1D6OA

Native fkbp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d6oA00
3GPKA 1EYMA 2MPHA 2XP8A 4DRMA 1FKJA 2MNTA 3KAHA 2L2SA 2RUQA 2XP9A 5J6EA 5BXJA 1J6YA 4R0XA 1KT0A 4DROA 1KT1A 3O5QA 3KCEA 2ZQVA 3VAWA 2ZR5A 1ROTA 2AWGA 2RUCA 3KABA 3O5MA 2KGJA 3IHZA 4TW6A 3UI6A 3EY6A 2Q5AA 4O2TA 4TW8A 3OOBA 4C02B 4JYSA 2ZR4A 3O5IA 4TNSA 1Q6UA 4TYOA 5D75A 3NI6A 3TCZA 2KO7A 3JYJA 4GGQA 4QT2A 3IKGA 1D7IA 1YW5A 4QIBA 5DITA 3O5EA 1ROUA 3O5KA 4DRKA 4DRIA 4LAXA 1FKIA 5HUAA 1JVWA 2XP3A 2M1IA 4U85A 3ODKA 1N1AA 2ZR6A 1NMVA 1R9HA 2KFWA 2PPOA 2XP7A 3O5JA 1U79A 2XPAA 4JFLA 4U86A 2JZVA 3IKDA 1FKKA 2LGOA 1QPFA 3MDYB 3B7XA 1YATA 4FN2A 4ODOA 3O5RA 2VN1A 5HW8A 1J4IA 2IF4A 2F21A 3JYMA 1QPLA 2MF9A 2K8IA 4FAPA 1FAPA 2XP6A 4ODLA 3UI4A 2XPBA 3NTPA 4DRJA 1EQ3A 4QT3A 2DG9A 1ZK6A 1F40A 1TCOC 2RUDA 3CGNA 4J4OA 1FKGA 2F2DA 2RSEA 4J4NA 2ITKA 3WH0A 3O5GA 3O5LA 3PRDA 3TC5A 1A7XA 2PPNA 4DZ2A 1JNSA 2PBCA 3H9RB 2RURA 3CGMA 4TW7A 3JXVA 2F4EA 5GPGA 4ODQA 4DT4A 1FKLA 4JFMA 2ZQUA 4DRPA 4ODKA 5HT1A 3RGCA 3UF8A 3IK8A 3O5DA 1FKHA 1PBKA 4IPXA 4DZ3A 1D6OA 1F8AB 4JFIA 3UQBA 2MLXA 3RFWA 4U84A 2ZQTA 4DRHA 3UQIA 4NNRA 4MGVA 4TX0A 1FD9A 1Y0OA 2PPPA 4LAYA 2OFNA 1HXVA 2FKEA 2XP5A 2KI3A 4ODMA 4DIPA 4W9OA 2XP4A 1Q6HA 1Q6IA 2MLZA 1T11A 2PV3A 2N87A 4MSPA 4W9PA 3NRKA 5HKGA 1BL4A 3FAPA 3PA7A 4LAWA 5DIUA 1JNTA 3UI5A 5HW7A 3O5OA 2RQSA 1FKRA 1FKTA 3KADA 4IQ2A 2M08A 3UQAA 2PV2A 3O5PA 3PRBA 1BKFA 2Y78A 1PINA 2VCDA 2ZQSA 1FKFA 3KAIA 2MLYA 1B6CA 3LUOA 4G50A 4IQCA 1FKDA 2DG4A 4ODRA 1L1PA 1M5YA 3KZ7A 1FKSA 5DIVA 4JFJA 1W26A 3KAGA 2PV1A 5HTGA 2LKNA 4N19A 1NSGA 5HWBA 1FKBA 1P5QA 4ODPA 2KR7A 5HW6A 2LPVA 1Q1CA 2M2AA 4DH0A 2FAPA 1J4HA 1NMWA 4G2PA 4ITZA 1J4RA 4JFKA 4DRQA 1FJDA 2DG3A 4LAVA 2UZ5A 5I98A 4BF8A 1C9HA 2D9FA 3I6CA 5B8IC 4DRNA 4GIVA 2LJ4A 4ODNA 4W9QA 5HWCA 1QZ2A 3TDBA 1ZCNA 1D7JA 1D7HA 3O5FA 2KE0A 3KACA 3KAFA
chains in the Genus database with same CATH superfamily
3GPKA 3GU0A 1FKJA 2L2SA 2XP9A 5J6EA 1ZBVA 4DROA 1KT0A 3O5QA 1E6PA 1HKIA 4P8WA 4AY1A 1ROTA 3ARSA 3KABA 4MNMA 3UI6A 2Q5AA 3AS0A 3OOBA 2DT2A 4TNSA 3WKZA 1OGGA 1JNDA 3JYJA 4L72B 2B5UB 4NSBA 3O5KA 1WAWA 3ODKA 1R9HA 2KFWA 3ALGA 2PPOA 1D2KA 4JFLA 3WD0A 3G6LA 3IKDA 3ARRA 1QPFA 3B7XA 1YATA 3O5RA 2MF9A 3CZ8A 5HBFA 1SR0A 1EQ3A 1JNEA 4QT3A 1CTNA 1E9LA 4IT4A 2F2DA 4MNJA 2PBCA 2RURA 3AQUA 3JXVA 2F4EA 5GPGA 3AS3A 4URIA 1FKLA 4JFMA 2ZQUA 1XHGA 4DRPA 3ALFA 4ODKA 4HBEA 1PBKA 1W1PA 1D6OA 5JH8A 2O9OA 4P8XA 3UQBA 4NNRA 1Y0OA 2OFNA 1HXVA 1JCHB 1Q6HA 2YBUA 1T11A 3FAPA 4LAWA 5DIUA 3UI5A 1FKRA 2DT3A 2PV2A 1PINA 2VCDA 4IQCA 1B6CA 1H0GA 1LJYA 3WD4A 1IX5A 3BXWA 3KZ7A 4Z2HA 2DSUA 4WKHA 1K9TA 4WJXA 1RD6A 5DF0A 2KR7A 5HW6A 4WKFA 2FAPA 3FY1A 3WL1A 1FJDA 2UZ5A 1C9HA 1LG2A 4DRNA 1ZBCA 4HARA 2DPEA 4UDMA 5DEZA 1OWQA 4TYOA 2O92A 3KAFA 2B31A 2XP8A 2F23A 4NZCA 2RUQA 1E6ZA 3ARWA 3KCEA 2ZQVA 3WD1A 2ZR5A 3O5MA 2RUCA 3EY6A 5D75A 1Q6UA 2AOSA 3IKGA 1YW5A 1ROUA 1HKMA 4U85A 2XP3A 2ZR6A 1ZBKA 4Q22A 3CHDA 4MPKA 2XPAA 3ARTA 2JZVA 3AROA 1J4IA 2F21A 1FAPA 2RSEA 2ITKA 3WH0A 2QF8A 3O5LA 3TC5A 4TW7A 4ODQA 3EIPA 1X6NA 1EIBA 1GUVA 4JFIA 2P4VA 3RFWA 4KQZA 3UQIA 1FD9A 4HBOA 2PPPA 4LAYA 2FKEA 3OA5A 2MLZA 3ARPA 2PV3A 2N87A 4WIWA 5GQBA 3NRKA 5HKGA 1BL4A 1JNTA 5HW7A 2RQSA 1LL6A 2M08A 2DSZA 2A3BA 4MAVA 4W5UA 2Y78A 5GPRA 3LUOA 1GRJA 3WQWA 1FKSA 5DIVA 2A3CA 4JFJA 1W26A 5HTGA 4ZS6A 1KFWA 3FXYA 1WNOA 4DH0A 1J4HA 4MTVA 4G2PA 4ITZA 4JFKA 1J4RA 1SYTA 4DRQA 3B9EA 1E44A 1W1VA 3ARVA 3RMEA 5I98A 4BF8A 2D9FA 5B8IC 4ODNA 1ZCNA 4O2TA 3O5FA 3CH9A 2MPHA 4DRMA 1E6RA 4WKAA 1ZB5A 1ZBWA 2MNTA 3WL0A 3CHFA 5BXJA 4R0XA 3RM4A 1TFVA 2DSWA 2KGJA 3IHZA 1LL7A 4JYSA 2ZR4A 3NI6A 4QZVB 4QT2A 4DRKA 1W9UA 4DRIA 4LAXA 1FKIA 5HUAA 4ZPWR 3ARXA 2M1IA 1GPFA 1N1AA 1NMVA 2XP7A 3O5JA 2LGOA 4DWSB 1HKKA 4ODOA 5HW8A 2VN1A 2IF4A 3JYMA 1QPLA 3AS1A 1LQ0A 2XP6A 4ODLA 3UI4A 3RM8A 1ZK6A 2RUDA 3CGNA 1NWRA 3O5GA 1A7XA 2PPNA 1JNSA 3CGMA 4DT4A 3UF8A 3IK8A 2WK2A 1FKHA 4IPXA 4DZ3A 3PR9A 5DO2A 2MLXA 2ETNA 2PI6A 4U84A 4Z2KA 2YBTA 1Q6IA 1HJXA 4W9PA 1E15A 3B9DA 3PA7A 1W9VA 1ITXA 1HJVA 3KADA 4IQ2A 3UQAA 3O5PA 3PRBA 2OLHA 1FKFA 4Z2JA 4DWSD 2A3AA 1M5YA 3WD3A 4Z2IA 2WLZA 3KAGA 2PV1A 4N19A 1LG1A 5HWBA 1FKBA 4ODPA 2LPVA 1Q1CA 3PRAA 1UR8A 4WK9A 3W4RA 1NMWA 1EHNA 1FFRA 1E6NA 4IT6A 4GIVA 1W1YA 2EULA 1QZ2A 1ZU8A 3TDBA 1HKJA 3KACA 1EYMA 3KAHA 1J6YA 1VF8A 2DSVA 1KT1A 2G41A 3ARQA 3VAWA 2DT1A 1OGBA 1W9PA 2AWGA 2WM0A 4TW6A 1XRVA 4TW8A 3O5IA 4C02B 3TCZA 2KO7A 4GGQA 1D7IA 4QIBA 5DITA 3O5EA 1NWUA 4Z2GA 1JVWA 2G8ZA 1U79A 4U86A 1X6LA 3B9AA 1FKKA 1H0IA 3MDYB 1WB0A 4FN2A 4MNLA 1NH6A 3WD2A 4L3NA 2K8IA 4FAPA 4S3JA 4LGXA 2WLYA 2XPBA 3NTPA 4XAKA 4DRJA 1W1TA 1O6IA 2DG9A 1F40A 1TCOC 4J4OA 4ML4A 1FKGA 1LL4A 4J4NA 3PRDA 4DZ2A 2ESCA 3H9RB 4S3KA 3WIJA 3QOKA 4ZPVR 5HT1A 3RGCA 3AS2A 3O5DA 4DWSA 2DT0A 1UR9A 1F8AB 2PN0A 3B8SA 2ZQTA 4DRHA 4MGVA 4TX0A 3RM9A 3ARZA 2XP5A 2KI3A 4ODMA 4DIPA 4W9OA 2XP4A 4MSPA 2IUZA 3O5OA 1EDQA 1FKTA 1FFQA 4DWSC 3ARUA 1BKFA 2ZQSA 3KAIA 4G50A 2MLYA 4P8UA 1FKDA 2DG4A 4ODRA 1L1PA 3G6MA 4PTMA 4KR0B 3WQVA 2LKNA 2A3EA 1NSGA 3BMBA 1P5QA 2FDMA 4Q7NA 2M2AA 1NWSA 4MNKA 3CHEA 4Z2LA 1GOIA 3CHCA 1ZL1A 2DG3A 4LAVA 1HJWA 4P8VA 3ARYA 3I6CA 5HWCA 4W9QA 2LJ4A 4R5EA 3GTYX 4ZPTR 1D7JA 1D7HA 1NWTA 2KE0A
chains in the Genus database with same CATH topology
3GPKA 1FKJA 2L2SA 2XP9A 5J6EA 1ZBVA 4DROA 1KT0A 3O5QA 1E6PA 1HKIA 4P8WA 4AY1A 1ROTA 3ARSA 3KABA 4MNMA 3UI6A 2Q5AA 3AS0A 3OOBA 2DT2A 4TNSA 3WKZA 1OGGA 1JNDA 3JYJA 4L72B 4NSBA 3O5KA 1WAWA 3ODKA 1R9HA 2KFWA 3ALGA 2PPOA 1D2KA 4JFLA 3WD0A 3G6LA 3IKDA 3ARRA 1QPFA 3B7XA 1YATA 3O5RA 2MF9A 3CZ8A 5HBFA 1SR0A 1EQ3A 1JNEA 4QT3A 1CTNA 1E9LA 4IT4A 2F2DA 4MNJA 2PBCA 2RURA 3AQUA 3JXVA 2F4EA 5GPGA 3AS3A 4URIA 1FKLA 4JFMA 2ZQUA 1XHGA 4DRPA 3ALFA 4ODKA 4HBEA 1PBKA 1W1PA 1D6OA 5JH8A 2O9OA 4P8XA 3UQBA 4NNRA 1Y0OA 2OFNA 1HXVA 1Q6HA 2YBUA 1T11A 3FAPA 4LAWA 5DIUA 3UI5A 1FKRA 2DT3A 2PV2A 1PINA 2VCDA 4IQCA 1B6CA 1H0GA 1LJYA 3WD4A 1IX5A 3BXWA 3KZ7A 4Z2HA 2DSUA 4WKHA 1K9TA 4WJXA 1RD6A 5DF0A 2KR7A 5HW6A 4WKFA 2FAPA 3FY1A 3WL1A 1FJDA 2UZ5A 1C9HA 1LG2A 4DRNA 1ZBCA 4HARA 2DPEA 5DEZA 1OWQA 4TYOA 2O92A 3KAFA 2B31A 2XP8A 4NZCA 2RUQA 1E6ZA 3ARWA 3KCEA 2ZQVA 3WD1A 2ZR5A 3O5MA 2RUCA 3EY6A 5D75A 1Q6UA 2AOSA 3IKGA 1YW5A 1ROUA 1HKMA 4U85A 2XP3A 2ZR6A 1ZBKA 4Q22A 3CHDA 4MPKA 2XPAA 3ARTA 2JZVA 3AROA 1J4IA 2F21A 1FAPA 2RSEA 2ITKA 3WH0A 2QF8A 3O5LA 3TC5A 4TW7A 4ODQA 1X6NA 1EIBA 1GUVA 4JFIA 3RFWA 4KQZA 3UQIA 1FD9A 4HBOA 2PPPA 4LAYA 2FKEA 3OA5A 2MLZA 3ARPA 2PV3A 2N87A 4WIWA 5GQBA 3NRKA 5HKGA 1BL4A 1JNTA 5HW7A 2RQSA 1LL6A 2M08A 2DSZA 2A3BA 4MAVA 4W5UA 2Y78A 5GPRA 3LUOA 3WQWA 1FKSA 5DIVA 2A3CA 4JFJA 1W26A 5HTGA 4ZS6A 1KFWA 3FXYA 1WNOA 4DH0A 1J4HA 4MTVA 4G2PA 4ITZA 4JFKA 1J4RA 1SYTA 4DRQA 3B9EA 1W1VA 3ARVA 3RMEA 5I98A 4BF8A 2D9FA 5B8IC 4ODNA 1ZCNA 4O2TA 3O5FA 3CH9A 2MPHA 4DRMA 1E6RA 4WKAA 1ZB5A 1ZBWA 2MNTA 3WL0A 3CHFA 5BXJA 4R0XA 3RM4A 1TFVA 2DSWA 2KGJA 3IHZA 1LL7A 4JYSA 2ZR4A 3NI6A 4QZVB 4QT2A 4DRKA 1W9UA 4DRIA 4LAXA 1FKIA 5HUAA 4ZPWR 3ARXA 2M1IA 1GPFA 1N1AA 1NMVA 2XP7A 3O5JA 2LGOA 4DWSB 1HKKA 4ODOA 5HW8A 2VN1A 2IF4A 3JYMA 1QPLA 3AS1A 1LQ0A 2XP6A 4ODLA 3UI4A 3RM8A 1ZK6A 2RUDA 3CGNA 1NWRA 3O5GA 1A7XA 2PPNA 1JNSA 3CGMA 4DT4A 3UF8A 3IK8A 2WK2A 1FKHA 4IPXA 4DZ3A 3PR9A 5DO2A 2MLXA 2PI6A 4U84A 4Z2KA 2YBTA 1Q6IA 1HJXA 4W9PA 1E15A 3B9DA 3PA7A 1W9VA 1ITXA 1HJVA 3KADA 4IQ2A 3UQAA 3O5PA 3PRBA 2OLHA 1FKFA 4Z2JA 4DWSD 2A3AA 1M5YA 3WD3A 4Z2IA 2WLZA 3KAGA 2PV1A 4N19A 1LG1A 5HWBA 1FKBA 4ODPA 2LPVA 1Q1CA 3PRAA 1UR8A 4WK9A 3W4RA 1NMWA 1EHNA 1FFRA 1E6NA 4IT6A 4GIVA 1W1YA 1QZ2A 1ZU8A 3TDBA 1HKJA 3KACA 1EYMA 3KAHA 1J6YA 1VF8A 2DSVA 1KT1A 2G41A 3ARQA 3VAWA 2DT1A 1OGBA 1W9PA 2AWGA 2WM0A 4TW6A 1XRVA 4TW8A 3O5IA 4C02B 3TCZA 2KO7A 4GGQA 1D7IA 4QIBA 5DITA 3O5EA 1NWUA 4Z2GA 1JVWA 2G8ZA 1U79A 4U86A 1X6LA 3B9AA 1FKKA 1H0IA 3MDYB 1WB0A 4FN2A 4MNLA 1NH6A 3WD2A 4L3NA 2K8IA 4FAPA 4S3JA 4LGXA 2WLYA 2XPBA 3NTPA 4XAKA 4DRJA 1W1TA 1O6IA 2DG9A 1F40A 1TCOC 4J4OA 4ML4A 1FKGA 1LL4A 4J4NA 3PRDA 4DZ2A 2ESCA 3H9RB 4S3KA 3WIJA 3QOKA 4ZPVR 5HT1A 3RGCA 3AS2A 3O5DA 4DWSA 2DT0A 1UR9A 1F8AB 3B8SA 2ZQTA 4DRHA 4MGVA 4TX0A 3RM9A 3ARZA 2XP5A 2KI3A 4ODMA 4DIPA 4W9OA 2XP4A 4MSPA 2IUZA 3O5OA 1EDQA 1FKTA 1FFQA 4DWSC 3ARUA 1BKFA 2ZQSA 3KAIA 4G50A 2MLYA 4P8UA 1FKDA 2DG4A 4ODRA 1L1PA 3G6MA 4PTMA 4KR0B 3WQVA 2LKNA 2A3EA 1NSGA 1P5QA 2FDMA 4Q7NA 2M2AA 1NWSA 4MNKA 3CHEA 4Z2LA 1GOIA 3CHCA 1ZL1A 2DG3A 4LAVA 1HJWA 4P8VA 3ARYA 3I6CA 5HWCA 4W9QA 2LJ4A 4R5EA 4ZPTR 1D7JA 1D7HA 1NWTA 2KE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPK A;  1EYM A;  2MPH A;  2XP8 A;  4DRM A;  1FKJ A;  2MNT A;  3KAH A;  2L2S A;  2RUQ A;  2XP9 A;  5J6E A;  5BXJ A;  1J6Y A;  4R0X A;  1KT0 A;  4DRO A;  1KT1 A;  3O5Q A;  3KCE A;  2ZQV A;  3VAW A;  2ZR5 A;  1ROT A;  2AWG A;  2RUC A;  3KAB A;  3O5M A;  2KGJ A;  3IHZ A;  4TW6 A;  3UI6 A;  3EY6 A;  2Q5A A;  4O2T A;  4TW8 A;  3OOB A;  4C02 B;  4JYS A;  2ZR4 A;  3O5I A;  4TNS A;  1Q6U A;  4TYO A;  5D75 A;  3NI6 A;  3TCZ A;  2KO7 A;  3JYJ A;  4GGQ A;  4QT2 A;  3IKG A;  1D7I A;  1YW5 A;  4QIB A;  5DIT A;  3O5E A;  1ROU A;  3O5K A;  4DRK A;  4DRI A;  4LAX A;  1FKI A;  5HUA A;  1JVW A;  2XP3 A;  2M1I A;  4U85 A;  3ODK A;  1N1A A;  2ZR6 A;  1NMV A;  1R9H A;  2KFW A;  2PPO A;  2XP7 A;  3O5J A;  1U79 A;  2XPA A;  4JFL A;  4U86 A;  2JZV A;  3IKD A;  1FKK A;  2LGO A;  1QPF A;  3MDY B;  3B7X A;  1YAT A;  4FN2 A;  4ODO A;  3O5R A;  2VN1 A;  5HW8 A;  1J4I A;  2IF4 A;  2F21 A;  3JYM A;  1QPL A;  2MF9 A;  2K8I A;  4FAP A;  1FAP A;  2XP6 A;  4ODL A;  3UI4 A;  2XPB A;  3NTP A;  4DRJ A;  1EQ3 A;  4QT3 A;  2DG9 A;  1ZK6 A;  1F40 A;  1TCO C;  2RUD A;  3CGN A;  4J4O A;  1FKG A;  2F2D A;  2RSE A;  4J4N A;  2ITK A;  3WH0 A;  3O5G A;  3O5L A;  3PRD A;  3TC5 A;  1A7X A;  2PPN A;  4DZ2 A;  1JNS A;  2PBC A;  3H9R B;  2RUR A;  3CGM A;  4TW7 A;  3JXV A;  2F4E A;  5GPG A;  4ODQ A;  4DT4 A;  1FKL A;  4JFM A;  2ZQU A;  4DRP A;  4ODK A;  5HT1 A;  3RGC A;  3UF8 A;  3IK8 A;  3O5D A;  1FKH A;  1PBK A;  4IPX A;  4DZ3 A;  1D6O A;  1F8A B;  4JFI A;  3UQB A;  2MLX A;  3RFW A;  4U84 A;  2ZQT A;  4DRH A;  3UQI A;  4NNR A;  4MGV A;  4TX0 A;  1FD9 A;  1Y0O A;  2PPP A;  4LAY A;  2OFN A;  1HXV A;  2FKE A;  2XP5 A;  2KI3 A;  4ODM A;  4DIP A;  4W9O A;  2XP4 A;  1Q6H A;  1Q6I A;  2MLZ A;  1T11 A;  2PV3 A;  2N87 A;  4MSP A;  4W9P A;  3NRK A;  5HKG A;  1BL4 A;  3FAP A;  3PA7 A;  4LAW A;  5DIU A;  1JNT A;  3UI5 A;  5HW7 A;  3O5O A;  2RQS A;  1FKR A;  1FKT A;  3KAD A;  4IQ2 A;  2M08 A;  3UQA A;  2PV2 A;  3O5P A;  3PRB A;  1BKF A;  2Y78 A;  1PIN A;  2VCD A;  2ZQS A;  1FKF A;  3KAI A;  2MLY A;  1B6C A;  3LUO A;  4G50 A;  4IQC A;  1FKD A;  2DG4 A;  4ODR A;  1L1P A;  1M5Y A;  3KZ7 A;  1FKS A;  5DIV A;  4JFJ A;  1W26 A;  3KAG A;  2PV1 A;  5HTG A;  2LKN A;  4N19 A;  1NSG A;  5HWB A;  1FKB A;  1P5Q A;  4ODP A;  2KR7 A;  5HW6 A;  2LPV A;  1Q1C A;  2M2A A;  4DH0 A;  2FAP A;  1J4H A;  1NMW A;  4G2P A;  4ITZ A;  1J4R A;  4JFK A;  4DRQ A;  1FJD A;  2DG3 A;  4LAV A;  2UZ5 A;  5I98 A;  4BF8 A;  1C9H A;  2D9F A;  3I6C A;  5B8I C;  4DRN A;  4GIV A;  2LJ4 A;  4ODN A;  4W9Q A;  5HWC A;  1QZ2 A;  3TDB A;  1ZCN A;  1D7J A;  1D7H A;  3O5F A;  2KE0 A;  3KAC A;  3KAF A; 
#chains in the Genus database with same CATH topology
 3GPK A;  3GU0 A;  1FKJ A;  2L2S A;  2XP9 A;  5J6E A;  1ZBV A;  4DRO A;  1KT0 A;  3O5Q A;  1E6P A;  1HKI A;  4P8W A;  4AY1 A;  1ROT A;  3ARS A;  3KAB A;  4MNM A;  3UI6 A;  2Q5A A;  3AS0 A;  3OOB A;  2DT2 A;  4TNS A;  3WKZ A;  1OGG A;  1JND A;  3JYJ A;  4L72 B;  2B5U B;  4NSB A;  3O5K A;  1WAW A;  3ODK A;  1R9H A;  2KFW A;  3ALG A;  2PPO A;  1D2K A;  4JFL A;  3WD0 A;  3G6L A;  3IKD A;  3ARR A;  1QPF A;  3B7X A;  1YAT A;  3O5R A;  2MF9 A;  3CZ8 A;  5HBF A;  1SR0 A;  1EQ3 A;  1JNE A;  4QT3 A;  1CTN A;  1E9L A;  4IT4 A;  2F2D A;  4MNJ A;  2PBC A;  2RUR A;  3AQU A;  3JXV A;  2F4E A;  5GPG A;  3AS3 A;  4URI A;  1FKL A;  4JFM A;  2ZQU A;  1XHG A;  4DRP A;  3ALF A;  4ODK A;  4HBE A;  1PBK A;  1W1P A;  1D6O A;  5JH8 A;  2O9O A;  4P8X A;  3UQB A;  4NNR A;  1Y0O A;  2OFN A;  1HXV A;  1JCH B;  1Q6H A;  2YBU A;  1T11 A;  3FAP A;  4LAW A;  5DIU A;  3UI5 A;  1FKR A;  2DT3 A;  2PV2 A;  1PIN A;  2VCD A;  4IQC A;  1B6C A;  1H0G A;  1LJY A;  3WD4 A;  1IX5 A;  3BXW A;  3KZ7 A;  4Z2H A;  2DSU A;  4WKH A;  1K9T A;  4WJX A;  1RD6 A;  5DF0 A;  2KR7 A;  5HW6 A;  4WKF A;  2FAP A;  3FY1 A;  3WL1 A;  1FJD A;  2UZ5 A;  1C9H A;  1LG2 A;  4DRN A;  1ZBC A;  4HAR A;  2DPE A;  4UDM A;  5DEZ A;  1OWQ A;  4TYO A;  2O92 A;  3KAF A;  2B31 A;  2XP8 A;  2F23 A;  4NZC A;  2RUQ A;  1E6Z A;  3ARW A;  3KCE A;  2ZQV A;  3WD1 A;  2ZR5 A;  3O5M A;  2RUC A;  3EY6 A;  5D75 A;  1Q6U A;  2AOS A;  3IKG A;  1YW5 A;  1ROU A;  1HKM A;  4U85 A;  2XP3 A;  2ZR6 A;  1ZBK A;  4Q22 A;  3CHD A;  4MPK A;  2XPA A;  3ART A;  2JZV A;  3ARO A;  1J4I A;  2F21 A;  1FAP A;  2RSE A;  2ITK A;  3WH0 A;  2QF8 A;  3O5L A;  3TC5 A;  4TW7 A;  4ODQ A;  3EIP A;  1X6N A;  1EIB A;  1GUV A;  4JFI A;  2P4V A;  3RFW A;  4KQZ A;  3UQI A;  1FD9 A;  4HBO A;  2PPP A;  4LAY A;  2FKE A;  3OA5 A;  2MLZ A;  3ARP A;  2PV3 A;  2N87 A;  4WIW A;  5GQB A;  3NRK A;  5HKG A;  1BL4 A;  1JNT A;  5HW7 A;  2RQS A;  1LL6 A;  2M08 A;  2DSZ A;  2A3B A;  4MAV A;  4W5U A;  2Y78 A;  5GPR A;  3LUO A;  1GRJ A;  3WQW A;  1FKS A;  5DIV A;  2A3C A;  4JFJ A;  1W26 A;  5HTG A;  4ZS6 A;  1KFW A;  3FXY A;  1WNO A;  4DH0 A;  1J4H A;  4MTV A;  4G2P A;  4ITZ A;  4JFK A;  1J4R A;  1SYT A;  4DRQ A;  3B9E A;  1E44 A;  1W1V A;  3ARV A;  3RME A;  5I98 A;  4BF8 A;  2D9F A;  5B8I C;  4ODN A;  1ZCN A;  4O2T A;  3O5F A;  3CH9 A;  2MPH A;  4DRM A;  1E6R A;  4WKA A;  1ZB5 A;  1ZBW A;  2MNT A;  3WL0 A;  3CHF A;  5BXJ A;  4R0X A;  3RM4 A;  1TFV A;  2DSW A;  2KGJ A;  3IHZ A;  1LL7 A;  4JYS A;  2ZR4 A;  3NI6 A;  4QZV B;  4QT2 A;  4DRK A;  1W9U A;  4DRI A;  4LAX A;  1FKI A;  5HUA A;  4ZPW R;  3ARX A;  2M1I A;  1GPF A;  1N1A A;  1NMV A;  2XP7 A;  3O5J A;  2LGO A;  4DWS B;  1HKK A;  4ODO A;  5HW8 A;  2VN1 A;  2IF4 A;  3JYM A;  1QPL A;  3AS1 A;  1LQ0 A;  2XP6 A;  4ODL A;  3UI4 A;  3RM8 A;  1ZK6 A;  2RUD A;  3CGN A;  1NWR A;  3O5G A;  1A7X A;  2PPN A;  1JNS A;  3CGM A;  4DT4 A;  3UF8 A;  3IK8 A;  2WK2 A;  1FKH A;  4IPX A;  4DZ3 A;  3PR9 A;  5DO2 A;  2MLX A;  2ETN A;  2PI6 A;  4U84 A;  4Z2K A;  2YBT A;  1Q6I A;  1HJX A;  4W9P A;  1E15 A;  3B9D A;  3PA7 A;  1W9V A;  1ITX A;  1HJV A;  3KAD A;  4IQ2 A;  3UQA A;  3O5P A;  3PRB A;  2OLH A;  1FKF A;  4Z2J A;  4DWS D;  2A3A A;  1M5Y A;  3WD3 A;  4Z2I A;  2WLZ A;  3KAG A;  2PV1 A;  4N19 A;  1LG1 A;  5HWB A;  1FKB A;  4ODP A;  2LPV A;  1Q1C A;  3PRA A;  1UR8 A;  4WK9 A;  3W4R A;  1NMW A;  1EHN A;  1FFR A;  1E6N A;  4IT6 A;  4GIV A;  1W1Y A;  2EUL A;  1QZ2 A;  1ZU8 A;  3TDB A;  1HKJ A;  3KAC A;  1EYM A;  3KAH A;  1J6Y A;  1VF8 A;  2DSV A;  1KT1 A;  2G41 A;  3ARQ A;  3VAW A;  2DT1 A;  1OGB A;  1W9P A;  2AWG A;  2WM0 A;  4TW6 A;  1XRV A;  4TW8 A;  3O5I A;  4C02 B;  3TCZ A;  2KO7 A;  4GGQ A;  1D7I A;  4QIB A;  5DIT A;  3O5E A;  1NWU A;  4Z2G A;  1JVW A;  2G8Z A;  1U79 A;  4U86 A;  1X6L A;  3B9A A;  1FKK A;  1H0I A;  3MDY B;  1WB0 A;  4FN2 A;  4MNL A;  1NH6 A;  3WD2 A;  4L3N A;  2K8I A;  4FAP A;  4S3J A;  4LGX A;  2WLY A;  2XPB A;  3NTP A;  4XAK A;  4DRJ A;  1W1T A;  1O6I A;  2DG9 A;  1F40 A;  1TCO C;  4J4O A;  4ML4 A;  1FKG A;  1LL4 A;  4J4N A;  3PRD A;  4DZ2 A;  2ESC A;  3H9R B;  4S3K A;  3WIJ A;  3QOK A;  4ZPV R;  5HT1 A;  3RGC A;  3AS2 A;  3O5D A;  4DWS A;  2DT0 A;  1UR9 A;  1F8A B;  2PN0 A;  3B8S A;  2ZQT A;  4DRH A;  4MGV A;  4TX0 A;  3RM9 A;  3ARZ A;  2XP5 A;  2KI3 A;  4ODM A;  4DIP A;  4W9O A;  2XP4 A;  4MSP A;  2IUZ A;  3O5O A;  1EDQ A;  1FKT A;  1FFQ A;  4DWS C;  3ARU A;  1BKF A;  2ZQS A;  3KAI A;  4G50 A;  2MLY A;  4P8U A;  1FKD A;  2DG4 A;  4ODR A;  1L1P A;  3G6M A;  4PTM A;  4KR0 B;  3WQV A;  2LKN A;  2A3E A;  1NSG A;  3BMB A;  1P5Q A;  2FDM A;  4Q7N A;  2M2A A;  1NWS A;  4MNK A;  3CHE A;  4Z2L A;  1GOI A;  3CHC A;  1ZL1 A;  2DG3 A;  4LAV A;  1HJW A;  4P8V A;  3ARY A;  3I6C A;  5HWC A;  4W9Q A;  2LJ4 A;  4R5E A;  3GTY X;  4ZPT R;  1D7J A;  1D7H A;  1NWT A;  2KE0 A; 
#chains in the Genus database with same CATH homology
 3GPK A;  1FKJ A;  2L2S A;  2XP9 A;  5J6E A;  1ZBV A;  4DRO A;  1KT0 A;  3O5Q A;  1E6P A;  1HKI A;  4P8W A;  4AY1 A;  1ROT A;  3ARS A;  3KAB A;  4MNM A;  3UI6 A;  2Q5A A;  3AS0 A;  3OOB A;  2DT2 A;  4TNS A;  3WKZ A;  1OGG A;  1JND A;  3JYJ A;  4L72 B;  4NSB A;  3O5K A;  1WAW A;  3ODK A;  1R9H A;  2KFW A;  3ALG A;  2PPO A;  1D2K A;  4JFL A;  3WD0 A;  3G6L A;  3IKD A;  3ARR A;  1QPF A;  3B7X A;  1YAT A;  3O5R A;  2MF9 A;  3CZ8 A;  5HBF A;  1SR0 A;  1EQ3 A;  1JNE A;  4QT3 A;  1CTN A;  1E9L A;  4IT4 A;  2F2D A;  4MNJ A;  2PBC A;  2RUR A;  3AQU A;  3JXV A;  2F4E A;  5GPG A;  3AS3 A;  4URI A;  1FKL A;  4JFM A;  2ZQU A;  1XHG A;  4DRP A;  3ALF A;  4ODK A;  4HBE A;  1PBK A;  1W1P A;  1D6O A;  5JH8 A;  2O9O A;  4P8X A;  3UQB A;  4NNR A;  1Y0O A;  2OFN A;  1HXV A;  1Q6H A;  2YBU A;  1T11 A;  3FAP A;  4LAW A;  5DIU A;  3UI5 A;  1FKR A;  2DT3 A;  2PV2 A;  1PIN A;  2VCD A;  4IQC A;  1B6C A;  1H0G A;  1LJY A;  3WD4 A;  1IX5 A;  3BXW A;  3KZ7 A;  4Z2H A;  2DSU A;  4WKH A;  1K9T A;  4WJX A;  1RD6 A;  5DF0 A;  2KR7 A;  5HW6 A;  4WKF A;  2FAP A;  3FY1 A;  3WL1 A;  1FJD A;  2UZ5 A;  1C9H A;  1LG2 A;  4DRN A;  1ZBC A;  4HAR A;  2DPE A;  5DEZ A;  1OWQ A;  4TYO A;  2O92 A;  3KAF A;  2B31 A;  2XP8 A;  4NZC A;  2RUQ A;  1E6Z A;  3ARW A;  3KCE A;  2ZQV A;  3WD1 A;  2ZR5 A;  3O5M A;  2RUC A;  3EY6 A;  5D75 A;  1Q6U A;  2AOS A;  3IKG A;  1YW5 A;  1ROU A;  1HKM A;  4U85 A;  2XP3 A;  2ZR6 A;  1ZBK A;  4Q22 A;  3CHD A;  4MPK A;  2XPA A;  3ART A;  2JZV A;  3ARO A;  1J4I A;  2F21 A;  1FAP A;  2RSE A;  2ITK A;  3WH0 A;  2QF8 A;  3O5L A;  3TC5 A;  4TW7 A;  4ODQ A;  1X6N A;  1EIB A;  1GUV A;  4JFI A;  3RFW A;  4KQZ A;  3UQI A;  1FD9 A;  4HBO A;  2PPP A;  4LAY A;  2FKE A;  3OA5 A;  2MLZ A;  3ARP A;  2PV3 A;  2N87 A;  4WIW A;  5GQB A;  3NRK A;  5HKG A;  1BL4 A;  1JNT A;  5HW7 A;  2RQS A;  1LL6 A;  2M08 A;  2DSZ A;  2A3B A;  4MAV A;  4W5U A;  2Y78 A;  5GPR A;  3LUO A;  3WQW A;  1FKS A;  5DIV A;  2A3C A;  4JFJ A;  1W26 A;  5HTG A;  4ZS6 A;  1KFW A;  3FXY A;  1WNO A;  4DH0 A;  1J4H A;  4MTV A;  4G2P A;  4ITZ A;  4JFK A;  1J4R A;  1SYT A;  4DRQ A;  3B9E A;  1W1V A;  3ARV A;  3RME A;  5I98 A;  4BF8 A;  2D9F A;  5B8I C;  4ODN A;  1ZCN A;  4O2T A;  3O5F A;  3CH9 A;  2MPH A;  4DRM A;  1E6R A;  4WKA A;  1ZB5 A;  1ZBW A;  2MNT A;  3WL0 A;  3CHF A;  5BXJ A;  4R0X A;  3RM4 A;  1TFV A;  2DSW A;  2KGJ A;  3IHZ A;  1LL7 A;  4JYS A;  2ZR4 A;  3NI6 A;  4QZV B;  4QT2 A;  4DRK A;  1W9U A;  4DRI A;  4LAX A;  1FKI A;  5HUA A;  4ZPW R;  3ARX A;  2M1I A;  1GPF A;  1N1A A;  1NMV A;  2XP7 A;  3O5J A;  2LGO A;  4DWS B;  1HKK A;  4ODO A;  5HW8 A;  2VN1 A;  2IF4 A;  3JYM A;  1QPL A;  3AS1 A;  1LQ0 A;  2XP6 A;  4ODL A;  3UI4 A;  3RM8 A;  1ZK6 A;  2RUD A;  3CGN A;  1NWR A;  3O5G A;  1A7X A;  2PPN A;  1JNS A;  3CGM A;  4DT4 A;  3UF8 A;  3IK8 A;  2WK2 A;  1FKH A;  4IPX A;  4DZ3 A;  3PR9 A;  5DO2 A;  2MLX A;  2PI6 A;  4U84 A;  4Z2K A;  2YBT A;  1Q6I A;  1HJX A;  4W9P A;  1E15 A;  3B9D A;  3PA7 A;  1W9V A;  1ITX A;  1HJV A;  3KAD A;  4IQ2 A;  3UQA A;  3O5P A;  3PRB A;  2OLH A;  1FKF A;  4Z2J A;  4DWS D;  2A3A A;  1M5Y A;  3WD3 A;  4Z2I A;  2WLZ A;  3KAG A;  2PV1 A;  4N19 A;  1LG1 A;  5HWB A;  1FKB A;  4ODP A;  2LPV A;  1Q1C A;  3PRA A;  1UR8 A;  4WK9 A;  3W4R A;  1NMW A;  1EHN A;  1FFR A;  1E6N A;  4IT6 A;  4GIV A;  1W1Y A;  1QZ2 A;  1ZU8 A;  3TDB A;  1HKJ A;  3KAC A;  1EYM A;  3KAH A;  1J6Y A;  1VF8 A;  2DSV A;  1KT1 A;  2G41 A;  3ARQ A;  3VAW A;  2DT1 A;  1OGB A;  1W9P A;  2AWG A;  2WM0 A;  4TW6 A;  1XRV A;  4TW8 A;  3O5I A;  4C02 B;  3TCZ A;  2KO7 A;  4GGQ A;  1D7I A;  4QIB A;  5DIT A;  3O5E A;  1NWU A;  4Z2G A;  1JVW A;  2G8Z A;  1U79 A;  4U86 A;  1X6L A;  3B9A A;  1FKK A;  1H0I A;  3MDY B;  1WB0 A;  4FN2 A;  4MNL A;  1NH6 A;  3WD2 A;  4L3N A;  2K8I A;  4FAP A;  4S3J A;  4LGX A;  2WLY A;  2XPB A;  3NTP A;  4XAK A;  4DRJ A;  1W1T A;  1O6I A;  2DG9 A;  1F40 A;  1TCO C;  4J4O A;  4ML4 A;  1FKG A;  1LL4 A;  4J4N A;  3PRD A;  4DZ2 A;  2ESC A;  3H9R B;  4S3K A;  3WIJ A;  3QOK A;  4ZPV R;  5HT1 A;  3RGC A;  3AS2 A;  3O5D A;  4DWS A;  2DT0 A;  1UR9 A;  1F8A B;  3B8S A;  2ZQT A;  4DRH A;  4MGV A;  4TX0 A;  3RM9 A;  3ARZ A;  2XP5 A;  2KI3 A;  4ODM A;  4DIP A;  4W9O A;  2XP4 A;  4MSP A;  2IUZ A;  3O5O A;  1EDQ A;  1FKT A;  1FFQ A;  4DWS C;  3ARU A;  1BKF A;  2ZQS A;  3KAI A;  4G50 A;  2MLY A;  4P8U A;  1FKD A;  2DG4 A;  4ODR A;  1L1P A;  3G6M A;  4PTM A;  4KR0 B;  3WQV A;  2LKN A;  2A3E A;  1NSG A;  1P5Q A;  2FDM A;  4Q7N A;  2M2A A;  1NWS A;  4MNK A;  3CHE A;  4Z2L A;  1GOI A;  3CHC A;  1ZL1 A;  2DG3 A;  4LAV A;  1HJW A;  4P8V A;  3ARY A;  3I6C A;  5HWC A;  4W9Q A;  2LJ4 A;  4R5E A;  4ZPT R;  1D7J A;  1D7H A;  1NWT A;  2KE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...