1D6JA

Crystal structure of adenosine 5'-phosphosulfate (aps) kinase from penicillium chrysogenum
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
177
Chain Sequence
HASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of adenosine 5'-phosphosulfate kinase from Penicillium chrysogenum.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Transferase
molecule keywords ADENOSINE-5'PHOSPHOSULFATE KINASE
total genus 63
structure length 177
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d6jA00
3HPRA 3GJ5A 4OHZA 4D25A 2GF0A 4FCVA 4F7WA 1FTSA 1YKSA 2C9YA 4A2WA 2ZI5A 1XCMA 3IHWA 4LBYA 4RVCA 1DAGA 3QF4A 1G41A 3A1WA 4DCNA 1G64A 3D31A 2QAGA 1NRJB 3M1IA 3GLGA 1OFUX 2HYIC 2ASEA 2BBTA 2R44A 4YMWA 4OQFA 4PAOA 4D2IA 1ZM2A 2XEXA 1CS4C 3PUYA 3QXSA 2J46A 1OT3A 3ASYA 2B8WA 2QORA 3DO6A 4OQMA 5CB6A 4KFSA 3EZ6A 4MITA 3THOA 4BEJA 5DI3A 5F9FA 2GBLA 4M1TA 2QROA 3FHOA 1ZNYA 4EJSA 2WSSA 1G8GA 4G5GA 2GXAA 5HKKA 3EC2A 2YYZA 5DH9A 1JALA 5AWFC 2C2HA 4NZYA 4QL3A 2VF7A 3P32A 1II8A 1ZC3A 2IXGA 2K5UA 4GOKA 3WMFA 2WWGA 5CIWA 1XFAA 5IK2A 1FPMA 3TRFA 3BH7A 1W4AA 5LPNA 2ONJA 4DLZA 3VR3A 3IDQA 2JLVA 4XWAA 1E1QA 1D9XA 1P73A 4FMCF 4A2QA 4XVUA 4FXPA 3RDPA 2AXNA 4DVGA 1E3MA 3LNCA 3HYTA 5EXPA 1VYVA 3HP1A 1VCNA 3EAQA 2YOGA 2QSYA 5CIQA 1M7HA 5CM8B 2NO7A 2WJIA 4A2PA 5LD2C 3KUDA 1CF4A 1A7JA 1FP7A 1A2BA 3CF2A 4ILEA 3V4FA 4EDHA 2W6ID 2VH5R 1IN7A 3T1VA 4LCBA 1NN3A 1DEKA 1Z0FA 1KDOA 4JZKA 1NKSA 1DTSA 2ODNA 1JXMA 1SVSA 2QAGC 3MUFA 4KBGA 1T5LA 1TEXA 5DYGA 2WSMA 4PFSA 5TVKA 4ACAA 3MJHA 4MGZR 2GJSA 2P2LA 4IEIA 5E4FA 4ESVA 4D4LA 2EFDB 2DWQA 4R2IA 5KU1A 2FSHA 1JPNA 2NO9A 3T5GA 2D2EA 3TR5A 4C0AC 1IHUA 2FGKA 3MWJA 221PA 2ATXA 2FX3A 2P3SA 4DKXA 2HXYA 1Z6XA 4YMVA 4MKGA 3L0OA 2J41A 5BYKA 1BO6A 5JS8A 4O0MA 1NI3A 1Z28A 1E2JA 1O87A 2QNRA 3FYHA 1CXZA 2W0SA 1JEDA 2IWHA 3O8CA 2GCPA 1YZLA 1Z5ZA 3QIAA 2AWOA 4QKQA 1W0KA 3M4YA 3AKDA 3U6KA 2WM9B 4MYCA 2GTPA 3B6EA 1YZQA 3IUYA 4BZPA 1ANKA 4X8MA 5KDLA 2OM2A 4WAUA 1VCMA 1Z0DA 1T8UA 2GKSA 4IOJA 1IY2A 2KI5A 2NG1A 3K8YA 3KB2A 4GZMA 4A0RA 1KI9A 3L82B 2JJ2A 4DB2A 4BECA 1IN4A 1KMHB 4Y0VA 4U7DA 2OE2A 4M1KA 1NMXA 4A8JB 1E9SA 5KSPA 2YNMA 1KNQA 1OYYA 5FOXA 2AR7A 4E22A 1G17A 2ZROA 1VHLA 2EFEB 1GL9B 4A0HA 3U2QA 1U8YA 2J0UB 1CLUA 4HAXA 3NH6A 4C0KA 4PSVA 1FUKA 4R7ZA 1Z0AA 5AJZA 1KMQA 2EU8A 2AKAB 2XTMA 3LDAA 1E9DA 2GETA 4Q18A 3SJBA 2IC5A 4AK9A 1KJYA 3VAAA 1ZU4A 1YR7A 2ZI6A 3A8TA 4IHQA 1CBUA 1ZINA 4V0NA 4LJ4A 3LVQE 4L9SA 3KQLA 1DAKA 1MO3A 1VG0B 1XEFA 3L8YA 4H1VA 3AGPA 3K09C 2KBEA 1KI2A 3AKEA 3CB4A 4MQBA 2IS2A 1G4AE 2O8BB 2DPXA 3CX6A 3TW4A 3CR7A 3QKRA 2ZI3A 1US8A 2J5XA 4M2LA 4MYHA 3I61A 2IS4A 3CNLA 4O2LA 1DPFA 2GESA 1P9NA 1R8SA 4QBHA 1OSNA 4DEYA 2F43A 2REOA 3CIOA 2WJJA 3LWNA 3DMDA 2XOKA 4HUTA 4Q9KA 3HR8A 2IS6A 3SJCA 4DEXA 5L3RA 2QM7A 1Z63A 3NEJA 4EPXA 4MYTA 3U3KA 4HLCA 3U3RA 1FNNA 2FPMA 1S1MA 2GJ8A 1CJMA 4QHSA 3IKJA 1ZM3A 2RGXA 3IO3A 4TLAA 4Q1CA 4FW9A 2CBZA 1N2CE 1SKQA 3L0IB 3NDPA 2WPDD 4G5QA 4URUR 3OF5A 4UNQA 5C4MA 2QPOA 5G3ZA 1EWRA 1Q1EA 2EW1A 3ADBA 4QGHA 4GDFA 2G83A 5CK5A 1NLZA 2NGRA 3OIYA 1EFUA 4WW0A 2V7QD 2WWHA 4OK6A 3AUYA 1E9EA 1HUQA 1E2HA 4B48A 1LFDB 4YDSA 3T1TA 2BWJA 5FL7D 2PZGA 2BMFA 3RS2A 2V3CC 5JJIA 1VDZA 1VYUA 2PMKA 4RZ2A 4B3FX 1F2UA 4OK3A 1ZD1A 2WOJA 3B2EA 4KHZA 1XMSA 2P65A 4PANA 2XJ9A 3PUZA 2MSEB 1OFTA 2W2XA 2VPPA 4M9QA 4UJ5A 5FTNA 2UKDA 2N1BA 1HA3A 4MH0R 4ZIRA 1Z83A 2QGNA 3S1AB 5JJKA 5JSZB 1KDPA 3AP3A 2IYLD 2JLUA 3FB4A 1G5PA 5TXGA 4BLOA 1OIVA 2QN6A 1D2NA 3LQQA 3EX7C 2RAPA 1J99A 3BE4A 3H1TA 2IW3A 4KODA 4GNKA 4ERNA 1P2UA 1Q21A 3NG1A 2O8FA 2FN4A 3QPUA 3QENA 4LC0A 3KKNA 4NDZA 4A0FA 2WPDA 4UXIA 4Z1MA 3AF4A 4E07A 4CEHA 1IN5A 3C4JA 3QI2A 1W4RA 3LVRE 1K5DA 4M4SA 4PX9A 5FR2A 1Z07A 4BPBA 1XTSA 4BLTA 1L7VC 4FD2A 3GLFA 1H8EA 3RS0A 2CK3D 3GLHE 1LV7A 2WJVA 5K8UA 4EPTA 3AVWA 3OESA 2VHJA 1E9BA 1W4CA 4LV8B 3RRNA 3SBDA 5FUWA 5EXTA 5D3QA 3KJIA 4A92A 5HZKA 1SVKA 2FEMA 2RGNA 3AB3A 3SNHA 4D81A 4Z1MD 3T5DA 4MGYR 2QE7D 5L3SB 3TK1A 4EPYA 1MO4A 4OL0A 1GITA 2YWEA 2OBMA 3OIWA 3A4LA 2Z4SA 1CJKC 1ZRHA 2LCFA 4MRSA 4NPHA 1G9XA 3CH5A 1RJ9A 5H70A 3GJ3A 1DELA 3SE0A 3BS4A 4K8OA 2FMXA 1W36B 5FBRB 1T8TA 1NSTA 4JIMA 1UF9A 2GK6A 3KZ1E 3BFVA 3T35A 1E2GA 1X6VA 3CRVA 2ZRDA 2P6RA 2A5GA 2BCJQ 3SS8A 3GJXC 2JLWA 2XITA 3PUWA 4M9XA 3SEAA 4Q66C 3Q5DA 2RCNA 4JL5A 2FV8A 4DCTA 3CF6R 4HI0E 2V6IA 4W5JA 4LPSA 1RZ3A 1UAAA 1V43A 2GAAA 5G41A 1QDEA 4CRWB 4KAXA 3U3OA 4OI4A 1I4TD 1NBME 5C1BA 3B1VA 3U7GA 3WYAA 1Q44A 2GRJA 3FHCB 1XD9A 4OHXA 4FINA 4XTRA 3MD0A 3U7FB 1F5NA 5TDHA 3VR5A 4Z51A 1E96A 2P6NA 1QRAA 2F55A 2FEOA 3E5HA 2R6GA 3RRYA 1L4YA 3THYA 1E0AA 3LRPA 1TADA 1KDRA 1F3OA 1GIAA 3PV0A 1FMJA 1MH1A 2P5SA 2AN9A 4Q9IA 3CO5A 3VR6A 1D9ZA 3EASA 2CE2X 4PPNA 4AIIA 1VTKA 2JJ8A 1E2EA 3UWOA 4EPRA 4GMXA 3TAUA 3GQBA 4Q48A 1CKEA 4IDNA 1ESNA 4TQAA 4B75A 1N5LA 2YOFA 1GILA 1IJEA 1XP8A 3LA6A 3VU9A 2DWPA 4PTLA 5IDVA 4K46A 4LJYA 3ONWA 3CLVA 3GFTA 1LB1B 2CNWD 3OEHD 4TQ9A 2C95A 2D06A 2G0TA 4YMTA 1QF9A 2GEUA 3B78A 2AXPA 1COWA 1WE2A 3B1XA 4QNMA 1WBDA 3GEHA 4CEJB 4C7OA 1R0XA 5AR1A 1K6MA 2YWGA 4LUCA 4QHTA 3NHAA 1S8FA 4DDUA 2RGAA 3TH5A 2OCYC 2ZTSA 3DMNA 1A5TA 3LBHA 1P5ZB 3FFBA 3RWMB 1PLKA 2OT3B 4LHZA 1OLOA 3T12A 2GZHA 4D80A 3FWYA 3GJ4A 1W0JA 1SVOA 2QG6A 1XTKA 3OAAA 3ZIAD 5AK0A 3L8ZA 2ZS8A 3B82A 4HLUC 5KUTA 1KY2A 5IF9A 2C96A 2V54A 4POAA 2EVWX 1G3IA 3KKQA 3ZLJA 3QY0A 2AHOA 3UMRA 5JWHA 4B2LA 3QE0A 5F9HA 1OPXA 1NF3A 2QQEA 3K9HA 1S9HA 2WAXA 4LOAA 4DUGD 2BJVA 2ZYVX 2ZSEA 4AYTA 4N0DA 4YXWA 2X8AA 1OV4A 1W0JD 2Z83A 1KZGB 1P75A 3QF4B 4WIAA 2VSOA 4DDWA 1ZNZA 4IVPA 4RCYA 1ZVQA 3SDZA 2WAYA 5JFGA 3BFXA 2JJ1D 3AQ4A 4LJ9A 2O8FB 4PC7A 2FNAA 5DGXA 4B3XA 5HZHA 2HLDD 1HH4A 2ZRLA 1YU9A 4XJXA 2OO7A 3AKYA 3BB3A 4XH9B 1OFHA 4DLTA 2WJHA 3QF7A 1E2QA 1GKIA 2H8KA 3UXMA 4DBLC 1KNXA 4DWJA 5C2JB 4BZQA 2F7SA 5HTKA 3TQFA 4QJ3A 1S96A 3T61A 2O0KA 1H8HA 2A5FA 4FN5A 4XTCS 4NYMQ 2X1VA 4B34A 1GKYA 2XXAA 1R0ZA 2G0NA 1D5CA 3BXZA 1XJQA 3SFVA 2ZXUA 3NKVA 1A82A 1AQYA 2BDTA 1QZXA 2PCLA 1XEXB 4ZPXA 4EFLA 4Q7JB 2O8BA 3IQWA 4I81A 4Q4HA 3VKHA 2QM8A 2P5TB 1PV4A 4B2PA 1QVAA 2HCJB 2RGGA 1FX0B 5EP3A 5FOTA 3SJAA 3R7WA 3BERA 3O8BA 2V1UA 3BGWA 5JMTA 4Q00A 4B73A 3SQWA 1Q1ZA 3W90A 4Q7LA 3K9NA 1GTVA 1JR3E 1Z0IA 4NU0A 4KV9A 4AWXA 3VX3A 4U00A 4EFMA 3EW9A 1ZCBA 4KLNA 3AVTA 2ODEA 3DM9B 2EQBA 2AD5A 4TLBA 5BWMA 1Z2CA 3X1YA 2WJGA 1CEEA 3KXKA 2F6RA 1TU3A 5TARA 5IHPA 3B9QA 5EZ5A 4C0HA 3OIVA 4NHOA 1LF0A 1Q0UA 821PA 2ZRBA 1HYQA 1NMZA 2C5LA 1JEEA 1HQCA 1UEIA 4JLMA 1NG9A 3RC8A 3VNUA 3JZMA 1BYUA 2MMGA 3GLHA 1FQKA 4JJZA 2IUUA 2JDID 2ZRGA 3HYRA 3LD9A 3PJRA 1ZCAA 2P67A 1UDXA 1SXJA 2UVQA 5G3YA 1VKJA 1GZSA 1KO7A 5BQ5A 1JQJC 3AH8A 3FPAA 5KYKA 1R0YA 2IYQA 4GP6A 1FUUA 5CLQA 4B44A 1EXMA 4P0TA 4V03A 4LBZA 3Q8XB 2PZEA 2VP5A 3ADDA 2Q0HA 2NZJA 2JLSA 4YLGA 1GUAA 4Q21A 3C15C 3WBJA 1R5OA 2XNDA 1R5BA 4RD1A 3BH6A 5M04A 3R8FA 1A2KC 5TB5A 3H84A 4G0NA 1M74A 3KX2A 2ZI7A 5AJVB 5L3SA 4C0JA 5ELXA 4WZBE 1QBKC 3RYTC 3K0FA 4JLBA 5EE9A 5FPTA 1QHHB 1FQJA 4JBYA 4DSOA 1KDTA 3EZ2A 1R7RA 4NYIQ 4Q01A 1E2IA 4B76A 2PJRA 1G6OA 2D3WA 4UNSA 1OB5A 2VP9A 2R2AA 1ELOA 1UPTA 2BEKA 4P4SA 3U7EB 2FZLA 2GEVA 1WP9A 1T0JB 1YZGA 3OFNA 3UWKA 2RHMA 4X8HA 1BKDR 2VSFA 3C5HA 2PLRA 3RAPR 3KDSE 1GSIA 2G1KA 4DJTA 1ZMXA 5KNBA 2QMEA 4MYUA 4H9GA 4KO8A 3TVTA 2KSQA 1NLFA 2ZSDA 5G53C 1XZQA 1GRNA 1TF2A 4KU4A 3A1VA 4TSFD 4DDTA 1P62B 4M0LA 1P2VA 3SJZA 2XGJA 2MSDB 3B1YA 3EPHA 5IK2D 4DLUA 4I1SA 4LI0A 1PUJA 1NLYA 1ZJ6A 3KKOA 4DRZA 3QKSA 5JEDA 1R0WA 4IOKA 1X3SA 3EWAA 2QP4A 1U0HC 1XD2B 3ZZTA 4I4LA 4MGIR 1YJ5A 3QSYA 2NO6A 1SULA 4WZAE 3DPUA 1JB1A 5BW8A 1M6NA 2NQ2C 1JAHA 2YOHA 4B3DA 1NKTA 4QM6A 2R65A 4GL2A 2C9OA 1OJLA 3KXIA 3K53A 5FUYA 2O8DB 4OI1A 1XTJA 2ZSBA 1N5KA 1QG2A 3W8RA 3GLFB 3ECCA 5TV2A 2ZRIA 5JLJA 1FW6A 4M21A 5SZIA 1YRAA 2ZJYA 2V6JA 3GFOA 2ZJ5A 4NTZA 4PC1A 4PHTA 1PVOA 3OE7A 2HUPA 3FMOB 4KYUA 1KIMA 1E2PA 5FI1B 4LBWA 3BFKA 2WVJA 3I73A 3AUXA 3QG5A 3AVOA 1EFCA 4DSNA 1GM5A 4W9MC 3HWSA 1GNQA 3MLEA 4JBXA 4E09A 3U5ZB 4IEEA 1JR6A 2V9PA 2H18A 2OSBA 2BCGY 3BJIC 1T3HA 4IDPA 4DLYA 4A82A 4B71A 3GLIB 2FFHA 3U3MA 1KY3A 3SN6A 1EX7A 5L3VA 1G3RA 4ZCLA 1Z29A 4YDHB 4D26A 4IVQA 5GJBA 3U4QB 4BFUA 1E0SA 2CVFA 2H17A 4Q5IA 1UADA 5DSZA 4TLDA 1TQDA 1EFRA 1W48A 4OHYA 1DAEA 1UKZA 1WA5A 2DR3A 2RMKA 2CLSA 5CYOA 4GBMA 1GKUB 4Q4HB 2FGJA 2VBCA 1TQ6A 5GVRA 3SR0A 4ZDIA 4TT3D 2H1LA 2EWWA 4II7A 4RD0A 1YQTA 4WA7A 6Q21A 4W5HA 2B92A 3THWA 4JT4A 2ZUDA 1OXUA 1VECA 2ZSAA 2E87A 4MKIA 4X8OA 1G6HA 1W44A 3VQTA 5KPJA 2FA9A 1OXXK 4BZXA 1W5SA 1XD2A 1WQ1R 2VF8A 1SVLA 3P27A 1TX4B 4YMUA 3P26A 1NIPA 2QTHA 1U9IA 1MRSA 5KNCA 3UIEA 2ZVQX 4P3YA 4TMVA 4YONB 3QPVA 4DSTA 2ZAMA 1AK2A 2GHIA 3U3JA 1YHNA 4JLPA 4PPQA 3D3QA 4O25A 2GJKA 3GJ8A 5BN4A 4KITB 3RS7A 1SZPA 2ZI4A 1IQPA 2PJZA 1VG1A 4URWR 1DO0A 2X19A 2MSCB 1UBGA 2EYQA 2QI9C 4B47A 2ZRPA 3W6NA 2GXSA 1AQUA 5FUVA 1E9CA 2RH5A 4TT3A 4KJZA 3P1JA 3K70C 2WBLC 2GDJA 2CJWB 2JEOA 1G21E 5CJ2A 1S2MA 2VTKA 1KI6A 1M2OB 1MOZA 1QHNA 1VIAA 1KHTA 4IDOA 3CRRA 4XVRA 3A1UA 1RRGA 1Z22A 3QKSB 2KE5A 3PXGA 1VPLA 3HU2A 3V00A 4URXR 1N5JA 3LLUA 1DAIA 3RVBA 1NVXQ 4XWKA 4DDVA 5DO9A 4PAMA 5JEEA 1W0KD 1RFLA 3TSZA 2AK2A 3ZZ0A 4NYJR 3ZVMA 2C77A 1G8PA 2DB3A 5HKKD 1KMHA 3BK7A 5EJEA 4CIDA 1GL7A 4QHYA 3TMKA 3WRXC 4HB0A 4LGMA 4TMZA 2Q9CA 1KJZA 4GOJA 3NIBA 4LY6A 2OFWA 4LBVA 4HUQA 2JLZA 3DDCA 1SXJB 4CEJA 1KK3A 4JSYA 1F60A 2HJVA 4D4JA 4JKIA 2X2EA 2XB4A 4QXAA 1BS1A 4RD2A 3K0CA 2OHFA 1N25A 1X1RA 1JJVA 3IIKA 2HEIA 5KHOC 1W2HA 3SFZA 1QHIA 4QGFA 4LSGA 4BASA 4TYNA 4HAVA 4ON9A 1NN5A 3KJGA 1G19A 4N1AA 1Z3IX 4PSAA 2B6HA 5AJWA 4PHGA 5FBLB 3DOFA 2IYSA 2PX0A 3WY9A 4M1SA 1TUIA 4ZDWA 3FMPB 4Q9LA 2CDNA 1ZNWA 4FIDA 5JECA 2VEDA 1HY3A 1N0WA 2WTUA 4TSFA 3TIFA 3QVVA 1KK1A 2AWNA 4BEBA 1SXJC 1ZW6A 2Z43A 2ZANA 4L8GA 5CLLA 1T3SA 3R7WB 2GF9A 2FU5C 3R9XA 1II8B 1JAIA 1XRJA 5KSZA 4DLXA 1RW4A 4GPTA 4JVNA 4V02A 4BFVA 4PQRA 4TYYA 5F3WB 1IONA 2JATA 2R6CA 2WWFA 1R10A 1N6KA 2JCSA 1ZNXA 3LH5A 4LJ7A 4PAQA 3LV8A 4MRRA 4NCNA 1Z0KA 1W2GA 1DG1G 2HXSA 2WSSD 2AKYA 4UJ3A 2KWIA 5EUMA 5FOVA 1Q1QA 3RHFA 3UG7A 4D0NA 5K8TA 3REFA 3X1WA 4G5SA 1OFIA 2ZRMA 3OIUA 1UBFA 4RJLA 4ARZA 3DVLA 4D4KA 2GXQA 2Q9BA 2A5YB 1KI4A 5L3QB 1P4SA 3H2YA 1YR9A 2NIPA 1BOFA 1CRPA 1Q57A 2W83A 3M0EA 4NL4H 3BRWD 1ZC4A 1P7CA 3K70B 1RE0A 2IHYA 4M1WA 1MABB 4HATA 1SXJE 2BVNA 5JBQA 3MWYW 1NBMD 1RC8A 1D8TA 1AIPA 2J0VA 4V0ME 4MDEA 2F1IA 3RANA 3K1JA 3LW7A 3TLXA 1GAJA 4HDOB 1TF7A 2I3BA 4U02A 2ZS9A 1KO1A 4B74A 1IBRA 1AZTA 1TPZA 3W3AA 4JBWA 4CYMA 3GPLA 3IEVA 3UK6A 1G1MA 2YWFA 2ZJAA 3LXXA 2Z5FA 3DKVA 1R5NA 4JLVA 1IY1A 1G7TA 4BLPA 1EESA 2ZRKA 3B9PA 3U44A 4QNRA 2I1VB 5B57C 2DHRA 4ESHA 2ZE6A 1NG1A 1G3MA 2O0JA 2WWYA 2EFCB 3AP1A 4CF7A 2J1LA 1Z47A 1AN0A 3H86A 2LKDA 4OI2A 3PFIA 4PZZA 5J5CA 1E69A 3NBFA 1JECA 2QT0A 2YC2C 1KI8A 2ERYA 2J7PD 4JKYA 2QPTA 4KVGA 3P20A 2XTZA 4BFZA 1MABA 2XOKD 4OKSA 3K9GA 5FL3A 3LX8A 4TL9A 2BMDA 4JVSB 2EFGA 4HZIA 2VL7A 1NY5A 4TYPA 1VIYA 1CR2A 1E94E 2BEJA 3THXA 3QUSA 4QBGB 1KSGA 3VTKA 2VYFA 3L0PA 1SKYE 4UNNA 4ASUA 2C78A 3D8BA 1G18A 2ZJZA 4KFTA 3NVAA 1Z08A 1W36C 1KAGA 1NIJA 2ODBA 1OHHD 1U98A 4PC2A 4PPGA 3EA5A 1B0UA 2IHBA 2Q6TA 4KXFB 4PZYA 2G6BA 3K0FB 3BIFA 4TTRA 5FTMA 4C30A 2VRWA 5LB2A 4IVRA 4A4DA 2QP3A 4A8JC 1GFIA 3IPYA 4JLDA 3X1ZA 1E2MA 5AUOB 5J4LA 4CT4B 1COWD 2ORVA 2P0EA 2Q3MA 1ZUHA 2DFNA 1W47A 2XJ4A 4MKHA 5BXQC 3GJ6A 4GT1A 4FMBB 3SZRA 5KOYA 3PEYA 1MV5A 3UKDA 4F4JA 4AG6A 3NH9A 4M8NE 4CEIB 5G40A 3C8UA 3Q9LA 1N0UA 1OHHA 4Q02A 4XWOA 2VA8A 3BWDD 3JVUA 4A15A 2FFQA 5JI3E 4MRPA 1AKYA 3W34A 3ZVNA 1GNPA 1M8PA 2W6JA 1QHYA 4Q19A 3VKGA 1WCV1 4JJKA 4IOLA 3GLHB 2QQ0A 4CZ2A 2OFOA 2CL6X 3BAFA 3LY5A 1GWNA 1XPRA 5DI9A 5L8VA 3SYKA 1AA9A 4QM7A 2OAP1 4DB4A 3KTAA 1SKYB 1ZM4A 4IDHA 4FWTA 2VHTA 2IYXA 4FI3C 4HAZA 1N0VC 4LV6A 1LW7A 1NVWQ 3PQCA 1HV8A 4LHYA 1XZPA 2BBOA 4A6PA 2BBWA 3EIEA 2HF9A 2Z4RA 2ZI9A 3C14C 5B64A 3LLMA 2J0SA 3TKLA 1KO8A 5DIFA 1Z2AA 3SHWA 1G4UR 4LRWA 3W5JA 2H7VA 4HAWA 3UMSA 4DSUA 4Z54A 5H8WA 2I1QA 2ZRAA 3B7GA 5F2EA 4X8LA 4Q4AB 1U99A 4GP7A 2R6DA 2ZYWX 3FTQA 5HR5A 4PHHA 2QT1A 4IFBA 3R8CA 5EP1A 4C2TA 1CIPA 3QXJA 1G7SA 2VP6A 4JMPA 1CR0A 3UMFA 1G7CA 1G291 5FOUA 1LY1A 2OUKA 3PEVA 1PLJA 4AKEA 1KTVA 4PPFA 4OK5A 4QJ4A 5IRCD 3U60B 2WMOB 4F91B 3HR7A 3K0EA 4AURA 3BH0A 5A0FA 5JS7A 2NPIA 5FL7A 1UKYA 2BMEA 3MJRA 421PA 4C0LA 1CU1A 2ANCA 1D2EA 1CTQA 4ASUD 1CJVC 1G8YA 2G88A 4A6XA 4QGGA 3TJZA 3T06B 3SYNA 2GK7A 3LXRA 5CYPA 5H68A 1QHSA 3ZS8A 2IYVA 1E79A 2ONKA 2WWWA 1BIFA 1EGAA 1N6PA 1YR8A 4PC6A 1OH6A 4A36A 1T3LA 1ZM9A 4HDCA 3TQCA 1M1YE 4ZDKA 3QG1A 2NMVA 3JZAA 5DE3A 5EP2A 3DKPA 3KJHA 4LHWA 3BOSA 1NJFA 3QEOA 2BBSA 3GD7A 4LHXA 4NBSA 3EPJA 1EFRD 2CHQA 1UJ2A 3B1ZA 4DLSA 4TMTA 5TY0A 5JZVA 4IXNA 3T15A 3QEJA 4RFSB 3LBIA 1RYHA 4DLWA 4KFRA 3N5CA 5B30A 2J0QA 4RKFA 2H57A 1E4VA 2F1JA 4IXMA 2WHXA 2VLIA 2C04A 3GLGE 1YZKA 1GP2A 2QZ4A 1W5TA 1DS6A 5ANRB 3RABA 2IYUA 4K81B 4C9BA 4S2EA 2F3TA 1E0KA 4TYWA 2QTVB 1AJEA 4W5WA 4D0GA 1Z6AA 1CJTC 3ASZA 5CITA 3AF1A 3RNLA 3ZS9A 3QKTA 4EFNA 4QFMA 5J4KA 5FBVB 5K8IA 1HE8B 4NYIR 3NC1C 3A37A 1DOAA 2CCJA 3CF0A 3ETLA 1XX6A 1OYWA 2BC9A 2PT5A 3L43A 1CULC 1OXSC 2GZDA 2WWXA 1KKMA 4C7OB 4C0QC 1XMIA 4HZUA 5JWOA 3AVYA 1AS3A 4IJMA 4URYR 2HT1A 4PO9A 1BH2A 3QKUA 1VYTA 4I1UA 3D6TB 4KYIB 3S1AA 3WYGA 4CGZA 5JRJA 1E2LA 1TUEA 2KBFA 4S35A 2JLXA 2DBYA 3CR8A 1E1QD 3N2EA 1YZTA 1GOTA 4BUJA 2O5VA 1HE1C 3C7KA 1WRBA 4QRHA 5CJPA 1NVVR 2OG2A 3PEWA 2FFBA 2F43B 3Q7PA 2IXEA 4ZI2A 1D6JA 3DL0A 2OBNA 2FF7A 1W49A 2V1XA 4PHFA 3RRZA 3AVVA 2O0HA 3WNCA 4OJQA 1HT2E 1FL9A 2CEAA 1HEIA 3F5FA 4TMKA 2F3RA 1U94A 2JAQA 4ZCMA 5CM9C 1XEWY 3T1QA 8OHMA 4R98A 1E98A 4HLDA 4BFYA 4A0GA 3LX5A 1R2QA 2QRNA 2ZR7A 5JWRA 2JGNA 2ZE7A 2H92A 3WBKA 1OIXA 4BFSA 2D74A 4LC1A 2G1JA 1FOEB 1ZUNB 1B23P 1IXRC 3KFXA 4KSBA 3R20A 4RFVA 1XJ0A 1TF5A 3TSWA 2WMNB 2QMUA 4D4MA 2J0UA 3B5JA 3J81k 3EPKA 2XZPA 1RPZA 4GMDA 1A1VA 3OE7D 3FFAA 4HZUB 2KJQA 1S9DA 2VHUA 3OEEA 4GZLA 1UM8A 2QEQA 4JLKA 4AD8A 1H8HD 1I4DD 1U81A 1RRPA 2YZ2A 1J8MF 2W2VA 1P2SA 1N6IA 1YRBA 2DFKB 4EUNA 3RS5A 4IKEA 1DBSA 5LDDC 2CNWA 2PLFA 3D7MA 3KQNA 3VR4A 1ETUA 2OXRA 5FI0B 2OEPA 4NYMR 3AKCA 4JL8A 1KJWA 3I92A 3PENA 3TNFA 5CK4A 2EFHB 4RZXA 4M9SA 3P4XA 2VHCA 3DM5A 2YWHA 4V0MA 3NC0C 4P4UA 4AKHA 2J7PA 1FP6A 3X1XA 3PUXA 1QHHA 1E4YA 2IUSA 2QGZA 3EG5A 3KQKA 1DO2A 2IYZA 5EE3A 4OQXA 1AKEA 2GZAA 3L2OB 2W00A 4EQ6B 2DFTA 2O8EB 3I8SA 3SI7A 2GAOA 2PX3A 2ZR0A 3CUEF 4C0BA 3KQUA 2ORIA 3ADKA 4XD7A 4EAQA 1PZNA 2GA8A 4TLCA 4TTPA 1RRCA 4C2UA 2IEYA 4AKGA 1HURA 3PR1A 3RS4A 1S3GA 1IAQA 1VG8A 1N5IA 3NTUA 5JHHB 4HLQB 2X77A 4Q1FA 2VP0A 1W46A 3CPJB 3VR1A 4CEHB 2C03A 3EIQA 1ZD9A 4Y0AA 5FBWB 3RRMA 4NCKA 4HDQB 2FPLA 1C9KA 2SHKA 4KFUA 3AEZA 2ZRCA 4RD6A 3KB1A 2YJTD 2UZIR 4OQNA 1MO6A 1U90A 1JNYA 1Z8FA 2ZU6A 2ECKA 3ZDQA 3KFVA 5A5GA 2KB0A 1T6NA 4OI0A 4IRUB 4UXHA 3DOEA 3AM1A 4MGKR 2OV2A 2ZUBA 4B33A 4PZLA 1HT1E 2OFXA 1XCGB 1NSFA 2BM0A 2BV3A 4PO1A 4BLSA 3FHTA 3IIMA 3F3YA 4BLRA 3CNOA 2DYKA 1T9HA 1P6XA 1XDBA 2ZUCA 4TMWA 1U0LA 2WOOA 2HLDA 4Q7MB 2IUTA 3THWB 1UBEA 3KL4A 4R9UC 4BFWA 4JYCA 2BJWA 2JIZA 3KJEA 3QXXA 2FFAA 2V7QA 3LBNA 3U61B 1FX0A 3G5UA 2GVDC 5EE5B 2QE7A 1TQ2A 4TLEA 1KI1A 3X1DA 2E1RA 2EYUA 1KI7A 5B2ZA 4EJSB 2D7DA 1E32A 1TQ4A 3BBPA 5FUXA 3UATA 4BWYA 5E7MA 4BLQA 3SQXA 4QC2A 5DI3B 1VHTA 1LTQA 2PL3A 2UZ3A 2VP2A 3CZPA 3U4QA 1OH7A 3I32A 2FSIA 2HYDA 1XJCA 4OJKA 3VFDA 1ZAKA 4MRNA 1J90A 3OFND 4DLVA 1BYIA 2A5JA 4M53A 3I4LA 4QOSA 3SOPA 3O8RA 4WXRA 4A1FA 1LF5A 4A9AA 1S1CA 1WXQA 4B3GA 5FFMA 4G5OA 2BOVA 1UBCA 2TMKA 4PSKA 2V8OA 2IF0A 1OH5A 3HPQA 4ITRC 1KYIA 1G7RA 2XZLA 2XZOA 4EPWA 1US8B 4NONA 2ZE8A 1CR1A 3VKWA 2GJ9A 4LJ8A 1L8QA 4HAYA 4EJSC 3UPUA 1KKLA 4LYAA 2OBLA 3AVPA 2QP9X 5AUNB 3NXSA 3UG6A 2IYRA 1XF9A 4I99A 4Z8XA 2JLYA 4ZCIA 4JSTA 2H16A 3MG9A 4F93B 3CX8A 2IT1A 4L5BA 4AC9A 5BN3A 1R4AA 1RKBA 1TU4A 3E1SA 3KKPA 2J87A 2J7KA 1CJUC 3GLIA 1T4GA 3VX4A 5J4HA 3WNBA 2XSZD 2B7CA 2WICA 4NCJA 3WMEA 5HE8A 2GJAA 1XMVA 3CRMA 3THXB 4NMMA 1UDWA 3HJNA 5CDFA 1U8AA 4A8JA 2OCAA 3BD9A 1GRRA 2W2TA 3QBTA 3BB1A 1N6OA 5LB4A 3W6OA 2NZ8A 4L9WA 1XCPA 1Q3TA 4B43A 3K09A 5AUPB 1AGPA 1T5IA 4DIEA 1E99A 121PA 2ZJOA 3B60A 3MSXA 5D3MB 4FCWA 4UNPA 4QGAA 4RD4A 2PZFA 3PVSA 1IJFA 5UKDA 5L3QA 1AS2A 1ZIPA 2FDCA 5EZ6B 2CE7A 3SU8A 1ZP6A 1N6NA 4PQFA 3HU1A 2AX4A 4KCGA 4QBFA 1L4UA 4HLUA 3T34A 1H65A 3EXAA 2A78A 3B8HA 2XB2A 1NN1A 5FOSA 1QHXA 2IEZA 2HJGA 1U8ZA 3OAAD 2G9NA 2BMJA 2WZQA 1EK0A 2RGBA 4LJ6A 1W36D 1LNZA 3AF0A 2YV5A 1ZUIA 1WBBA 4CDGA 3OEED 1JJ7A 1IN6A 1EX6A 1DE0A 4US1R 2ZJBA 1KAOA 1NJGA 3LQRA 2CCGA 5DISB 4NP6A 4TN1A 1NBMA 3MWKA 4KBFA 4Q47A 2GVZC 1MT0A 2HDNB 1DAFA 5H1YA 3PUVA 4ZKDA 3OEHA 1E9RA 2BIFA 2Y8EA 2FG5A 3WRYC 2FJUA 3N70A 3C16C 1PUIA 3B1WA 1UKVY 4UXJA 2QL6A 4YMSA 5KTYA 4KVAA 3EZ7A 4I1VA 4TTQA 4DXAA 3K0SA 2QENA 621PA 4TZ6A 3WP0A 1XBTA 4Q4JA 2DCUA 2R6AA 1W1WA 2DFLA 2JJ2D 1ODFA 1E1RA 1M34E 2YVUA 4PO8A 2HT6A 3W9YA 1BMFD 3AF3A 2D62A 4G1UC 3O47A 4LYHA 4C4PA 3GP8A 3TUJC 4FMDF 4TMXA 3I5YA 2CLCX 3AV0B 4US0R 2AL7A 3GFPA 3JVVA 5EE1A 4HUQB 3SC3A 4D82A 1AS0A 4KSCA 1QHGA 4G5RA 3MRSA 3N2IA 4OQLA 4PR0A 1CRQA 3SHFA 1E1RD 3NHBA 1NY6A 3THYB 3CRQA 2BM1A 5KSYA 4B35A 4B3CA 2C98A 5IT5A 3IHLA 4Q4LA 5LD2B 2PEYA 3TUIC 3GCGA 3RC3A 2JLQA 2A9KA 1S0UA 5KDDA 4N0EA 4OBEA 2R9VA 1F6BA 3CM0A 3ZYCA 2RGEA 3K0AA 4E5UA 2QU8A 1KI6B 1C1YA 1VMAA 2RHDA 3CONA 4V0LA 1G16A 2PH1A 1I2MA 1DADA 2O8CA 1G8HA 5BYJA 2LWIA 1O3YA 2R8RA 1J2JA 3QJYA 1G8FA 2CMKA 4TL7A 5DN6A 1GRQA 4FCTA 3R9IA 2F1HA 3I5XA 1T91A 4G01B 4EKDA 4F38A 3H0KA 2P6UA 2Q3FA 2R62A 3FMFA 4MA4A 1TL7C 2FZ4A 1FNMA 1FFHA 4HEJA 5D3MA 3MCAA 4JVLA 2PBRA 1P3JA 1C4OA 1SXJD 2WV9A 2WKPA 3RS3A 3WP1B 3B13B 2YHSA 3E2IA 1J7KA 2NO0A 3WYFA 5AUQA 1WB9A 3K0CC 2G3YA 1KO4A 2O8EA 2GBLC 1MO5A 4JLNA 2ZITA 1XEXA 2ZJ8A 3I1FA 1EFHA 2B8TA 1HQYE 2FH5B 1SVIA 3IIJA 5KPDA 3Q3JB 3IEUA 3TE6A 3LW8A 1LS6A 2WJYA 3E70C 3FKSA 3TAHA 4DIDA 1NNEA 2C8VA 1TMKA 4U5XA 3CPEA 3CZQA 4OYHA 2ZE5A 3CWQA 2MMCA 1NL3A 3FE2A 3RSLA 2RGCA 4GFDA 5AJXA 1KZ7B 2WWIA 3GEIA 4WBSA 4WVFA 1KK2A 2XNDD 3IO5A 3P4YA 2IL1A 1JPJA 1YZNA 3QXHA 4UNRA 2IK8A 2WIAA 4ZDJA 4BGDA 2XSZA 2QUZA 3AGQA 2R6FA 4ACBA 4LZZA 3EC1A 4RZUA 2PT7A 2ZSFA 4Q1BA 2A2ZA 2GCNA 1RYFA 2CCKA 4BFXA 1XPOA 3NBXX 2NPFA 4JLOA 1IY0A 3ZZUA 1YE8A 3KUCA 1II9A 1R8QA 5KDOA 1KOFA 4PC3A 2IYWA 5EXSA 3ICEA 2OLJA 1S4QA 1XXHB 3A4NA 2BKUA 1ESMA 1XU4A 3MWLA 1DVRA 2Q3HA 1XWIA 4J0QA 3FKQA 4LHVA 4D0LB 3CKLA 5GJCA 4Q9HA 4P31A 2XX3A 1TAGA 4FWIB 3FKSD 2B21A 1IXZA 1LVGA 3EWSA 4NCHA 1U9IC 2NTYC 5C4GB 1R6BX 5P21A 3FDIA 2GCOB 3U7HB 4W7SA 2IXFA 3TW8B 4E03A 1GNRA 1WF3A 2XNSA 4XIGS 3REGA 2OCBA 4R71A 2OESA 3V4RA 5JJLA 2O8CB 4B32A 1CP2A 2GCOA 4PXAA 4JLAA 4HAUA 521PA 4Q9JA 3GLIE 1OF1A 3OHMA 5DNYB 2ZM5A 2W58A 3AF2A 1Q12A 1N3BA 2ZRJA 1E79D 2IX3A 1X8JA 3I72A 4XSHA 2FE4A 1KO5A 5EXXA 2OXCA 2FSGA 4RY2A 3EPLA 2CVHA 2IYYA 4Q1EA 4TL6A 3KKMA 1XXHA 1SHKA 3SYLA 5K8LA 4WXPA 1ZU5A 1X8LA 1ZYUA 5E7JA 4ZO4A 2ZRNA 2QMHA 2ZQ5A 3VU9B 3CW2A 1Y63A 5JCZA 1V5WA 3R9WA 3RSOA 1J8YF 3GMTA 4AG5A 4EPVA 2PEZA 5FTKA 3PCRB 1N6HA 3MGCA 1TTTA 3QPWA 1XXHE 3ZVRA 1FTNA 2OLKA 2RGDA 3ND8A 3ZD7A 4O2RA 3WMGA 3IBGA 5FOWA 2CL0X 1UFQA 2E9SA 4V0KA 1ZBDA 2IYTA 4GRAA 1S3SA 5JCPA 2ZEJA 1LS1A 2ZYUX 4LYFA 1NVVQ 3VHXA 1DARA 4TL8A 5LBIA 1P9RA 4M1YA 4NKRA 5GJVC 3A58B 5TMPA 3NBYC 2GXUA 3Q85A 4M22A 3V9PA 4D6PA 5EQTA 1RJ9B 3CX7A 4DCSA 4TQUS 3TUZC 2WKRA 4L4UA 4RFSA 5SZHB 4URZR 2BHRA 3PITA 4AYXA 2DWOA 2Z6VA 3DZ8A 4NYJQ 2ERXA 2ZIAA 1QVRA 1VCIA 1ONBA 2AD1A 1KI3A 3PIRA 4WOPA 4B3BA 3NBZC 3I3SR 1KSHA 2J45A 3BB4A 4LDJA 1GG2A 2CL7X 4QBIA 2CJWA 4FMDB 1BMFA 4YC7A 3K70D 1E6CA 1TNDA 3KXLA 1EFTA 4G3XA 5HCNA 4ZI3A 721PA 1Q20A 3G0HA 4ABYA 4BRUA 4AI6A 3B85A 3A6PC 2O52A 3DZDA 1VG9B 4JS0A 1JBKA 2ZJ2A 4HB4A 4F4CA 2JASA 4P4SB 1Z06A 1P72A 5FTJA 2EWVA 5DLQC 3ADCA 3C41J 3ZQJA 2IBMA 1EWQA 3AP2A 4JLJA 4WZ6A 4P32A 3I62A 1E9FA 4C0SA 1CR4A 3GJ7A 1OKKA 1VCOA 5SZKB 4AY2A 3QXCA 3ICQB 5A4JA 2C9CA 2VHQA 1JI0A 5DHFA 1ZIOA 4HB3A 4LV5B 3ZQ6A 3A1SA 1E2FA 2FWRA 4IDQA 5E3HA 1KK0A 2OAQ1 5C46F 5CDFE 2XAUA 1GL6A 1OXVA 3QBVA 1OKKD 3GLFE 2PCJA 3RWOA 2Z0MA 2ATVA 4L15A 3ND9A 4IFEA 1G3QA 2HF8A 2ZS7A 3G82C 2JJ1A 3Q7QA 5BN5A 3H4MA 3ZVLA 1N6LA 2GWHA 5FTLA 2YKGA 1F2TB 4N3NA 4XOIA 1Q22A 1XTQA 3HU3A 2C99A 2CLDX 5DYIA 4AKIA 1L2TA 4ZKEA 1UKEA 1XMJA 2D2FA 4GI7A 4XD7D 2L0XA 4DC9A 3K9LA 3LO5A 2CK3A 4KI0A 4O3MA 2X2FA 3VNVA 4Q4JB 3QQ5A 4IOMA 2IS1A 2JLRA 5JHGB 4DCVA 2QTFA 3A1TA 1W7AA 2ZREA 2J59A 1DAMA 1OXTA 1XTIA 1SVMA 1G5TA 2QMOA 4NE2A 5HPYB 3FOZA 1A4RA 4RCZA 3BC1A 1E2NA 3Q5EA 1PJRA 3T1OA 4DHEA 5J4VA 4OHVA 2FSFA 2QSZA 2VP4A 1I2DA 1P2TA 1X86B 3TVDA 2OCPA 1IN8A 2WIBA 3IPXA 1F2TA 3GEEA 3I8XA 3QKRB 3MMPA 4F4IA 1XEWX 4JYBA 2G77B 4US2R 1MR3F 2ZETA 1AZSC 4QJ5A 4RZ3A 1Z6GA 3ZGXA 2O8DA 2NO1A 1D2MA 2YC4C 3PEUA 2AK3A 4LWZA 1NP6A 1XNJA 3RLFA 3L0SA 2W0MA 3TBKA 3NDBB 1F48A 4BQSA 2QA5A 5FH9A 2IWRA 4Q03A 2J3EA 4P33A 4MDFA 1G3UA 5GADl 5GJWC 3FGNA 4QG7A 1XB2A 3QOFA 2F1RA 4CVNA 1XPUA 4Q7KA 4BRWA 5JI2E 1RIFA 2DY1A 2QAGB 5FBQB 1Z6YA 4MKFA 5EUQB 2Q9AA 3GJ0A 2ZU0C 4H1UA 3F0TA 2ZPTX 2JDIA 5FPHA 1IXSB 4YXWD 3F8TA 2B7BA 3CPHA 1XTRA 2RGNC 3FVQA 3ZJYA 4MRVA 3IQXA 4GSYA 2BKEA 1ZD8A 2RB4A 3EZFA 4HSEA 4LYJA 5EP4A 3SBEA 3AVXA 1JXOA 4R2HA 2QBYA 4AYWA 2A5DA 4MUBA 1HTWA 1P9WA 4M9ZA 3UANA 3DHWC 3IILA 3WHLA 1N6RA 3U6BA 3EZ9A 3EA0A 1AM4D 4XSGA 2JA1A 3WNDA 3U44B 1T0HB 2V55B 3HDTA 4LX0A 3WHKA 3PG5A 5GVSA 1H8ED 1SVWA 4LJ5A 5KSOA 2CHVA 1PLLA 1UEJA 4DT1A 1P60A 3C5CA 4URVR 2YINC 1IM2A 1E2DA 4HYYA 3MAAC 5JRZA 3AVQA 2GEDA 3EIHA 2RKOA 1P61B 4ZV4A 2HV8A 1NVUQ 3K0AB 2IF2A 1J70A 4M1MA 3TGPA 3M6AA 2REXB 2WKQA 5FPYA 1I4LD 3ZH9B 2A30A 1YZUA 1U0JA 3OZXA 3EARA 1IOZA 5E7IA 4CW7A 4Z8YA 1NMYA 1FMLA 4KLZA 1GDDA 3LAWA 3NWJA 1QG4A 1MKYA 1TEVA 3A36A 4IW3B 3MFYA 3VR2A 3LFUA 1X1SA 4L16A 1XD8A 1M7BA 4F92B 1Y3AA 4HB2A 2Q21A 2W6IA 4ARZB 2XTNA 1AGRA 1OB2A 2ANBA 1JR3A 5AJYA 1KSJA 2IA5A 2ZYTX 3KTAB 4RSGA 2NOAA 2VQSA 3WXMA 1OH8A 1E2KA 4P4TA 5DHAA 2CXXA 2ODWA 1WDTA 4JT2A 1OW3B 1KSFX 2OILA 3VHLB 3CWZA 1Q1BA 3X2SA 3QNUA 4JL6A 2ORWA 4FMCB 1KGDA 3VMFA 1Q3HA 4V0OA 1E9AA 3CRW1 4Q4AA 2OZEA 3TSOA 2REBA 3BORA 2HCBA 4CT5A 3CNNA 1M7GA 4NCIA 2ZR9A 2J9RA 2VSXA 1RRFA 2QAJA 2W6JD 1U2RA 2N46A 1OE0A 4XVQA 5J40A 4TZ0A 2F9MA 4EIWA 5J47A 1Z6TA 4Q1AA 2GILA 4LJAA 5KO2A 3Q72A 3W5IA 4GOXA 2N42A 4JVMA 3FMIA 4NH0A 4UKDA 1OIWA 1FZQA 4BE7B 2GNOA 1W4BA 3W8NA 5DN6D 1E0JA 2ZRHA 2XXAB 3QVUA 5FR1A 4DCUA 2H5EA 1JR3D 4TYQA 2F9LA 2ZVPX 3IGFA 4MUAA 5EE0A 2VO1A 2AFIE 4LK2A 3W6PA 2V4ZA 1JQLB 2D4HA 1K8RA 4OHWA 3NEYA 1DAHA 4BFTA 1SGWA 3AVUA 1G20E 1YVDA 5CB8A 5KNDA 4M1OA 2A7QA 1X8KA 2A3RA 1RVDA 1MRNA 1SHZA 3IBYA 4DZZA 4DLRA 4CEIA 5E95A 3ZD6A 4EQ6A 4B6FA 3KQHA 2ZAOA 3TR0A 1II0A 5JSZA 5B58C 1Z0JA 1EG7A 4ZIRB 4UQOA 1DG3A 2LKCA 4I1OA 4RKEA 4B6EA 4RD3A 3W3ZB 3ZIAA 4DT1B 1F2UB 1WMSA 4DUGA 2QPAA 1SQ5A 1YR6A 2QY9A 4LPKA 1G5RA 5J4YA 3DEFA 5FPKA 2FOLA 5FPSA 3CBQA 5HCIA 5SZJA 2ZRFA 2AFHE 5F98A 2VIIA 3GLGB 3A4MA 2QRZA 1GVNB 4YQFA 1K5GA 2D7CA 5HE9A 4PQYA 2I4IA 2JIZD 4C3ZA 3O8DA 2CHGA 5C18A 1NN0A 3CH4B 4Q1DA 4B2IA 2QBYB 2FPKA 1ZM7A 4TWZA 2PMDA
chains in the Genus database with same CATH superfamily
3HPRA 2DPYA 1SPXA 1C2YA 2V0NA 5GINE 3SLKA 4ZRDA 1I6WA 4J2OA 2ZI5A 3IHWA 4AJKA 1XCLA 1FFYA 3OCVA 3A1WA 3GPDG 3UN1A 5AKHA 2QAGA 2QPLA 1HPLA 2A8YA 1LW6E 5C5DA 3GLGA 2AFVA 4MVXA 4U2FA 3TGWA 3FVVA 3LXMA 1A4UA 2UUOA 4ML3A 4Z3KA 4G0VA 1MB4A 2PL9A 1KRXA 3LRTA 4D2IA 2XEXA 1EX9A 1KA9H 3QXSA 3HXQA 2ABWA 1REQB 1RWOA 3F6SA 2DKNA 4MITA 5SY9A 4BEJA 5JATA 2B61A 5F9FA 4G1EB 1C9NA 1MOPA 4HVCA 2TECE 1HDXA 3FHOA 1NNI1 1H1LB 3IDZA 4RM3A 1KYWA 4EKEA 3TG2A 2FPPA 3EC2A 3TO5A 1JALA 1SBYA 4HGNA 2C2HA 1AGYA 1Q0SA 5IAOA 4JJIA 3HZZA 4D6XA 1DRUA 3TOSA 1DBQA 1NLUA 4B0PA 2V7GA 2IXGA 4HPJB 2B99A 3O0DA 4UTPA 3DWFA 1A8PA 2VTEA 3WMFA 1VE5A 1RQXA 3DAFA 5BSVA 1QIFA 3V9AA 5CIWA 4MV6A 4KXVA 1PQ4A 1FPMA 4BV2A 2VDPB 4N8EA 2HA5A 2YVQA 1SQ0A 4FYJA 5JAHA 2IYFA 4P3KA 3M1LA 1MW9X 4EHKA 2XCUA 5E9WA 3UMBA 3IDQA 2PV0A 1OU0A 2MU1A 5F3DA 3GGCA 3HC7A 2CW5A 1I1HA 4FMCF 4IY1A 1KYQA 3H1BA 3V2HA 1KXJA 5T4FA 3I8OA 5EYPA 1SPBS 3FZYA 1X7YA 4L07A 2HRDA 1RTKA 4Q3NA 3HYTA 2VQFB 3DO5A 1WS6A 4FDUA 3EAQA 4CKBB 1YA6A 1T1EA 4F6RA 3H9UA 1RWWA 4RC9A 3DMGA 4A2PA 4KNWA 3HCDA 4F1WA 3OTWA 1VIMA 1CF4A 1X15A 5IUNC 3CLUD 1A2BA 4MPPA 2D00A 2YFQA 4M7RA 3WYDA 4C4RA 2W6ID 4DWWA 4QQRA 5JO0A 3V80A 2VH5R 1MA0A 5AH0A 1PG5A 1QQ6A 1YZ3A 1X2EA 3W2FA 4H27A 2OA0A 1DEKA 2B9VA 1WDKA 2CYCA 4JZKA 4BC1A 1DTSA 4R1LA 3ROXA 4BY9E 3V4VB 2QAGC 1F8XA 1E1CB 1KFCB 1TEXA 1VSTA 4PFSA 5DYGA 2P77A 5KX5F 3Q9SA 3OECA 4HMOA 4MO9A 4BE9A 3GZ4A 1LDBA 4D4LA 2GR9A 3OM1A 2FWJA 3I5UA 2FSHA 1JPNA 3PDHA 2NO9A 4M1QA 4R2IA 3VR6H 5HUJA 3FETA 2D2EA 3TR5A 3JWEA 4UVIA 3MWJA 1QM5A 3T4EA 2R8BA 1UQUA 1RKUA 2ATXA 4W9RA 2DHEA 1B0ZA 4OCZA 3WSVA 3KOWA 4EX7A 3I0ZA 4PVCA 2QAIA 2J41A 3TM5A 4LEIA 4AF7A 1TJYA 1NI3A 1E2JA 2IGBA 1N32B 2WY2D 2VJDA 2OHIA 4DDHA 2C9MA 2IWHA 3PQ2A 3GCZA 2AWOA 3TI9A 1YZYA 1Y37A 4K6KA 4PRYA 1XDDA 2ZQZA 3U6KA 1BCRA 2WM9B 2L18A 2JHCA 1PK9A 2WUEA 4KN9S 3OQIA 3ST7A 4C43A 3L1JA 1VCMA 3H5VA 3JVDA 4BX3A 4DQDA 3C74A 2JIPA 1Z0DA 5D5PA 1TYZA 2IHTA 1T8UA 4OKIA 4A0RA 2KI5A 3K8YA 3ETCA 2JGEA 5ALEA 4DCPA 2I5PO 1HR0B 2JJ2A 5A4KA 1JG2A 1R9MA 4BECA 4DB2A 1IN4A 2G63A 2NSHA 5DLDA 2WEKA 4U7DA 3D4LA 3VGJA 4DMLA 1NMXA 4RAQA 3MWGA 4TM8A 5H4HA 3OMXA 3WQBA 2FMKA 3KJFA 3O2NA 5KSPA 4C2BA 5MN6A 1OYYA 5FOXA 3U17A 1AKMA 2AIRA 1W88A 4PLZA 1ADFA 1GNTA 3DR5A 2R7MA 4B7UA 2G4LA 4A0HA 3U2QA 1FJ2A 5CBPA 4WD3A 1B0AA 2QB5A 3A04A 1CT9A 3HL0A 2QN2A 5AJZA 3ZE2B 3GAZA 2SCUA 4ZP1A 4O5OA 2EU8A 3H1AA 5TQ0B 5KQPA 1SHLA 2AKAB 3L8GA 4HMPA 4KLRA 1DX9A 4L8VA 3LP8A 4PZUA 3EXEA 4Q18A 2C42A 5C80A 3WK9A 1NNSA 2IC5A 4O6VA 3V4OA 4AJLA 1YRQA 1ZU4A 2ZI6A 4V0NA 4WXEA 1ZINA 1TTQB 3JQCA 4LJ4A 3PC8C 3U48A 2YMQA 1DAKA 3HUFA 4XCXA 3FDXA 1MO3A 5K3DA 1XEFA 3ZI0A 4WBNB 3AGPA 1MTOA 3GCXA 1RT9A 3IEPA 4P4NA 5L4NA 1IM5A 1KI2A 1V4VA 2VDNB 3CB4A 4MQBA 2YH2A 1YB1A 3DUFB 1CVLA 2PX5A 2YWJA 4EY3A 2GAFA 1PL6A 1US8A 2J5XA 3I61A 3PRHA 1JHMA 3ZI4A 4BN5A 1H0KA 2F43A 1HI9A 3CIOA 3D4PA 4XPIA 5B3AA 4AJ2A 1GTJ1 3LYLA 4Q9KA 2ZVJA 3INYA 3V4ZA 2WA1A 1NYTA 3WGVA 4H4DA 3HKDB 1B16A 2Y1EA 4INZA 2O2ZA 3ETGA 5IAGA 3WBBA 5JXJA 4EPXA 4MYTA 3U3KA 3U3RA 2QJFA 3OQ1A 2FPMA 1S1MA 2QYOA 1E18A 1SUWA 5TVGA 1X13A 3H2IA 2NVOA 2X13A 5SV2A 3IO3A 3TTVA 1WXWA 4YRJA 1C0LA 1SHJA 2H07A 4FW9A 1N2CE 4CM9A 4D9JA 4JYAB 5DNUA 2J3DA 3L0IB 5BSGA 3OURA 2WPDD 5HQTA 1SIOA 2C5SA 1ZO8A 2Q5FA 3A31A 4UNQA 2EX0A 3GNSA 5ALPA 3D8TA 4DQUA 1QIGA 3PDUA 3PGJA 5G3ZA 5C8XA 2OM6A 3ZKWA 5ES3A 2I9KA 4NECA 3FG9A 2G83A 3ET4A 5DTJA 2HRBA 3E84A 3OIYA 1SD2A 1EFUA 1A8IA 2WWHA 3OFSA 3QX3A 2Z2XA 3CIFA 2IHUA 3GUZA 3A1EA 4P3PA 3KLPX 1XDZA 2AQIA 3IMEA 4YDSA 1J21A 4BB5A 1KY5A 4YY3B 2PGJA 1LNQA 2PIDA 4JKOA 2V3CC 1A9ZA 2FRDC 1FP2A 4LOKA 4B3FX 4ECEA 4OK3A 1CJSA 5LQKA 2B83A 2O3JA 3DTVD 4KHZA 1XMSA 1MJFA 2GO7A 2P65A 4KUEA 4L95C 4XQ0A 5T5QA 2MSEB 3KYCA 4P5EA 1HA3A 1WZUA 4MH0R 2Q45A 2ZUWA 1Z83A 2YW2A 1SVUA 1TEZA 2FLWA 3MF4A 2V59A 3FB4A 5EESA 2P4EA 5JJBA 5FPQA 3SQNA 1UM9B 2I8LA 3TIIA 3J7AC 3UKOA 4IEFB 2RAPA 1ZDMA 2XGSA 4BVHA 4TMYA 1Q7GA 2Y2UA 4KODA 3VZCA 3GYBA 2FPXA 3MELA 2X0RA 2FN4A 4ZI7A 2WTBA 4NFHA 4LC0A 1FU8A 2PTHA 2OO3A 2UYYA 1GQRA 5ALXA 5GPBA 3WK5A 2IH2A 5EZYB 4UE2A 4MNTA 3RC1A 1U6IA 1W4RA 1K5DA 3LVRE 1QFMA 4BPBA 1XTSA 5DP2A 4BLTA 3FMVA 5L53A 1DQRA 1Y0BA 3F4KA 2WP8J 3OQPA 5AMXA 3RS0A 4U7GA 3GLHE 5A4AA 1LV7A 2WJVA 1E9BA 2M98A 1TT5B 3Q98A 4CLRA 4E13A 4KO3S 4YI3A 3ZGVA 5HZKA 4XYLA 2VXOA 2FF5A 4W82A 1IB6A 1XAGA 1P3Y1 2FEMA 2AN1A 2DUMA 3SNHA 5BSFA 4YCCA 4ENQA 1TJ3A 2A92A 3PGMA 4MGYR 2EHJA 3ESZA 1J22A 1VJ0A 4FT2A 3UCFA 5JCJD 4PRKA 3IVMA 3C8DA 2YWEA 4OL0A 3OIWA 1UXIA 3A4LA 1CJKC 5E6SB 4HSGA 5IKMA 1N34B 1SOAA 4LDPA 1XCOA 3RNOA 4ZQEA 3GJ3A 1DELA 3OHPA 3GAMA 1ORWA 2ZUTA 4MMZB 4DMCA 1W4ZA 3D6MA 3E5MA 4QT4A 3PPYA 3GDWA 3RYCA 4E32A 2INGX 4FSXA 4Q3BA 4XYGA 2WHYA 3CFYA 3N2ZB 1DJMA 4WY2A 1YE3A 1G42A 3HMQA 1H1TA 1YQEA 1NNUA 3RKRA 2DLCX 1HTTA 3P71T 4KQHA 1WTCA 3PIDA 1JMVA 4UUQA 4R4JA 5DM70 4KQCA 4JI2B 1T29A 1BCRB 2CHUA 4FJ0A 5IEJA 1KF0A 1EQAA 1Z7GA 2I6UA 3HQ4O 4AWBA 4Q66C 2LRHA 2AXQA 3L4KA 2RCNA 4HCJA 1QOPB 4HI0E 1J2UA 2V6IA 3FB1A 3KVNA 5BV7A 5C8YB 1ZHOA 1TAUA 3HHPA 3OE4A 5E4TA 3I37X 3ZOKA 3ROFA 4EYGA 1QDEA 3EWNA 1HWYA 1W2WB 2R7KA 4YP6A 4YUAA 4KR6A 1U28C 4UHBA 4XXHA 3RUEA 3TDMA 1PZGA 3QLTA 2WILA 5T7BA 4PYKA 3LLVA 3KEOA 4QQ8A 5C1BA 3B1VA 5B3JC 4BVLA 1ABEA 2AFHA 2GSDA 3ROTA 1ZICA 3D3WB 1RQ7A 5HS6A 1ZD4A 2GRJA 3H04A 4RE5A 3TNYA 2XA1A 4XTRA 3HM9A 3GJRA 1FP1D 4MP8A 1P4AA 3EVEA 3JWHA 3PPIA 4RE6A 5TDHA 3SOZA 4PFQA 1E96A 4IIGA 3VR5A 1K06A 4Z51A 5HEKA 4AZTA 4PHCA 2F55A 5EJ4A 2HXGA 2R6GA 2JFVA 4AS2A 5HYVA 1E0AA 3LRPA 2CHEA 3FOCA 4UUPA 1EFAA 1JIJA 4NESA 1Y9ZA 1BJTA 1N4DA 1U0NA 5D01A 2GHRA 2CVQA 4F9TA 4X84A 1D3AA 3FSGA 1FMJA 4W8HA 3WHPA 2AN9A 2JKZA 3CO5A 3U9SA 4HX2A 4MVJF 4Y2TA 5JDCC 5TF0A 4PPNA 3OTOB 3DAYA 1VTKA 3EFOA 3IB6A 3LF1A 2WQ7A 4ILKA 3TAUA 5IABA 1X42A 1QYIA 2IVFA 1V5EA 1KP9A 1NJ1A 1VMKA 3MCZA 4IDNA 3I4CA 4IXDA 4TQAA 2PGOA 4W4TA 5DEOA 1U7PA 4MV8A 4CF3A 2Z95A 3RRBA 1VIVA 3K5PA 4M9RA 2H54A 2VJQA 4RK0A 2RONA 4RBNA 5HJ7A 3GFTA 3OEHD 4BX2A 4ENVA 2UYOA 4TQ9A 2GAIA 5LN1A 5AVYA 2C95A 1E1KA 3AWIA 4PZEA 1QF9A 2B4AA 2C4HA 2GPBA 1UT8A 3OTGA 2UZAA 2ZJ0A 2CNNA 2W42A 3B78A 2AXPA 1N7GA 2Y66A 1T2EA 4QNMA 4EG3A 3GEHA 3PL1A 4HFJA 1R0XA 3P9QA 3RD5A 4B80A 2FEWB 2YWGA 3AUJB 3NHAA 3BEOA 4JMLA 3CKYA 2H59A 4NENA 2NUAB 1NBIA 3A9TA 4IUCS 5CLGA 1GR1A 1A5TA 3HNPA 1SKBA 1QZTA 1UK6A 1I94B 4P3XA 5MFZA 2XQFA 1DFGA 1P5ZB 4GX0A 5EG5A 5CU7A 3ANSA 1CV2A 1SH7A 2W8BA 5CFQA 3WGKA 4EB0A 2AG8A 4D80A 2OV1A 4EEZA 3GJ4A 5ALDA 3ZIAD 3PHBE 1HNZB 4UHKA 4X1YB 4BATA 1L7PA 3N7UA 4D41A 1XV5A 3B82A 2NUTB 3O93A 2WWTA 1AHNA 4HC4A 3ZLJA 2C96A 2V54A 4U7WA 1PJLA 3I1YA 4EI7A 3PE3A 1U5BB 2AHOA 2G28A 5BSWA 3H4IA 3OM8A 5K4GA 2HADA 1OPXA 1S9HA 3ITEA 3W8EA 1X7WB 2FMIA 4OXQA 2VZ8A 4LOAA 5ALSA 4CTNA 2MSLA 2GUWA 1L1FA 3CJRA 1SCQA 5FWYA 3GEBA 1NW6A 2P75A 5FA6A 9LDTA 1XALA 3IQHX 5I9IA 2NX2A 2Z5LA 4HGPA 4NS4A 4RCYA 5JFGA 5JNLA 2J6IA 2I99A 2JJ1D 3R0XA 3LG2A 5DGXA 4BO0A 4BNWA 1FQWA 2HLDD 2IU3A 3IPRA 3KLOA 2IEGA 5DX1A 3SS7X 1YU9A 4DL9A 1R00A 1BEEA 1VCHA 4I46A 5ALRA 2CY0A 3AKYA 4XH9B 2E6UX 4DLTA 1BROA 3RVDA 3UXMA 1LRLA 2O2SA 3C48A 1KNXA 3PXAA 5C2JB 4NNPA 4BZQA 4ENRA 4AN1A 2C4TA 5HTKA 3KKZA 5K7SA 5KVVA 3N6XA 1WR8A 1P81A 4AWAA 3C3EA 5CNKA 3TQIA 5JH7F 3HYLA 4ZU6X 3DTNA 3EGIA 2AKEA 4F84A 3ZE8A 3H9BA 3AHFA 4B34A 4C89A 4QICA 5ADWA 1GKYA 4DDKA 1SRRA 4JC8A 3Q7SA 3GRKA 5KC8A 1EP2B 1CZOA 1R0ZA 4FFDA 5B6PA 1XJQA 2CYBA 3NKVA 2BDTA 2PCLA 4LKOA 3S2UA 7AT1A 1DLIA 4U2DA 3PLRA 3DUFA 4YPFA 4JENA 1E61A 1GVHA 9ABPA 4RTSA 4L0MA 3PXXA 4UHCA 1VL6A 2QM8A 3DF7A 4QUKA 3EGVA 1QVAA 2HCJB 4YAIA 5FOTA 4WN9A 3R7WA 5MN5A 1FNBA 4GZ3A 4E30A 4FNOA 4Q00A 4B73A 1OASA 4C20A 1QGOA 3RTCA 1BKYA 3U13A 4Q7LA 1I6MA 3TJMA 4KV9A 2RHRA 3OPQA 2R6HA 5B1DA 4NDAA 1JZSA 1QWSA 3Q40A 4JI8B 3EW9A 1GZ6A 4B6RA 4KLNA 1FFWA 2B4YA 2ODEA 5I7OA 5AW9A 2W48A 4BP3A 1RYBA 4IINA 2HIGA 2VZ9A 4HDNB 3NHUA 3SSAA 4C4TA 4M0DA 2F6RA 2GLXA 1AE1A 2WYOA 4X00A 1B8NA 3OIVA 2RC6A 1PD0A 1KS2A 3FPCA 3MJVA 3I83A 4NHOA 4OBXA 1NMZA 1O03A 1HQCA 3EVAA 4DVJA 4E6PA 4YRNA 3VNUA 1BYUA 1FQKA 2IUUA 5C4IA 2JDID 4RIFA 3EUEA 4RHFA 4BVAA 3PJRA 4J2TA 4E5MA 5H59A 2UVQA 1CUJA 4Q12A 3FBWA 3SQLA 1ESDA 1E2UA 5CX1A 3FPAA 1M73E 4GP6A 4HP8A 2FHPA 4RQTA 5COQA 1L4EA 5HILA 4G81A 4P0TA 4GXQA 4V03A 3B6JA 2EF1A 1ZD5A 1R6TA 2PZEA 1WXDA 2FZVA 3OQJA 4F3NA 3W2HA 2JLSA 2HHHB 1KFEB 3BKWA 1SC1A 4GPD1 2XNDA 4AZSA 4MI9A 1ZH2A 3HS3A 5BQXA 1TUBB 5KQRA 4G0NA 1XTPA 1L0BA 3KX2A 5C7YA 2ZI7A 1EIWA 5K3FA 2B37A 4TS3A 2ATCA 5ELXA 3LMKA 4YRRA 4WZBE 1QBKC 3RYTC 4JLBA 1FQJA 3LKBA 4HFRA 3F5DA 1YFJA 1T8WA 4NYIQ 5ERYA 4B76A 5AKXA 4MAMA 1G6OA 1Z26A 2D3WA 3ITKA 4FYVA 4RL6A 4RV5A 4UNSA 4B79A 1EZZA 1VZ3A 4NNJA 1OB5A 2VP9A 3MQ4A 5EI5A 4EG5A 2R2AA 4MWBA 1EEXB 2BEKA 4P4SA 3H97A 1ORVA 4GWKA 1MW8X 2E37A 1OBFO 1BDMA 1WP9A 2YFHA 1YZGA 1QNFA 3CJQA 2P2ZA 4DY6A 2I4TA 3SKYA 3DV0A 3HVKA 4II3A 4QUGA 2BFCA 3KDSE 4HDMB 3DPSA 2VWPA 4RGBA 5FORA 1ZMXA 3KT8A 2JCYA 4CM8B 5KNBA 4H9GA 3HB9A 3JQ7A 5LMNB 2KSQA 1NLFA 2ZSDA 3R5FA 5G53C 3TWOA 3U81A 1EUZA 3A1VA 4PG7A 3ZLUA 3RBXA 4FI3F 1JAXA 3CHYA 1OXBB 1Z39A 5HFNA 4E15A 3SJZA 3EPHA 1HMYA 3PXUA 4OAQA 3RI3A 5IK2D 1WPXA 4UFPA 2Y1FA 1GL3A 3ODGA 4Z4CA 1FXWA 4BO5A 4G9EA 2XODA 1X3SA 1NBAA 3EWAA 1U0HC 2QP4A 3PNYA 3R6GA 3V8PA 9GPBA 3NOOA 5HMMA 5LBTA 4XVHA 1OX4B 2Z58A 3G0OA 3N8KA 1QG0A 3JALA 2FPIA 4IMRA 4UAGA 4DNFA 3G68A 4DV2B 1RHQA 3ZHVA 2NQ2C 1JAHA 3ANNA 4B3DA 4DJFC 2O7NA 1BE0A 4D8XA 2LCIA 1SXIA 5CXSA 4ZAFA 5FUYA 4WBNF 2EBFX 5DFAA 4CTOA 1YQWA 4OSPA 2O7QA 4PYIA 4UEOA 2ZSBA 5YASA 1N5KA 1O6FA 2ZRIA 4PCLA 1Y5IA 5SZIA 2QVGA 4J0HA 5B5SA 1IG3A 1C3OB 1YQQA 2PRYA 3WLTA 4GOMD 3IAFA 5CFNA 1GGVA 4PC1A 1T5SA 3M6WA 3LL4A 1PBNA 1T15A 3PIIA 1KIMA 3WA7A 3LE8A 2JIOA 3H5AA 3R44A 5FI1B 5LYJF 3BFKA 3L4SO 2IZOA 1B6SA 5CGZA 1REQA 4LS3A 4UVEA 2JAWA 2Z6AA 4W9MC 3RHFA 1RSZA 2DEUA 4JP2A 1U0EA 1W85A 2V9PA 1YVEI 1JJBA 1LBSA 4LKRA 4D92A 1CF9A 3HVUA 3U1TA 2B0CA 2FI1A 4DQKA 5D5HA 1FA9A 3PUKA 2P62A 3E4CA 4TV9B 4DLYA 3GLIB 2FQXA 4D4GA 5HKBA 1E4OA 3ICOA 5L3VA 1WD5A 1G3RA 5IM4F 1F20A 3R7AA 4YDHB 4ZO8A 4IVQA 4D26A 5GJBA 3MBIA 4K9MA 2WT8A 3MJCA 1U1EA 1IU9A 1E0SA 3BGIA 3OJ0A 1FJGB 2H17A 4Q5IA 2EW2A 3PLNA 1DKLA 1TQDA 4J4BA 4CUKA 4H1TA 4JJEA 1W48A 3GARA 1WA5A 3KAJA 1Q3KA 2CLSA 1QP4A 4O4IF 4EHDA 2C84A 1TCVA 4Q4HB 3BRCA 5EHZA 3MRVA 4JX9A 2GD1O 4ZDIA 4X64B 2AC4A 3SR0A 4LXUA 4TT3D 3HO1A 3RQIA 4AJEA 2H1LA 2EWWA 4Z4HA 3SEFA 1YQTA 5GGXA 2FDXA 2C4UA 2I7CA 2XDQB 5I48A 4NOMA 3NHLA 1XP5A 2ZSAA 4E3WA 4NICA 3JALB 1E77A 1ZZEA 1W44A 2XYHA 3EIOA 2C88A 2FA9A 4RDXA 1VHWA 5IJ0A 1MJGA 2XWSA 3MLBA 2ZAYA 4F2HA 4HHEA 1TX4B 1RQNA 3P26A 2ZTLA 3KXPA 4J1SA 1NIPA 1PVVA 1U7UA 1U9IA 4F46A 4X91A 5ISMA 3VDMA 1EE9A 3PTZA 3DMYA 4P3YA 2IYOA 2Y1KA 1C3LA 3GRRA 4HQFA 4LXIA 1AK2A 1GGEA 1IWBB 4J1QA 3U3JA 4AX4A 4KPGA 1O9GA 1KPGA 2FUKA 2HSWA 1H9AA 1IVYA 2XUQA 4O63O 5DOZA 1J2RA 2WUGA 3GJ8A 4I5EA 4WXHA 4YBZA 1DZ3A 3MJTA 2EFYA 2Q28A 2PJZA 2PT9A 4EO7A 3GGGA 4YQZA 2EYQA 4JOCA 1QKJA 1Q92A 2ISQA 2ZWPA 3KDAA 1AQUA 5CYGA 3LXUX 5FUVA 1FPQA 1HG0A 3NEPX 1FFSA 5CD9A 2O5CA 3SHFA 3Q7EA 4KJZA 1DKMA 2FZKA 2WBLC 2VDVE 2YV3A 1NV9A 2NUPA 2CJWB 2JEOA 4E4TA 1BHJA 1WQ3A 2GVNA 2V6GA 1M2OB 1MOZA 4OEHA 3LFTA 3VI4B 1QUFA 1M8FA 1V26A 3BSYA 2X1HA 5H16A 3ROKA 3QKSB 2KE5A 3VDQA 4LOIA 1BE6A 5FXMA 1EE2A 1N5JA 5E2AA 3CLRC 4URXR 1DAIA 2PE5A 4XWKA 4LF4B 4Z86A 4PAMA 3TSZA 3BWMA 3FZEA 5DF1A 3DKKA 2O4UX 3DLCA 3MOGA 5IF3A 2CV0A 4K03A 1YVRA 5HKKD 3A3OA 3BK7A 3F3MA 3HKCA 1GL7A 3WRXC 3TMKA 3OEYA 1Y8QA 3ZBPA 4CIDA 4HB0A 3O4JA 1NVBA 1KJZA 5EWMA 4AM8A 1S3IA 3NIBA 5KYVA 1KYYA 5BRJA 1LRJA 2WHPB 3PCTA 1V5GA 4HUQA 3DDCA 5HQJA 1CUHA 1U7WA 1Z16A 2PKRA 1F60A 3CB2A 3S3TA 3CVXA 4YP9A 1ZK2A 3SF8A 3ZK7A 4AFNA 5K0JA 2I7DA 4JKIA 2X2EA 1YS7A 3UGJA 1T9GR 1N25A 1X1RA 3U44A 3DBRB 5LA6B 1W2HA 1MUUA 4K8RB 1IXYA 2EBUA 2Y3IA 4XDHA 2XR1A 3ICVA 4QGFA 4JDPA 4LSGA 1F6WA 1W94A 2OORA 4HAVA 4QJIA 1NQUA 2WDZA 1NN5A 1ZMBA 4PSAA 4IHKA 1VRVA 1Z3IX 5LZ9A 4QPNA 5FBLB 2VXYA 4JOQA 3WY9A 3WAJA 4M1SA 1TUIA 1E7MA 3COZA 2O1EA 4H2DA 3IESA 4ND8B 3TQTA 5KWEA 5CT5A 1UJCA 1B8OA 2I6SA 4PZ9A 5I3CA 2TYSB 3KIPA 5JECA 1C9DB 3L7OA 4RHXA 3UJCA 2C5BA 3QOYA 4JI7B 4TSFA 4YGYA 4YQEA 3TIFA 1KK1A 4LOJA 1G9TA 2MWMA 5AK4A 4RSRA 4BEBA 1G98A 4H7FA 1YXMA 2E55A 1RAIA 1SWVA 1ZW6A 3KP1A 3Q2OA 1H3FA 2FW9A 2P4HX 5T8KA 3R7WB 1II8B 3DAOA 1M2GA 1J1UA 1JDVA 1IHYA 1ZOLA 5DGDA 1TKAA 4QTXA 3D1JA 1CK4A 1SBTA 3RYHA 1M8JA 1RCTE 2PX6A 3WGMA 2JNWA 3ESCA 1MQAA 1K7CA 3DDHA 3OIDA 4ALNA 4PZCA 2ZCJA 2IE8A 2H1CA 4H59A 1E58A 4LJ7A 4YBRA 2AYYA 4MRRA 5IX8A 4NCNA 1H85A 1LC3A 3YASA 1SEPA 5KNCA 4WNAB 5DWDA 1L7RA 1VGQA 4LSZA 3IBTA 5JPCA 5K8VA 5COBA 2H2IA 2VA9A 4A5OA 2ZRMA 4NZ9A 1UBFA 3LHSA 2WU8A 2IUYA 1J2TA 4U7PB 1TJ4A 4JR0A 2Q9BA 4HBZA 2A5YB 2G04A 3FIUA 1P4SA 4UM9D 4D02A 2C4VA 2NIPA 5CFLA 2JLAA 4DJDC 1BW9A 3PA8A 3WLFA 3EGXB 4OJTA 5AW4A 5J58A 3BXOA 1ZC4A 3VZRA 4F1JA 3FTEA 2HR1A 1XHFA 2C83A 3TLBA 3M1YA 3O92A 4I55F 4M1WA 4FE7A 1QFZA 1FX1A 1SXJE 5COAA 1UMKA 2XQVA 4I4CA 4PY2A 4IJ6A 3K2QA 3WGHA 1NBMD 1OWMA 1D8TA 2BI7A 1JA9A 4V0ME 4MDEA 5TPZD 5GIOE 2F1IA 4ZEVA 3UBMA 3K1JA 3UJ3X 1UWLA 1C4XA 2Y76A 4KKXB 3TLXA 1DTEA 3IOEA 3B36A 2ZBDA 1X7WA 3PWZA 4HDOB 1TF7A 3TIXB 4U02A 1XMQB 4N03A 1QV6A 2CFRA 1LPAB 4B74A 1QYXA 3CVOA 5JQGA 1IBRA 5A9SB 5EAIA 1GLVA 1PQUA 2AJBA 2EL9A 5AOAA 1ZJJA 5HF9A 5JXHA 2JLBA 3LXXA 5L4LA 2Z5FA 3DKVA 4DYVA 3AIKA 1IVSA 1Y48E 2H65A 1IY1A 5DWVA 1IXKA 2HN9A 3PCXA 4FZ5A 3VI3B 1JGTA 2I1VB 3BILA 2DHRA 3VR5D 4ESHA 5A5FA 4IH4A 2O0JA 1G3MA 5FIUA 2WWYA 1E7SA 4DANA 4J6FA 4INJA 3TEJA 2LKDA 5J5CA 3WLEA 4Y67A 1XTVA 3NBFA 4AF6A 3RC8A 4JKYA 2QPTA 2DUWA 4KVGA 1CVIA 3O7MA 4O8CA 3ZNOA 1IIRA 5FL3A 3DTVB 2BMDA 2PMBA 4R1UA 5KREA 1SELA 4RA6B 2VL7A 1V7PC 1QIIA 1W35A 2F17A 3F98A 4UBOA 3SZUA 5LIRA 2PWYA 4LTMA 4K6HA 4UNNA 5G4KA 2EJVA 3CZAA 5LQUA 2JRCA 2F4NA 3BMQB 4JR2A 2ZJZA 3OT5A 4POOA 2A59A 2X8BA 3NIDB 3NVAA 4KH0A 3ED1A 5MGNA 4LMBA 1W36C 3SS9X 4YGXB 2FW6A 5GM1A 2ODBA 3GJSA 1U98A 3QNWA 4PC2A 3RRFA 3P97A 5C3MA 2XYPA 1B0UA 8LDHA 4C6TB 2E5WA 1PV2A 2G6BA 2PO7A 2Q7DA 5KZMB 1BS2A 1PJ2A 2VRWA 3P9XA 4A8JC 1GFIA 1T10A 3H5LA 2JGLA 1E2MA 3IPYA 4CI0B 1MXFA 3UK7A 3EFOB 1QR2A 4QJ3A 2P0EA 2Q3MA 2XYVA 1ZUHA 2DFNA 2JFBA 3LJKA 5AHKA 5BQPA 4DCJA 3E9MA 4RLQA 3UGTA 3ZCUA 1DDGA 2EJCA 1HETA 3CMCO 1MB9A 3LUFA 3BL8A 4L5CA 2X8JA 2HWKA 3ISTA 3FH0A 3H3FA 3I5AA 4OXXA 3WTCA 4AG6A 3NH9A 1Q1NA 3TECE 3T3GA 2FEXA 3C8UA 3DFZA 3Q9LA 4Q02A 5ITZB 3WQRA 1DX4A 2JLYA 1ECJA 2VA8A 4FZVA 4P7KA 4RX1A 1T34A 3TRHA 4A15A 2PUAA 2AJCA 4OU5A 2B7LA 1QLJA 1BN6A 1E66A 3L02A 2HF2A 4L3VA 4P4GA 3AR5A 3QSGA 4Q19A 1FMTA 1U1CA 2HMTA 2FUG6 2CNKA 3LLCA 4D9FA 2I7XA 4IOLA 4CDMA 1XRRA 3GLHB 4B8WA 5GTDA 3LIIA 3D3WA 2PN1A 3DBLB 1I9GA 1SUIA 4L57A 3OE5A 3T6KA 2QL5A 4YP0A 4KPYA 2BH2A 1JXQA 3DEZA 1GWNA 1XPRA 1F7UA 2O50A 5L8VA 4FC6A 4MB2A 1IOWA 4BKRA 1RJGA 2C00A 3GUCA 5B3JA 2C3PA 3GF4A 1VJ5A 1QE0A 2OAP1 2GI4A 2W6MA 1AQIA 3IAHA 1V1RA 1C14A 5AXAA 3V1UA 1QB8A 4N5MA 4AQDA 1F51E 1HT0A 2BFPA 2VEOA 1JFLA 4U9UA 3GW8A 3IXLA 1ZM4A 2LDBA 1JA1A 1DL5A 3ETDA 3I2HA 4MVJP 2NN3C 2QRPA 5AKGA 4FWTA 2I4MA 2JFNA 1LW7A 1NVWQ 1QK3A 2BM8A 5CFMA 5KWVA 1HV8A 2H4HA 1VA4A 1GKKA 4MX8A 3DZKA 3BZWA 3EIEA 2JFOA 1JLLA 3ENKA 4GWLA 4Y2RA 2Z4RA 2ZI9A 3C14C 1PGJA 3LDGA 1LD3A 3LLMA 4NJMA 4TN5A 5DJ5A 5DX0A 4AXBA 3SD7A 1OLXB 3QLUA 3BL6A 4Q16A 4Y2GA 3W5JA 3ZUPA 4ARCA 1L8XA 2AN3A 2W4MA 1TYCA 2OWEA 2PPLA 4HQKA 3UMSA 5F2EA 1NT2A 3BWVA 1E3TA 4X8LA 3JAMA 2R6DA 4UUBA 1DUIA 2ZYWX 3IUEA 1QS0A 2QT1A 3GOHA 3LSYA 1QVWA 2O2GA 2YJ4A 4AUMA 1XYYA 3T5MA 2H1OA 4C2TA 1EK1A 3DYBA 1FS4A 4G24A 4JSRA 1L9KA 1S2OA 2WKWA 4O1MA 1DMRA 5KQLA 4HYQA 1R9NA 1LY1A 2UUBB 2E49A 3PEVA 5SYAA 3GVHA 3WL3A 4ZQGA 1YBMA 2YUIA 4QJ4A 4G8JA 1U9CA 2A3NA 1Y6JA 1YFLA 3TEFA 3GMSA 4KN5A 2VUTA 5JS7A 1APBA 4P5PA 2OR3A 5FL7A 1UKYA 4NLLA 2Z6UA 4CL8A 1ZISA 2LBPA 1E92A 1T9GS 2VYND 1QCZA 1NYRA 3R09A 4L5IA 5I7WA 1D03A 4DBVO 5EPEA 1CJVC 3SPXA 4A6XA 4CL3A 1EAYA 2UZ1A 1Y4UA 1Q7TA 1QTNA 3U62A 4EA9A 3E1GA 3GBVA 2YN4A 3SYNA 5CFZA 5JZOA 2I87A 3BGVA 1M6EX 3CYFA 5AQ1A 3NHYA 3PX2A 3V1LA 1P0PA 3AR3A 1XTTA 2D2XA 5JNRA 1L6IA 4XQCA 4ZDKA 1ZM9A 2CMGA 1WY5A 1M1YE 4XLZA 3QE3A 3NP7A 1GPBA 2VRCD 2VYVA 1DU4A 3Q11A 2OGTA 3R3JA 3DKPA 3G5LA 3HDJA 1SM4A 4NBSA 2BBSA 4LHXA 3EPJA 2I33A 5KSWB 3GZNB 2FP4A 1PTJC 1ZOOA 4GR9A 5KYUB 2HH9A 3T15A 3P9ZA 3QEJA 3GA7A 3BA6A 4NV0A 3LBIA 1RYHA 3KOXA 1XZEA 4H7DA 1WJGA 2I66A 2P30A 1CFJA 5K6AC 2JVKA 5JNTA 2Z8YM 2WHRA 2VPZA 4F8YA 5CT8A 2C59A 2QD4A 2VLIA 2C04A 5E1DA 1QMGA 1K8XB 1YZKA 2QZ4A 3WVNA 1XR3A 3AR2A 5TPZA 1DS6A 3HEMA 3RABA 5BPFA 2H29A 4C9BA 3O75A 1LZKA 4DUYB 2XT6A 2NO4A 3H5OA 1NT4A 4TYWA 4OJYA 1GTL1 4ESEA 4W5WA 1UCFA 1ULAA 1XZNA 1M5UA 4JGIA 5ALYA 3ZZ1A 4MVJG 4MS1A 3RNLA 3OZIA 3QKTA 4QFMA 4EFNA 2BHNA 2J9FB 3KT0A 1HE8B 1YDWA 1BDBA 4TLMB 2KW5A 2XBUA 4NYIR 4S1PA 3A37A 4EFDA 1TT7A 1EHCA 3D9QX 1EWYA 3HCPA 4COOA 2YIJA 3PUHA 4RKRA 1UJ6A 2GZDA 1GD1O 1I3LA 1YJAA 3WGTA 3U3ZA 1C7ZA 4FDVA 4B5KA 4URYR 2YDXA 1JDPA 3JASB 1SA0A 3PA6A 4IXTA 4A8TA 4KYIB 1NHGA 3D6TB 4PGGA 3WYGA 1LPPA 4C3UA 4CKEA 4D9EA 2QOEA 5IVDA 1NW3A 1ZGGA 1TZKA 3N2EA 1JEOA 5KCZA 1GOTA 4WJKB 2AYZA 3TLGB 4EHFA 3GGOA 1CF2O 1Z25A 2QVYX 5CJPA 1NVVR 2FQQA 1EVJA 2F43B 3RRXA 3Q7PA 3Q15C 4NFLA 1K6EA 1U1FA 2OBNA 2FF7A 2H1WA 1KU0A 1NUSA 4QODA 4YTEA 1UJ5A 3P94A 4TXLA 5LZ2A 3ER9A 3WKEA 1HEIA 3F5FA 4BKMA 4DM4A 3PQ6A 4ZCMA 2PL1A 1EVKA 2ADOA 4RDIA 4GOOD 8OHMA 1ID8A 1GTZA 1LSUA 1O5IA 2YMLA 1GTMA 4C05A 4N3CA 3AHGA 4BFYA 4DAOA 2ESRA 4FW8A 3D4OA 4NAUA 4L75A 1K7FB 3Q9NA 2XBLA 1EXNA 4F5WA 1A97A 2UVDA 3EXFA 3BRSA 1NU6A 4FS8A 1FS5A 1TC1A 3BGSA 4LG1A 4J0GA 4RNDB 5HW0A 4LC1A 1RAEA 3GYGA 4V2UA 4D4HA 3IBFA 1B23P 4KSBA 1LQUA 1VHQA 4PBRA 4RFVA 1JV2B 4UM7A 4LE1A 5ESDA 1NXVA 3OD5A 4CLDA 5CBPB 2QMUA 4HAOA 1NYQA 2OSVA 3B1KA 3B5JA 4OFXA 4WLFA 5L45A 1S8NA 2RHHA 1GPH1 2QDKA 2XZPA 5AW6A 1BDIA 4YRCA 2EXXA 4LFAB 4MJ3A 1RPZA 4Z9YA 3OLQA 1EBFA 1TK9A 2BM9A 2V5UA 3IC5A