1X1PA 2ME0A 4KYWA 4RM3A 3K4CA 4RGSA 4YFXF 1EF4A 3ERMA 1YHQI 2ZFUA 3V4GA 1RUOA 1R36A 3IUOA 2KPMA 3MWMA 4RS8A 2QUFA 4FCYA 2PJRA 3VWBA 2LTPA 2E7WA 4X0GA 3F0CA 1V54H 5M5XJ 4MEXF 3IAM2 2NS8A 5E1XA 2M1BA 2BXYA 2KKOA 2E1MC 4JX4A 5F04A 2X6WA 3IAS2 2L9RA 2X6XA 2OAZA 2R7SA 5JLXA 5ILVA 5D4RA 1ZLKA 2MFZA 1R9TJ 3FXRA 4B3XA 2HDWA 3TQNA 4PGGA 4MQ9F 3TOBA 4XRSA 2LSOA 1IV6A 4DZJA 2R5YA 3RPUD 3WGHA 2DFIA 2ADUA 2LYCA 3TO9A 1MH3A 1YE9A 4E7KA 2P7VB 3HG9A 3KX2A 3OYNA 1J59A 2CUFA 3ASOH 3OYBA 3EUAA 2VUMJ 3CP2A 1TLHB 5E3OA 2M4GA 2W1OA 5J1YA 4NQWA 4ANJA 2RAEA 2ZMEA 2D1VA 3BR2A 3DTEA 4MHGA 5EEAA 2QBYA 3AKZA 2I8DA 3JCUC 4U87A 5DEQA 5EGOA 1HF0A 1MBHA 1XC5A 3HSRA 3S1MJ 4P5OA 5AIPA 2ELJA 3ZN1A 3DBHB 3CESA 2JUCA 4A2UA 1KQ0A 2XPVA 1ZGAA 3BZKA 4Q4ZF 1HSTA 1QGPA 4Z2YA 2R7QA 2PEXA 4F52A 5L3DA 5IOZA 4YIRX 3BC8A 4KN7X 3PNVA 2Z9OA 3IH2A 1A5JA 2EFWA 1ZTRA 3W3CA 2XAUA 3FXOA 2FF4A 2J5OA 1TBXA 3RKXA 1KQ8A 3ZMTA 5IT9Z 1UAAA 3HKZN 3TO7A 2PMZA 4IO9F 1B4AA 1G4DA 4CH7A 4BBRJ 2DJIA 1OYYA 1SD4A 3LAPA 1EJ9A 4DOZA 2MD0A 2L01A 5DS9A 2HNHA 4XKBA 1LEBA 3AG4H 4BE1A 4LK1F 5L3BA 4MGRA 1ZG3A 2XPWA 4BJ5C 1P4AA 3QWLA 2ELHA 2JMWA 4A0ZA 2VT3A 3VODA 3ZR8X 3OSGA 2BVLA 4EEFG 2DMNA 5CJ9A 1HA8A 1P4WA 5HODA 4HW0A 4XQFA 4ESJA 1XGOA 4JX5A 1ZARA 2DDAA 2E34A 4LK0F 1IRXA 2CWEA 3WHCA 2R93J 4RDUA 3H36A 4JOMA 5ICEA 4XNFA 5LGNA 1H0MA 2EJRA 1C0WA 4Y52J 2ECBA 1UFMA 1A31A 4IHWA 2A07F 3S14J 2HU9A 3HSEA 1E3HA 3O8HA 2BY3A 4MFEA 3V42A 2QYOA 3WGGA 4IOCF 2Y31A 3ZMVA 1MD0A 3CMYA 3A01B 2ZJRF 2IGNA 3BTCA 4Q48A 1G3TA 1T56A 4WF2A 4QWQA 2XHKA 1OFCX 2OUMA 2X6YA 3SFIA 2M30A 3PUBA 2Q0OA 3I4NJ 4XLFA 4UB8C 3CF5F 4RB2C 2EZKA 5F27A 3QPSA 3DKXA 3KETA 5E18F 2HOTA 3U21A 3OYGA 5F0HA 5DD8A 2QQ9A 3BQYA 3D5LA 1ZGJA 1QU3A 3W2AA 5DCFA 2FOWA 3BR6A 3KYLA 2XGCA 2NVTJ 2VPRA 3GCMA 3ZQFA 2GA2A 1MNEA 3LSJA 3PSFA 2R0QC 1I5ZA 2DT5A 2RDPA 1R5HA 1NG7A 2LY9A 1LNWA 3LFKA 3RDIA 2X4HA 4PSXA 3BWGA 2OA4A 2BXZA 3TO6A 2KRCA 3M07A 1EH6A 5EDNA 3BTIA 5LD2C 2K3FA 2EIJH 2UUZA 3WE2A 1W36C 4XORA 3J7ZI 3S93A 4A3FJ 4D5FA 2CU7A 2WB1N 5J8CA 2GIVA 4F7ZA 4IX7A 1XN7A 1Z7UA 1APLC 5IYBJ 1JHFA 1GV2A 3K7AJ 3LSPA 1FTTA 3S1RJ 1T2KA 2CQXA 4OMYA 5LRSA 4RB1A 1R1VA 4IOAF 3P9IA 3A0HC 3LSMA 1LEAA 1IN8A 4CICA 5LFAA 1FP2A 3IKTA 2R5ZA 4NUBA 2NVXJ 3CC2I 2V1UA 3A4CA 3LL7A 4M3FA 3CMAI 2RNGA 1X58A 2HTJA 3GEZA 5GPCA 2V9KA 4DW6A 3OIPA 1WKMA 3FBIB 1R7JA 2KQRA 2P5VA 5H6RA 4S0HB 4B47A 1YFHA 1JGGA 3K70C 2E2JJ 5CVRA 1J75A 4IHXA 2XAGA 1MDMA 2KT0A 5F0CA 1YO5C 3BR1A 3JW4A 3O8GA 3QYBA 2OJED 5K5RA 4S05A 3F21A 2LP0A 4LLGF 4R8HA 2K27A 4IRIA 2R7FA 3C2BA 3A02A 4ZC3A 2DA2A 3HB9A 3MEXA 4I99C 2VKEA 4KA4A 1VZ0A 1G8XA 4WK8F 2NOGA 5EEHA 4ENNA 3IRRA 2E1CA 1YX3A 3CCVI 3QU3A 4LJZF 2AXTC 2FA5A 2GQQA 3JSPA 1UMQA 1IV8A 3BG9A 1B8IB 4XN3A 3FDYA 1WH7A 1D5YA 4Q47A 3KP2A 3HIFA 2FQ3A 3W6KB 1FSEA 1SFKA 1ACIA 2ZXHA 6PAXA 4PFPA 1KU9A 2OZUA 2ESHA 5GTHC 4PJMA 4BDYA 3TW7A 2R92J 3NARA 5IYDJ 2Q8KA 5IP9J 4A3IJ 1S9HA 3FBNB 1X4PA 5FROA 3GTJJ 1D5VA 1S29A 2MYSA 4XKWA 1KA8A 4I0BA 4LB6B 1SD6A 3Q5FA 4LGWA 3NQOA 1YW8A 3N97A 2HFHA 2KISA 1IUFA 4HDUA 1YIJI 2L7FP 4AYBN 5FKNA 3CP8A 3G1MA 3H3ZA 1N78A 2L0KA 2P8TA 3GVAA 3V8LA 1T39A 4CXFA 5FD6A 3LSKA 2YR2A 3L7WA 3RKYA 3LSTA 4KJZA 3BR5A 3KCCA 4CYCB 1MZBA 5IP7J 3ZQQA 4F91B 2FBIA 3U1DA 3TMOA 1Y56A 1B9NA 4I0AA 1ENHA 4WXHA 1IDZA 1K6YA 2V1DA 4AU7A 3CDHA 2EIKH 2NAZA 3I59B 2PBIA 1BI1A 2AXLA 4Y13A 3FF5A 4I76A 2GWRA 2ZXIA 2JA6J 4FX4A 1NK2P 4XRMA 1JI8A 2ZB9A 2R4GA 5J3LA 3I4PA 3K4LA 3K70D 1OKRA 4M9SA 4DYRA 1HXDA 3DPTA 1A04A 2F2EA 3HPGA 2RV8A 1FOYA 2MD5A 3P9KA 1QBJA 3PFYA 4ENMA 3V7CA 2OC6A 1LDDA 3MMYB 4FE4A 1B59A 1ON2A 3HZJA 3PIOF 3DF8A 2IA1A 1QRYA 3HGYA 4A3JJ 2HPMA 1WJAA 1WJEA 4RLFA 1ITYA 1I1SA 2MG4A 1I50J 3D0SA 1X4OA 4P96A 2OCCH 4BU2A 2QEXI 4V2FA 3I4MJ 1BN5A 3OYLA 1QZZA 2QKMB 2FUG2 1W0UA 3RJPA 2E60A 2X0LA 3QPTA 1Y1WJ 1BL0A 4RA2A 2STTA 1R4MB 2K7LA 4LFUA 3EUKL 4KMUX 4WCGA 3I53A 5HLGA 2P0WA 1S8NA 2E71A 4GCVA 1ZR2A 3CUQB 2L2OA 2W4SA 3FM5A 3T8RA 1V5FA 3T5XA 2VT2A 1WRJA 4IPAA 2IRFG 2DMPA 4CDGA 3G6EI 3JREA 3MD2A 2NVUB 1TWGJ 4EATA 5HDKA 2JTVA 1F1ZA 3OYFA 4IXAA 2MA3A 4CZCA 1OR7C 2MSYA 5JHFA 4HAMA 2I10A 4Y7NJ 1BR2A 1MH4A 4AWXB 3QYEA 2KRFA 2IGMA 2L3DA 3HUGB 2P5KA 2RC4A 3M1CA 4I6ZA 4YELA 2FNAA 4EVIA 5F1JA 2VIXA 3TKYA 1U5TB 1HW5A 3WG7H 2K3PA 2JVGA
chains in the Genus database with same CATH topology
3CUQC 3WU0A 2NRAC 5L3CA 2R7DA 3HOSA 2V6CA 1ON1A 4GYIA 1GXPA 4OINF 1HBXG 3R0JA 1IXSB 4I01A 1YG2A 5ICFA 2CO5A 5KVRA 3QOPA 4EM0B 1U5TC 3RYRA 3GF2A 3GFMA 4HF1A 3K1NA 2M5WA 2PMUA 2ISZA 3JTGA 1FPQA 2EV6A 1QO0D 3CO6C 2W24A 1Y0UA 1K6OA 3KZYA 4HA8A 1B1BA 1YW9A 3DXJF 3K1MA 2VN2A 1RNLA 3HUGA 5FD5A 3LA7A 1LB2A 5LEJA 2WV0A 1I6XA 3T0YA 2HOEA 5HLIA 5FGMA 1YW7A 3HRMA 2K4JA 4EQQA 1BIBA 4M74A 3ZMZA 2YX4A 1W7PD 1LQ1A 4A6DA 5H6QA 2H27A 4D0PA 2EK5A 3EUHA 3RKWA 2LF7A 1CF7A 3KEQA 4UVCA 3ABTA 1B6AA 1FC3A 2XASA 3ISPA 1BIAA 4ESFA 3F23A 3ZMUA 1H9GA 4AD9A 2XV4S 2VBWA 3F6VA 1FYMA 1JHHA 3E5UA 3GZ5A 2XKOA 2QQAA 3LA2A 3OV8A 4I98B 2EV5A 1XGNA 4ESBA 5FLXZ 5H20A 1JE8A 3GWZA 1BI0A 2RVCA 3G3ZA 3ZQ7A 3SQNA 3CJNA 1W4MA 1MJAA 2XRNA 1IN4A 4EJWA 3MCZA 3OOPA 3KZZA 2CFXA 2EFQA 4XSZF 1REPC 2F5FA 4M6XA 3HHHA 1FYKA 3E5QA 1YIOA 3GO5A 3MZYA 5HVQC 2R3SA 4EJUA 2K4BA 5AONA 2DO7A 1FNNA 3MQ0A 3T1BA 1R5GA 1TW3A 1T98A 4LG0A 3BROA 1I27A 3AAFA 2Q2EA 2FU4A 4ASNA 1EH7A 4LLNA 3M8FA 2L02A 3KE2A 4ZYDA 5CVJA 3PQJA 2UWMA 4ZYHA 2V79A 4PCQA 3MAJA 2FBKA 2VOOA 3KLNA 5JHUA 1Z6RA 1R58A 2F5CA 2MH9A 5IT9K 2A68F 3HTSB 1TQMA 4U88A 4L5IA 3T8TA 4G6DA 4EMSA 2O0YA 1BBYA 3FWEA 3J81Z 3V8KA 3BP8A 3U2RA 5ERIA 4YIFA 4MQVA 1F9NA 3I64A 2K86A 4XSXF 3M1EA 1Z1DA 3VOEA 1R1TA 2MLGA 5F64A 3NRVA 4LD5A 4KNYA 3BY6A 5E17F 4TV7A 2FE3A 3MFKA 1BM9A 2YSRA 4M73A 2CW0F 2VE9A 5FB2A 3IWFA 1U8RA 3J7AO 2NNYA 3FMQA 1CGPA 5LHHA 5LLQA 4IJAA 1P2FA 2W85A 4ON0A 2MH2A 2EWNA 1XSVA 3QU6A 2B0LA 2NS0A 2XAHA 1UB9A 2TDXA 3WE3A 3FMRA 3HSFA 1U2WA 1LDKB 2MC3A 2YPRA 2DLLA 1J2XA 4O3MA 3DQVC 1DPUA 3QRFF 1F4KA 3V7SA 2F5DA 5TRDA 5E8IA 2XAJA 2LF8A 3ERED 2FNPA 1IXCA 2LDUA 2XAQA 3TGNA 2D2WA 1MJBA 4N0BA 4G9YA 5E1WA 1FP1D 4BXUA 2CQKA 5EEGA 4KDPA 4OIQF 3KEOA 2PJPA 2VONA 3LA3A 4E70A 5E20A 2ZFWA 3IRQA 4KT5C 3WTSC 2Y75A 1XGMA 2BBYA 2HEOA 2OBPA 4ZYGA 1HKTA 2EFOA 3GFIA 2EV0A 1QZYA 4OMZA 1W5SA 4A0XA 1SAXA 1BC7C 5CYVA 3QP6A 3WG9A 5HOOA 4HV6A 3Q9SA 3ZMDA 2H6CA 2BYVE 5BOXA 2DK8A 5BS6A 4PDKA 2HTSA 3R60A 4ZH4F 1ZAOA 1H9TA 2VC1A 1E17A 4WXCA 2W84A 2HR3A 3DEUA 1Z9CA 2J5PA 2VODA 2XIGA 3KP4A 4OIRF 1PP8F 1SFUA 5DYMA 4LLLA 1MKMA 2JPBA 2KIMA 3KP3A 1ULYA 2YX7A 3M7GA 4N9HA 1U6GA 3I5UA 2FBHA 3O6BB 2L4MA 3F3XA 3RYPA 3IC7A 1KQ9A 1LVAA 1YQAA 5DUKA 2RNJA 1FZPB 3ZPLA 1YS6A 1DUXC 2JPCA 4G7HF 1FBQA 2HYGD 4HYEA 2BEOA 1XCBA 2RKHA 2W25A 2PFBA 3J80Z 1USTA 5ILSA 5FFZA 3GX4X 1ZYRF 2EB7A 1S7AA 3I58A 4L0YB 2DTRA 1TW2A 3E97A 3B73A 2A61A 2M8EA 3DPLC 1ZG1A 4EJTA 2HYFA 2UXNA 1XMKA 4JBAA 3SFZA 2GXBA 4Y15A 3GW2A 1OYWA 4BHPA 5ILUA 3TOAA 2DAOA 2O61A 4HQEA 4A0YA 5DUIA 1HKQA 4EGZA 3GFLA 2YU3A 2H6BA 1D8JA 3ELKA 4FT8A 1ZHFA 5JR3A 1KU3A 3U9GA 1G6NA 3FZVA 1XD7A 3V8JA 4UHTA 4IRHA 2K02A 4HZFA 4UXNA 1ZRFA 2BGCA 2RN7A 3ECHA 5HDGA 3LAJA 1O7FA 2QENA 1W7PB 3I59A 4U7BA 1R00A 1IN5A 2P7CB 2ZCWA 4DNCA 5TJJA 5HS9A 1XDUA 3BZ6A 5DCMB 3K9TA 4UVAA 3MZHA 2DK5A 4JQFA 1HW2A 1KU2A 1BC8C 3GYHX 2BV6A 2CSOA 1ZG5A 3GLXA 5FFXA 5D5VB 1ZLJA 3K0LA 1Z6TA 3L2CA 2QWWA 4WXDA 3KP6A 4G7ZF 3GFJA 2FSWA 2LNBA 4G6QA 1OR7A 2FRHA 2EA2A 1WQ2A 4IHSA 1DP7P 1IN7A 2PMHA 3RI4A 1ZRCA 1L0OC 3DV8A 1R22A 4L9VA 1KYZA 5BPIA 3CUQA 3HRUA 4L9JA 2A3SA 3I71A 3HYIA 4CYDA 4I2OA 4S04A 1K78B 1DPRA 3WU1B 1LDJA 3C18A 5DCMA 2DU9A 5DV5A 4R1HA 2HDCA 2VE8A 3IKVA 2KJCA 1U5TA 2M87A 5ED4A 5BMZA 3GXOA 1WWXA 1P6RA 4GO1A 3P9CA 1SD7A 2V1XA 1O3QA 4XRFA 1J0RA 1TNSA 1T6SA 4A6EA 4AIHA 3SZPA 5D5XB 4BQAA 3F72A 4IVNA 2XKPA 3M9AA 3CO7C 3Q9VA 2O3FA 2STWA 4YG2F 1L3LA 4HBLA 4CZZA 2D45A 2IA0A 4G7OF 2A6EF 2PN6A 1SFXA 1B9MA 2FEZA 3H3UA 3F8FA 4BAYA 3RIRA 1WI9A 1QNTA 1IN6A 4NHJA 3C3WA 1MJ9A 3M8EA 3E6CC 1UHMA 1GHCA 1O3SA 2V9VA 1IAWA 1HSJA 1IW7F 2DW4A 3ZN0A 3JAMZ 1IRFA 1JGSA 3HHGA 3V7RA 2GAUA 4HF2A 3DP7A 1QQIA 3WODF 5J8FA 4RGXA 4ENJA 1G3YA 4ETSA 3QP5A 2ESNA 4HX8A 5HDNA 5JFRA 2P4WA 3RPUA 5CLSA 3F6OA 3W6JB 1ZREA 4M9XA 5ICGA 3J81K 5A2QZ 4BH9A 2VXZA 5LEKA 5D6FA 2HGCA 4RGUA 5LGUA 2ZMEB 2QBYB 2HQNA 2JZYA 2H94A 3H92A 2RGVA 1HQCA 4KMFA 3BPXA 1P92A 4EM2A 4ZYEA 4HLXA 2ZKZA 1FBUA 1S7OA 4GXOA 1Z91A 4RGRA 2P5LC 2OQRA 5D6EA 4AIJA 1GVJA 1V3FA 4HX7A 5HS7A 3L00A 2FMLA 1D3YA 2VOPA 4MTEA 5DDGA 1USSA 2JSCA 1J7KA 2XGXA 5E8GA 3WTWC 3G73A 1IUYA 2GXGA 1VTNC 1XGSA 4GYGA 4UV8A 5K5OA 4L18B 2Z33A 3BJOA 3FM3A 4EGYA 4H0EA 1BI3A 4A12A 1XMAA 4UV9A 2C6YA 4HOBA 5ICCA 5JVTA 3K2ZA 4MTDA 1TTYA 4AIKA 3F8BA 2GA1A 3EQLF 2CG4A 2WTEA 3KP5A 4NB5A 4XLPF 2PG4A 4R79A 5K5QA 1T38A 3KP7A 4IHTA 1FX7A 1BI2A 3L9FA 1YYVA 4DQ2A 1UCRA 5JI6A 2VC0A 3RPQA 3PQKA 2KIUA 1XB4A 4LB5A 2LKPA 1J9IA 3SZTA 2A5YB 1W5TA 4Y17A 4HF0A 4UVBA 2MLKA 3WTXC 2VBZA 2WC2A 3JSOA 2O8XA 4M71A 4FX0A 3DFGA 2ZNZA 4O6JA 1TNTA 1QPMA 3C7JA 1MDMB 2QLZA 1PUEE 4M9ZA 2DQLA 3R0AA 3ZMSA 2E7XA 1E2XA 3HTUA 3FXUA 3F8CA 3F8MA 1KYWA 1EH8A 2ZXJA 4HLYA 4ZZLA 4WX9A 4GGGA 5HS8A 3WGIA 2QZ8A 3VB2A 4Q5SF 1OMIA 5IT3A 5FO5A 5D8LB 4FHTA 5LRRA 4L0ZB 3J80K 4JK1X 3IHUA 4HDVA 3N4MA 2EFPA 1O3TA 1XSXA 4MEYF 2UXXA 3LWFA 4OOIA 4U0VA 5K1YA 5D8KB 4WWCA 3SHFA 1K79A 1IZ1A 4KICA 2ETHA 1WSUA 5D5UB 2OD5A 3WTVC 1U78A 1FYLA 2Y48A 3WTZA 4YIIA 4O5VA 4G8XA 2E1NA 4QLCU 3F22A 2G7HA 3E5XA 2GZWA 2XUBA 4EM1A 1Z05A 4KN4X 2DPDA 2ZJ2A 1RZ4A 1SD5A 4B8XA 3COAC 1SFEA 2MBFA 1DDNA 1FBSA 2OQGA 2AS5F 3ABUA 2O03A 3RTRA 4OIPF 1P4XA 2WWYA 3EYYA 3KFWX 2IT0A 3BPVA 2Z3YA 2PI0A 1AOYA 1S3JA 1RUNA 5L3GA 2NYXA 4G94A 5F6FA 3LQRA 2QVOA 1Q1HA 4EJOA 5DD4A 2F5EA 5L3FA 5CVVA 1U3EM 1ZH5A 2Y0MA 2EA4A 2FMYA 4RB0A 4XBFA 4KIFA 4YFKF 1HW1A 4HX4A 1O57A 4IRGA 5E1ZB 2KIFA 1EV7A 3NEUA 1O3RA 2L4AA 2JT1A 3E6BA 3IL2A 2HS5A 4M6YA 2KJBA 4L9TA 2RQPA 3R6SA 2D1HA 1ODDA 5LBQA 1TQIA 3QAHA 2DQRA 2ISYA 2CYYA 3WTUC 2IVMA 2OU2A 1FT9A 4KUMA 4P55A 1IXRC 3FX3A 1F5TA 3FHZA 2PLYA 2IA2A 4N9IA 2BE5F 3ECOA 2Z99A 5HLHA 1OPCA 4ENKA 3ZP5A 1TQPA 5LGTA 3BDDA 1ZRDA 3DKWA 4HQMA 3QPHA 3L09A 3VEPA 1AWCA 3K69A 4U0YA 2ZNYA 2EFNA 4EV0A 3WTTC 2P6SA 1MGTA 4PZJA 2DPUA 2G9WA 4KIGA 4RAZA 1XSDA 3R4KA 4CGZA 5KK1A 2XAFA 1ONVA 5D4SA 4UNOA 1D8KA 5D5WB 2DBBA 4LMYA 5LHIA 1OYIA 2UZKA 2VBYA 3BJAA 2COMA 1K7AA 3O3KA 3VFZA 1FLIA 4B09A 1IF1A 2IJLA 3ULQB 2G7UA 3F8NA 5L3EA 3E6DA 4CHUA 1JXSA 3EDPA 2QM3A 3FXQA 4BHCA 1W7PA 4RAYA 1R23A 1GXQA 2O6GE 1J5YA 2OZ6A 3B02A 1BOAA 4KFCA 1SMTA 4KIBA 1XDSA 4OIOF 1IRGA 3WTYC 4IF4A 2FOKA 1FOKA 2XVCA 4EJVA 2A6HF 1CF7B 3EYIA 4I02A 1PDNC 3IWZA 2JRTA 3JTHA 4UUVA 4K2EA 3O2PE 1G3WA 1YTYA 5LHGA 3I0TA 2IP2A 4BNCA 2PQ8A 5FLXK 1UHWA 2HQRA 4HV5A 1S6LA 4L9NA 5CVUA 2IPQX 1YLFA 5BQTA 4PGHA 5F1RA 3JAMK 5J6XA 1PP7U 4CO8A 3BJ6A 4BHBA 4M72A 4YFNF 1ZN2A 2XROA 3SXYA 3K1PA 3HRSA 1FSHA 3BOQA 1K78A 1STZA 1SMYF 2W57A 2ZO4A 3S2WA 1X3UA 3PFIA 5BPDA 4I09A 2M45A 2P6TA 2NNNA 1LJ9A 1KGSA 3GZ6A 5AIQA 4MNUA 3EETA 5A2QK 2QQBA 3CTAA 1RIOH 2HKXA 4P9UA 4LG0B 3TDZC 1KU7A 3REOA 4XLNF 3HRTA 2HZTA 1FWZA 2FXAA 1R1UA 4BYYA 2HWVA 5CVIA 1RI7A 2VBXA 4A5MA 2IW5A 3CLOA 4ZZDA 1T0FA 1FY7A 3E3VA 2CGPA 2ACJA 1BJAA 2L54A 3FMSA 1O7LA 2H09A 3C1DA 3ML6A 4RB3C 3TDUC 4I7HA 3P7NA 4U0WA 2Z5UA 2A69F 2ZBKA 1V4RA 3LQQA 3GUDA 3KLOA 2DI3A 1YS7A 3I54A 1I1GA 1G3SA 3E6MA 3CUOA 3R61A 2HKOA 1NHAA 4AVPA 3ROUA 4L5JA 3HOTA 4U7DA 4A5NA 1XCVA 1HKSA 4OU0A 4P9FA 4KYWA 4YFXF 4RGSA 3V4GA 1RUOA 1R36A 3MWMA 4RS8A 2QUFA 2E7WA 4MEXF 5E1XA 2M1BA 2KKOA 2OAZA 5D4RA 5ILVA 1ZLKA 3FXRA 3TQNA 4PGGA 4MQ9F 3TOBA 2LSOA 3WGHA 2DFIA 2ADUA 3TO9A 2P7VB 1J59A 1TLHB 4NQWA 2ZMEA 2D1VA 4MHGA 2QBYA 5DEQA 3HSRA 4P5OA 5AIPA 3ZN1A 4A2UA 1KQ0A 4Q4ZF 1ZGAA 1HSTA 1QGPA 4Z2YA 2PEXA 5L3DA 4KN7X 2Z9OA 2EFWA 2FF4A 2J5OA 1TBXA 3RKXA 1KQ8A 3ZMTA 5IT9Z 3TO7A 1B4AA 1G4DA 1OYYA 1SD4A 3LAPA 2L01A 1LEBA 4LK1F 5L3BA 4MGRA 1ZG3A 1P4AA 2ELHA 4A0ZA 2VT3A 3VODA 5CJ9A 1P4WA 4HW0A 4ESJA 1XGOA 1ZARA 4LK0F 2CWEA 5LGNA 5ICEA 1H0MA 2EJRA 1C0WA 1UFMA 2A07F 3HSEA 2QYOA 3WGGA 3ZMVA 1MD0A 4Q48A 1G3TA 4WF2A 4QWQA 2XHKA 2M30A 2Q0OA 4RB2C 3KETA 5E18F 5DD8A 2QQ9A 3D5LA 1ZGJA 5DCFA 2GA2A 1I5ZA 2DT5A 2RDPA 1R5HA 1LNWA 3LFKA 3RDIA 2X4HA 3BWGA 2OA4A 3TO6A 1EH6A 3WE2A 5J8CA 2GIVA 4F7ZA 1XN7A 1Z7UA 1JHFA 1T2KA 4OMYA 5LRSA 4RB1A 1R1VA 3P9IA 1LEAA 1IN8A 4CICA 3IKTA 1FP2A 2V1UA 3GEZA 2HTJA 1WKMA 1R7JA 2P5VA 5H6RA 1YFHA 5CVRA 1J75A 2XAGA 1MDMA 1YO5C 3JW4A 5K5RA 4S05A 3F21A 4LLGF 4R8HA 2K27A 4IRIA 2R7FA 3MEXA 4KA4A 4WK8F 5EEHA 4ENNA 3IRRA 2E1CA 3QU3A 4LJZF 2FA5A 2GQQA 3JSPA 4Q47A 3KP2A 3HIFA 2FQ3A 3W6KB 1FSEA 6PAXA 1KU9A 2OZUA 2ESHA 2Q8KA 1D5VA 1S29A 4LB6B 1KA8A 4I0BA 1SD6A 3Q5FA 4LGWA 3NQOA 1YW8A 3N97A 2HFHA 4HDUA 3H3ZA 2P8TA 3GVAA 3V8LA 1T39A 4CXFA 5FD6A 2YR2A 3L7WA 3RKYA 3LSTA 3KCCA 1MZBA 2FBIA 3U1DA 1B9NA 4I0AA 4WXHA 2V1DA 3CDHA 2NAZA 3I59B 2PBIA 1BI1A 2AXLA 4Y13A 3FF5A 2GWRA 4FX4A 3I4PA 1OKRA 4M9SA 1HXDA 3DPTA 1A04A 2F2EA 2RV8A 2MD5A 3P9KA 1QBJA 4ENMA 3V7CA 1LDDA 1B59A 1ON2A 3DF8A 2IA1A 1I1SA 3D0SA 4P96A 1BN5A 1QZZA 3RJPA 2X0LA 3QPTA 2STTA 2K7LA 4LFUA 4KMUX 4WCGA 3I53A 5HLGA 1S8NA 4GCVA 3CUQB 3FM5A 3T8RA 3T5XA 2VT2A 1WRJA 4IPAA 2IRFG 4CDGA 5HDKA 2JTVA 1F1ZA 4IXAA 2MA3A 4HAMA 4AWXB 2KRFA 2L3DA 2P5KA 2RC4A 2FNAA 4EVIA 3TKYA 1U5TB 1HW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ C;  3WU0 A;  2NRA C;  5L3C A;  2R7D A;  3HOS A;  2V6C A;  1ON1 A;  4GYI A;  1GXP A;  4OIN F;  1HBX G;  3R0J A;  1IXS B;  4I01 A;  1YG2 A;  5ICF A;  2CO5 A;  5KVR A;  3QOP A;  4EM0 B;  1U5T C;  3RYR A;  3GF2 A;  3GFM A;  4HF1 A;  3K1N A;  2M5W A;  2PMU A;  2ISZ A;  3JTG A;  1FPQ A;  2EV6 A;  1QO0 D;  3CO6 C;  2W24 A;  1Y0U A;  1K6O A;  3KZY A;  4HA8 A;  1B1B A;  1YW9 A;  3DXJ F;  3K1M A;  2VN2 A;  1RNL A;  3HUG A;  5FD5 A;  3LA7 A;  1LB2 A;  5LEJ A;  2WV0 A;  1I6X A;  3T0Y A;  2HOE A;  5HLI A;  5FGM A;  1YW7 A;  3HRM A;  2K4J A;  4EQQ A;  1BIB A;  4M74 A;  3ZMZ A;  2YX4 A;  1W7P D;  1LQ1 A;  4A6D A;  5H6Q A;  2H27 A;  4D0P A;  2EK5 A;  3EUH A;  3RKW A;  2LF7 A;  1CF7 A;  3KEQ A;  4UVC A;  3ABT A;  1B6A A;  1FC3 A;  2XAS A;  3ISP A;  1BIA A;  4ESF A;  3F23 A;  3ZMU A;  1H9G A;  4AD9 A;  2XV4 S;  2VBW A;  3F6V A;  1FYM A;  1JHH A;  3E5U A;  3GZ5 A;  2XKO A;  2QQA A;  3LA2 A;  3OV8 A;  4I98 B;  2EV5 A;  1XGN A;  4ESB A;  5FLX Z;  5H20 A;  1JE8 A;  3GWZ A;  1BI0 A;  2RVC A;  3G3Z A;  3ZQ7 A;  3SQN A;  3CJN A;  1W4M A;  1MJA A;  2XRN A;  1IN4 A;  4EJW A;  3MCZ A;  3OOP A;  3KZZ A;  2CFX A;  2EFQ A;  4XSZ F;  1REP C;  2F5F A;  4M6X A;  3HHH A;  1FYK A;  3E5Q A;  1YIO A;  3GO5 A;  3MZY A;  5HVQ C;  2R3S A;  4EJU A;  2K4B A;  5AON A;  2DO7 A;  1FNN A;  3MQ0 A;  3T1B A;  1R5G A;  1TW3 A;  1T98 A;  4LG0 A;  3BRO A;  1I27 A;  3AAF A;  2Q2E A;  2FU4 A;  4ASN A;  1EH7 A;  4LLN A;  3M8F A;  2L02 A;  3KE2 A;  4ZYD A;  5CVJ A;  3PQJ A;  2UWM A;  4ZYH A;  2V79 A;  4PCQ A;  3MAJ A;  2FBK A;  2VOO A;  3KLN A;  5JHU A;  1Z6R A;  1R58 A;  2F5C A;  2MH9 A;  5IT9 K;  2A68 F;  3HTS B;  1TQM A;  4U88 A;  4L5I A;  3T8T A;  4G6D A;  4EMS A;  2O0Y A;  1BBY A;  3FWE A;  3J81 Z;  3V8K A;  3BP8 A;  3U2R A;  5ERI A;  4YIF A;  4MQV A;  1F9N A;  3I64 A;  2K86 A;  4XSX F;  3M1E A;  1Z1D A;  3VOE A;  1R1T A;  2MLG A;  5F64 A;  3NRV A;  4LD5 A;  4KNY A;  3BY6 A;  5E17 F;  4TV7 A;  2FE3 A;  3MFK A;  1BM9 A;  2YSR A;  4M73 A;  2CW0 F;  2VE9 A;  5FB2 A;  3IWF A;  1U8R A;  3J7A O;  2NNY A;  3FMQ A;  1CGP A;  5LHH A;  5LLQ A;  4IJA A;  1P2F A;  2W85 A;  4ON0 A;  2MH2 A;  2EWN A;  1XSV A;  3QU6 A;  2B0L A;  2NS0 A;  2XAH A;  1UB9 A;  2TDX A;  3WE3 A;  3FMR A;  3HSF A;  1U2W A;  1LDK B;  2MC3 A;  2YPR A;  2DLL A;  1J2X A;  4O3M A;  3DQV C;  1DPU A;  3QRF F;  1F4K A;  3V7S A;  2F5D A;  5TRD A;  5E8I A;  2XAJ A;  2LF8 A;  3ERE D;  2FNP A;  1IXC A;  2LDU A;  2XAQ A;  3TGN A;  2D2W A;  1MJB A;  4N0B A;  4G9Y A;  5E1W A;  1FP1 D;  4BXU A;  2CQK A;  5EEG A;  4KDP A;  4OIQ F;  3KEO A;  2PJP A;  2VON A;  3LA3 A;  4E70 A;  5E20 A;  2ZFW A;  3IRQ A;  4KT5 C;  3WTS C;  2Y75 A;  1XGM A;  2BBY A;  2HEO A;  2OBP A;  4ZYG A;  1HKT A;  2EFO A;  3GFI A;  2EV0 A;  1QZY A;  4OMZ A;  1W5S A;  4A0X A;  1SAX A;  1BC7 C;  5CYV A;  3QP6 A;  3WG9 A;  5HOO A;  4HV6 A;  3Q9S A;  3ZMD A;  2H6C A;  2BYV E;  5BOX A;  2DK8 A;  5BS6 A;  4PDK A;  2HTS A;  3R60 A;  4ZH4 F;  1ZAO A;  1H9T A;  2VC1 A;  1E17 A;  4WXC A;  2W84 A;  2HR3 A;  3DEU A;  1Z9C A;  2J5P A;  2VOD A;  2XIG A;  3KP4 A;  4OIR F;  1PP8 F;  1SFU A;  5DYM A;  4LLL A;  1MKM A;  2JPB A;  2KIM A;  3KP3 A;  1ULY A;  2YX7 A;  3M7G A;  4N9H A;  1U6G A;  3I5U A;  2FBH A;  3O6B B;  2L4M A;  3F3X A;  3RYP A;  3IC7 A;  1KQ9 A;  1LVA A;  1YQA A;  5DUK A;  2RNJ A;  1FZP B;  3ZPL A;  1YS6 A;  1DUX C;  2JPC A;  4G7H F;  1FBQ A;  2HYG D;  4HYE A;  2BEO A;  1XCB A;  2RKH A;  2W25 A;  2PFB A;  3J80 Z;  1UST A;  5ILS A;  5FFZ A;  3GX4 X;  1ZYR F;  2EB7 A;  1S7A A;  3I58 A;  4L0Y B;  2DTR A;  1TW2 A;  3E97 A;  3B73 A;  2A61 A;  2M8E A;  3DPL C;  1ZG1 A;  4EJT A;  2HYF A;  2UXN A;  1XMK A;  4JBA A;  3SFZ A;  2GXB A;  4Y15 A;  3GW2 A;  1OYW A;  4BHP A;  5ILU A;  3TOA A;  2DAO A;  2O61 A;  4HQE A;  4A0Y A;  5DUI A;  1HKQ A;  4EGZ A;  3GFL A;  2YU3 A;  2H6B A;  1D8J A;  3ELK A;  4FT8 A;  1ZHF A;  5JR3 A;  1KU3 A;  3U9G A;  1G6N A;  3FZV A;  1XD7 A;  3V8J A;  4UHT A;  4IRH A;  2K02 A;  4HZF A;  4UXN A;  1ZRF A;  2BGC A;  2RN7 A;  3ECH A;  5HDG A;  3LAJ A;  1O7F A;  2QEN A;  1W7P B;  3I59 A;  4U7B A;  1R00 A;  1IN5 A;  2P7C B;  2ZCW A;  4DNC A;  5TJJ A;  5HS9 A;  1XDU A;  3BZ6 A;  5DCM B;  3K9T A;  4UVA A;  3MZH A;  2DK5 A;  4JQF A;  1HW2 A;  1KU2 A;  1BC8 C;  3GYH X;  2BV6 A;  2CSO A;  1ZG5 A;  3GLX A;  5FFX A;  5D5V B;  1ZLJ A;  3K0L A;  1Z6T A;  3L2C A;  2QWW A;  4WXD A;  3KP6 A;  4G7Z F;  3GFJ A;  2FSW A;  2LNB A;  4G6Q A;  1OR7 A;  2FRH A;  2EA2 A;  1WQ2 A;  4IHS A;  1DP7 P;  1IN7 A;  2PMH A;  3RI4 A;  1ZRC A;  1L0O C;  3DV8 A;  1R22 A;  4L9V A;  1KYZ A;  5BPI A;  3CUQ A;  3HRU A;  4L9J A;  2A3S A;  3I71 A;  3HYI A;  4CYD A;  4I2O A;  4S04 A;  1K78 B;  1DPR A;  3WU1 B;  1LDJ A;  3C18 A;  5DCM A;  2DU9 A;  5DV5 A;  4R1H A;  2HDC A;  2VE8 A;  3IKV A;  2KJC A;  1U5T A;  2M87 A;  5ED4 A;  5BMZ A;  3GXO A;  1WWX A;  1P6R A;  4GO1 A;  3P9C A;  1SD7 A;  2V1X A;  1O3Q A;  4XRF A;  1J0R A;  1TNS A;  1T6S A;  4A6E A;  4AIH A;  3SZP A;  5D5X B;  4BQA A;  3F72 A;  4IVN A;  2XKP A;  3M9A A;  3CO7 C;  3Q9V A;  2O3F A;  2STW A;  4YG2 F;  1L3L A;  4HBL A;  4CZZ A;  2D45 A;  2IA0 A;  4G7O F;  2A6E F;  2PN6 A;  1SFX A;  1B9M A;  2FEZ A;  3H3U A;  3F8F A;  4BAY A;  3RIR A;  1WI9 A;  1QNT A;  1IN6 A;  4NHJ A;  3C3W A;  1MJ9 A;  3M8E A;  3E6C C;  1UHM A;  1GHC A;  1O3S A;  2V9V A;  1IAW A;  1HSJ A;  1IW7 F;  2DW4 A;  3ZN0 A;  3JAM Z;  1IRF A;  1JGS A;  3HHG A;  3V7R A;  2GAU A;  4HF2 A;  3DP7 A;  1QQI A;  3WOD F;  5J8F A;  4RGX A;  4ENJ A;  1G3Y A;  4ETS A;  3QP5 A;  2ESN A;  4HX8 A;  5HDN A;  5JFR A;  2P4W A;  3RPU A;  5CLS A;  3F6O A;  3W6J B;  1ZRE A;  4M9X A;  5ICG A;  3J81 K;  5A2Q Z;  4BH9 A;  2VXZ A;  5LEK A;  5D6F A;  2HGC A;  4RGU A;  5LGU A;  2ZME B;  2QBY B;  2HQN A;  2JZY A;  2H94 A;  3H92 A;  2RGV A;  1HQC A;  4KMF A;  3BPX A;  1P92 A;  4EM2 A;  4ZYE A;  4HLX A;  2ZKZ A;  1FBU A;  1S7O A;  4GXO A;  1Z91 A;  4RGR A;  2P5L C;  2OQR A;  5D6E A;  4AIJ A;  1GVJ A;  1V3F A;  4HX7 A;  5HS7 A;  3L00 A;  2FML A;  1D3Y A;  2VOP A;  4MTE A;  5DDG A;  1USS A;  2JSC A;  1J7K A;  2XGX A;  5E8G A;  3WTW C;  3G73 A;  1IUY A;  2GXG A;  1VTN C;  1XGS A;  4GYG A;  4UV8 A;  5K5O A;  4L18 B;  2Z33 A;  3BJO A;  3FM3 A;  4EGY A;  4H0E A;  1BI3 A;  4A12 A;  1XMA A;  4UV9 A;  2C6Y A;  4HOB A;  5ICC A;  5JVT A;  3K2Z A;  4MTD A;  1TTY A;  4AIK A;  3F8B A;  2GA1 A;  3EQL F;  2CG4 A;  2WTE A;  3KP5 A;  4NB5 A;  4XLP F;  2PG4 A;  4R79 A;  5K5Q A;  1T38 A;  3KP7 A;  4IHT A;  1FX7 A;  1BI2 A;  3L9F A;  1YYV A;  4DQ2 A;  1UCR A;  5JI6 A;  2VC0 A;  3RPQ A;  3PQK A;  2KIU A;  1XB4 A;  4LB5 A;  2LKP A;  1J9I A;  3SZT A;  2A5Y B;  1W5T A;  4Y17 A;  4HF0 A;  4UVB A;  2MLK A;  3WTX C;  2VBZ A;  2WC2 A;  3JSO A;  2O8X A;  4M71 A;  4FX0 A;  3DFG A;  2ZNZ A;  4O6J A;  1TNT A;  1QPM A;  3C7J A;  1MDM B;  2QLZ A;  1PUE E;  4M9Z A;  2DQL A;  3R0A A;  3ZMS A;  2E7X A;  1E2X A;  3HTU A;  3FXU A;  3F8C A;  3F8M A;  1KYW A;  1EH8 A;  2ZXJ A;  4HLY A;  4ZZL A;  4WX9 A;  4GGG A;  5HS8 A;  3WGI A;  2QZ8 A;  3VB2 A;  4Q5S F;  1OMI A;  5IT3 A;  5FO5 A;  5D8L B;  4FHT A;  5LRR A;  4L0Z B;  3J80 K;  4JK1 X;  3IHU A;  4HDV A;  3N4M A;  2EFP A;  1O3T A;  1XSX A;  4MEY F;  2UXX A;  3LWF A;  4OOI A;  4U0V A;  5K1Y A;  5D8K B;  4WWC A;  3SHF A;  1K79 A;  1IZ1 A;  4KIC A;  2ETH A;  1WSU A;  5D5U B;  2OD5 A;  3WTV C;  1U78 A;  1FYL A;  2Y48 A;  3WTZ A;  4YII A;  4O5V A;  4G8X A;  2E1N A;  4QLC U;  3F22 A;  2G7H A;  3E5X A;  2GZW A;  2XUB A;  4EM1 A;  1Z05 A;  4KN4 X;  2DPD A;  2ZJ2 A;  1RZ4 A;  1SD5 A;  4B8X A;  3COA C;  1SFE A;  2MBF A;  1DDN A;  1FBS A;  2OQG A;  2AS5 F;  3ABU A;  2O03 A;  3RTR A;  4OIP F;  1P4X A;  2WWY A;  3EYY A;  3KFW X;  2IT0 A;  3BPV A;  2Z3Y A;  2PI0 A;  1AOY A;  1S3J A;  1RUN A;  5L3G A;  2NYX A;  4G94 A;  5F6F A;  3LQR A;  2QVO A;  1Q1H A;  4EJO A;  5DD4 A;  2F5E A;  5L3F A;  5CVV A;  1U3E M;  1ZH5 A;  2Y0M A;  2EA4 A;  2FMY A;  4RB0 A;  4XBF A;  4KIF A;  4YFK F;  1HW1 A;  4HX4 A;  1O57 A;  4IRG A;  5E1Z B;  2KIF A;  1EV7 A;  3NEU A;  1O3R A;  2L4A A;  2JT1 A;  3E6B A;  3IL2 A;  2HS5 A;  4M6Y A;  2KJB A;  4L9T A;  2RQP A;  3R6S A;  2D1H A;  1ODD A;  5LBQ A;  1TQI A;  3QAH A;  2DQR A;  2ISY A;  2CYY A;  3WTU C;  2IVM A;  2OU2 A;  1FT9 A;  4KUM A;  4P55 A;  1IXR C;  3FX3 A;  1F5T A;  3FHZ A;  2PLY A;  2IA2 A;  4N9I A;  2BE5 F;  3ECO A;  2Z99 A;  5HLH A;  1OPC A;  4ENK A;  3ZP5 A;  1TQP A;  5LGT A;  3BDD A;  1ZRD A;  3DKW A;  4HQM A;  3QPH A;  3L09 A;  3VEP A;  1AWC A;  3K69 A;  4U0Y A;  2ZNY A;  2EFN A;  4EV0 A;  3WTT C;  2P6S A;  1MGT A;  4PZJ A;  2DPU A;  2G9W A;  4KIG A;  4RAZ A;  1XSD A;  3R4K A;  4CGZ A;  5KK1 A;  2XAF A;  1ONV A;  5D4S A;  4UNO A;  1D8K A;  5D5W B;  2DBB A;  4LMY A;  5LHI A;  1OYI A;  2UZK A;  2VBY A;  3BJA A;  2COM A;  1K7A A;  3O3K A;  3VFZ A;  1FLI A;  4B09 A;  1IF1 A;  2IJL A;  3ULQ B;  2G7U A;  3F8N A;  5L3E A;  3E6D A;  4CHU A;  1JXS A;  3EDP A;  2QM3 A;  3FXQ A;  4BHC A;  1W7P A;  4RAY A;  1R23 A;  1GXQ A;  2O6G E;  1J5Y A;  2OZ6 A;  3B02 A;  1BOA A;  4KFC A;  1SMT A;  4KIB A;  1XDS A;  4OIO F;  1IRG A;  3WTY C;  4IF4 A;  2FOK A;  1FOK A;  2XVC A;  4EJV A;  2A6H F;  1CF7 B;  3EYI A;  4I02 A;  1PDN C;  3IWZ A;  2JRT A;  3JTH A;  4UUV A;  4K2E A;  3O2P E;  1G3W A;  1YTY A;  5LHG A;  3I0T A;  2IP2 A;  4BNC A;  2PQ8 A;  5FLX K;  1UHW A;  2HQR A;  4HV5 A;  1S6L A;  4L9N A;  5CVU A;  2IPQ X;  1YLF A;  5BQT A;  4PGH A;  5F1R A;  3JAM K;  5J6X A;  1PP7 U;  4CO8 A;  3BJ6 A;  4BHB A;  4M72 A;  4YFN F;  1ZN2 A;  2XRO A;  3SXY A;  3K1P A;  3HRS A;  1FSH A;  3BOQ A;  1K78 A;  1STZ A;  1SMY F;  2W57 A;  2ZO4 A;  3S2W A;  1X3U A;  3PFI A;  5BPD A;  4I09 A;  2M45 A;  2P6T A;  2NNN A;  1LJ9 A;  1KGS A;  3GZ6 A;  5AIQ A;  4MNU A;  3EET A;  5A2Q K;  2QQB A;  3CTA A;  1RIO H;  2HKX A;  4P9U A;  4LG0 B;  3TDZ C;  1KU7 A;  3REO A;  4XLN F;  3HRT A;  2HZT A;  1FWZ A;  2FXA A;  1R1U A;  4BYY A;  2HWV A;  5CVI A;  1RI7 A;  2VBX A;  4A5M A;  2IW5 A;  3CLO A;  4ZZD A;  1T0F A;  1FY7 A;  3E3V A;  2CGP A;  2ACJ A;  1BJA A;  2L54 A;  3FMS A;  1O7L A;  2H09 A;  3C1D A;  3ML6 A;  4RB3 C;  3TDU C;  4I7H A;  3P7N A;  4U0W A;  2Z5U A;  2A69 F;  2ZBK A;  1V4R A;  3LQQ A;  3GUD A;  3KLO A;  2DI3 A;  1YS7 A;  3I54 A;  1I1G A;  1G3S A;  3E6M A;  3CUO A;  3R61 A;  2HKO A;  1NHA A;  4AVP A;  3ROU A;  4L5J A;  3HOT A;  4U7D A;  4A5N A;  1XCV A;  1HKS A;  4OU0 A;  4P9F A;  4KYW A;  4YFX F;  4RGS A;  3V4G A;  1RUO A;  1R36 A;  3MWM A;  4RS8 A;  2QUF A;  2E7W A;  4MEX F;  5E1X A;  2M1B A;  2KKO A;  2OAZ A;  5D4R A;  5ILV A;  1ZLK A;  3FXR A;  3TQN A;  4PGG A;  4MQ9 F;  3TOB A;  2LSO A;  3WGH A;  2DFI A;  2ADU A;  3TO9 A;  2P7V B;  1J59 A;  1TLH B;  4NQW A;  2ZME A;  2D1V A;  4MHG A;  2QBY A;  5DEQ A;  3HSR A;  4P5O A;  5AIP A;  3ZN1 A;  4A2U A;  1KQ0 A;  4Q4Z F;  1ZGA A;  1HST A;  1QGP A;  4Z2Y A;  2PEX A;  5L3D A;  4KN7 X;  2Z9O A;  2EFW A;  2FF4 A;  2J5O A;  1TBX A;  3RKX A;  1KQ8 A;  3ZMT A;  5IT9 Z;  3TO7 A;  1B4A A;  1G4D A;  1OYY A;  1SD4 A;  3LAP A;  2L01 A;  1LEB A;  4LK1 F;  5L3B A;  4MGR A;  1ZG3 A;  1P4A A;  2ELH A;  4A0Z A;  2VT3 A;  3VOD A;  5CJ9 A;  1P4W A;  4HW0 A;  4ESJ A;  1XGO A;  1ZAR A;  4LK0 F;  2CWE A;  5LGN A;  5ICE A;  1H0M A;  2EJR A;  1C0W A;  1UFM A;  2A07 F;  3HSE A;  2QYO A;  3WGG A;  3ZMV A;  1MD0 A;  4Q48 A;  1G3T A;  4WF2 A;  4QWQ A;  2XHK A;  2M30 A;  2Q0O A;  4RB2 C;  3KET A;  5E18 F;  5DD8 A;  2QQ9 A;  3D5L A;  1ZGJ A;  5DCF A;  2GA2 A;  1I5Z A;  2DT5 A;  2RDP A;  1R5H A;  1LNW A;  3LFK A;  3RDI A;  2X4H A;  3BWG A;  2OA4 A;  3TO6 A;  1EH6 A;  3WE2 A;  5J8C A;  2GIV A;  4F7Z A;  1XN7 A;  1Z7U A;  1JHF A;  1T2K A;  4OMY A;  5LRS A;  4RB1 A;  1R1V A;  3P9I A;  1LEA A;  1IN8 A;  4CIC A;  3IKT A;  1FP2 A;  2V1U A;  3GEZ A;  2HTJ A;  1WKM A;  1R7J A;  2P5V A;  5H6R A;  1YFH A;  5CVR A;  1J75 A;  2XAG A;  1MDM A;  1YO5 C;  3JW4 A;  5K5R A;  4S05 A;  3F21 A;  4LLG F;  4R8H A;  2K27 A;  4IRI A;  2R7F A;  3MEX A;  4KA4 A;  4WK8 F;  5EEH A;  4ENN A;  3IRR A;  2E1C A;  3QU3 A;  4LJZ F;  2FA5 A;  2GQQ A;  3JSP A;  4Q47 A;  3KP2 A;  3HIF A;  2FQ3 A;  3W6K B;  1FSE A;  6PAX A;  1KU9 A;  2OZU A;  2ESH A;  2Q8K A;  1D5V A;  1S29 A;  4LB6 B;  1KA8 A;  4I0B A;  1SD6 A;  3Q5F A;  4LGW A;  3NQO A;  1YW8 A;  3N97 A;  2HFH A;  4HDU A;  3H3Z A;  2P8T A;  3GVA A;  3V8L A;  1T39 A;  4CXF A;  5FD6 A;  2YR2 A;  3L7W A;  3RKY A;  3LST A;  3KCC A;  1MZB A;  2FBI A;  3U1D A;  1B9N A;  4I0A A;  4WXH A;  2V1D A;  3CDH A;  2NAZ A;  3I59 B;  2PBI A;  1BI1 A;  2AXL A;  4Y13 A;  3FF5 A;  2GWR A;  4FX4 A;  3I4P A;  1OKR A;  4M9S A;  1HXD A;  3DPT A;  1A04 A;  2F2E A;  2RV8 A;  2MD5 A;  3P9K A;  1QBJ A;  4ENM A;  3V7C A;  1LDD A;  1B59 A;  1ON2 A;  3DF8 A;  2IA1 A;  1I1S A;  3D0S A;  4P96 A;  1BN5 A;  1QZZ A;  3RJP A;  2X0L A;  3QPT A;  2STT A;  2K7L A;  4LFU A;  4KMU X;  4WCG A;  3I53 A;  5HLG A;  1S8N A;  4GCV A;  3CUQ B;  3FM5 A;  3T8R A;  3T5X A;  2VT2 A;  1WRJ A;  4IPA A;  2IRF G;  4CDG A;  5HDK A;  2JTV A;  1F1Z A;  4IXA A;  2MA3 A;  4HAM A;  4AWX B;  2KRF A;  2L3D A;  2P5K A;  2RC4 A;  2FNA A;  4EVI A;  3TKY A;  1U5T B;  1HW5 A; 
#chains in the Genus database with same CATH topology
 3CUQ C;  4ZDL A;  1J09 A;  3WU0 A;  2F48 A;  1JKR C;  2NRA C;  5L3C A;  2R7D A;  4C2M J;  5TGT A;  3HOS A;  2V6C A;  1NK3 P;  4B1R A;  1ON1 A;  4GYI A;  5M5Y J;  4OIN F;  1WVR A;  4ZDP A;  1GXP A;  1HBX G;  2EZH A;  2XB5 A;  1D0X A;  3R0J A;  5CPR B;  2OTL I;  1IXS B;  4I01 A;  1YG2 A;  3K4B A;  3IH3 A;  5ICF A;  2L7M P;  2CO5 A;  1VQO I;  5B5E C;  5KVR A;  1X1D A;  3QOP A;  4EM0 B;  2XC7 A;  5EG0 A;  1U5T C;  3RYR A;  2L9V A;  2KP6 A;  2CW7 A;  3GF2 A;  4Y33 A;  4D9J A;  3UKG A;  2GXA A;  3GFM A;  4HF1 A;  3K1N A;  4IQJ A;  2M5W A;  2PMU A;  1TWC J;  2ISZ A;  3JTG A;  1FPQ A;  2EV6 A;  2R7V A;  1QO0 D;  3CO6 C;  2W24 A;  1Y0U A;  1K6O A;  3KZY A;  4XM3 A;  4HA8 A;  1B1B A;  1SAU A;  3TP0 A;  1YW9 A;  3DXJ F;  4FIS A;  3K1M A;  2VN2 A;  3WU2 C;  1Y0N A;  2F4O B;  4CCN A;  1RNL A;  4X6A J;  3HUG A;  3LSG A;  1N75 A;  1PJR A;  1OCZ H;  5FD5 A;  3GTP J;  2LVS A;  3LA7 A;  4C2U A;  3J7A Y;  1LB2 A;  1QHH D;  5LEJ A;  3H5A A;  3EUH C;  2WV0 A;  1I6X A;  2ZJQ F;  1K83 J;  3T0Y A;  1JKQ C;  5BNG A;  2R7R A;  5CQE A;  2HOE A;  1RR7 A;  5GAG J;  1PUF B;  3D5S C;  3E7L A;  4HEA 2;  3TL4 X;  5HLI A;  5FGM A;  1YW7 A;  3K6G A;  4HRI A;  3HRM A;  1DGW Y;  4A3L J;  1T08 B;  2K4J A;  4EQQ A;  1BIB A;  4M74 A;  3ZMZ A;  2DXI A;  2HPI A;  2YX4 A;  3KPH A;  2LH9 A;  5IYC J;  1W7P D;  3G4S I;  1LQ1 A;  1KZH A;  2L7Z A;  4BGD A;  2M0C A;  4A6D A;  5J4V A;  4XOP A;  4XON A;  1D1B A;  1YRN B;  5HNF A;  2TCT A;  5H6Q A;  3P5J A;  2ZXW H;  2H27 A;  4D0P A;  2EK5 A;  3EUH A;  3RKW A;  2LF7 A;  5EYR A;  1NH3 A;  1CF7 A;  3KEQ A;  4M3G A;  4UVC A;  4NC8 A;  3S3N A;  1BOB A;  3BR3 A;  3MKZ A;  1IJW C;  3ABT A;  1B6A A;  1FC3 A;  2L9S A;  2XAS A;  5IP6 A;  3ISP A;  1BIA A;  1AU7 A;  4ESF A;  3F23 A;  3ZMU A;  1H9G A;  3S32 A;  4AD9 A;  4BEH B;  2XV4 S;  1WFX A;  2VBW A;  3MZ8 A;  2Q2E B;  4OAZ A;  3F6V A;  4AM3 A;  1FYM A;  4HNV A;  1WJC A;  1JHH A;  3E5U A;  3GZ5 A;  2XKO A;  1VQL I;  2QQA A;  3LA2 A;  3OV8 A;  4I98 B;  2EV5 A;  4F55 A;  1XGN A;  4ESB A;  5FLX Z;  4DZP A;  3OYJ A;  3BT9 A;  5H20 A;  3DLA A;  4XIC A;  4DJA A;  4ZJZ A;  5B1A H;  1JE8 A;  2YUS A;  3OYM A;  2ECC A;  3GWZ A;  1BI0 A;  4MLO A;  2RVC A;  3G3Z A;  3ZQ7 A;  3SQN A;  3CJN A;  3A03 A;  5DM6 F;  1W4M A;  2BHY A;  4XRS G;  1LE8 A;  2BY2 A;  2CV1 A;  3VPR A;  1MJA A;  4UUS B;  2XRN A;  1IN4 A;  4EJW A;  3MCZ A;  3OOP A;  3KZZ A;  2VJI A;  1LFB A;  3SEQ A;  2CFX A;  2AQE A;  2DA5 A;  4PUS A;  1Y8R B;  2EFQ A;  2MW8 A;  4XSZ F;  2WAQ N;  1JT0 A;  3LSH A;  1REP C;  2F5F A;  4M6X A;  3HHH A;  1FYK A;  3E5Q A;  4AID A;  1YIO A;  3GO5 A;  3MZY A;  4PK4 A;  2R7Z J;  5HVQ C;  2R3S A;  1YIT I;  4QSH A;  4EJU A;  2K4B A;  4Y3O A;  5AON A;  2DO7 A;  1FNN A;  3MQ0 A;  3T1B A;  2LR8 A;  2DFE A;  3ZGK A;  1B72 A;  2GM4 A;  1R5G A;  1WPK A;  1TW3 A;  2MGQ A;  1T98 A;  2IBD A;  4LG0 A;  1MBK A;  2JQ7 A;  3BRO A;  3CCL I;  2L5Q A;  1I27 A;  1XX5 A;  3AAF A;  2Q2E A;  4FTH A;  3S1N J;  2P81 A;  4D1Q A;  2FU4 A;  4ASN A;  3FXJ A;  1EH7 A;  4LLN A;  2CMP A;  3RQ4 A;  3M8F A;  2L02 A;  5GAD J;  2QSG X;  3KE2 A;  2KZG A;  4ZYD A;  5CVJ A;  3PQJ A;  2UWM A;  4ZYH A;  4QTR A;  3LNQ A;  2V79 A;  1EKE A;  1H8A C;  1FEX A;  4PCQ A;  3MAJ A;  2FBK A;  2VOO A;  3KLN A;  1XTA A;  5JHU A;  1ZQ3 P;  1VQ6 I;  3ZXS A;  3CC4 I;  1UG2 A;  3JRH A;  4BY7 J;  1Z6R A;  1R58 A;  1WH5 A;  2F5C A;  4XID A;  2MH9 A;  1MMN A;  3AG1 H;  5IT9 K;  2A68 F;  1ZKG A;  3FXM A;  3HTS B;  1TQM A;  4JYK A;  4U88 A;  2LKS A;  4PFO A;  4L5I A;  1N77 A;  3GTM J;  3T8T A;  4Y4R A;  2M9H A;  3M8J A;  2F5V A;  4G6D A;  4EMS A;  2O0Y A;  1BBY A;  3FWE A;  3J81 Z;  5KHD A;  4IL6 C;  3V8K A;  4IHY A;  1TL8 A;  2JA7 J;  2RRE A;  3BP8 A;  3U2R A;  4AC0 A;  5ERI A;  4YIF A;  4MQV A;  5TIS C;  2X1C A;  1Y6I A;  3M4O J;  1F9N A;  3I64 A;  2K86 A;  4XSX F;  3M1E A;  1Z1D A;  3L1P A;  1MMD A;  3VOE A;  2LOO A;  3RZO J;  1R1T A;  2MLG A;  1T8I A;  5F64 A;  5IY5 H;  4UY8 I;  2BW3 A;  3NRV A;  4BAC A;  2Y2Z A;  4LD5 A;  4KNY A;  3BY6 A;  4LIV A;  3BG5 A;  4TV7 A;  5E17 F;  1AA7 A;  2FE3 A;  2FX0 A;  3MFK A;  5C44 J;  1BM9 A;  2YSR A;  3HOU J;  4M73 A;  2CW0 F;  3JRI A;  3OIO A;  5FB2 A;  2VE9 A;  3HOZ J;  3S8P A;  1M1E B;  3PUF A;  3IWF A;  1CQT A;  2X51 A;  1D1A A;  1U8R A;  3J7A O;  2NNY A;  3FMQ A;  1CGP A;  3ABK H;  2AHQ A;  4BQO A;  5LHH A;  2JSP A;  1WJD A;  3CF2 A;  5LLQ A;  4IJA A;  1K4T A;  2IS4 A;  2DA4 A;  5M5W J;  1TC3 C;  3H5R A;  1P2F A;  1ETQ A;  2W85 A;  3GBG A;  4J19 A;  1WGX A;  2H1L A;  4UUT A;  4ON0 A;  3H0D A;  1NTC A;  4BDZ A;  4PJL A;  2MH2 A;  2EWN A;  1XSV A;  3QU6 A;  2B0L A;  2NS0 A;  2XAH A;  1UB9 A;  2COB A;  2TDX A;  4C30 A;  3WE3 A;  3FMR A;  2DYR H;  1Z67 A;  3DU5 A;  5FLM J;  1IG7 A;  3FHN A;  2NOJ B;  3HSF A;  1U2W A;  1LDK B;  2MC3 A;  2YPR A;  1QVT A;  2DLL A;  4AVZ A;  1GUU A;  4OAY A;  5E3N A;  1J2X A;  4O3M A;  1O4X A;  3J7Y J;  3DQV C;  1DPU A;  1F43 A;  2LLK A;  3QRF F;  1F4K A;  3V7S A;  2F5D A;  2F6C A;  4F3Q A;  5TRD A;  4MFD A;  5E8I A;  2DYS H;  2XAJ A;  2LF8 A;  3ERE D;  2FNP A;  2Y9Z A;  1IXC A;  2LDU A;  4IZZ A;  2XAQ A;  3TGN A;  4D5C A;  2D2W A;  2LRE A;  1JTY A;  4E4H A;  2ME6 A;  1MJB A;  4N0B A;  4G9Y A;  2CUZ A;  5E1W A;  3E1S A;  1E0E A;  4A69 C;  2R7O A;  1FP1 D;  4GRI A;  4BXU A;  2CQK A;  1TWH J;  5EEG A;  2CV2 A;  4KDP A;  2R7T A;  1GDT A;  4OIQ F;  3KEO A;  1A6Q A;  2IS6 A;  2PJP A;  2VON A;  2MAB A;  1LKX A;  3DTK A;  3JRB A;  3GTL J;  5GP9 A;  3LA3 A;  5FKK A;  3ZQH A;  1TP4 A;  4E70 A;  5E20 A;  2ZFW A;  3IRQ A;  5J4Y A;  4KT5 C;  1PVE A;  5K7Z A;  3UR3 C;  4DBR A;  2FQ4 A;  3WTS C;  3CD6 I;  4BXX J;  2Y75 A;  1T95 A;  3OR1 C;  1HLV A;  1XGM A;  2BBY A;  2HVQ A;  2HEO A;  2OBP A;  4ZYG A;  3S16 J;  2EFO A;  1HKT A;  1VQ8 I;  1WI3 A;  4C3J J;  3GFI A;  2EV0 A;  5E79 C;  1F36 A;  2XGE A;  2V1N A;  1I3Q J;  1OIS A;  1QZY A;  4OMZ A;  1W5S A;  4A0X A;  1SAX A;  1BC7 C;  5CYV A;  2EIL H;  4HST A;  4M3B A;  2IGO A;  3QP6 A;  3WG9 A;  5HOO A;  4HV6 A;  3Q9S A;  3ZMD A;  2H6C A;  4HNU A;  2BYV E;  3AG3 H;  3Q0V A;  5BOX A;  3A01 A;  2DK8 A;  5BS6 A;  1IO2 A;  2BOL A;  4PDK A;  2HTS A;  3R60 A;  4ZH4 F;  3ZRG A;  1ZAO A;  1JJ8 C;  1H9T A;  2HYJ A;  2WV1 A;  1VI0 A;  2VC1 A;  1E17 A;  3NWS A;  3WHB A;  1VQ5 I;  4WXC A;  1YI2 I;  3SZG A;  2W84 A;  3DEU A;  2HR3 A;  2VJ5 A;  1FIP A;  2XSJ C;  4CA0 A;  2K40 A;  1Z9C A;  2J5P A;  3DWL E;  2VOD A;  2XIG A;  3KP4 A;  4OIR F;  2W7N A;  1PP8 F;  1SFU A;  5DYM A;  2XDV A;  4LLL A;  3VYU B;  3I55 I;  1MKM A;  2XF7 A;  4AUX A;  2JPB A;  5H2F C;  2KIM A;  3KP3 A;  1ULY A;  2YX7 A;  4BXF A;  4E7S A;  4BE2 A;  2DA6 A;  3SEZ A;  3M7G A;  2LY2 A;  4N9H A;  4B48 A;  3L2Q A;  1U6G A;  3I5U A;  2FBH A;  3O6B B;  2L4M A;  3F3X A;  5FKO A;  3RYP A;  5E3M A;  3IC7 A;  2QF7 A;  1KQ9 A;  1LVA A;  2WBM A;  1YQA A;  2HI3 A;  2VB6 A;  2B7E A;  5DUK A;  2RNJ A;  1FZP B;  3ZPL A;  1POG A;  3VYT B;  1YS6 A;  2K9N A;  2JPC A;  1DUX C;  2QSH X;  4G7H F;  3N05 A;  3BZC A;  2JVH A;  1FBQ A;  2HYG D;  3CZ6 A;  1YOV B;  2BEO A;  4HYE A;  2CQ7 A;  1XCB A;  2IGK A;  2M3A A;  3QPL A;  2RKH A;  2W25 A;  3CDI A;  2PFB A;  3J80 Z;  1UST A;  5ILS A;  5FFZ A;  5DTD A;  3GX4 X;  4UB6 C;  3S15 J;  4Z6Y A;  1ZYR F;  2EB7 A;  4XL9 A;  1S7A A;  3I58 A;  1SVL A;  4L0Y B;  2DTR A;  5M3M J;  1QZE A;  1TW2 A;  2Y69 H;  3E97 A;  3LOC A;  3RCO A;  9ANT A;  3B73 A;  3F9K A;  2A61 A;  2M8E A;  4ITV A;  4CCO A;  2LKX A;  3VYS B;  5EF6 A;  3FIW A;  5FRN A;  1A36 A;  4B4C A;  4FAS D;  1Y1V J;  3VSL A;  3MKW B;  3DPL C;  1ZG1 A;  4EJT A;  3DTI A;  2CJJ A;  5HNH A;  2HYF A;  2UXN A;  4HG2 A;  1XMK A;  3A1Y A;  4JBA A;  4XN0 A;  3SFZ A;  4BUP A;  2CQQ A;  2GXB A;  4KIS A;  3SYT A;  2M2E A;  4Y15 A;  5EJC A;  3CDL A;  3GW2 A;  1B8I A;  1OYW A;  4BHP A;  5IPA A;  3OYD A;  2FJ1 A;  4A3M J;  3FK6 A;  5ILU A;  4FE7 A;  3TOA A;  4BY1 J;  2D5V A;  2DAO A;  2K9S A;  2O61 A;  4HQE A;  2IAI A;  4A0Y A;  5DUI A;  4ZTF A;  1HKQ A;  1XPX A;  4EGZ A;  3GFL A;  2EQR A;  2YU3 A;  2H6B A;  3U1K A;  1D8J A;  3ELK A;  4FT8 A;  1ZHF A;  5JR3 A;  1KU3 A;  2QA4 I;  1R6R A;  1Z7L A;  2EIM H;  4RLQ A;  3U9G A;  2E5Z A;  1FMV A;  2F4I A;  1G6N A;  3FZV A;  2TRT A;  1XD7 A;  3V8J A;  4UHT A;  2IXS A;  4IRH A;  1VQ7 I;  2K02 A;  2CS3 A;  4HZF A;  4UXN A;  1ZRF A;  2VAS A;  2RQQ A;  3D1N I;  2BGC A;  3HOX J;  4CYC A;  2A05 A;  2RN7 A;  3ECH A;  3OY9 A;  2K9M A;  2V9P A;  3C2G A;  5HDG A;  3LAJ A;  5J1R A;  1O7F A;  3G1O A;  1MNM C;  2V4J C;  2M8G X;  2QEN A;  1W7P B;  3I59 A;  4U7B A;  1R00 A;  3K10 A;  1IN5 A;  3KYC B;  2P7C B;  3CCU I;  2ZCW A;  1BW5 A;  2X9D A;  3HKZ A;  4DNC A;  5TJJ A;  4E7Z A;  5HS9 A;  1XDU A;  3LSI A;  1AKH B;  4L5E A;  2X1D A;  1K61 A;  3BZ6 A;  2X6O A;  5DCM B;  1JKO C;  3K9T A;  4UVA A;  1S5L C;  2DK5 A;  3MZH A;  2HZD A;  4JQF A;  2CUE A;  2Z1D A;  5J47 A;  1HW2 A;  1KU2 A;  3FKI J;  3VDX A;  3H9J A;  1R5I D;  2WA0 A;  3OSF A;  1BC8 C;  3GYH X;  4X1E A;  4M6V A;  2BV6 A;  5JVG F;  2CSO A;  1LUJ B;  1ZG5 A;  2AQF A;  3DBL B;  3GLX A;  5FFX A;  5D5V B;  1ZLJ A;  3A0B C;  1RES A;  2QGU A;  3K0L A;  3S3M A;  1DU6 A;  2DFF A;  1X3W B;  1Z6T A;  3L2C A;  1ETK A;  2QWW A;  4WXD A;  3KP6 A;  4G7Z F;  3GFJ A;  2BHZ A;  2FSW A;  2LNB A;  4G6Q A;  4NDL A;  4BJT A;  1OR7 A;  4DYQ A;  2FRH A;  4GFB A;  2Y0S N;  2EA2 A;  3RSN A;  1WQ2 A;  3OS2 A;  1JTX A;  3OL3 A;  1Y39 A;  4IHS A;  2CH0 A;  2JWT A;  1DP7 P;  1IN7 A;  3BG6 A;  2PMH A;  3RI4 A;  1ZRC A;  3DEW A;  1ETV A;  2KFD A;  1L0O C;  3DV8 A;  4PSW A;  3M3Y J;  3K2A A;  4XOT A;  1R22 A;  4L9V A;  3I9V 2;  1P9Q C;  1KYZ A;  2EBI A;  5BPI A;  3CUQ A;  3HRU A;  4L9J A;  2R7W A;  2O7O A;  2A3S A;  4CSW A;  4XR6 A;  3I71 A;  3HYI A;  4CYD A;  4I2O A;  1UG0 A;  4P1W A;  4IQ4 A;  2KIQ A;  2LBF B;  4S04 A;  1K78 B;  1DPR A;  5B1B H;  2DOE A;  3WU1 B;  1LDJ A;  2PMZ N;  1KON A;  1Z21 A;  3C18 A;  5CQG A;  2GLO A;  3HOV J;  5DCM A;  2DU9 A;  1JT6 A;  4BS9 A;  3HM5 A;  3OMY A;  5HLT A;  1Q1V A;  1H88 C;  3ABM H;  5DV5 A;  4R1H A;  2DMT A;  1ETO A;  2GBY A;  2VE8 A;  3BTJ A;  3IKV A;  3OYA A;  3JR9 A;  2KJC A;  2HDC A;  3H3V K;  2WB1 A;  1U5T A;  2M87 A;  5ED4 A;  2JA8 J;  5BMZ A;  3GXO A;  3HPH A;  1E3P A;  1WWX A;  1P6R A;  4D7M A;  3CCE I;  4GO1 A;  3P9C A;  4XLC A;  1SD7 A;  2V1X A;  2DDB A;  1O3Q A;  4XRF A;  1I6H J;  1J0R A;  1TNS A;  1T6S A;  3LMM A;  4RBO A;  2HDD A;  2OF7 A;  4A6E A;  1K4S A;  4AIH A;  3SZP A;  3OS1 A;  4J00 A;  2BVM A;  2AO9 A;  5D5X B;  1X19 A;  4BQA A;  3F72 A;  4FQG A;  2KZV A;  4IVN A;  2XKP A;  2Y30 A;  3M9A A;  4J01 A;  3CO7 C;  3Q9V A;  2CV0 A;  2O3F A;  2STW A;  1A6I A;  4E7L A;  3DLL F;  3S2H J;  4OWR B;  2X48 A;  3KEY A;  1Z3Y A;  4YG2 F;  1L3L A;  2M0M A;  3GZN B;  4HBL A;  4CZZ A;  2D45 A;  1X1A A;  3NAU A;  2IA0 A;  3EPZ A;  2OPT A;  4G7O F;  3VYR B;  2A6E F;  2PN6 A;  2LBF A;  2CQN A;  3CCR I;  1SFX A;  3OOU A;  4DYC A;  1B9M A;  2FEZ A;  4HPQ A;  2LC2 A;  3H3U A;  3F8F A;  4BAY A;  2DA7 A;  3RIR A;  1WI9 A;  2DJN A;  2H8R A;  1EA3 A;  1QNT A;  4H4K C;  1IN6 A;  4NHJ A;  3C3W A;  3AG2 H;  1W5C C;  1MJ9 A;  1T0F C;  1OCT C;  3M8E A;  3E6C C;  1UHM A;  1JUP A;  2QQ8 A;  2R7U A;  3QYF A;  1GHC A;  1O3S A;  4AYB A;  1V5G A;  2V9V A;  1SEU A;  4NC6 A;  1IAW A;  1HSJ A;  1OCR H;  1PUF A;  5JLW A;  1IW7 F;  1JUS A;  2DW4 A;  4E6K G;  1MMA A;  3ZN0 A;  2W48 A;  1SVO A;  2Q1Z B;  3JAM Z;  1IRF A;  1JGS A;  3HHG A;  1VQ4 I;  3V7R A;  2GAU A;  3GTO J;  5KNL A;  4V19 K;  3S2D J;  2OTJ I;  4HF2 A;  1WJ5 A;  3DP7 A;  4F92 B;  1QQI A;  4N4O B;  3WOD F;  1YRN A;  5J8F A;  2PJR B;  4RGX A;  1UJ8 A;  4ENJ A;  1G3Y A;  4ETS A;  3TP3 A;  4PJ0 C;  3QP5 A;  2ESN A;  4HX8 A;  3ONQ A;  3FIS A;  5HDN A;  2M34 A;  3OL4 A;  5JFR A;  2P4W A;  3RPU A;  1Y8Q B;  5CLS A;  3F6O A;  3W6J B;  1WCM J;  1ZRE A;  4M9X A;  3KIO A;  3DCF A;  5ICG A;  3IH4 A;  3J81 K;  2R5Y B;  3I56 I;  2VKD A;  1FIA A;  3H9Q A;  1S72 I;  4BEH A;  1N25 A;  5A2Q Z;  1GT0 C;  4BH9 A;  2VXZ A;  5LEK A;  5D6F A;  2HGC A;  4RGU A;  2JUG A;  2M7A A;  5LGU A;  3AL0 B;  4BBS J;  4NQW B;  4E7I A;  3BG3 A;  3TBI A;  2ZME B;  2QBY B;  2JA2 A;  4A3E J;  5FKL A;  2HQN A;  2JZY A;  2H94 A;  4C3I J;  3H92 A;  2XPU A;  4XKC A;  3MKY B;  2RGV A;  1HQC A;  5EGO B;  3L2V A;  4KMF A;  3BPX A;  1P92 A;  2ID3 A;  1LVK A;  4EM2 A;  4ZYE A;  4HLX A;  2ZKZ A;  4V2G A;  1FBU A;  3G1L A;  3JRC A;  2VQL A;  1S7O A;  4GXO A;  1Z91 A;  4RGR A;  4BE0 A;  2P5L C;  4LG3 A;  3DU6 A;  2OQR A;  2HXO A;  5D6E A;  4AIJ A;  3E0J B;  1GVJ A;  4UUS A;  3PNY A;  3SDG A;  2X1E A;  1V3F A;  3B6A A;  1TWF J;  4HX7 A;  1VQN I;  5HS7 A;  3L00 A;  2DFH A;  2FML A;  1JUM A;  1D3Y A;  2KDZ A;  3AL0 C;  4C3H J;  2VOP A;  4MTE A;  2ZME C;  3JRG A;  5DDG A;  3DPU A;  1USS A;  1G2H A;  2JSC A;  1J7K A;  4RAF A;  1Z77 A;  2XGX A;  5E8G A;  2WAE A;  3WTW C;  3OYE A;  3GLL A;  2LD5 A;  2E19 A;  1T33 A;  3G73 A;  2E2H J;  1IUY A;  1BR1 A;  2GXG A;  2ICW G;  1VTN C;  4F93 B;  1XGS A;  4GYG A;  3KYD B;  2VLA A;  3CCQ I;  1RET A;  1ZK8 A;  4ABZ A;  4UV8 A;  5K5O A;  4L18 B;  4XLA A;  2Z33 A;  2N8G A;  3BJO A;  3FM3 A;  4EGY A;  2CFO A;  4H0E A;  1RR8 C;  1BI3 A;  4LOC A;  5K7H A;  2KMU A;  1VFC A;  4A12 A;  2CW8 A;  1XMA A;  3K4M A;  4UV9 A;  3ZQC A;  3TED A;  2Y0S A;  2C6Y A;  2KRH A;  1ORK A;  4HOB A;  5GAE J;  5EZH A;  5ICC A;  5JVT A;  2IS2 A;  1X3Z B;  3K2Z A;  1QA6 A;  1AHD P;  4MTD A;  2M7B A;  2V6E A;  1TTY A;  3H1C A;  4M3E A;  4QPO A;  1X1B A;  1UHS A;  4AIK A;  3F8B A;  1W1W E;  2VI6 A;  3ESW B;  2WY8 Q;  2GA1 A;  2XGD A;  2VKH A;  3JRD A;  2YU9 J;  2VXD A;  3QOD A;  3LSR A;  1E3O C;  3K4K A;  5IOY A;  3EQL F;  2CG4 A;  2NVQ J;  1IC8 A;  2WTE A;  3KP5 A;  4NB5 A;  4XLP F;  1FMW A;  1OLT A;  2EZI A;  2PG4 A;  4R79 A;  5K5Q A;  1T38 A;  1VQP I;  2VPL A;  3KP7 A;  4IHT A;  1FX7 A;  1JJ6 C;  1X2M A;  2B9S A;  1BI2 A;  2XF6 A;  5E3L A;  1DQU A;  1R4N B;  1D0Y A;  2DMQ A;  3BCB A;  3L9F A;  3SDB A;  1FOX A;  2DOD A;  2G0E A;  1YYV A;  1UEL B;  3HGG A;  2ZC2 A;  4G12 A;  4DQ2 A;  2Z2S B;  4NNJ A;  1UCR A;  4XKV A;  5JI6 A;  1DGR M;  3DKY A;  5KCM A;  2VC0 A;  3RPQ A;  5GAH J;  3PQK A;  3BLY A;  3CCM I;  2KIU A;  1XB4 A;  5FJ8 J;  3HDD A;  4LB5 A;  3CJQ B;  2LKP A;  1J9I A;  3SZT A;  2A5Y B;  3CCJ I;  1U0J A;  2HXI A;  4A3D J;  1VQM I;  1W5T A;  4Y17 A;  2DOA A;  1X1C A;  4HF0 A;  4UVB A;  5B66 C;  1OJL A;  2MLK A;  4W97 A;  3WTX C;  2R5Z B;  2VBZ A;  2EPF A;  4PJN A;  1MND A;  2WC2 A;  4LIU A;  3LFU A;  3JSO A;  2O8X A;  4LIT A;  2E36 A;  4M71 A;  4FX0 A;  3DFG A;  2ZNZ A;  4O6J A;  2L9N A;  1TNT A;  1QPM A;  5K7F A;  4B43 A;  4JX6 A;  3DBR B;  3C7J A;  1MDM B;  1LFP A;  3G2B A;  2QLZ A;  3H5N A;  3CME I;  1PUE E;  4M9Z A;  2DQL A;  2W00 A;  3R0A A;  3BQZ A;  3OR2 C;  1FOW A;  1WJF A;  2E7X A;  3ZMS A;  1ZGW A;  2PX9 A;  2VJ4 A;  3OWT A;  1E2X A;  3W2W A;  1ETW A;  4ZYA A;  3HTU A;  5J1U A;  2WY7 Q;  3FXU A;  1R71 A;  3UNG C;  1WHU A;  3NWT A;  3F8C A;  3F8M A;  4MIM A;  1KYW A;  3RQI A;  1EH8 A;  4IKF A;  2I5U A;  2ZXJ A;  4ZZL A;  2DMU A;  1QVU A;  4HLY A;  4WX9 A;  4GGG A;  5HS8 A;  1TZL A;  3WGI A;  2QZ8 A;  4NBQ A;  3VB2 A;  4YRV A;  2JK3 A;  4Q5S F;  3HBL A;  2E1O A;  2FD5 A;  1OMI A;  1VQ9 I;  2X85 A;  3L2W A;  5IT3 A;  5FO5 A;  5DM7 F;  2DCE A;  5D8L B;  2BY0 A;  4FHT A;  5LRR A;  4BJ6 C;  3W6V A;  4L0Z B;  1OCO H;  2VJJ A;  3J80 K;  4JK1 X;  3IHU A;  3QQA A;  2ZJP F;  4HDV A;  2YS9 A;  3N4M A;  2EFP A;  2ZSI B;  1O3T A;  2A6T A;  4BL0 B;  1XSX A;  4BQN A;  4MEY F;  2UXX A;  3LWF A;  4OOI A;  4D7N A;  2VQC A;  4U0V A;  5K1Y A;  5D8K B;  2DA1 A;  3SHF A;  4WWC A;  1K79 A;  1MBE A;  3SJM A;  1IZ1 A;  2K9L A;  4NC7 A;  3HOW J;  1OCC H;  4KIC A;  4CCJ A;  2ETH A;  1WSU A;  5D5U B;  2QSF X;  4FET A;  1H89 C;  1W0T A;  2OD5 A;  2E2I J;  3WTV C;  4PJJ A;  2VKV A;  1U78 A;  2WAQ A;  1FYL A;  2Y48 A;  2OCE A;  5C3E J;  1IRZ A;  2EH3 A;  3WTZ A;  1ZEL A;  1BA5 A;  4YII A;  4O5V A;  4G8X A;  2E1N A;  4QLC U;  2ID6 A;  2L7K A;  3F22 A;  1RKT A;  2G7H A;  3E5X A;  2GZW A;  4XLH A;  4DGW B;  2XUB A;  4EM1 A;  3PL8 A;  3A2K A;  1Z05 A;  1LPQ A;  4KN4 X;  3OYK A;  2DPD A;  4XMY A;  3CLQ A;  3IV5 A;  5FRM A;  2ZJ2 A;  3CMM A;  1RZ4 A;  5B3S H;  1SD5 A;  4B8X A;  4CCL A;  3COA C;  1SFE A;  2MBF A;  3CCY A;  3HXL A;  1RC9 A;  2EZL A;  1DDN A;  2NXN B;  1HOM A;  1FBS A;  4A93 J;  2GOX B;  3D5R C;  1MW7 A;  1VND A;  4QIW N;  3HL2 A;  2OQG A;  2AS5 F;  3ABU A;  3HEF A;  1DU0 A;  1UZC A;  2O03 A;  3RTR A;  2DTZ A;  4OIP F;  3S3O A;  1P4X A;  1SAN A;  1U9N A;  2WWY A;  3EYY A;  3KFW X;  2QKL B;  5F0F A;  1ERD A;  1SVM A;  2IT0 A;  3VSK A;  1V55 H;  3BPV A;  1BW6 A;  2Z3Y A;  2PI0 A;  1AOY A;  1GV5 A;  1S3J A;  1RUN A;  4A3B J;  4N4N B;  5L3G A;  2NYX A;  3FXK A;  2F4M B;  2DT6 A;  1W36 D;  4G94 A;  5F6F A;  4JP0 A;  3LQR A;  1P7I A;  2QVO A;  1Q1H A;  4EJO A;  4KIT B;  5DD4 A;  2E35 A;  1MIJ A;  2F5E A;  4IHV A;  5L3F A;  2CUJ A;  1A35 A;  5CVV A;  4B3A A;  5M3F J;  1SFO J;  1U3E M;  2K5C A;  2GIZ A;  4A3G J;  1ZH5 A;  2Y0M A;  2EA4 A;  2FMY A;  4RB0 A;  4XBF A;  4KIF A;  4YFK F;  1HW1 A;  3W2V A;  4HX4 A;  1O57 A;  4IRG A;  1WZ2 A;  2H1K A;  5E1Z B;  4ZDO A;  2HVS A;  2KIF A;  3OYC A;  3Q0W A;  3FKJ A;  3L2R A;  1EV7 A;  3NEU A;  2MC4 A;  4C9Y A;  3IP4 B;  1O3R A;  4A3C J;  3CCS I;  2L4A A;  2JT1 A;  1S7E A;  2XSD C;  3E6B A;  3IL2 A;  2Z16 A;  2LG4 A;  2HS5 A;  4M6Y A;  3RZD J;  2KJB A;  1ZR4 A;  4L9T A;  2RQP A;  2DOF A;  1SC7 A;  1IGN A;  3R6S A;  1I39 A;  2D1H A;  1ODD A;  5LBQ A;  1TQI A;  3Q3S A;  3QAH A;  2DQR A;  2ISY A;  2CYY A;  3WTU C;  1YJN I;  2IEK A;  2KLO A;  2IVM A;  2ELK A;  2OU2 A;  1FT9 A;  4RAG A;  2O8K A;  2LRD A;  1HCR A;  4KUM A;  4P55 A;  1IXR C;  2O9L A;  3FX3 A;  3TW6 A;  2GOM A;  1F5T A;  2OV7 A;  1U8B A;  3FHZ A;  2PLY A;  2IA2 A;  4N9I A;  4BQQ A;  3CQZ J;  4ZTJ A;  2BE5 F;  1X2N A;  3ECO A;  2Z99 A;  4YEJ A;  5HLH A;  1OPC A;  4ENK A;  3ZP5 A;  2NVY J;  1TQP A;  2O5R A;  5LGT A;  5EG0 B;  1NG6 A;  3BDD A;  1MBG A;  1ZRD A;  3DKW A;  3PM1 A;  4HQM A;  1P7J A;  3L09 A;  3QPH A;  3VEP A;  1AWC A;  3K69 A;  4U0Y A;  2ZNY A;  3S1Q J;  2EFN A;  3OIQ A;  4EV0 A;  3WTT C;  2P6S A;  1MGT A;  4PZJ A;  2DPU A;  3Q0U A;  4W1U A;  5GTI C;  2IS1 A;  2G9W A;  4KIG A;  4RAZ A;  1XSD A;  1BR4 A;  5C4X J;  3R4K A;  4CCM A;  4CGZ A;  5KK1 A;  3GTQ J;  3AFH A;  2XAF A;  1ONV A;  5D4S A;  4UNO A;  3K4N A;  2XB0 X;  4BKX A;  4II3 A;  1D8K A;  5D5W B;  3PO2 J;  2NS7 A;  2BZT A;  3OYI A;  2DBB A;  4LMY A;  5LHI A;  3GME A;  3ZQL A;  1DP3 A;  1OQY A;  2H8W A;  1OYI A;  4CCK A;  2UZK A;  2VBY A;  4G6T B;  3BJA A;  3BG7 A;  3MKL A;  3PJR A;  1XMX A;  2LMD A;  2COM A;  1K7A A;  3O3K A;  3FK7 A;  5GPA A;  3VFZ A;  1FLI A;  3DEE A;  3JRA A;  4B09 A;  1IF1 A;  2IJL A;  3ULQ B;  2G7U A;  1MMG A;  5EZG A;  3F8N A;  3H9G A;  5L3E A;  3E6D A;  5KAF C;  1VQK I;  2HQ5 A;  3EDP A;  4CHU A;  1JXS A;  3ZQG A;  2QM3 A;  3FXQ A;  5F08 A;  4BHC A;  1XS9 A;  1OCP A;  1W7P A;  4RAY A;  4RM2 A;  4DIQ A;  3OYH A;  1R23 A;  1GXQ A;  2O6G E;  1J5Y A;  3HJE A;  2OZ6 A;  1GVD A;  3B02 A;  1BOA A;  2CRG A;  4KFC A;  1AKH A;  1SMT A;  4KIB A;  1XDS A;  1D0Z A;  4OIO F;  1IRG A;  3WTY C;  4IF4 A;  2FOK A;  1Z3X A;  2VQG A;  2XVC A;  4EJV A;  1FOK A;  2A6H F;  1CF7 B;  3EYI A;  4I02 A;  3CJR B;  3IWZ A;  1PDN C;  1HDD C;  1YJW I;  2JRT A;  3JTH A;  4UUV A;  4CUG A;  2QCO A;  3S17 J;  1MMS A;  2LY1 A;  4K2E A;  4M3D A;  3O2P E;  1G3W A;  2VL8 A;  2VQH A;  1ETX A;  1YTY A;  5LHG A;  3I0T A;  4E7J A;  3G71 I;  2B63 J;  3B6C A;  2KHM A;  1MSF C;  2IP2 A;  1HDP A;  5CKT A;  4BNC A;  2PQ8 A;  2EIN H;  5FLX K;  2DN0 A;  5J40 A;  3GTG J;  4XLE A;  1UHW A;  2HQR A;  2ZSH B;  4HV5 A;  1S6L A;  1LFU P;  4L9N A;  2V7F A;  1FTZ A;  5CVU A;  3X2Q H;  2IPQ X;  3PIP F;  1RPW A;  4GDF A;  1YX5 A;  1YLF A;  5BQT A;  3C2H A;  1JKP C;  4PGH A;  5F1R A;  2UV1 A;  2XRL A;  3JAM K;  5J6X A;  1PP7 U;  4CO8 A;  3CJT B;  3BJ6 A;  3I3L A;  4BHB A;  1BJZ A;  2LK2 A;  4M72 A;  1HC8 A;  2WAD A;  2HOS A;  1XG1 A;  4A3K J;  2WAF A;  2M4K A;  4YFN F;  1LE8 B;  1ZN2 A;  2XRO A;  3SXY A;  3K1P A;  1WJB A;  3HRS A;  1FSH A;  3MVP A;  3BOQ A;  1K78 A;  2DT7 B;  1STZ A;  1SMY F;  3HC7 A;  2W57 A;  3GTK J;  2ZO4 A;  1D1C A;  1MBF A;  2XF5 A;  3S2W A;  3BCA A;  1X3U A;  3PFI A;  5C4J J;  5BPD A;  4MO7 A;  1VF9 A;  4IEJ A;  1GLN A;  4I09 A;  1RRJ A;  4B44 A;  3KZI C;  4II2 A;  2M45 A;  2P6T A;  1G59 A;  1QHG A;  1IDY A;  2NNN A;  1LJ9 A;  2W82 A;  1KGS A;  3GZ6 A;  4QPQ A;  3BTL A;  3ASN H;  4MNU A;  5AIQ A;  3EET A;  5A2Q K;  2KDO A;  3H35 A;  2QQB A;  3CTA A;  2HOA A;  1RIO H;  2E5N A;  2HKX A;  1B72 B;  1PYV A;  4P9U A;  4LG0 B;  3TDZ C;  1KU7 A;  3REO A;  1FJL A;  1MSE C;  4XLN F;  1QPI A;  4XK4 A;  3HRT A;  2HZT A;  1FWZ A;  2Y9Y A;  2FXA A;  1R1U A;  4BYY A;  1R49 A;  2DA3 A;  2KL4 A;  2HWV A;  4KT6 A;  5CVI A;  1RI7 A;  2VBX A;  1YJ9 I;  2K9Q A;  4A5M A;  4DBQ A;  3ABL H;  2IW5 A;  3CLO A;  4ZZD A;  1T0F A;  1FY7 A;  3E3V A;  3MN2 A;  2CGP A;  3JRF A;  2ACJ A;  2R7X A;  1BJA A;  2HVR A;  2JA5 J;  2L54 A;  1Z0X A;  3FMS A;  1O7L A;  3ZQI A;  2H09 A;  3C1D A;  3ML6 A;  1TT0 A;  1TT5 B;  2HQA A;  5FKM A;  4RB3 C;  2A5W A;  1I3A A;  3TDU C;  3ZOB A;  5FLV A;  4I7H A;  1V5E A;  2JRM A;  3P7N A;  4U0W A;  4RMN A;  2Z5U A;  2K85 A;  4E7H A;  2LFB A;  3H0G J;  3PNT A;  3QOE A;  2V26 A;  3PSI A;  4HNT A;  1TWA J;  2A69 F;  2ZBK A;  1V4R A;  3PO3 J;  3LQQ A;  3GUD A;  3BR0 A;  3KLO A;  2DI3 A;  4HSR A;  4C2T A;  1YS7 A;  3K4J A;  3ZCO A;  3RKQ A;  3I54 A;  5KAI C;  1I1G A;  1G3S A;  3E6M A;  3OS0 A;  2E1M B;  3L2U A;  3CUO A;  3R61 A;  2HKO A;  1NHA A;  1U9O A;  4AVP A;  3ROU A;  3CC7 I;  3HOY J;  2BW3 B;  4L5J A;  1ETY A;  3HOT A;  4U7D A;  4A5N A;  2JJ7 A;  1MBJ A;  2JN6 A;  1RKW A;  1XCV A;  3FXL A;  2BY1 A;  1HKS A;  4OU0 A;  4P9F A;  1X1P A;  2ME0 A;  4KYW A;  4RM3 A;  3K4C A;  4RGS A;  4YFX F;  1EF4 A;  3ERM A;  1YHQ I;  2ZFU A;  3V4G A;  1RUO A;  1R36 A;  3IUO A;  2KPM A;  3MWM A;  4RS8 A;  2QUF A;  4FCY A;  2PJR A;  3VWB A;  2LTP A;  2E7W A;  4X0G A;  3F0C A;  1V54 H;  5M5X J;  4MEX F;  3IAM 2;  2NS8 A;  5E1X A;  2M1B A;  2BXY A;  2KKO A;  2E1M C;  4JX4 A;  5F04 A;  2X6W A;  3IAS 2;  2L9R A;  2X6X A;  2OAZ A;  2R7S A;  5JLX A;  5ILV A;  5D4R A;  1ZLK A;  2MFZ A;  1R9T J;  3FXR A;  4B3X A;  2HDW A;  3TQN A;  4PGG A;  4MQ9 F;  3TOB A;  4XRS A;  2LSO A;  1IV6 A;  4DZJ A;  2R5Y A;  3RPU D;  3WGH A;  2DFI A;  2ADU A;  2LYC A;  3TO9 A;  1MH3 A;  1YE9 A;  4E7K A;  2P7V B;  3HG9 A;  3KX2 A;  3OYN A;  1J59 A;  2CUF A;  3ASO H;  3OYB A;  3EUA A;  2VUM J;  3CP2 A;  1TLH B;  5E3O A;  2M4G A;  2W1O A;  5J1Y A;  4NQW A;  4ANJ A;  2RAE A;  2ZME A;  2D1V A;  3BR2 A;  3DTE A;  4MHG A;  5EEA A;  2QBY A;  3AKZ A;  2I8D A;  3JCU C;  4U87 A;  5DEQ A;  5EGO A;  1HF0 A;  1MBH A;  1XC5 A;  3HSR A;  3S1M J;  4P5O A;  5AIP A;  2ELJ A;  3ZN1 A;  3DBH B;  3CES A;  2JUC A;  4A2U A;  1KQ0 A;  2XPV A;  1ZGA A;  3BZK A;  4Q4Z F;  1HST A;  1QGP A;  4Z2Y A;  2R7Q A;  2PEX A;  4F52 A;  5L3D A;  5IOZ A;  4YIR X;  3BC8 A;  4KN7 X;  3PNV A;  2Z9O A;  3IH2 A;  1A5J A;  2EFW A;  1ZTR A;  3W3C A;  2XAU A;  3FXO A;  2FF4 A;  2J5O A;  1TBX A;  3RKX A;  1KQ8 A;  3ZMT A;  5IT9 Z;  1UAA A;  3HKZ N;  3TO7 A;  2PMZ A;  4IO9 F;  1B4A A;  1G4D A;  4CH7 A;  4BBR J;  2DJI A;  1OYY A;  1SD4 A;  3LAP A;  1EJ9 A;  4DOZ A;  2MD0 A;  2L01 A;  5DS9 A;  2HNH A;  4XKB A;  1LEB A;  3AG4 H;  4BE1 A;  4LK1 F;  5L3B A;  4MGR A;  1ZG3 A;  2XPW A;  4BJ5 C;  1P4A A;  3QWL A;  2ELH A;  2JMW A;  4A0Z A;  2VT3 A;  3VOD A;  3ZR8 X;  3OSG A;  2BVL A;  4EEF G;  2DMN A;  5CJ9 A;  1HA8 A;  1P4W A;  5HOD A;  4HW0 A;  4XQF A;  4ESJ A;  1XGO A;  4JX5 A;  1ZAR A;  2DDA A;  2E34 A;  4LK0 F;  1IRX A;  2CWE A;  3WHC A;  2R93 J;  4RDU A;  3H36 A;  4JOM A;  5ICE A;  4XNF A;  5LGN A;  1H0M A;  2EJR A;  1C0W A;  4Y52 J;  2ECB A;  1UFM A;  1A31 A;  4IHW A;  2A07 F;  3S14 J;  2HU9 A;  3HSE A;  1E3H A;  3O8H A;  2BY3 A;  4MFE A;  3V42 A;  2QYO A;  3WGG A;  4IOC F;  2Y31 A;  3ZMV A;  1MD0 A;  3CMY A;  3A01 B;  2ZJR F;  2IGN A;  3BTC A;  4Q48 A;  1G3T A;  1T56 A;  4WF2 A;  4QWQ A;  2XHK A;  1OFC X;  2OUM A;  2X6Y A;  3SFI A;  2M30 A;  3PUB A;  2Q0O A;  3I4N J;  4XLF A;  4UB8 C;  3CF5 F;  4RB2 C;  2EZK A;  5F27 A;  3QPS A;  3DKX A;  3KET A;  5E18 F;  2HOT A;  3U21 A;  3OYG A;  5F0H A;  5DD8 A;  2QQ9 A;  3BQY A;  3D5L A;  1ZGJ A;  1QU3 A;  3W2A A;  5DCF A;  2FOW A;  3BR6 A;  3KYL A;  2XGC A;  2NVT J;  2VPR A;  3GCM A;  3ZQF A;  2GA2 A;  1MNE A;  3LSJ A;  3PSF A;  2R0Q C;  1I5Z A;  2DT5 A;  2RDP A;  1R5H A;  1NG7 A;  2LY9 A;  1LNW A;  3LFK A;  3RDI A;  2X4H A;  4PSX A;  3BWG A;  2OA4 A;  2BXZ A;  3TO6 A;  2KRC A;  3M07 A;  1EH6 A;  5EDN A;  3BTI A;  5LD2 C;  2K3F A;  2EIJ H;  2UUZ A;  3WE2 A;  1W36 C;  4XOR A;  3J7Z I;  3S93 A;  4A3F J;  4D5F A;  2CU7 A;  2WB1 N;  5J8C A;  2GIV A;  4F7Z A;  4IX7 A;  1XN7 A;  1Z7U A;  1APL C;  5IYB J;  1JHF A;  1GV2 A;  3K7A J;  3LSP A;  1FTT A;  3S1R J;  1T2K A;  2CQX A;  4OMY A;  5LRS A;  4RB1 A;  1R1V A;  4IOA F;  3P9I A;  3A0H C;  3LSM A;  1LEA A;  1IN8 A;  4CIC A;  5LFA A;  1FP2 A;  3IKT A;  2R5Z A;  4NUB A;  2NVX J;  3CC2 I;  2V1U A;  3A4C A;  3LL7 A;  4M3F A;  3CMA I;  2RNG A;  1X58 A;  2HTJ A;  3GEZ A;  5GPC A;  2V9K A;  4DW6 A;  3OIP A;  1WKM A;  3FBI B;  1R7J A;  2KQR A;  2P5V A;  5H6R A;  4S0H B;  4B47 A;  1YFH A;  1JGG A;  3K70 C;  2E2J J;  5CVR A;  1J75 A;  4IHX A;  2XAG A;  1MDM A;  2KT0 A;  5F0C A;  1YO5 C;  3BR1 A;  3JW4 A;  3O8G A;  3QYB A;  2OJE D;  5K5R A;  4S05 A;  3F21 A;  2LP0 A;  4LLG F;  4R8H A;  2K27 A;  4IRI A;  2R7F A;  3C2B A;  3A02 A;  4ZC3 A;  2DA2 A;  3HB9 A;  3MEX A;  4I99 C;  2VKE A;  4KA4 A;  1VZ0 A;  1G8X A;  4WK8 F;  2NOG A;  5EEH A;  4ENN A;  3IRR A;  2E1C A;  1YX3 A;  3CCV I;  3QU3 A;  4LJZ F;  2AXT C;  2FA5 A;  2GQQ A;  3JSP A;  1UMQ A;  1IV8 A;  3BG9 A;  1B8I B;  4XN3 A;  3FDY A;  1WH7 A;  1D5Y A;  4Q47 A;  3KP2 A;  3HIF A;  2FQ3 A;  3W6K B;  1FSE A;  1SFK A;  1ACI A;  2ZXH A;  6PAX A;  4PFP A;  1KU9 A;  2OZU A;  2ESH A;  5GTH C;  4PJM A;  4BDY A;  3TW7 A;  2R92 J;  3NAR A;  5IYD J;  2Q8K A;  5IP9 J;  4A3I J;  1S9H A;  3FBN B;  1X4P A;  5FRO A;  3GTJ J;  1D5V A;  1S29 A;  2MYS A;  4XKW A;  1KA8 A;  4I0B A;  4LB6 B;  1SD6 A;  3Q5F A;  4LGW A;  3NQO A;  1YW8 A;  3N97 A;  2HFH A;  2KIS A;  1IUF A;  4HDU A;  1YIJ I;  2L7F P;  4AYB N;  5FKN A;  3CP8 A;  3G1M A;  3H3Z A;  1N78 A;  2L0K A;  2P8T A;  3GVA A;  3V8L A;  1T39 A;  4CXF A;  5FD6 A;  3LSK A;  2YR2 A;  3L7W A;  3RKY A;  3LST A;  4KJZ A;  3BR5 A;  3KCC A;  4CYC B;  1MZB A;  5IP7 J;  3ZQQ A;  4F91 B;  2FBI A;  3U1D A;  3TMO A;  1Y56 A;  1B9N A;  4I0A A;  1ENH A;  4WXH A;  1IDZ A;  1K6Y A;  2V1D A;  4AU7 A;  3CDH A;  2EIK H;  2NAZ A;  3I59 B;  2PBI A;  1BI1 A;  2AXL A;  4Y13 A;  3FF5 A;  4I76 A;  2GWR A;  2ZXI A;  2JA6 J;  4FX4 A;  1NK2 P;  4XRM A;  1JI8 A;  2ZB9 A;  2R4G A;  5J3L A;  3I4P A;  3K4L A;  3K70 D;  1OKR A;  4M9S A;  4DYR A;  1HXD A;  3DPT A;  1A04 A;  2F2E A;  3HPG A;  2RV8 A;  1FOY A;  2MD5 A;  3P9K A;  1QBJ A;  3PFY A;  4ENM A;  3V7C A;  2OC6 A;  1LDD A;  3MMY B;  4FE4 A;  1B59 A;  1ON2 A;  3HZJ A;  3PIO F;  3DF8 A;  2IA1 A;  1QRY A;  3HGY A;  4A3J J;  2HPM A;  1WJA A;  1WJE A;  4RLF A;  1ITY A;  1I1S A;  2MG4 A;  1I50 J;  3D0S A;  1X4O A;  4P96 A;  2OCC H;  4BU2 A;  2QEX I;  4V2F A;  3I4M J;  1BN5 A;  3OYL A;  1QZZ A;  2QKM B;  2FUG 2;  1W0U A;  3RJP A;  2E60 A;  2X0L A;  3QPT A;  1Y1W J;  1BL0 A;  4RA2 A;  2STT A;  1R4M B;  2K7L A;  4LFU A;  3EUK L;  4KMU X;  4WCG A;  3I53 A;  5HLG A;  2P0W A;  1S8N A;  2E71 A;  4GCV A;  1ZR2 A;  3CUQ B;  2L2O A;  2W4S A;  3FM5 A;  3T8R A;  1V5F A;  3T5X A;  2VT2 A;  1WRJ A;  4IPA A;  2IRF G;  2DMP A;  4CDG A;  3G6E I;  3JRE A;  3MD2 A;  2NVU B;  1TWG J;  4EAT A;  5HDK A;  2JTV A;  1F1Z A;  3OYF A;  4IXA A;  2MA3 A;  4CZC A;  1OR7 C;  2MSY A;  5JHF A;  4HAM A;  2I10 A;  4Y7N J;  1BR2 A;  1MH4 A;  4AWX B;  3QYE A;  2KRF A;  2IGM A;  2L3D A;  3HUG B;  2P5K A;  2RC4 A;  3M1C A;  4I6Z A;  4YEL A;  2FNA A;  4EVI A;  5F1J A;  2VIX A;  3TKY A;  1U5T B;  1HW5 A;  3WG7 H;  2K3P A;  2JVG A; 
#chains in the Genus database with same CATH homology
 3CUQ C;  3WU0 A;  2NRA C;  5L3C A;  2R7D A;  3HOS A;  2V6C A;  1ON1 A;  4GYI A;  1GXP A;  4OIN F;  1HBX G;  3R0J A;  1IXS B;  4I01 A;  1YG2 A;  5ICF A;  2CO5 A;  5KVR A;  3QOP A;  4EM0 B;  1U5T C;  3RYR A;  3GF2 A;  3GFM A;  4HF1 A;  3K1N A;  2M5W A;  2PMU A;  2ISZ A;  3JTG A;  1FPQ A;  2EV6 A;  1QO0 D;  3CO6 C;  2W24 A;  1Y0U A;  1K6O A;  3KZY A;  4HA8 A;  1B1B A;  1YW9 A;  3DXJ F;  3K1M A;  2VN2 A;  1RNL A;  3HUG A;  5FD5 A;  3LA7 A;  1LB2 A;  5LEJ A;  2WV0 A;  1I6X A;  3T0Y A;  2HOE A;  5HLI A;  5FGM A;  1YW7 A;  3HRM A;  2K4J A;  4EQQ A;  1BIB A;  4M74 A;  3ZMZ A;  2YX4 A;  1W7P D;  1LQ1 A;  4A6D A;  5H6Q A;  2H27 A;  4D0P A;  2EK5 A;  3EUH A;  3RKW A;  2LF7 A;  1CF7 A;  3KEQ A;  4UVC A;  3ABT A;  1B6A A;  1FC3 A;  2XAS A;  3ISP A;  1BIA A;  4ESF A;  3F23 A;  3ZMU A;  1H9G A;  4AD9 A;  2XV4 S;  2VBW A;  3F6V A;  1FYM A;  1JHH A;  3E5U A;  3GZ5 A;  2XKO A;  2QQA A;  3LA2 A;  3OV8 A;  4I98 B;  2EV5 A;  1XGN A;  4ESB A;  5FLX Z;  5H20 A;  1JE8 A;  3GWZ A;  1BI0 A;  2RVC A;  3G3Z A;  3ZQ7 A;  3SQN A;  3CJN A;  1W4M A;  1MJA A;  2XRN A;  1IN4 A;  4EJW A;  3MCZ A;  3OOP A;  3KZZ A;  2CFX A;  2EFQ A;  4XSZ F;  1REP C;  2F5F A;  4M6X A;  3HHH A;  1FYK A;  3E5Q A;  1YIO A;  3GO5 A;  3MZY A;  5HVQ C;  2R3S A;  4EJU A;  2K4B A;  5AON A;  2DO7 A;  1FNN A;  3MQ0 A;  3T1B A;  1R5G A;  1TW3 A;  1T98 A;  4LG0 A;  3BRO A;  1I27 A;  3AAF A;  2Q2E A;  2FU4 A;  4ASN A;  1EH7 A;  4LLN A;  3M8F A;  2L02 A;  3KE2 A;  4ZYD A;  5CVJ A;  3PQJ A;  2UWM A;  4ZYH A;  2V79 A;  4PCQ A;  3MAJ A;  2FBK A;  2VOO A;  3KLN A;  5JHU A;  1Z6R A;  1R58 A;  2F5C A;  2MH9 A;  5IT9 K;  2A68 F;  3HTS B;  1TQM A;  4U88 A;  4L5I A;  3T8T A;  4G6D A;  4EMS A;  2O0Y A;  1BBY A;  3FWE A;  3J81 Z;  3V8K A;  3BP8 A;  3U2R A;  5ERI A;  4YIF A;  4MQV A;  1F9N A;  3I64 A;  2K86 A;  4XSX F;  3M1E A;  1Z1D A;  3VOE A;  1R1T A;  2MLG A;  5F64 A;  3NRV A;  4LD5 A;  4KNY A;  3BY6 A;  5E17 F;  4TV7 A;  2FE3 A;  3MFK A;  1BM9 A;  2YSR A;  4M73 A;  2CW0 F;  2VE9 A;  5FB2 A;  3IWF A;  1U8R A;  3J7A O;  2NNY A;  3FMQ A;  1CGP A;  5LHH A;  5LLQ A;  4IJA A;  1P2F A;  2W85 A;  4ON0 A;  2MH2 A;  2EWN A;  1XSV A;  3QU6 A;  2B0L A;  2NS0 A;  2XAH A;  1UB9 A;  2TDX A;  3WE3 A;  3FMR A;  3HSF A;  1U2W A;  1LDK B;  2MC3 A;  2YPR A;  2DLL A;  1J2X A;  4O3M A;  3DQV C;  1DPU A;  3QRF F;  1F4K A;  3V7S A;  2F5D A;  5TRD A;  5E8I A;  2XAJ A;  2LF8 A;  3ERE D;  2FNP A;  1IXC A;  2LDU A;  2XAQ A;  3TGN A;  2D2W A;  1MJB A;  4N0B A;  4G9Y A;  5E1W A;  1FP1 D;  4BXU A;  2CQK A;  5EEG A;  4KDP A;  4OIQ F;  3KEO A;  2PJP A;  2VON A;  3LA3 A;  4E70 A;  5E20 A;  2ZFW A;  3IRQ A;  4KT5 C;  3WTS C;  2Y75 A;  1XGM A;  2BBY A;  2HEO A;  2OBP A;  4ZYG A;  1HKT A;  2EFO A;  3GFI A;  2EV0 A;  1QZY A;  4OMZ A;  1W5S A;  4A0X A;  1SAX A;  1BC7 C;  5CYV A;  3QP6 A;  3WG9 A;  5HOO A;  4HV6 A;  3Q9S A;  3ZMD A;  2H6C A;  2BYV E;  5BOX A;  2DK8 A;  5BS6 A;  4PDK A;  2HTS A;  3R60 A;  4ZH4 F;  1ZAO A;  1H9T A;  2VC1 A;  1E17 A;  4WXC A;  2W84 A;  2HR3 A;  3DEU A;  1Z9C A;  2J5P A;  2VOD A;  2XIG A;  3KP4 A;  4OIR F;  1PP8 F;  1SFU A;  5DYM A;  4LLL A;  1MKM A;  2JPB A;  2KIM A;  3KP3 A;  1ULY A;  2YX7 A;  3M7G A;  4N9H A;  1U6G A;  3I5U A;  2FBH A;  3O6B B;  2L4M A;  3F3X A;  3RYP A;  3IC7 A;  1KQ9 A;  1LVA A;  1YQA A;  5DUK A;  2RNJ A;  1FZP B;  3ZPL A;  1YS6 A;  1DUX C;  2JPC A;  4G7H F;  1FBQ A;  2HYG D;  4HYE A;  2BEO A;  1XCB A;  2RKH A;  2W25 A;  2PFB A;  3J80 Z;  1UST A;  5ILS A;  5FFZ A;  3GX4 X;  1ZYR F;  2EB7 A;  1S7A A;  3I58 A;  4L0Y B;  2DTR A;  1TW2 A;  3E97 A;  3B73 A;  2A61 A;  2M8E A;  3DPL C;  1ZG1 A;  4EJT A;  2HYF A;  2UXN A;  1XMK A;  4JBA A;  3SFZ A;  2GXB A;  4Y15 A;  3GW2 A;  1OYW A;  4BHP A;  5ILU A;  3TOA A;  2DAO A;  2O61 A;  4HQE A;  4A0Y A;  5DUI A;  1HKQ A;  4EGZ A;  3GFL A;  2YU3 A;  2H6B A;  1D8J A;  3ELK A;  4FT8 A;  1ZHF A;  5JR3 A;  1KU3 A;  3U9G A;  1G6N A;  3FZV A;  1XD7 A;  3V8J A;  4UHT A;  4IRH A;  2K02 A;  4HZF A;  4UXN A;  1ZRF A;  2BGC A;  2RN7 A;  3ECH A;  5HDG A;  3LAJ A;  1O7F A;  2QEN A;  1W7P B;  3I59 A;  4U7B A;  1R00 A;  1IN5 A;  2P7C B;  2ZCW A;  4DNC A;  5TJJ A;  5HS9 A;  1XDU A;  3BZ6 A;  5DCM B;  3K9T A;  4UVA A;  3MZH A;  2DK5 A;  4JQF A;  1HW2 A;  1KU2 A;  1BC8 C;  3GYH X;  2BV6 A;  2CSO A;  1ZG5 A;  3GLX A;  5FFX A;  5D5V B;  1ZLJ A;  3K0L A;  1Z6T A;  3L2C A;  2QWW A;  4WXD A;  3KP6 A;  4G7Z F;  3GFJ A;  2FSW A;  2LNB A;  4G6Q A;  1OR7 A;  2FRH A;  2EA2 A;  1WQ2 A;  4IHS A;  1DP7 P;  1IN7 A;  2PMH A;  3RI4 A;  1ZRC A;  1L0O C;  3DV8 A;  1R22 A;  4L9V A;  1KYZ A;  5BPI A;  3CUQ A;  3HRU A;  4L9J A;  2A3S A;  3I71 A;  3HYI A;  4CYD A;  4I2O A;  4S04 A;  1K78 B;  1DPR A;  3WU1 B;  1LDJ A;  3C18 A;  5DCM A;  2DU9 A;  5DV5 A;  4R1H A;  2HDC A;  2VE8 A;  3IKV A;  2KJC A;  1U5T A;  2M87 A;  5ED4 A;  5BMZ A;  3GXO A;  1WWX A;  1P6R A;  4GO1 A;  3P9C A;  1SD7 A;  2V1X A;  1O3Q A;  4XRF A;  1J0R A;  1TNS A;  1T6S A;  4A6E A;  4AIH A;  3SZP A;  5D5X B;  4BQA A;  3F72 A;  4IVN A;  2XKP A;  3M9A A;  3CO7 C;  3Q9V A;  2O3F A;  2STW A;  4YG2 F;  1L3L A;  4HBL A;  4CZZ A;  2D45 A;  2IA0 A;  4G7O F;  2A6E F;  2PN6 A;  1SFX A;  1B9M A;  2FEZ A;  3H3U A;  3F8F A;  4BAY A;  3RIR A;  1WI9 A;  1QNT A;  1IN6 A;  4NHJ A;  3C3W A;  1MJ9 A;  3M8E A;  3E6C C;  1UHM A;  1GHC A;  1O3S A;  2V9V A;  1IAW A;  1HSJ A;  1IW7 F;  2DW4 A;  3ZN0 A;  3JAM Z;  1IRF A;  1JGS A;  3HHG A;  3V7R A;  2GAU A;  4HF2 A;  3DP7 A;  1QQI A;  3WOD F;  5J8F A;  4RGX A;  4ENJ A;  1G3Y A;  4ETS A;  3QP5 A;  2ESN A;  4HX8 A;  5HDN A;  5JFR A;  2P4W A;  3RPU A;  5CLS A;  3F6O A;  3W6J B;  1ZRE A;  4M9X A;  5ICG A;  3J81 K;  5A2Q Z;  4BH9 A;  2VXZ A;  5LEK A;  5D6F A;  2HGC A;  4RGU A;  5LGU A;  2ZME B;  2QBY B;  2HQN A;  2JZY A;  2H94 A;  3H92 A;  2RGV A;  1HQC A;  4KMF A;  3BPX A;  1P92 A;  4EM2 A;  4ZYE A;  4HLX A;  2ZKZ A;  1FBU A;  1S7O A;  4GXO A;  1Z91 A;  4RGR A;  2P5L C;  2OQR A;  5D6E A;  4AIJ A;  1GVJ A;  1V3F A;  4HX7 A;  5HS7 A;  3L00 A;  2FML A;  1D3Y A;  2VOP A;  4MTE A;  5DDG A;  1USS A;  2JSC A;  1J7K A;  2XGX A;  5E8G A;  3WTW C;  3G73 A;  1IUY A;  2GXG A;  1VTN C;  1XGS A;  4GYG A;  4UV8 A;  5K5O A;  4L18 B;  2Z33 A;  3BJO A;  3FM3 A;  4EGY A;  4H0E A;  1BI3 A;  4A12 A;  1XMA A;  4UV9 A;  2C6Y A;  4HOB A;  5ICC A;  5JVT A;  3K2Z A;  4MTD A;  1TTY A;  4AIK A;  3F8B A;  2GA1 A;  3EQL F;  2CG4 A;  2WTE A;  3KP5 A;  4NB5 A;  4XLP F;  2PG4 A;  4R79 A;  5K5Q A;  1T38 A;  3KP7 A;  4IHT A;  1FX7 A;  1BI2 A;  3L9F A;  1YYV A;  4DQ2 A;  1UCR A;  5JI6 A;  2VC0 A;  3RPQ A;  3PQK A;  2KIU A;  1XB4 A;  4LB5 A;  2LKP A;  1J9I A;  3SZT A;  2A5Y B;  1W5T A;  4Y17 A;  4HF0 A;  4UVB A;  2MLK A;  3WTX C;  2VBZ A;  2WC2 A;  3JSO A;  2O8X A;  4M71 A;  4FX0 A;  3DFG A;  2ZNZ A;  4O6J A;  1TNT A;  1QPM A;  3C7J A;  1MDM B;  2QLZ A;  1PUE E;  4M9Z A;  2DQL A;  3R0A A;  3ZMS A;  2E7X A;  1E2X A;  3HTU A;  3FXU A;  3F8C A;  3F8M A;  1KYW A;  1EH8 A;  2ZXJ A;  4HLY A;  4ZZL A;  4WX9 A;  4GGG A;  5HS8 A;  3WGI A;  2QZ8 A;  3VB2 A;  4Q5S F;  1OMI A;  5IT3 A;  5FO5 A;  5D8L B;  4FHT A;  5LRR A;  4L0Z B;  3J80 K;  4JK1 X;  3IHU A;  4HDV A;  3N4M A;  2EFP A;  1O3T A;  1XSX A;  4MEY F;  2UXX A;  3LWF A;  4OOI A;  4U0V A;  5K1Y A;  5D8K B;  4WWC A;  3SHF A;  1K79 A;  1IZ1 A;  4KIC A;  2ETH A;  1WSU A;  5D5U B;  2OD5 A;  3WTV C;  1U78 A;  1FYL A;  2Y48 A;  3WTZ A;  4YII A;  4O5V A;  4G8X A;  2E1N A;  4QLC U;  3F22 A;  2G7H A;  3E5X A;  2GZW A;  2XUB A;  4EM1 A;  1Z05 A;  4KN4 X;  2DPD A;  2ZJ2 A;  1RZ4 A;  1SD5 A;  4B8X A;  3COA C;  1SFE A;  2MBF A;  1DDN A;  1FBS A;  2OQG A;  2AS5 F;  3ABU A;  2O03 A;  3RTR A;  4OIP F;  1P4X A;  2WWY A;  3EYY A;  3KFW X;  2IT0 A;  3BPV A;  2Z3Y A;  2PI0 A;  1AOY A;  1S3J A;  1RUN A;  5L3G A;  2NYX A;  4G94 A;  5F6F A;  3LQR A;  2QVO A;  1Q1H A;  4EJO A;  5DD4 A;  2F5E A;  5L3F A;  5CVV A;  1U3E M;  1ZH5 A;  2Y0M A;  2EA4 A;  2FMY A;  4RB0 A;  4XBF A;  4KIF A;  4YFK F;  1HW1 A;  4HX4 A;  1O57 A;  4IRG A;  5E1Z B;  2KIF A;  1EV7 A;  3NEU A;  1O3R A;  2L4A A;  2JT1 A;  3E6B A;  3IL2 A;  2HS5 A;  4M6Y A;  2KJB A;  4L9T A;  2RQP A;  3R6S A;  2D1H A;  1ODD A;  5LBQ A;  1TQI A;  3QAH A;  2DQR A;  2ISY A;  2CYY A;  3WTU C;  2IVM A;  2OU2 A;  1FT9 A;  4KUM A;  4P55 A;  1IXR C;  3FX3 A;  1F5T A;  3FHZ A;  2PLY A;  2IA2 A;  4N9I A;  2BE5 F;  3ECO A;  2Z99 A;  5HLH A;  1OPC A;  4ENK A;  3ZP5 A;  1TQP A;  5LGT A;  3BDD A;  1ZRD A;  3DKW A;  4HQM A;  3QPH A;  3L09 A;  3VEP A;  1AWC A;  3K69 A;  4U0Y A;  2ZNY A;  2EFN A;  4EV0 A;  3WTT C;  2P6S A;  1MGT A;  4PZJ A;  2DPU A;  2G9W A;  4KIG A;  4RAZ A;  1XSD A;  3R4K A;  4CGZ A;  5KK1 A;  2XAF A;  1ONV A;  5D4S A;  4UNO A;  1D8K A;  5D5W B;  2DBB A;  4LMY A;  5LHI A;  1OYI A;  2UZK A;  2VBY A;  3BJA A;  2COM A;  1K7A A;  3O3K A;  3VFZ A;  1FLI A;  4B09 A;  1IF1 A;  2IJL A;  3ULQ B;  2G7U A;  3F8N A;  5L3E A;  3E6D A;  4CHU A;  1JXS A;  3EDP A;  2QM3 A;  3FXQ A;  4BHC A;  1W7P A;  4RAY A;  1R23 A;  1GXQ A;  2O6G E;  1J5Y A;  2OZ6 A;  3B02 A;  1BOA A;  4KFC A;  1SMT A;  4KIB A;  1XDS A;  4OIO F;  1IRG A;  3WTY C;  4IF4 A;  2FOK A;  1FOK A;  2XVC A;  4EJV A;  2A6H F;  1CF7 B;  3EYI A;  4I02 A;  1PDN C;  3IWZ A;  2JRT A;  3JTH A;  4UUV A;  4K2E A;  3O2P E;  1G3W A;  1YTY A;  5LHG A;  3I0T A;  2IP2 A;  4BNC A;  2PQ8 A;  5FLX K;  1UHW A;  2HQR A;  4HV5 A;  1S6L A;  4L9N A;  5CVU A;  2IPQ X;  1YLF A;  5BQT A;  4PGH A;  5F1R A;  3JAM K;  5J6X A;  1PP7 U;  4CO8 A;  3BJ6 A;  4BHB A;  4M72 A;  4YFN F;  1ZN2 A;  2XRO A;  3SXY A;  3K1P A;  3HRS A;  1FSH A;  3BOQ A;  1K78 A;  1STZ A;  1SMY F;  2W57 A;  2ZO4 A;  3S2W A;  1X3U A;  3PFI A;  5BPD A;  4I09 A;  2M45 A;  2P6T A;  2NNN A;  1LJ9 A;  1KGS A;  3GZ6 A;  5AIQ A;  4MNU A;  3EET A;  5A2Q K;  2QQB A;  3CTA A;  1RIO H;  2HKX A;  4P9U A;  4LG0 B;  3TDZ C;  1KU7 A;  3REO A;  4XLN F;  3HRT A;  2HZT A;  1FWZ A;  2FXA A;  1R1U A;  4BYY A;  2HWV A;  5CVI A;  1RI7 A;  2VBX A;  4A5M A;  2IW5 A;  3CLO A;  4ZZD A;  1T0F A;  1FY7 A;  3E3V A;  2CGP A;  2ACJ A;  1BJA A;  2L54 A;  3FMS A;  1O7L A;  2H09 A;  3C1D A;  3ML6 A;  4RB3 C;  3TDU C;  4I7H A;  3P7N A;  4U0W A;  2Z5U A;  2A69 F;  2ZBK A;  1V4R A;  3LQQ A;  3GUD A;  3KLO A;  2DI3 A;  1YS7 A;  3I54 A;  1I1G A;  1G3S A;  3E6M A;  3CUO A;  3R61 A;  2HKO A;  1NHA A;  4AVP A;  3ROU A;  4L5J A;  3HOT A;  4U7D A;  4A5N A;  1XCV A;  1HKS A;  4OU0 A;  4P9F A;  4KYW A;  4YFX F;  4RGS A;  3V4G A;  1RUO A;  1R36 A;  3MWM A;  4RS8 A;  2QUF A;  2E7W A;  4MEX F;  5E1X A;  2M1B A;  2KKO A;  2OAZ A;  5D4R A;  5ILV A;  1ZLK A;  3FXR A;  3TQN A;  4PGG A;  4MQ9 F;  3TOB A;  2LSO A;  3WGH A;  2DFI A;  2ADU A;  3TO9 A;  2P7V B;  1J59 A;  1TLH B;  4NQW A;  2ZME A;  2D1V A;  4MHG A;  2QBY A;  5DEQ A;  3HSR A;  4P5O A;  5AIP A;  3ZN1 A;  4A2U A;  1KQ0 A;  4Q4Z F;  1ZGA A;  1HST A;  1QGP A;  4Z2Y A;  2PEX A;  5L3D A;  4KN7 X;  2Z9O A;  2EFW A;  2FF4 A;  2J5O A;  1TBX A;  3RKX A;  1KQ8 A;  3ZMT A;  5IT9 Z;  3TO7 A;  1B4A A;  1G4D A;  1OYY A;  1SD4 A;  3LAP A;  2L01 A;  1LEB A;  4LK1 F;  5L3B A;  4MGR A;  1ZG3 A;  1P4A A;  2ELH A;  4A0Z A;  2VT3 A;  3VOD A;  5CJ9 A;  1P4W A;  4HW0 A;  4ESJ A;  1XGO A;  1ZAR A;  4LK0 F;  2CWE A;  5LGN A;  5ICE A;  1H0M A;  2EJR A;  1C0W A;  1UFM A;  2A07 F;  3HSE A;  2QYO A;  3WGG A;  3ZMV A;  1MD0 A;  4Q48 A;  1G3T A;  4WF2 A;  4QWQ A;  2XHK A;  2M30 A;  2Q0O A;  4RB2 C;  3KET A;  5E18 F;  5DD8 A;  2QQ9 A;  3D5L A;  1ZGJ A;  5DCF A;  2GA2 A;  1I5Z A;  2DT5 A;  2RDP A;  1R5H A;  1LNW A;  3LFK A;  3RDI A;  2X4H A;  3BWG A;  2OA4 A;  3TO6 A;  1EH6 A;  3WE2 A;  5J8C A;  2GIV A;  4F7Z A;  1XN7 A;  1Z7U A;  1JHF A;  1T2K A;  4OMY A;  5LRS A;  4RB1 A;  1R1V A;  3P9I A;  1LEA A;  1IN8 A;  4CIC A;  3IKT A;  1FP2 A;  2V1U A;  3GEZ A;  2HTJ A;  1WKM A;  1R7J A;  2P5V A;  5H6R A;  1YFH A;  5CVR A;  1J75 A;  2XAG A;  1MDM A;  1YO5 C;  3JW4 A;  5K5R A;  4S05 A;  3F21 A;  4LLG F;  4R8H A;  2K27 A;  4IRI A;  2R7F A;  3MEX A;  4KA4 A;  4WK8 F;  5EEH A;  4ENN A;  3IRR A;  2E1C A;  3QU3 A;  4LJZ F;  2FA5 A;  2GQQ A;  3JSP A;  4Q47 A;  3KP2 A;  3HIF A;  2FQ3 A;  3W6K B;  1FSE A;  6PAX A;  1KU9 A;  2OZU A;  2ESH A;  2Q8K A;  1D5V A;  1S29 A;  4LB6 B;  1KA8 A;  4I0B A;  1SD6 A;  3Q5F A;  4LGW A;  3NQO A;  1YW8 A;  3N97 A;  2HFH A;  4HDU A;  3H3Z A;  2P8T A;  3GVA A;  3V8L A;  1T39 A;  4CXF A;  5FD6 A;  2YR2 A;  3L7W A;  3RKY A;  3LST A;  3KCC A;  1MZB A;  2FBI A;  3U1D A;  1B9N A;  4I0A A;  4WXH A;  2V1D A;  3CDH A;  2NAZ A;  3I59 B;  2PBI A;  1BI1 A;  2AXL A;  4Y13 A;  3FF5 A;  2GWR A;  4FX4 A;  3I4P A;  1OKR A;  4M9S A;  1HXD A;  3DPT A;  1A04 A;  2F2E A;  2RV8 A;  2MD5 A;  3P9K A;  1QBJ A;  4ENM A;  3V7C A;  1LDD A;  1B59 A;  1ON2 A;  3DF8 A;  2IA1 A;  1I1S A;  3D0S A;  4P96 A;  1BN5 A;  1QZZ A;  3RJP A;  2X0L A;  3QPT A;  2STT A;  2K7L A;  4LFU A;  4KMU X;  4WCG A;  3I53 A;  5HLG A;  1S8N A;  4GCV A;  3CUQ B;  3FM5 A;  3T8R A;  3T5X A;  2VT2 A;  1WRJ A;  4IPA A;  2IRF G;  4CDG A;  5HDK A;  2JTV A;  1F1Z A;  4IXA A;  2MA3 A;  4HAM A;  4AWX B;  2KRF A;  2L3D A;  2P5K A;  2RC4 A;  2FNA A;  4EVI A;  3TKY A;  1U5T B;  1HW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...