1D6OA

Native fkbp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d6oA00
4DRNA 3OOBA 2JZVA 1FKDA 3O5JA 1A7XA 2PPPA 1PINA 3UQBA 1ZK6A 4DRPA 3IK8A 2RUDA 3TC5A 5HTGA 2XPBA 4TW7A 2KE0A 1FKRA 3KABA 2DG3A 2FKEA 3JYMA 1N1AA 4G2PA 1J6YA 1NMWA 1FKJA 4GGQA 1EQ3A 2VCDA 3MDYB 4J4OA 3KADA 4MSPA 5HKGA 5HW7A 2RURA 5HWBA 4BF8A 1YW5A 1F8AB 3O5EA 4ODKA 4G50A 1C9HA 1FAPA 1ZCNA 2KFWA 3KZ7A 3O5RA 4FN2A 2PPNA 2KGJA 4JFKA 2D9FA 2ZR5A 3EY6A 2M2AA 3FAPA 3NRKA 4TW8A 4QIBA 4JYSA 4TYOA 2MLXA 2XP5A 2RUQA 3O5KA 4DRJA 2UZ5A 4DROA 5D75A 4ODMA 2DG9A 2M1IA 1TCOC 2OFNA 4DT4A 3JXVA 2F21A 3O5PA 5I98A 1KT1A 1L1PA 3O5GA 1P5QA 3O5IA 1D7HA 1J4HA 2MLZA 1Q6IA 1FJDA 4DRHA 1Q1CA 2IF4A 2KO7A 4QT3A 4U84A 5J6EA 3I6CA 3ODKA 3UF8A 4JFMA 5GPGA 4DRKA 3RFWA 3UI5A 2ZQSA 4IQ2A 1BKFA 2ZR6A 4TNSA 3O5FA 4DIPA 1FKGA 2F2DA 4QT2A 2PV3A 3IKGA 1ROUA 5HT1A 1F40A 1Y0OA 4DRQA 1D7IA 1W26A 1FKTA 2ZQUA 2LKNA 2ZQVA 4LAYA 5BXJA 2Y78A 2MLYA 4MGVA 5HW8A 1FKHA 4FAPA 2LJ4A 2RQSA 3O5OA 3PRDA 2K8IA 4O2TA 1KT0A 2AWGA 2ZR4A 3PRBA 4LAWA 2PV1A 3NTPA 2KI3A 4TX0A 1EYMA 3H9RB 3O5MA 3UI4A 2PV2A 1FKKA 2PPOA 4W9OA 2FAPA 2XP7A 5HWCA 4JFIA 2XP9A 4IQCA 3KCEA 3LUOA 1FD9A 2M08A 3O5DA 4JFJA 1ROTA 4R0XA 4DRMA 4IPXA 4LAVA 5DIVA 4J4NA 3TCZA 4ODLA 2MF9A 4ODPA 3IKDA 1B6CA 4ODRA 1JVWA 2MNTA 3PA7A 4W9QA 3GPKA 1YATA 1D6OA 2LPVA 1PBKA 1Q6UA 2PBCA 1Q6HA 4ODQA 1QPFA 3KAHA 4ITZA 2ITKA 3UI6A 5B8IC 4W9PA 4ODNA 2XP4A 3KAGA 1JNSA 3WH0A 5DITA 3O5QA 1FKBA 2L2SA 1NSGA 1T11A 1J4IA 1D7JA 4N19A 1J4RA 4TW6A 2XP8A 3IHZA 4C02B 1HXVA 4LAXA 4DH0A 1NMVA 3O5LA 2N87A 3UQIA 4U85A 3NI6A 3CGMA 3UQAA 2VN1A 4JFLA 3VAWA 2Q5AA 3CGNA 1R9HA 1QZ2A 1QPLA 4U86A 3JYJA 2KR7A 2LGOA 1FKSA 4NNRA 3RGCA 3TDBA 2RSEA 2XP6A 3KAFA 2ZQTA 5HW6A 2F4EA 3KAIA 4DRIA 4DZ2A 5DIUA 1JNTA 1FKIA 2XPAA 4ODOA 2MPHA 2DG4A 4GIVA 4DZ3A 2XP3A 5HUAA 1BL4A 3B7XA 1FKLA 1M5YA 2RUCA 1U79A 3KACA 1FKFA
chains in the Genus database with same CATH superfamily
4DRNA 3OOBA 1FKDA 3UQBA 1PINA 5HTGA 2XPBA 4TW7A 3KABA 3JYMA 4NSBA 3AS3A 1J6YA 1NMWA 4GGQA 5HKGA 4MSPA 5HW7A 3RM9A 4BF8A 3G6LA 3PR9A 1FAPA 2EULA 3O5RA 3AS0A 4AY1A 2M2AA 4DROA 2MLXA 2UZ5A 3ALGA 5D75A 3GTYX 2M1IA 5DF0A 3ARPA 1TCOC 2OFNA 5I98A 3O5GA 1J4HA 2IF4A 2KO7A 4U84A 3ODKA 1H0IA 2DSZA 4DRKA 1E9LA 3RFWA 4TNSA 3O5FA 2F2DA 4QT2A 5HT1A 4LAYA 2ZQVA 2MLYA 4MGVA 1FKHA 1GOIA 2K8IA 4O2TA 4LAWA 4WKHA 1GRJA 2WLYA 2PV2A 2FAPA 4KQZA 1IX5A 1FD9A 1HKIA 4DWSD 1UR9A 5DIVA 4LAVA 1E44A 4ODLA 1B6CA 3B8SA 1LL4A 1OGBA 1HJVA 1D6OA 4WKAA 1Q6HA 4ODQA 1QPFA 3KAHA 5B8IC 1FFQA 3KAGA 1NWSA 4W5UA 5DITA 1HJWA 1NSGA 4TW6A 4LAXA 2N87A 3WIJA 4Q7NA 4MTVA 4HBEA 4P8UA 1FKSA 3TDBA 2RSEA 3KAFA 4LGXA 1FFRA 2YBTA 1E6ZA 4PTMA 4DZ3A 1BL4A 1FKLA 1U79A 2JZVA 3O5JA 1A7XA 3WL1A 3CHEA 3FY1A 1EQ3A 3G6MA 1H0GA 4J4OA 3KADA 2RURA 4WJXA 3ARZA 2A3CA 3ARQA 4URIA 1HKKA 4G50A 1C9HA 2O9OA 1E6NA 3ARRA 4FN2A 2KGJA 1HKMA 3FAPA 3EIPA 3O5KA 1SYTA 1HJXA 4ODMA 4R5EA 3W4RA 2F21A 1P5QA 3O5IA 2MLZA 1FJDA 3I6CA 4Z2GA 4S3JA 4Z2KA 4JFMA 3ALFA 2ZQSA 4IQ2A 2ZR6A 3WD4A 4DIPA 3ARUA 3GU0A 4DRQA 4ZS6A 1D7IA 1W26A 1FKTA 2ZQUA 1EDQA 2OLHA 2Y78A 3B9EA 1JNDA 2DT2A 1W1TA 3O5OA 2A3BA 4L3NA 2ZR4A 2PV1A 4TX0A 2PN0A 1NH6A 1EYMA 3H9RB 3UI4A 4W9OA 5HWCA 1GPFA 4IQCA 2DSVA 3LUOA 4JFJA 1ROTA 4R0XA 3TCZA 4J4NA 2MF9A 3IKDA 4ODRA 1YATA 3UI6A 2XP4A 2L2SA 1T11A 4MNMA 1D7JA 4N19A 3IHZA 1NMVA 4HBOA 3CGMA 3VAWA 1QZ2A 1QPLA 1LL7A 2KR7A 4NNRA 1X6NA 2XP6A 3ARWA 3RM8A 1E6PA 4S3KA 3WL0A 4DZ2A 1W1YA 1FKIA 4ODOA 3CH9A 4GIVA 1GUVA 4Z2LA 1M5YA 2RUCA 1VF8A 2PPPA 1ZL1A 4L72B 4DRPA 3IK8A 2RUDA 2DT0A 2KE0A 1FKRA 2DG3A 2FKEA 1FKJA 3WKZA 4XAKA 2VCDA 4WIWA 1D2KA 3OA5A 4MNLA 4ODKA 5DO2A 1X6LA 4ZPVR 3KZ7A 1ZCNA 4FAPA 1JNSA 4JFKA 2D9FA 3NRKA 3EY6A 4TYOA 4TW8A 2XP5A 4DRJA 3ARVA 2P4VA 1W1VA 4WKFA 1WB0A 5GPRA 1TFVA 4DT4A 3O5PA 1KT1A 1L1PA 1D7HA 3AS2A 1W9VA 1K9TA 2ESCA 1Q1CA 3CHCA 5J6EA 2A3AA 1RD6A 1CTNA 3UF8A 5GPGA 1SR0A 3UI5A 3CHDA 1NWTA 1F40A 1Y0OA 1ITXA 4Z2HA 2LKNA 1LG2A 2QF8A 2ETNA 4IT4A 3PRDA 2AWGA 3NTPA 1ZU8A 1FKKA 3AQUA 1OWQA 2XP7A 3ARSA 4HARA 2XP9A 2YBUA 2M08A 3O5DA 4IT6A 4IPXA 4MAVA 1ZBVA 4ODPA 2F23A 1KFWA 3ARXA 4MNJA 1JVWA 2MNTA 3PA7A 2LPVA 1PBKA 2WM0A 2PBCA 3RM4A 4ITZA 2ITKA 4ZPTR 4ODNA 3WD3A 1NWRA 3WH0A 3WQWA 3O5QA 1HKJA 1NWUA 1J4IA 1J4RA 1EIBA 3WD2A 4DH0A 3UQIA 3UQAA 3ARYA 4JFLA 3CGNA 1R9HA 3JYJA 3RGCA 2LGOA 1W9PA 2O92A 4MNKA 4ML4A 5DIUA 1JNTA 4P8WA 3WD1A 1LJYA 3FXYA 2G8ZA 5HBFA 2DG4A 5HUAA 3QOKA 3B7XA 2B5UB 2FDMA 1ZK6A 3RMEA 1UR8A 4DWSB 3TC5A 1JCHB 4WK9A 3PRAA 4DWSA 1N1AA 4G2PA 3MDYB 1OGGA 5HWBA 1ZBKA 1YW5A 1F8AB 3O5EA 2G41A 2KFWA 2WLZA 1JNEA 2PPNA 2ZR5A 4QIBA 4JYSA 2RUQA 3BMBA 2DG9A 3JXVA 1W1PA 3WD0A 1Q6IA 4DRHA 4QT3A 1ZBCA 3AROA 4UDMA 2DSWA 1BKFA 1FKGA 4QZVB 2PV3A 3IKGA 1ROUA 1O6IA 5BXJA 5HW8A 4DWSC 2LJ4A 2RQSA 3AS1A 1KT0A 2DT3A 3PRBA 1ZB5A 2KI3A 1LL6A 2DPEA 4Z2IA 3O5MA 4NZCA 3BXWA 1WNOA 2PPOA 4Z2JA 1E6RA 4JFIA 4Q22A 3KCEA 3WQVA 4DRMA 1EHNA 4W9QA 3CZ8A 3GPKA 2WK2A 2IUZA 1Q6UA 1LG1A 4ZPWR 3CHFA 4P8VA 4W9PA 1WAWA 1FKBA 2DSUA 5GQBA 1XRVA 1HXVA 2XP8A 4C02B 3O5LA 4U85A 3NI6A 1ZBWA 2VN1A 3B9AA 2Q5AA 1W9UA 4P8XA 4U86A 2PI6A 5JH8A 2ZQTA 2B31A 5HW6A 2F4EA 3KAIA 4MPKA 4DRIA 2DT1A 1XHGA 2XPAA 1LQ0A 2AOSA 2MPHA 2A3EA 3ARTA 3B9DA 2XP3A 5DEZA 4KR0B 3KACA 1E15A 1FKFA
chains in the Genus database with same CATH topology
4DRNA 3OOBA 1FKDA 3UQBA 1PINA 5HTGA 2XPBA 4TW7A 3KABA 3JYMA 4NSBA 3AS3A 1J6YA 1NMWA 4GGQA 5HKGA 4MSPA 5HW7A 3RM9A 4BF8A 3G6LA 3PR9A 1FAPA 3AS0A 3O5RA 4AY1A 2M2AA 4DROA 2MLXA 2UZ5A 3ALGA 5D75A 2M1IA 5DF0A 3ARPA 1TCOC 2OFNA 5I98A 3O5GA 1J4HA 2IF4A 2KO7A 4U84A 3ODKA 1H0IA 2DSZA 4DRKA 1E9LA 3RFWA 4TNSA 3O5FA 2F2DA 4QT2A 5HT1A 4LAYA 2ZQVA 2MLYA 4MGVA 1FKHA 1GOIA 2K8IA 4O2TA 4LAWA 4WKHA 2WLYA 2PV2A 2FAPA 4KQZA 1IX5A 1FD9A 1HKIA 4DWSD 1UR9A 5DIVA 4LAVA 4ODLA 1B6CA 3B8SA 1LL4A 1OGBA 1HJVA 1D6OA 4WKAA 1Q6HA 4ODQA 1QPFA 3KAHA 5B8IC 1FFQA 3KAGA 1NWSA 4W5UA 5DITA 1HJWA 1NSGA 4TW6A 4LAXA 2N87A 3WIJA 4Q7NA 4MTVA 4HBEA 4P8UA 1FKSA 3TDBA 2RSEA 3KAFA 4LGXA 1FFRA 2YBTA 1E6ZA 4PTMA 4DZ3A 1BL4A 1FKLA 1U79A 2JZVA 3O5JA 1A7XA 3WL1A 3CHEA 3FY1A 1EQ3A 3G6MA 1H0GA 4J4OA 3KADA 2RURA 4WJXA 3ARZA 2A3CA 3ARQA 4URIA 1HKKA 4G50A 1C9HA 2O9OA 1E6NA 3ARRA 4FN2A 2KGJA 1HKMA 3FAPA 3O5KA 1SYTA 1HJXA 4ODMA 4R5EA 3W4RA 2F21A 1P5QA 3O5IA 2MLZA 1FJDA 3I6CA 4Z2GA 4S3JA 4Z2KA 4JFMA 3ALFA 2ZQSA 4IQ2A 2ZR6A 3WD4A 4DIPA 3ARUA 4DRQA 4ZS6A 1D7IA 1W26A 1FKTA 2ZQUA 1EDQA 2OLHA 2Y78A 3B9EA 1JNDA 2DT2A 1W1TA 3O5OA 2A3BA 4L3NA 2ZR4A 2PV1A 4TX0A 1NH6A 1EYMA 3H9RB 3UI4A 4W9OA 5HWCA 1GPFA 4IQCA 2DSVA 3LUOA 4JFJA 1ROTA 4R0XA 3TCZA 4J4NA 2MF9A 3IKDA 4ODRA 1YATA 3UI6A 2XP4A 2L2SA 1T11A 4MNMA 1D7JA 4N19A 3IHZA 1NMVA 4HBOA 3CGMA 3VAWA 1QZ2A 1QPLA 1LL7A 2KR7A 4NNRA 1X6NA 2XP6A 3ARWA 3RM8A 1E6PA 4S3KA 3WL0A 4DZ2A 1W1YA 1FKIA 4ODOA 3CH9A 4GIVA 1GUVA 4Z2LA 1M5YA 2RUCA 1VF8A 2PPPA 1ZL1A 4L72B 4DRPA 3IK8A 2RUDA 2DT0A 2KE0A 1FKRA 2DG3A 2FKEA 1FKJA 3WKZA 4XAKA 2VCDA 4WIWA 1D2KA 3OA5A 4MNLA 4ODKA 5DO2A 1X6LA 4ZPVR 3KZ7A 1ZCNA 4FAPA 1JNSA 4JFKA 2D9FA 3NRKA 3EY6A 4TYOA 4TW8A 2XP5A 4DRJA 3ARVA 1W1VA 4WKFA 1WB0A 5GPRA 1TFVA 4DT4A 3O5PA 1KT1A 1L1PA 1D7HA 3AS2A 1W9VA 1K9TA 2ESCA 1Q1CA 3CHCA 5J6EA 2A3AA 1RD6A 1CTNA 3UF8A 5GPGA 1SR0A 3UI5A 3CHDA 1NWTA 1F40A 1Y0OA 1ITXA 4Z2HA 2LKNA 1LG2A 2QF8A 4IT4A 3PRDA 2AWGA 3NTPA 1ZU8A 1FKKA 3AQUA 1OWQA 2XP7A 3ARSA 4HARA 2XP9A 2YBUA 2M08A 3O5DA 4IT6A 4IPXA 4MAVA 1ZBVA 4ODPA 4MNJA 1KFWA 3ARXA 1JVWA 2MNTA 3PA7A 2LPVA 1PBKA 2WM0A 2PBCA 3RM4A 4ITZA 2ITKA 4ZPTR 4ODNA 3WD3A 1NWRA 3WH0A 3WQWA 3O5QA 1HKJA 1NWUA 1J4IA 1J4RA 1EIBA 3WD2A 4DH0A 3UQIA 3UQAA 3ARYA 4JFLA 3CGNA 1R9HA 3JYJA 3RGCA 2LGOA 1W9PA 2O92A 4MNKA 4ML4A 5DIUA 1JNTA 4P8WA 3WD1A 1LJYA 3FXYA 2G8ZA 5HBFA 2DG4A 5HUAA 3QOKA 3B7XA 2FDMA 1ZK6A 3RMEA 1UR8A 4DWSB 3TC5A 4WK9A 3PRAA 4DWSA 1N1AA 4G2PA 3MDYB 1OGGA 5HWBA 1ZBKA 1YW5A 1F8AB 3O5EA 2G41A 2KFWA 2WLZA 1JNEA 2PPNA 2ZR5A 4QIBA 4JYSA 2RUQA 2DG9A 3JXVA 1W1PA 3WD0A 1Q6IA 4DRHA 4QT3A 1ZBCA 3AROA 2DSWA 1BKFA 1FKGA 4QZVB 2PV3A 3IKGA 1ROUA 1O6IA 5BXJA 5HW8A 4DWSC 2LJ4A 2RQSA 3AS1A 1KT0A 2DT3A 3PRBA 1ZB5A 2KI3A 1LL6A 2DPEA 4Z2IA 3O5MA 4NZCA 3BXWA 1WNOA 2PPOA 4Z2JA 1E6RA 4JFIA 4Q22A 3KCEA 3WQVA 4DRMA 1EHNA 4W9QA 3CZ8A 3GPKA 2WK2A 2IUZA 1Q6UA 1LG1A 4ZPWR 3CHFA 4P8VA 4W9PA 1WAWA 1FKBA 2DSUA 5GQBA 1XRVA 1HXVA 2XP8A 4C02B 3O5LA 4U85A 3NI6A 1ZBWA 2VN1A 3B9AA 2Q5AA 1W9UA 4P8XA 4U86A 2PI6A 5JH8A 2ZQTA 2B31A 5HW6A 2F4EA 3KAIA 4MPKA 4DRIA 2DT1A 1XHGA 2XPAA 1LQ0A 2AOSA 2MPHA 2A3EA 3ARTA 3B9DA 2XP3A 5DEZA 4KR0B 3KACA 1E15A 1FKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRN A;  3OOB A;  2JZV A;  1FKD A;  3O5J A;  1A7X A;  2PPP A;  1PIN A;  3UQB A;  1ZK6 A;  4DRP A;  3IK8 A;  2RUD A;  3TC5 A;  5HTG A;  2XPB A;  4TW7 A;  2KE0 A;  1FKR A;  3KAB A;  2DG3 A;  2FKE A;  3JYM A;  1N1A A;  4G2P A;  1J6Y A;  1NMW A;  1FKJ A;  4GGQ A;  1EQ3 A;  2VCD A;  3MDY B;  4J4O A;  3KAD A;  4MSP A;  5HKG A;  5HW7 A;  2RUR A;  5HWB A;  4BF8 A;  1YW5 A;  1F8A B;  3O5E A;  4ODK A;  4G50 A;  1C9H A;  1FAP A;  1ZCN A;  2KFW A;  3KZ7 A;  3O5R A;  4FN2 A;  2PPN A;  2KGJ A;  4JFK A;  2D9F A;  2ZR5 A;  3EY6 A;  2M2A A;  3FAP A;  3NRK A;  4TW8 A;  4QIB A;  4JYS A;  4TYO A;  2MLX A;  2XP5 A;  2RUQ A;  3O5K A;  4DRJ A;  2UZ5 A;  4DRO A;  5D75 A;  4ODM A;  2DG9 A;  2M1I A;  1TCO C;  2OFN A;  4DT4 A;  3JXV A;  2F21 A;  3O5P A;  5I98 A;  1KT1 A;  1L1P A;  3O5G A;  1P5Q A;  3O5I A;  1D7H A;  1J4H A;  2MLZ A;  1Q6I A;  1FJD A;  4DRH A;  1Q1C A;  2IF4 A;  2KO7 A;  4QT3 A;  4U84 A;  5J6E A;  3I6C A;  3ODK A;  3UF8 A;  4JFM A;  5GPG A;  4DRK A;  3RFW A;  3UI5 A;  2ZQS A;  4IQ2 A;  1BKF A;  2ZR6 A;  4TNS A;  3O5F A;  4DIP A;  1FKG A;  2F2D A;  4QT2 A;  2PV3 A;  3IKG A;  1ROU A;  5HT1 A;  1F40 A;  1Y0O A;  4DRQ A;  1D7I A;  1W26 A;  1FKT A;  2ZQU A;  2LKN A;  2ZQV A;  4LAY A;  5BXJ A;  2Y78 A;  2MLY A;  4MGV A;  5HW8 A;  1FKH A;  4FAP A;  2LJ4 A;  2RQS A;  3O5O A;  3PRD A;  2K8I A;  4O2T A;  1KT0 A;  2AWG A;  2ZR4 A;  3PRB A;  4LAW A;  2PV1 A;  3NTP A;  2KI3 A;  4TX0 A;  1EYM A;  3H9R B;  3O5M A;  3UI4 A;  2PV2 A;  1FKK A;  2PPO A;  4W9O A;  2FAP A;  2XP7 A;  5HWC A;  4JFI A;  2XP9 A;  4IQC A;  3KCE A;  3LUO A;  1FD9 A;  2M08 A;  3O5D A;  4JFJ A;  1ROT A;  4R0X A;  4DRM A;  4IPX A;  4LAV A;  5DIV A;  4J4N A;  3TCZ A;  4ODL A;  2MF9 A;  4ODP A;  3IKD A;  1B6C A;  4ODR A;  1JVW A;  2MNT A;  3PA7 A;  4W9Q A;  3GPK A;  1YAT A;  1D6O A;  2LPV A;  1PBK A;  1Q6U A;  2PBC A;  1Q6H A;  4ODQ A;  1QPF A;  3KAH A;  4ITZ A;  2ITK A;  3UI6 A;  5B8I C;  4W9P A;  4ODN A;  2XP4 A;  3KAG A;  1JNS A;  3WH0 A;  5DIT A;  3O5Q A;  1FKB A;  2L2S A;  1NSG A;  1T11 A;  1J4I A;  1D7J A;  4N19 A;  1J4R A;  4TW6 A;  2XP8 A;  3IHZ A;  4C02 B;  1HXV A;  4LAX A;  4DH0 A;  1NMV A;  3O5L A;  2N87 A;  3UQI A;  4U85 A;  3NI6 A;  3CGM A;  3UQA A;  2VN1 A;  4JFL A;  3VAW A;  2Q5A A;  3CGN A;  1R9H A;  1QZ2 A;  1QPL A;  4U86 A;  3JYJ A;  2KR7 A;  2LGO A;  1FKS A;  4NNR A;  3RGC A;  3TDB A;  2RSE A;  2XP6 A;  3KAF A;  2ZQT A;  5HW6 A;  2F4E A;  3KAI A;  4DRI A;  4DZ2 A;  5DIU A;  1JNT A;  1FKI A;  2XPA A;  4ODO A;  2MPH A;  2DG4 A;  4GIV A;  4DZ3 A;  2XP3 A;  5HUA A;  1BL4 A;  3B7X A;  1FKL A;  1M5Y A;  2RUC A;  1U79 A;  3KAC A;  1FKF A; 
#chains in the Genus database with same CATH topology
 4DRN A;  3OOB A;  1FKD A;  3UQB A;  1PIN A;  5HTG A;  2XPB A;  4TW7 A;  3KAB A;  3JYM A;  4NSB A;  3AS3 A;  1J6Y A;  1NMW A;  4GGQ A;  5HKG A;  4MSP A;  5HW7 A;  3RM9 A;  4BF8 A;  3G6L A;  3PR9 A;  1FAP A;  2EUL A;  3O5R A;  3AS0 A;  4AY1 A;  2M2A A;  4DRO A;  2MLX A;  2UZ5 A;  3ALG A;  5D75 A;  3GTY X;  2M1I A;  5DF0 A;  3ARP A;  1TCO C;  2OFN A;  5I98 A;  3O5G A;  1J4H A;  2IF4 A;  2KO7 A;  4U84 A;  3ODK A;  1H0I A;  2DSZ A;  4DRK A;  1E9L A;  3RFW A;  4TNS A;  3O5F A;  2F2D A;  4QT2 A;  5HT1 A;  4LAY A;  2ZQV A;  2MLY A;  4MGV A;  1FKH A;  1GOI A;  2K8I A;  4O2T A;  4LAW A;  4WKH A;  1GRJ A;  2WLY A;  2PV2 A;  2FAP A;  4KQZ A;  1IX5 A;  1FD9 A;  1HKI A;  4DWS D;  1UR9 A;  5DIV A;  4LAV A;  1E44 A;  4ODL A;  1B6C A;  3B8S A;  1LL4 A;  1OGB A;  1HJV A;  1D6O A;  4WKA A;  1Q6H A;  4ODQ A;  1QPF A;  3KAH A;  5B8I C;  1FFQ A;  3KAG A;  1NWS A;  4W5U A;  5DIT A;  1HJW A;  1NSG A;  4TW6 A;  4LAX A;  2N87 A;  3WIJ A;  4Q7N A;  4MTV A;  4HBE A;  4P8U A;  1FKS A;  3TDB A;  2RSE A;  3KAF A;  4LGX A;  1FFR A;  2YBT A;  1E6Z A;  4PTM A;  4DZ3 A;  1BL4 A;  1FKL A;  1U79 A;  2JZV A;  3O5J A;  1A7X A;  3WL1 A;  3CHE A;  3FY1 A;  1EQ3 A;  3G6M A;  1H0G A;  4J4O A;  3KAD A;  2RUR A;  4WJX A;  3ARZ A;  2A3C A;  3ARQ A;  4URI A;  1HKK A;  4G50 A;  1C9H A;  2O9O A;  1E6N A;  3ARR A;  4FN2 A;  2KGJ A;  1HKM A;  3FAP A;  3EIP A;  3O5K A;  1SYT A;  1HJX A;  4ODM A;  4R5E A;  3W4R A;  2F21 A;  1P5Q A;  3O5I A;  2MLZ A;  1FJD A;  3I6C A;  4Z2G A;  4S3J A;  4Z2K A;  4JFM A;  3ALF A;  2ZQS A;  4IQ2 A;  2ZR6 A;  3WD4 A;  4DIP A;  3ARU A;  3GU0 A;  4DRQ A;  4ZS6 A;  1D7I A;  1W26 A;  1FKT A;  2ZQU A;  1EDQ A;  2OLH A;  2Y78 A;  3B9E A;  1JND A;  2DT2 A;  1W1T A;  3O5O A;  2A3B A;  4L3N A;  2ZR4 A;  2PV1 A;  4TX0 A;  2PN0 A;  1NH6 A;  1EYM A;  3H9R B;  3UI4 A;  4W9O A;  5HWC A;  1GPF A;  4IQC A;  2DSV A;  3LUO A;  4JFJ A;  1ROT A;  4R0X A;  3TCZ A;  4J4N A;  2MF9 A;  3IKD A;  4ODR A;  1YAT A;  3UI6 A;  2XP4 A;  2L2S A;  1T11 A;  4MNM A;  1D7J A;  4N19 A;  3IHZ A;  1NMV A;  4HBO A;  3CGM A;  3VAW A;  1QZ2 A;  1QPL A;  1LL7 A;  2KR7 A;  4NNR A;  1X6N A;  2XP6 A;  3ARW A;  3RM8 A;  1E6P A;  4S3K A;  3WL0 A;  4DZ2 A;  1W1Y A;  1FKI A;  4ODO A;  3CH9 A;  4GIV A;  1GUV A;  4Z2L A;  1M5Y A;  2RUC A;  1VF8 A;  2PPP A;  1ZL1 A;  4L72 B;  4DRP A;  3IK8 A;  2RUD A;  2DT0 A;  2KE0 A;  1FKR A;  2DG3 A;  2FKE A;  1FKJ A;  3WKZ A;  4XAK A;  2VCD A;  4WIW A;  1D2K A;  3OA5 A;  4MNL A;  4ODK A;  5DO2 A;  1X6L A;  4ZPV R;  3KZ7 A;  1ZCN A;  4FAP A;  1JNS A;  4JFK A;  2D9F A;  3NRK A;  3EY6 A;  4TYO A;  4TW8 A;  2XP5 A;  4DRJ A;  3ARV A;  2P4V A;  1W1V A;  4WKF A;  1WB0 A;  5GPR A;  1TFV A;  4DT4 A;  3O5P A;  1KT1 A;  1L1P A;  1D7H A;  3AS2 A;  1W9V A;  1K9T A;  2ESC A;  1Q1C A;  3CHC A;  5J6E A;  2A3A A;  1RD6 A;  1CTN A;  3UF8 A;  5GPG A;  1SR0 A;  3UI5 A;  3CHD A;  1NWT A;  1F40 A;  1Y0O A;  1ITX A;  4Z2H A;  2LKN A;  1LG2 A;  2QF8 A;  2ETN A;  4IT4 A;  3PRD A;  2AWG A;  3NTP A;  1ZU8 A;  1FKK A;  3AQU A;  1OWQ A;  2XP7 A;  3ARS A;  4HAR A;  2XP9 A;  2YBU A;  2M08 A;  3O5D A;  4IT6 A;  4IPX A;  4MAV A;  1ZBV A;  4ODP A;  2F23 A;  1KFW A;  3ARX A;  4MNJ A;  1JVW A;  2MNT A;  3PA7 A;  2LPV A;  1PBK A;  2WM0 A;  2PBC A;  3RM4 A;  4ITZ A;  2ITK A;  4ZPT R;  4ODN A;  3WD3 A;  1NWR A;  3WH0 A;  3WQW A;  3O5Q A;  1HKJ A;  1NWU A;  1J4I A;  1J4R A;  1EIB A;  3WD2 A;  4DH0 A;  3UQI A;  3UQA A;  3ARY A;  4JFL A;  3CGN A;  1R9H A;  3JYJ A;  3RGC A;  2LGO A;  1W9P A;  2O92 A;  4MNK A;  4ML4 A;  5DIU A;  1JNT A;  4P8W A;  3WD1 A;  1LJY A;  3FXY A;  2G8Z A;  5HBF A;  2DG4 A;  5HUA A;  3QOK A;  3B7X A;  2B5U B;  2FDM A;  1ZK6 A;  3RME A;  1UR8 A;  4DWS B;  3TC5 A;  1JCH B;  4WK9 A;  3PRA A;  4DWS A;  1N1A A;  4G2P A;  3MDY B;  1OGG A;  5HWB A;  1ZBK A;  1YW5 A;  1F8A B;  3O5E A;  2G41 A;  2KFW A;  2WLZ A;  1JNE A;  2PPN A;  2ZR5 A;  4QIB A;  4JYS A;  2RUQ A;  3BMB A;  2DG9 A;  3JXV A;  1W1P A;  3WD0 A;  1Q6I A;  4DRH A;  4QT3 A;  1ZBC A;  3ARO A;  4UDM A;  2DSW A;  1BKF A;  1FKG A;  4QZV B;  2PV3 A;  3IKG A;  1ROU A;  1O6I A;  5BXJ A;  5HW8 A;  4DWS C;  2LJ4 A;  2RQS A;  3AS1 A;  1KT0 A;  2DT3 A;  3PRB A;  1ZB5 A;  2KI3 A;  1LL6 A;  2DPE A;  4Z2I A;  3O5M A;  4NZC A;  3BXW A;  1WNO A;  2PPO A;  4Z2J A;  1E6R A;  4JFI A;  4Q22 A;  3KCE A;  3WQV A;  4DRM A;  1EHN A;  4W9Q A;  3CZ8 A;  3GPK A;  2WK2 A;  2IUZ A;  1Q6U A;  1LG1 A;  4ZPW R;  3CHF A;  4P8V A;  4W9P A;  1WAW A;  1FKB A;  2DSU A;  5GQB A;  1XRV A;  1HXV A;  2XP8 A;  4C02 B;  3O5L A;  4U85 A;  3NI6 A;  1ZBW A;  2VN1 A;  3B9A A;  2Q5A A;  1W9U A;  4P8X A;  4U86 A;  2PI6 A;  5JH8 A;  2ZQT A;  2B31 A;  5HW6 A;  2F4E A;  3KAI A;  4MPK A;  4DRI A;  2DT1 A;  1XHG A;  2XPA A;  1LQ0 A;  2AOS A;  2MPH A;  2A3E A;  3ART A;  3B9D A;  2XP3 A;  5DEZ A;  4KR0 B;  3KAC A;  1E15 A;  1FKF A; 
#chains in the Genus database with same CATH homology
 4DRN A;  3OOB A;  1FKD A;  3UQB A;  1PIN A;  5HTG A;  2XPB A;  4TW7 A;  3KAB A;  3JYM A;  4NSB A;  3AS3 A;  1J6Y A;  1NMW A;  4GGQ A;  5HKG A;  4MSP A;  5HW7 A;  3RM9 A;  4BF8 A;  3G6L A;  3PR9 A;  1FAP A;  3AS0 A;  3O5R A;  4AY1 A;  2M2A A;  4DRO A;  2MLX A;  2UZ5 A;  3ALG A;  5D75 A;  2M1I A;  5DF0 A;  3ARP A;  1TCO C;  2OFN A;  5I98 A;  3O5G A;  1J4H A;  2IF4 A;  2KO7 A;  4U84 A;  3ODK A;  1H0I A;  2DSZ A;  4DRK A;  1E9L A;  3RFW A;  4TNS A;  3O5F A;  2F2D A;  4QT2 A;  5HT1 A;  4LAY A;  2ZQV A;  2MLY A;  4MGV A;  1FKH A;  1GOI A;  2K8I A;  4O2T A;  4LAW A;  4WKH A;  2WLY A;  2PV2 A;  2FAP A;  4KQZ A;  1IX5 A;  1FD9 A;  1HKI A;  4DWS D;  1UR9 A;  5DIV A;  4LAV A;  4ODL A;  1B6C A;  3B8S A;  1LL4 A;  1OGB A;  1HJV A;  1D6O A;  4WKA A;  1Q6H A;  4ODQ A;  1QPF A;  3KAH A;  5B8I C;  1FFQ A;  3KAG A;  1NWS A;  4W5U A;  5DIT A;  1HJW A;  1NSG A;  4TW6 A;  4LAX A;  2N87 A;  3WIJ A;  4Q7N A;  4MTV A;  4HBE A;  4P8U A;  1FKS A;  3TDB A;  2RSE A;  3KAF A;  4LGX A;  1FFR A;  2YBT A;  1E6Z A;  4PTM A;  4DZ3 A;  1BL4 A;  1FKL A;  1U79 A;  2JZV A;  3O5J A;  1A7X A;  3WL1 A;  3CHE A;  3FY1 A;  1EQ3 A;  3G6M A;  1H0G A;  4J4O A;  3KAD A;  2RUR A;  4WJX A;  3ARZ A;  2A3C A;  3ARQ A;  4URI A;  1HKK A;  4G50 A;  1C9H A;  2O9O A;  1E6N A;  3ARR A;  4FN2 A;  2KGJ A;  1HKM A;  3FAP A;  3O5K A;  1SYT A;  1HJX A;  4ODM A;  4R5E A;  3W4R A;  2F21 A;  1P5Q A;  3O5I A;  2MLZ A;  1FJD A;  3I6C A;  4Z2G A;  4S3J A;  4Z2K A;  4JFM A;  3ALF A;  2ZQS A;  4IQ2 A;  2ZR6 A;  3WD4 A;  4DIP A;  3ARU A;  4DRQ A;  4ZS6 A;  1D7I A;  1W26 A;  1FKT A;  2ZQU A;  1EDQ A;  2OLH A;  2Y78 A;  3B9E A;  1JND A;  2DT2 A;  1W1T A;  3O5O A;  2A3B A;  4L3N A;  2ZR4 A;  2PV1 A;  4TX0 A;  1NH6 A;  1EYM A;  3H9R B;  3UI4 A;  4W9O A;  5HWC A;  1GPF A;  4IQC A;  2DSV A;  3LUO A;  4JFJ A;  1ROT A;  4R0X A;  3TCZ A;  4J4N A;  2MF9 A;  3IKD A;  4ODR A;  1YAT A;  3UI6 A;  2XP4 A;  2L2S A;  1T11 A;  4MNM A;  1D7J A;  4N19 A;  3IHZ A;  1NMV A;  4HBO A;  3CGM A;  3VAW A;  1QZ2 A;  1QPL A;  1LL7 A;  2KR7 A;  4NNR A;  1X6N A;  2XP6 A;  3ARW A;  3RM8 A;  1E6P A;  4S3K A;  3WL0 A;  4DZ2 A;  1W1Y A;  1FKI A;  4ODO A;  3CH9 A;  4GIV A;  1GUV A;  4Z2L A;  1M5Y A;  2RUC A;  1VF8 A;  2PPP A;  1ZL1 A;  4L72 B;  4DRP A;  3IK8 A;  2RUD A;  2DT0 A;  2KE0 A;  1FKR A;  2DG3 A;  2FKE A;  1FKJ A;  3WKZ A;  4XAK A;  2VCD A;  4WIW A;  1D2K A;  3OA5 A;  4MNL A;  4ODK A;  5DO2 A;  1X6L A;  4ZPV R;  3KZ7 A;  1ZCN A;  4FAP A;  1JNS A;  4JFK A;  2D9F A;  3NRK A;  3EY6 A;  4TYO A;  4TW8 A;  2XP5 A;  4DRJ A;  3ARV A;  1W1V A;  4WKF A;  1WB0 A;  5GPR A;  1TFV A;  4DT4 A;  3O5P A;  1KT1 A;  1L1P A;  1D7H A;  3AS2 A;  1W9V A;  1K9T A;  2ESC A;  1Q1C A;  3CHC A;  5J6E A;  2A3A A;  1RD6 A;  1CTN A;  3UF8 A;  5GPG A;  1SR0 A;  3UI5 A;  3CHD A;  1NWT A;  1F40 A;  1Y0O A;  1ITX A;  4Z2H A;  2LKN A;  1LG2 A;  2QF8 A;  4IT4 A;  3PRD A;  2AWG A;  3NTP A;  1ZU8 A;  1FKK A;  3AQU A;  1OWQ A;  2XP7 A;  3ARS A;  4HAR A;  2XP9 A;  2YBU A;  2M08 A;  3O5D A;  4IT6 A;  4IPX A;  4MAV A;  1ZBV A;  4ODP A;  4MNJ A;  1KFW A;  3ARX A;  1JVW A;  2MNT A;  3PA7 A;  2LPV A;  1PBK A;  2WM0 A;  2PBC A;  3RM4 A;  4ITZ A;  2ITK A;  4ZPT R;  4ODN A;  3WD3 A;  1NWR A;  3WH0 A;  3WQW A;  3O5Q A;  1HKJ A;  1NWU A;  1J4I A;  1J4R A;  1EIB A;  3WD2 A;  4DH0 A;  3UQI A;  3UQA A;  3ARY A;  4JFL A;  3CGN A;  1R9H A;  3JYJ A;  3RGC A;  2LGO A;  1W9P A;  2O92 A;  4MNK A;  4ML4 A;  5DIU A;  1JNT A;  4P8W A;  3WD1 A;  1LJY A;  3FXY A;  2G8Z A;  5HBF A;  2DG4 A;  5HUA A;  3QOK A;  3B7X A;  2FDM A;  1ZK6 A;  3RME A;  1UR8 A;  4DWS B;  3TC5 A;  4WK9 A;  3PRA A;  4DWS A;  1N1A A;  4G2P A;  3MDY B;  1OGG A;  5HWB A;  1ZBK A;  1YW5 A;  1F8A B;  3O5E A;  2G41 A;  2KFW A;  2WLZ A;  1JNE A;  2PPN A;  2ZR5 A;  4QIB A;  4JYS A;  2RUQ A;  2DG9 A;  3JXV A;  1W1P A;  3WD0 A;  1Q6I A;  4DRH A;  4QT3 A;  1ZBC A;  3ARO A;  2DSW A;  1BKF A;  1FKG A;  4QZV B;  2PV3 A;  3IKG A;  1ROU A;  1O6I A;  5BXJ A;  5HW8 A;  4DWS C;  2LJ4 A;  2RQS A;  3AS1 A;  1KT0 A;  2DT3 A;  3PRB A;  1ZB5 A;  2KI3 A;  1LL6 A;  2DPE A;  4Z2I A;  3O5M A;  4NZC A;  3BXW A;  1WNO A;  2PPO A;  4Z2J A;  1E6R A;  4JFI A;  4Q22 A;  3KCE A;  3WQV A;  4DRM A;  1EHN A;  4W9Q A;  3CZ8 A;  3GPK A;  2WK2 A;  2IUZ A;  1Q6U A;  1LG1 A;  4ZPW R;  3CHF A;  4P8V A;  4W9P A;  1WAW A;  1FKB A;  2DSU A;  5GQB A;  1XRV A;  1HXV A;  2XP8 A;  4C02 B;  3O5L A;  4U85 A;  3NI6 A;  1ZBW A;  2VN1 A;  3B9A A;  2Q5A A;  1W9U A;  4P8X A;  4U86 A;  2PI6 A;  5JH8 A;  2ZQT A;  2B31 A;  5HW6 A;  2F4E A;  3KAI A;  4MPK A;  4DRI A;  2DT1 A;  1XHG A;  2XPA A;  1LQ0 A;  2AOS A;  2MPH A;  2A3E A;  3ART A;  3B9D A;  2XP3 A;  5DEZ A;  4KR0 B;  3KAC A;  1E15 A;  1FKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...