1D6OA

Native fkbp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d6oA00
4ITZA 2JZVA 3O5GA 5BXJA 4W9QA 2DG3A 4U86A 2D9FA 3KCEA 2ZQSA 4NNRA 2F4EA 2M1IA 4LAXA 2Q5AA 3EY6A 1ZCNA 2F21A 4DT4A 1Q1CA 2RUCA 2ZQVA 2PPOA 1QPFA 4IPXA 3B7XA 5DITA 4TX0A 3H9RB 4ODRA 4TW7A 4DRJA 5B8IC 1EQ3A 1JNSA 3UQIA 3O5MA 4TW6A 3UI4A 4N19A 3UI6A 2MPHA 2RUQA 5HWCA 4JFJA 4O2TA 2M2AA 4W9PA 1U79A 2RURA 4LAVA 4ODPA 4GGQA 2M08A 4IQCA 1JNTA 5HT1A 3MDYB 4DRMA 2OFNA 1QZ2A 2XP7A 2DG4A 4DRIA 4R0XA 3JYJA 1HXVA 2XP6A 4J4OA 1FKIA 5D75A 1Q6UA 4MGVA 3O5KA 2PV1A 1D7IA 2MLYA 1EYMA 3O5RA 4DRPA 1NSGA 4JFIA 3LUOA 1F8AB 3O5PA 1FKGA 2K8IA 3ODKA 2IF4A 2MF9A 4TYOA 4DH0A 5HKGA 4G50A 1KT0A 1R9HA 3KAHA 1F40A 2PV2A 1N1AA 1QPLA 4FN2A 3IHZA 4IQ2A 1PINA 2XPBA 3IKDA 3O5EA 3PRDA 4ODNA 3TDBA 3IKGA 2RSEA 2LJ4A 1B6CA 1ZK6A 2PV3A 1YW5A 4DRKA 2MNTA 1NMVA 3O5JA 2PBCA 3O5LA 3VAWA 3CGNA 1P5QA 2Y78A 2XP5A 2RUDA 4DRNA 1FKKA 2FAPA 1Y0OA 2MLXA 2DG9A 3NRKA 4JFMA 3RGCA 1D7HA 1YATA 2LKNA 3KAFA 3WH0A 1W26A 4MSPA 4ODQA 4QT3A 4J4NA 1FJDA 1M5YA 1A7XA 2XPAA 1FKLA 4ODOA 3KAIA 1FKHA 5HW6A 4ODMA 5DIUA 3KZ7A 4DIPA 3KADA 2ITKA 2VCDA 4LAWA 2XP4A 5HUAA 1D6OA 2KGJA 3IK8A 4LAYA 4BF8A 1FKFA 4DRHA 4JYSA 1FKRA 2FKEA 4QIBA 4G2PA 5GPGA 1BL4A 3O5IA 1T11A 3UF8A 1J4IA 1PBKA 3GPKA 3FAPA 1NMWA 2ZR6A 4W9OA 3KAGA 4JFKA 1C9HA 2L2SA 2ZR5A 3KABA 3UQAA 4ODKA 3KACA 4FAPA 1FKBA 2ZR4A 2RQSA 3PRBA 1Q6HA 1FKJA 4DRQA 4U85A 5HW7A 1ROTA 2UZ5A 5HWBA 2ZQUA 2F2DA 3NTPA 4U84A 4QT2A 2VN1A 3OOBA 3NI6A 3UQBA 2XP3A 1FAPA 4GIVA 1Q6IA 1D7JA 5HW8A 1J4HA 1ROUA 2LPVA 5HTGA 5J6EA 1FKDA 2N87A 3O5DA 3I6CA 1FD9A 1TCOC 4ODLA 1L1PA 2AWGA 3JYMA 3O5OA 2PPPA 4C02B 2ZQTA 2XP8A 2XP9A 3O5FA 5DIVA 3RFWA 5I98A 2PPNA 4TNSA 4JFLA 2MLZA 4DZ2A 4DROA 1BKFA 2KE0A 1FKTA 2LGOA 3TCZA 1FKSA 4DZ3A 4TW8A 3CGMA 1JVWA 3JXVA 2KR7A 1J4RA 3TC5A 2KO7A 3O5QA 3PA7A 3UI5A 1J6YA 2KFWA 1KT1A 2KI3A
chains in the Genus database with same CATH superfamily
4ITZA 1E15A 2JZVA 1GPFA 2G8ZA 3ARUA 3WD4A 4U86A 4ZPWR 4NNRA 2F4EA 2M1IA 2Q5AA 2WLYA 1LG2A 1Q1CA 2RUCA 2ZQVA 1QPFA 4IPXA 5DITA 4TX0A 3H9RB 3CH9A 4TW6A 3ALGA 2RUQA 4O2TA 1JNDA 4MNJA 3WL1A 1E6ZA 2FDMA 4ZS6A 1W9UA 2O9OA 4KQZA 4MTVA 1FKIA 4QZVB 4DWSC 2P4VA 3WIJA 2PV1A 1HKIA 2MLYA 1NSGA 1F8AB 3ODKA 2MF9A 1KT0A 2DT0A 1RD6A 1LL4A 3IHZA 4IQ2A 2XPBA 5I98A 4P8UA 3PRDA 1HJVA 1B6CA 1ZK6A 3CZ8A 3W4RA 2EULA 3ARZA 1P5QA 3WQWA 2XP5A 2RUDA 4WJXA 1Y0OA 2DG9A 4JFMA 3RGCA 1D7HA 1YATA 2LKNA 1FJDA 3ARXA 1W26A 4J4NA 1ZL1A 1FKLA 5HW6A 1TFVA 4WK9A 1JCHB 2VCDA 3BXWA 4LAYA 4BF8A 3CHCA 1GRJA 1BL4A 3O5IA 4JFKA 4AY1A 4FAPA 2YBUA 1FKBA 3RM9A 4DRQA 3PRBA 3OOBA 3NI6A 2XP3A 4GIVA 5GPRA 1Q6IA 1D7JA 2WLZA 3O5DA 1FD9A 4ODLA 2AWGA 4HBEA 3O5OA 4C02B 2OLHA 3EIPA 3WKZA 4TNSA 2DSVA 3OA5A 4DZ2A 3CHDA 3TCZA 4MNLA 3ARYA 3JXVA 3PRAA 2KR7A 1J4RA 3O5QA 1J6YA 2DT2A 5BXJA 2A3AA 3ARWA 2IUZA 1OWQA 3KCEA 4WKAA 4DWSD 4WKFA 4LAXA 1H0GA 4NSBA 4KR0B 1NWSA 1NWTA 3UI4A 1LJYA 2MPHA 4JFJA 3RM8A 5DF0A 2M2AA 1W9PA 2RURA 4LAVA 2M08A 1JNTA 5HT1A 5JH8A 2ESCA 3ARSA 4DRIA 2DG4A 2QF8A 1LG1A 4MGVA 4L3NA 3O5KA 1D7IA 1NWUA 1EYMA 3GTYX 4Z2GA 1IX5A 2IF4A 1F40A 1UR9A 4G50A 2PV2A 3IKDA 3O5EA 2RSEA 2LJ4A 2PV3A 3WL0A 1YW5A 2ETNA 3O5JA 3VAWA 4S3JA 3CGNA 2DSUA 3WD2A 3WD0A 3AS3A 2MLXA 3NRKA 3ARTA 4MSPA 2B31A 1M5YA 2XPAA 3FXYA 4MNMA 2G41A 4LAWA 1XRVA 1ZB5A 1FKFA 4QIBA 5HBFA 1J4IA 3GPKA 3PR9A 4L72B 3ARPA 4Z2IA 1C9HA 1HKKA 2L2SA 1H0IA 1NH6A 4HBOA 4MNKA 1EHNA 2RQSA 4IT4A 5HW7A 3WD1A 2UZ5A 5HWBA 3NTPA 1X6NA 4U84A 4QT2A 1WB0A 3AQUA 3RM4A 3UQBA 1HKJA 2PI6A 1XHGA 1FFQA 2N87A 1TCOC 1W9VA 2PPPA 2DSZA 2XP8A 3O5FA 2PPNA 4JFLA 2MLZA 4MPKA 1W1VA 1BKFA 1FFRA 2DSWA 1WAWA 2A3CA 4TW8A 1E6RA 3CGMA 2WM0A 3TC5A 2KO7A 3GU0A 3PA7A 1KT1A 1E9LA 3O5GA 2D9FA 2ZQSA 4XAKA 4DWSB 3EY6A 4DT4A 1ZCNA 2F21A 3B9AA 1W1YA 2PPOA 4ODRA 1JNSA 1EQ3A 2AOSA 4N19A 4P8XA 5HWCA 1W1PA 4DH0A 4ODPA 4HARA 4IQCA 1SYTA 4DRMA 3MDYB 1OGBA 3AS1A 4MAVA 3ARRA 2XP7A 1CTNA 1Q6UA 1EIBA 4JFIA 3O5PA 4WKHA 5HKGA 4Z2LA 3KAHA 3B9EA 1NWRA 1QPLA 4FN2A 1PINA 3IKGA 1D2KA 1EDQA 4DRKA 2MNTA 2PBCA 1FKKA 2FAPA 3AS0A 1HJWA 3WH0A 1L1PA 2O92A 3KAFA 1E6PA 3CHFA 1ITXA 4ODOA 3KAIA 5DIUA 3KZ7A 4UDMA 3RMEA 4W5UA 4DRHA 4Q7NA 2FKEA 4G2PA 3FAPA 2ZR6A 4W9OA 3UQAA 4ODKA 4NZCA 1E6NA 3AROA 2ZR4A 1FKJA 1ZBKA 1W1TA 2ZQUA 1GUVA 5HW8A 4S3KA 5HTGA 4DWSA 4R5EA 2PN0A 3I6CA 3QOKA 4IT6A 3WD3A 3ARVA 3RFWA 5DIVA 5GQBA 4Q22A 3CHEA 2F23A 4DROA 2YBTA 2KE0A 4WIWA 2LGOA 4DZ3A 1FKSA 4P8WA 1JVWA 3UI5A 4Z2JA 2KI3A 4W9QA 2DG3A 3AS2A 1ZBCA 3B7XA 1HKMA 4TW7A 3G6LA 4DRJA 5B8IC 3UQIA 3O5MA 4URIA 3UI6A 1LQ0A 2WK2A 4W9PA 1U79A 1K9TA 1ZBVA 4GGQA 2OFNA 1QZ2A 4R0XA 3JYJA 2XP6A 4J4OA 1O6IA 3B8SA 5D75A 1ZU8A 3O5RA 4DRPA 3ARQA 3LUOA 1FKGA 2K8IA 4TYOA 1R9HA 1HJXA 1N1AA 4ODNA 3TDBA 4LGXA 1SR0A 1NMVA 3O5LA 2DT1A 2Y78A 1E44A 4DRNA 3B9DA 2B5UB 4P8VA 4ODQA 4QT3A 1A7XA 1FKHA 2A3BA 4ODMA 4DIPA 1GOIA 3KADA 2ITKA 2XP4A 5HUAA 1D6OA 2KGJA 3IK8A 1FKRA 4JYSA 1WNOA 5GPGA 3UF8A 1T11A 1LL7A 1PBKA 1NMWA 3G6MA 4ZPVR 4PTMA 3KAGA 4ML4A 3KABA 2ZR5A 3BMBA 3KACA 1X6LA 1Q6HA 4U85A 1ROTA 2F2DA 2VN1A 1FAPA 1J4HA 1ROUA 2DPEA 2LPVA 5J6EA 1VF8A 3ALFA 1FKDA 1OGGA 3FY1A 3JYMA 3WQVA 1JNEA 2ZQTA 4ZPTR 2XP9A 5DEZA 1ZBWA 1LL6A 1KFWA 2A3EA 1UR8A 1FKTA 4Z2KA 2DT3A 4Z2HA 5DO2A 2KFWA 1HXVA
chains in the Genus database with same CATH topology
4ITZA 1E15A 2JZVA 1GPFA 2G8ZA 3ARUA 3WD4A 4U86A 4ZPWR 4NNRA 2F4EA 2M1IA 2Q5AA 2WLYA 1LG2A 1Q1CA 2RUCA 2ZQVA 1QPFA 4IPXA 5DITA 4TX0A 3H9RB 3CH9A 4TW6A 3ALGA 2RUQA 4O2TA 1JNDA 4MNJA 3WL1A 1E6ZA 2FDMA 4ZS6A 1W9UA 2O9OA 4KQZA 4MTVA 1FKIA 4QZVB 4DWSC 3WIJA 2PV1A 1HKIA 2MLYA 1NSGA 1F8AB 3ODKA 2MF9A 1KT0A 2DT0A 1RD6A 1LL4A 3IHZA 4IQ2A 2XPBA 5I98A 4P8UA 3PRDA 1HJVA 1B6CA 1ZK6A 3CZ8A 3W4RA 3ARZA 1P5QA 3WQWA 2XP5A 2RUDA 4WJXA 1Y0OA 2DG9A 4JFMA 3RGCA 1D7HA 1YATA 2LKNA 1FJDA 3ARXA 1W26A 4J4NA 1ZL1A 1FKLA 5HW6A 1TFVA 4WK9A 2VCDA 3BXWA 4LAYA 4BF8A 3CHCA 1BL4A 3O5IA 4JFKA 4AY1A 4FAPA 2YBUA 1FKBA 3RM9A 4DRQA 3PRBA 3OOBA 3NI6A 2XP3A 4GIVA 5GPRA 1Q6IA 1D7JA 2WLZA 3O5DA 1FD9A 4ODLA 2AWGA 4HBEA 3O5OA 4C02B 2OLHA 3WKZA 4TNSA 2DSVA 3OA5A 4DZ2A 3CHDA 3TCZA 4MNLA 3ARYA 3JXVA 3PRAA 2KR7A 1J4RA 3O5QA 1J6YA 2DT2A 5BXJA 2A3AA 3ARWA 2IUZA 1OWQA 3KCEA 4WKAA 4DWSD 4WKFA 4LAXA 1H0GA 4NSBA 4KR0B 1NWSA 1NWTA 3UI4A 1LJYA 2MPHA 4JFJA 3RM8A 5DF0A 2M2AA 1W9PA 2RURA 4LAVA 2M08A 1JNTA 5HT1A 5JH8A 2ESCA 3ARSA 4DRIA 2DG4A 2QF8A 1LG1A 4MGVA 4L3NA 3O5KA 1D7IA 1NWUA 1EYMA 4Z2GA 1IX5A 2IF4A 1F40A 1UR9A 4G50A 2PV2A 3IKDA 3O5EA 2RSEA 2LJ4A 2PV3A 3WL0A 1YW5A 3O5JA 3VAWA 4S3JA 3CGNA 2DSUA 3WD2A 3WD0A 3AS3A 2MLXA 3NRKA 3ARTA 4MSPA 2B31A 1M5YA 2XPAA 3FXYA 4MNMA 2G41A 4LAWA 1XRVA 1ZB5A 1FKFA 4QIBA 5HBFA 1J4IA 3GPKA 3PR9A 4L72B 3ARPA 4Z2IA 1C9HA 1HKKA 2L2SA 1H0IA 1NH6A 4HBOA 4MNKA 1EHNA 2RQSA 4IT4A 5HW7A 3WD1A 2UZ5A 5HWBA 3NTPA 1X6NA 4U84A 4QT2A 1WB0A 3AQUA 3RM4A 3UQBA 1HKJA 2PI6A 1XHGA 1FFQA 2N87A 1TCOC 1W9VA 2PPPA 2DSZA 2XP8A 3O5FA 2PPNA 4JFLA 2MLZA 4MPKA 1W1VA 1BKFA 1FFRA 2DSWA 1WAWA 2A3CA 4TW8A 1E6RA 3CGMA 2WM0A 3TC5A 2KO7A 3PA7A 1KT1A 1E9LA 3O5GA 2D9FA 2ZQSA 4XAKA 4DWSB 3EY6A 4DT4A 1ZCNA 2F21A 3B9AA 1W1YA 2PPOA 4ODRA 1JNSA 1EQ3A 2AOSA 4N19A 4P8XA 5HWCA 1W1PA 4DH0A 4ODPA 4HARA 4IQCA 1SYTA 4DRMA 3MDYB 1OGBA 3AS1A 4MAVA 3ARRA 2XP7A 1CTNA 1Q6UA 1EIBA 4JFIA 3O5PA 4WKHA 5HKGA 4Z2LA 3KAHA 3B9EA 1NWRA 1QPLA 4FN2A 1PINA 3IKGA 1D2KA 1EDQA 4DRKA 2MNTA 2PBCA 1FKKA 2FAPA 3AS0A 1HJWA 3WH0A 1L1PA 2O92A 3KAFA 1E6PA 3CHFA 1ITXA 4ODOA 3KAIA 5DIUA 3KZ7A 3RMEA 4W5UA 4DRHA 4Q7NA 2FKEA 4G2PA 3FAPA 2ZR6A 4W9OA 3UQAA 4ODKA 4NZCA 1E6NA 3AROA 2ZR4A 1FKJA 1ZBKA 1W1TA 2ZQUA 1GUVA 5HW8A 4S3KA 5HTGA 4DWSA 4R5EA 3I6CA 3QOKA 4IT6A 3WD3A 3ARVA 3RFWA 5DIVA 5GQBA 4Q22A 3CHEA 4DROA 2YBTA 2KE0A 4WIWA 2LGOA 4DZ3A 1FKSA 4P8WA 1JVWA 3UI5A 4Z2JA 2KI3A 4W9QA 2DG3A 3AS2A 1ZBCA 3B7XA 1HKMA 4TW7A 3G6LA 4DRJA 5B8IC 3UQIA 3O5MA 4URIA 3UI6A 1LQ0A 2WK2A 4W9PA 1U79A 1K9TA 1ZBVA 4GGQA 2OFNA 1QZ2A 4R0XA 3JYJA 2XP6A 4J4OA 1O6IA 3B8SA 5D75A 1ZU8A 3O5RA 4DRPA 3ARQA 3LUOA 1FKGA 2K8IA 4TYOA 1R9HA 1HJXA 1N1AA 4ODNA 3TDBA 4LGXA 1SR0A 1NMVA 3O5LA 2DT1A 2Y78A 4DRNA 3B9DA 4P8VA 4ODQA 4QT3A 1A7XA 1FKHA 2A3BA 4ODMA 4DIPA 1GOIA 3KADA 2ITKA 2XP4A 5HUAA 1D6OA 2KGJA 3IK8A 1FKRA 4JYSA 1WNOA 5GPGA 3UF8A 1T11A 1LL7A 1PBKA 1NMWA 3G6MA 4ZPVR 4PTMA 3KAGA 4ML4A 3KABA 2ZR5A 3KACA 1X6LA 1Q6HA 4U85A 1ROTA 2F2DA 2VN1A 1FAPA 1J4HA 1ROUA 2DPEA 2LPVA 5J6EA 1VF8A 3ALFA 1FKDA 1OGGA 3FY1A 3JYMA 3WQVA 1JNEA 2ZQTA 4ZPTR 2XP9A 5DEZA 1ZBWA 1LL6A 1KFWA 2A3EA 1UR8A 1FKTA 4Z2KA 2DT3A 4Z2HA 5DO2A 2KFWA 1HXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITZ A;  2JZV A;  3O5G A;  5BXJ A;  4W9Q A;  2DG3 A;  4U86 A;  2D9F A;  3KCE A;  2ZQS A;  4NNR A;  2F4E A;  2M1I A;  4LAX A;  2Q5A A;  3EY6 A;  1ZCN A;  2F21 A;  4DT4 A;  1Q1C A;  2RUC A;  2ZQV A;  2PPO A;  1QPF A;  4IPX A;  3B7X A;  5DIT A;  4TX0 A;  3H9R B;  4ODR A;  4TW7 A;  4DRJ A;  5B8I C;  1EQ3 A;  1JNS A;  3UQI A;  3O5M A;  4TW6 A;  3UI4 A;  4N19 A;  3UI6 A;  2MPH A;  2RUQ A;  5HWC A;  4JFJ A;  4O2T A;  2M2A A;  4W9P A;  1U79 A;  2RUR A;  4LAV A;  4ODP A;  4GGQ A;  2M08 A;  4IQC A;  1JNT A;  5HT1 A;  3MDY B;  4DRM A;  2OFN A;  1QZ2 A;  2XP7 A;  2DG4 A;  4DRI A;  4R0X A;  3JYJ A;  1HXV A;  2XP6 A;  4J4O A;  1FKI A;  5D75 A;  1Q6U A;  4MGV A;  3O5K A;  2PV1 A;  1D7I A;  2MLY A;  1EYM A;  3O5R A;  4DRP A;  1NSG A;  4JFI A;  3LUO A;  1F8A B;  3O5P A;  1FKG A;  2K8I A;  3ODK A;  2IF4 A;  2MF9 A;  4TYO A;  4DH0 A;  5HKG A;  4G50 A;  1KT0 A;  1R9H A;  3KAH A;  1F40 A;  2PV2 A;  1N1A A;  1QPL A;  4FN2 A;  3IHZ A;  4IQ2 A;  1PIN A;  2XPB A;  3IKD A;  3O5E A;  3PRD A;  4ODN A;  3TDB A;  3IKG A;  2RSE A;  2LJ4 A;  1B6C A;  1ZK6 A;  2PV3 A;  1YW5 A;  4DRK A;  2MNT A;  1NMV A;  3O5J A;  2PBC A;  3O5L A;  3VAW A;  3CGN A;  1P5Q A;  2Y78 A;  2XP5 A;  2RUD A;  4DRN A;  1FKK A;  2FAP A;  1Y0O A;  2MLX A;  2DG9 A;  3NRK A;  4JFM A;  3RGC A;  1D7H A;  1YAT A;  2LKN A;  3KAF A;  3WH0 A;  1W26 A;  4MSP A;  4ODQ A;  4QT3 A;  4J4N A;  1FJD A;  1M5Y A;  1A7X A;  2XPA A;  1FKL A;  4ODO A;  3KAI A;  1FKH A;  5HW6 A;  4ODM A;  5DIU A;  3KZ7 A;  4DIP A;  3KAD A;  2ITK A;  2VCD A;  4LAW A;  2XP4 A;  5HUA A;  1D6O A;  2KGJ A;  3IK8 A;  4LAY A;  4BF8 A;  1FKF A;  4DRH A;  4JYS A;  1FKR A;  2FKE A;  4QIB A;  4G2P A;  5GPG A;  1BL4 A;  3O5I A;  1T11 A;  3UF8 A;  1J4I A;  1PBK A;  3GPK A;  3FAP A;  1NMW A;  2ZR6 A;  4W9O A;  3KAG A;  4JFK A;  1C9H A;  2L2S A;  2ZR5 A;  3KAB A;  3UQA A;  4ODK A;  3KAC A;  4FAP A;  1FKB A;  2ZR4 A;  2RQS A;  3PRB A;  1Q6H A;  1FKJ A;  4DRQ A;  4U85 A;  5HW7 A;  1ROT A;  2UZ5 A;  5HWB A;  2ZQU A;  2F2D A;  3NTP A;  4U84 A;  4QT2 A;  2VN1 A;  3OOB A;  3NI6 A;  3UQB A;  2XP3 A;  1FAP A;  4GIV A;  1Q6I A;  1D7J A;  5HW8 A;  1J4H A;  1ROU A;  2LPV A;  5HTG A;  5J6E A;  1FKD A;  2N87 A;  3O5D A;  3I6C A;  1FD9 A;  1TCO C;  4ODL A;  1L1P A;  2AWG A;  3JYM A;  3O5O A;  2PPP A;  4C02 B;  2ZQT A;  2XP8 A;  2XP9 A;  3O5F A;  5DIV A;  3RFW A;  5I98 A;  2PPN A;  4TNS A;  4JFL A;  2MLZ A;  4DZ2 A;  4DRO A;  1BKF A;  2KE0 A;  1FKT A;  2LGO A;  3TCZ A;  1FKS A;  4DZ3 A;  4TW8 A;  3CGM A;  1JVW A;  3JXV A;  2KR7 A;  1J4R A;  3TC5 A;  2KO7 A;  3O5Q A;  3PA7 A;  3UI5 A;  1J6Y A;  2KFW A;  1KT1 A;  2KI3 A; 
#chains in the Genus database with same CATH topology
 4ITZ A;  1E15 A;  2JZV A;  1GPF A;  2G8Z A;  3ARU A;  3WD4 A;  4U86 A;  4ZPW R;  4NNR A;  2F4E A;  2M1I A;  2Q5A A;  2WLY A;  1LG2 A;  1Q1C A;  2RUC A;  2ZQV A;  1QPF A;  4IPX A;  5DIT A;  4TX0 A;  3H9R B;  3CH9 A;  4TW6 A;  3ALG A;  2RUQ A;  4O2T A;  1JND A;  4MNJ A;  3WL1 A;  1E6Z A;  2FDM A;  4ZS6 A;  1W9U A;  2O9O A;  4KQZ A;  4MTV A;  1FKI A;  4QZV B;  4DWS C;  2P4V A;  3WIJ A;  2PV1 A;  1HKI A;  2MLY A;  1NSG A;  1F8A B;  3ODK A;  2MF9 A;  1KT0 A;  2DT0 A;  1RD6 A;  1LL4 A;  3IHZ A;  4IQ2 A;  2XPB A;  5I98 A;  4P8U A;  3PRD A;  1HJV A;  1B6C A;  1ZK6 A;  3CZ8 A;  3W4R A;  2EUL A;  3ARZ A;  1P5Q A;  3WQW A;  2XP5 A;  2RUD A;  4WJX A;  1Y0O A;  2DG9 A;  4JFM A;  3RGC A;  1D7H A;  1YAT A;  2LKN A;  1FJD A;  3ARX A;  1W26 A;  4J4N A;  1ZL1 A;  1FKL A;  5HW6 A;  1TFV A;  4WK9 A;  1JCH B;  2VCD A;  3BXW A;  4LAY A;  4BF8 A;  3CHC A;  1GRJ A;  1BL4 A;  3O5I A;  4JFK A;  4AY1 A;  4FAP A;  2YBU A;  1FKB A;  3RM9 A;  4DRQ A;  3PRB A;  3OOB A;  3NI6 A;  2XP3 A;  4GIV A;  5GPR A;  1Q6I A;  1D7J A;  2WLZ A;  3O5D A;  1FD9 A;  4ODL A;  2AWG A;  4HBE A;  3O5O A;  4C02 B;  2OLH A;  3EIP A;  3WKZ A;  4TNS A;  2DSV A;  3OA5 A;  4DZ2 A;  3CHD A;  3TCZ A;  4MNL A;  3ARY A;  3JXV A;  3PRA A;  2KR7 A;  1J4R A;  3O5Q A;  1J6Y A;  2DT2 A;  5BXJ A;  2A3A A;  3ARW A;  2IUZ A;  1OWQ A;  3KCE A;  4WKA A;  4DWS D;  4WKF A;  4LAX A;  1H0G A;  4NSB A;  4KR0 B;  1NWS A;  1NWT A;  3UI4 A;  1LJY A;  2MPH A;  4JFJ A;  3RM8 A;  5DF0 A;  2M2A A;  1W9P A;  2RUR A;  4LAV A;  2M08 A;  1JNT A;  5HT1 A;  5JH8 A;  2ESC A;  3ARS A;  4DRI A;  2DG4 A;  2QF8 A;  1LG1 A;  4MGV A;  4L3N A;  3O5K A;  1D7I A;  1NWU A;  1EYM A;  3GTY X;  4Z2G A;  1IX5 A;  2IF4 A;  1F40 A;  1UR9 A;  4G50 A;  2PV2 A;  3IKD A;  3O5E A;  2RSE A;  2LJ4 A;  2PV3 A;  3WL0 A;  1YW5 A;  2ETN A;  3O5J A;  3VAW A;  4S3J A;  3CGN A;  2DSU A;  3WD2 A;  3WD0 A;  3AS3 A;  2MLX A;  3NRK A;  3ART A;  4MSP A;  2B31 A;  1M5Y A;  2XPA A;  3FXY A;  4MNM A;  2G41 A;  4LAW A;  1XRV A;  1ZB5 A;  1FKF A;  4QIB A;  5HBF A;  1J4I A;  3GPK A;  3PR9 A;  4L72 B;  3ARP A;  4Z2I A;  1C9H A;  1HKK A;  2L2S A;  1H0I A;  1NH6 A;  4HBO A;  4MNK A;  1EHN A;  2RQS A;  4IT4 A;  5HW7 A;  3WD1 A;  2UZ5 A;  5HWB A;  3NTP A;  1X6N A;  4U84 A;  4QT2 A;  1WB0 A;  3AQU A;  3RM4 A;  3UQB A;  1HKJ A;  2PI6 A;  1XHG A;  1FFQ A;  2N87 A;  1TCO C;  1W9V A;  2PPP A;  2DSZ A;  2XP8 A;  3O5F A;  2PPN A;  4JFL A;  2MLZ A;  4MPK A;  1W1V A;  1BKF A;  1FFR A;  2DSW A;  1WAW A;  2A3C A;  4TW8 A;  1E6R A;  3CGM A;  2WM0 A;  3TC5 A;  2KO7 A;  3GU0 A;  3PA7 A;  1KT1 A;  1E9L A;  3O5G A;  2D9F A;  2ZQS A;  4XAK A;  4DWS B;  3EY6 A;  4DT4 A;  1ZCN A;  2F21 A;  3B9A A;  1W1Y A;  2PPO A;  4ODR A;  1JNS A;  1EQ3 A;  2AOS A;  4N19 A;  4P8X A;  5HWC A;  1W1P A;  4DH0 A;  4ODP A;  4HAR A;  4IQC A;  1SYT A;  4DRM A;  3MDY B;  1OGB A;  3AS1 A;  4MAV A;  3ARR A;  2XP7 A;  1CTN A;  1Q6U A;  1EIB A;  4JFI A;  3O5P A;  4WKH A;  5HKG A;  4Z2L A;  3KAH A;  3B9E A;  1NWR A;  1QPL A;  4FN2 A;  1PIN A;  3IKG A;  1D2K A;  1EDQ A;  4DRK A;  2MNT A;  2PBC A;  1FKK A;  2FAP A;  3AS0 A;  1HJW A;  3WH0 A;  1L1P A;  2O92 A;  3KAF A;  1E6P A;  3CHF A;  1ITX A;  4ODO A;  3KAI A;  5DIU A;  3KZ7 A;  4UDM A;  3RME A;  4W5U A;  4DRH A;  4Q7N A;  2FKE A;  4G2P A;  3FAP A;  2ZR6 A;  4W9O A;  3UQA A;  4ODK A;  4NZC A;  1E6N A;  3ARO A;  2ZR4 A;  1FKJ A;  1ZBK A;  1W1T A;  2ZQU A;  1GUV A;  5HW8 A;  4S3K A;  5HTG A;  4DWS A;  4R5E A;  2PN0 A;  3I6C A;  3QOK A;  4IT6 A;  3WD3 A;  3ARV A;  3RFW A;  5DIV A;  5GQB A;  4Q22 A;  3CHE A;  2F23 A;  4DRO A;  2YBT A;  2KE0 A;  4WIW A;  2LGO A;  4DZ3 A;  1FKS A;  4P8W A;  1JVW A;  3UI5 A;  4Z2J A;  2KI3 A;  4W9Q A;  2DG3 A;  3AS2 A;  1ZBC A;  3B7X A;  1HKM A;  4TW7 A;  3G6L A;  4DRJ A;  5B8I C;  3UQI A;  3O5M A;  4URI A;  3UI6 A;  1LQ0 A;  2WK2 A;  4W9P A;  1U79 A;  1K9T A;  1ZBV A;  4GGQ A;  2OFN A;  1QZ2 A;  4R0X A;  3JYJ A;  2XP6 A;  4J4O A;  1O6I A;  3B8S A;  5D75 A;  1ZU8 A;  3O5R A;  4DRP A;  3ARQ A;  3LUO A;  1FKG A;  2K8I A;  4TYO A;  1R9H A;  1HJX A;  1N1A A;  4ODN A;  3TDB A;  4LGX A;  1SR0 A;  1NMV A;  3O5L A;  2DT1 A;  2Y78 A;  1E44 A;  4DRN A;  3B9D A;  2B5U B;  4P8V A;  4ODQ A;  4QT3 A;  1A7X A;  1FKH A;  2A3B A;  4ODM A;  4DIP A;  1GOI A;  3KAD A;  2ITK A;  2XP4 A;  5HUA A;  1D6O A;  2KGJ A;  3IK8 A;  1FKR A;  4JYS A;  1WNO A;  5GPG A;  3UF8 A;  1T11 A;  1LL7 A;  1PBK A;  1NMW A;  3G6M A;  4ZPV R;  4PTM A;  3KAG A;  4ML4 A;  3KAB A;  2ZR5 A;  3BMB A;  3KAC A;  1X6L A;  1Q6H A;  4U85 A;  1ROT A;  2F2D A;  2VN1 A;  1FAP A;  1J4H A;  1ROU A;  2DPE A;  2LPV A;  5J6E A;  1VF8 A;  3ALF A;  1FKD A;  1OGG A;  3FY1 A;  3JYM A;  3WQV A;  1JNE A;  2ZQT A;  4ZPT R;  2XP9 A;  5DEZ A;  1ZBW A;  1LL6 A;  1KFW A;  2A3E A;  1UR8 A;  1FKT A;  4Z2K A;  2DT3 A;  4Z2H A;  5DO2 A;  2KFW A;  1HXV A; 
#chains in the Genus database with same CATH homology
 4ITZ A;  1E15 A;  2JZV A;  1GPF A;  2G8Z A;  3ARU A;  3WD4 A;  4U86 A;  4ZPW R;  4NNR A;  2F4E A;  2M1I A;  2Q5A A;  2WLY A;  1LG2 A;  1Q1C A;  2RUC A;  2ZQV A;  1QPF A;  4IPX A;  5DIT A;  4TX0 A;  3H9R B;  3CH9 A;  4TW6 A;  3ALG A;  2RUQ A;  4O2T A;  1JND A;  4MNJ A;  3WL1 A;  1E6Z A;  2FDM A;  4ZS6 A;  1W9U A;  2O9O A;  4KQZ A;  4MTV A;  1FKI A;  4QZV B;  4DWS C;  3WIJ A;  2PV1 A;  1HKI A;  2MLY A;  1NSG A;  1F8A B;  3ODK A;  2MF9 A;  1KT0 A;  2DT0 A;  1RD6 A;  1LL4 A;  3IHZ A;  4IQ2 A;  2XPB A;  5I98 A;  4P8U A;  3PRD A;  1HJV A;  1B6C A;  1ZK6 A;  3CZ8 A;  3W4R A;  3ARZ A;  1P5Q A;  3WQW A;  2XP5 A;  2RUD A;  4WJX A;  1Y0O A;  2DG9 A;  4JFM A;  3RGC A;  1D7H A;  1YAT A;  2LKN A;  1FJD A;  3ARX A;  1W26 A;  4J4N A;  1ZL1 A;  1FKL A;  5HW6 A;  1TFV A;  4WK9 A;  2VCD A;  3BXW A;  4LAY A;  4BF8 A;  3CHC A;  1BL4 A;  3O5I A;  4JFK A;  4AY1 A;  4FAP A;  2YBU A;  1FKB A;  3RM9 A;  4DRQ A;  3PRB A;  3OOB A;  3NI6 A;  2XP3 A;  4GIV A;  5GPR A;  1Q6I A;  1D7J A;  2WLZ A;  3O5D A;  1FD9 A;  4ODL A;  2AWG A;  4HBE A;  3O5O A;  4C02 B;  2OLH A;  3WKZ A;  4TNS A;  2DSV A;  3OA5 A;  4DZ2 A;  3CHD A;  3TCZ A;  4MNL A;  3ARY A;  3JXV A;  3PRA A;  2KR7 A;  1J4R A;  3O5Q A;  1J6Y A;  2DT2 A;  5BXJ A;  2A3A A;  3ARW A;  2IUZ A;  1OWQ A;  3KCE A;  4WKA A;  4DWS D;  4WKF A;  4LAX A;  1H0G A;  4NSB A;  4KR0 B;  1NWS A;  1NWT A;  3UI4 A;  1LJY A;  2MPH A;  4JFJ A;  3RM8 A;  5DF0 A;  2M2A A;  1W9P A;  2RUR A;  4LAV A;  2M08 A;  1JNT A;  5HT1 A;  5JH8 A;  2ESC A;  3ARS A;  4DRI A;  2DG4 A;  2QF8 A;  1LG1 A;  4MGV A;  4L3N A;  3O5K A;  1D7I A;  1NWU A;  1EYM A;  4Z2G A;  1IX5 A;  2IF4 A;  1F40 A;  1UR9 A;  4G50 A;  2PV2 A;  3IKD A;  3O5E A;  2RSE A;  2LJ4 A;  2PV3 A;  3WL0 A;  1YW5 A;  3O5J A;  3VAW A;  4S3J A;  3CGN A;  2DSU A;  3WD2 A;  3WD0 A;  3AS3 A;  2MLX A;  3NRK A;  3ART A;  4MSP A;  2B31 A;  1M5Y A;  2XPA A;  3FXY A;  4MNM A;  2G41 A;  4LAW A;  1XRV A;  1ZB5 A;  1FKF A;  4QIB A;  5HBF A;  1J4I A;  3GPK A;  3PR9 A;  4L72 B;  3ARP A;  4Z2I A;  1C9H A;  1HKK A;  2L2S A;  1H0I A;  1NH6 A;  4HBO A;  4MNK A;  1EHN A;  2RQS A;  4IT4 A;  5HW7 A;  3WD1 A;  2UZ5 A;  5HWB A;  3NTP A;  1X6N A;  4U84 A;  4QT2 A;  1WB0 A;  3AQU A;  3RM4 A;  3UQB A;  1HKJ A;  2PI6 A;  1XHG A;  1FFQ A;  2N87 A;  1TCO C;  1W9V A;  2PPP A;  2DSZ A;  2XP8 A;  3O5F A;  2PPN A;  4JFL A;  2MLZ A;  4MPK A;  1W1V A;  1BKF A;  1FFR A;  2DSW A;  1WAW A;  2A3C A;  4TW8 A;  1E6R A;  3CGM A;  2WM0 A;  3TC5 A;  2KO7 A;  3PA7 A;  1KT1 A;  1E9L A;  3O5G A;  2D9F A;  2ZQS A;  4XAK A;  4DWS B;  3EY6 A;  4DT4 A;  1ZCN A;  2F21 A;  3B9A A;  1W1Y A;  2PPO A;  4ODR A;  1JNS A;  1EQ3 A;  2AOS A;  4N19 A;  4P8X A;  5HWC A;  1W1P A;  4DH0 A;  4ODP A;  4HAR A;  4IQC A;  1SYT A;  4DRM A;  3MDY B;  1OGB A;  3AS1 A;  4MAV A;  3ARR A;  2XP7 A;  1CTN A;  1Q6U A;  1EIB A;  4JFI A;  3O5P A;  4WKH A;  5HKG A;  4Z2L A;  3KAH A;  3B9E A;  1NWR A;  1QPL A;  4FN2 A;  1PIN A;  3IKG A;  1D2K A;  1EDQ A;  4DRK A;  2MNT A;  2PBC A;  1FKK A;  2FAP A;  3AS0 A;  1HJW A;  3WH0 A;  1L1P A;  2O92 A;  3KAF A;  1E6P A;  3CHF A;  1ITX A;  4ODO A;  3KAI A;  5DIU A;  3KZ7 A;  3RME A;  4W5U A;  4DRH A;  4Q7N A;  2FKE A;  4G2P A;  3FAP A;  2ZR6 A;  4W9O A;  3UQA A;  4ODK A;  4NZC A;  1E6N A;  3ARO A;  2ZR4 A;  1FKJ A;  1ZBK A;  1W1T A;  2ZQU A;  1GUV A;  5HW8 A;  4S3K A;  5HTG A;  4DWS A;  4R5E A;  3I6C A;  3QOK A;  4IT6 A;  3WD3 A;  3ARV A;  3RFW A;  5DIV A;  5GQB A;  4Q22 A;  3CHE A;  4DRO A;  2YBT A;  2KE0 A;  4WIW A;  2LGO A;  4DZ3 A;  1FKS A;  4P8W A;  1JVW A;  3UI5 A;  4Z2J A;  2KI3 A;  4W9Q A;  2DG3 A;  3AS2 A;  1ZBC A;  3B7X A;  1HKM A;  4TW7 A;  3G6L A;  4DRJ A;  5B8I C;  3UQI A;  3O5M A;  4URI A;  3UI6 A;  1LQ0 A;  2WK2 A;  4W9P A;  1U79 A;  1K9T A;  1ZBV A;  4GGQ A;  2OFN A;  1QZ2 A;  4R0X A;  3JYJ A;  2XP6 A;  4J4O A;  1O6I A;  3B8S A;  5D75 A;  1ZU8 A;  3O5R A;  4DRP A;  3ARQ A;  3LUO A;  1FKG A;  2K8I A;  4TYO A;  1R9H A;  1HJX A;  1N1A A;  4ODN A;  3TDB A;  4LGX A;  1SR0 A;  1NMV A;  3O5L A;  2DT1 A;  2Y78 A;  4DRN A;  3B9D A;  4P8V A;  4ODQ A;  4QT3 A;  1A7X A;  1FKH A;  2A3B A;  4ODM A;  4DIP A;  1GOI A;  3KAD A;  2ITK A;  2XP4 A;  5HUA A;  1D6O A;  2KGJ A;  3IK8 A;  1FKR A;  4JYS A;  1WNO A;  5GPG A;  3UF8 A;  1T11 A;  1LL7 A;  1PBK A;  1NMW A;  3G6M A;  4ZPV R;  4PTM A;  3KAG A;  4ML4 A;  3KAB A;  2ZR5 A;  3KAC A;  1X6L A;  1Q6H A;  4U85 A;  1ROT A;  2F2D A;  2VN1 A;  1FAP A;  1J4H A;  1ROU A;  2DPE A;  2LPV A;  5J6E A;  1VF8 A;  3ALF A;  1FKD A;  1OGG A;  3FY1 A;  3JYM A;  3WQV A;  1JNE A;  2ZQT A;  4ZPT R;  2XP9 A;  5DEZ A;  1ZBW A;  1LL6 A;  1KFW A;  2A3E A;  1UR8 A;  1FKT A;  4Z2K A;  2DT3 A;  4Z2H A;  5DO2 A;  2KFW A;  1HXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...