1D6OA

Native fkbp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d6oA00
2IF4A 1U79A 3NI6A 4JFIA 2LPVA 4TW6A 4ODQA 4JYSA 3NTPA 5D75A 2ZQUA 3O5RA 2PV2A 4DIPA 3H9RB 2KE0A 2XPBA 2XP3A 2VCDA 3ODKA 2RUDA 1YW5A 2DG3A 2M2AA 2MPHA 1FAPA 3KAIA 2DG4A 2LGOA 3O5LA 4J4OA 4ODKA 1FKSA 3VAWA 4DZ3A 2PPNA 3O5FA 4DRHA 3CGNA 2F2DA 1FKDA 1FKKA 1P5QA 2XP5A 1FKBA 2PPPA 3JXVA 4G50A 4ODOA 3PRDA 3TCZA 3UF8A 3UQAA 2F4EA 2XP4A 4TW7A 3O5JA 3UI5A 1ZK6A 3FAPA 3KCEA 5DIUA 3PRBA 2XP9A 1ZCNA 4LAVA 2F21A 3GPKA 4IQ2A 5DIVA 2ZQTA 4DT4A 4TYOA 2ZR4A 2L2SA 3WH0A 3O5DA 3LUOA 1FKLA 4ODLA 3KACA 1M5YA 1FKGA 2LKNA 2N87A 2ZR6A 4ODNA 1Q1CA 2ZR5A 3KZ7A 1D7JA 1N1AA 2JZVA 1R9HA 2PPOA 5HWBA 3EY6A 1J4IA 1QZ2A 4JFKA 4DRNA 3O5EA 2Y78A 4DRPA 2OFNA 3KAFA 3O5QA 4JFMA 3PA7A 3O5IA 2M08A 2K8IA 2PV3A 3O5PA 5HWCA 1KT0A 1QPFA 4LAXA 1TCOC 1FKFA 4W9PA 2RSEA 4DRIA 4DZ2A 5J6EA 1NMVA 4U85A 3O5KA 5HUAA 2ITKA 4GIVA 4LAWA 1FJDA 1QPLA 1T11A 4QT2A 4U86A 1JVWA 5DITA 1NSGA 4DROA 2KI3A 4BF8A 5GPGA 1FKJA 1EQ3A 3IK8A 4QT3A 1BL4A 4DRMA 2RURA 4TX0A 4J4NA 3UI6A 5HW6A 2XP6A 3O5MA 1NMWA 3UI4A 1ROUA 1J4RA 2ZQVA 4IQCA 2XP8A 5HT1A 4MGVA 1Q6UA 1ROTA 1FKHA 2Q5AA 4O2TA 2PV1A 2XPAA 3B7XA 1C9HA 4ODMA 2KO7A 2LJ4A 1Y0OA 3KAHA 1KT1A 1D7HA 2D9FA 2KR7A 2MLZA 2ZQSA 3RFWA 1FD9A 3KAGA 4W9OA 4DRQA 2MLXA 1Q6HA 2MF9A 5HTGA 1PBKA 4U84A 3IHZA 5HW7A 3IKGA 3O5OA 4JFLA 1L1PA 1D7IA 2FAPA 2DG9A 2M1IA 3CGMA 4TNSA 1A7XA 2MLYA 4DRJA 3I6CA 4N19A 3OOBA 4GGQA 2MNTA 2FKEA 3TC5A 1BKFA 3KADA 4FN2A 2RUQA 2UZ5A 4MSPA 5B8IC 2XP7A 2VN1A 4QIBA 4W9QA 1J6YA 3KABA 1W26A 4LAYA 3NRKA 3UQBA 1FKRA 1F8AB 3JYJA 1J4HA 5I98A 2AWGA 1YATA 3MDYB 4C02B 1JNSA 3IKDA 1FKIA 3O5GA 1HXVA 4FAPA 1EYMA 3JYMA 2RUCA 4ODRA 1D6OA 2RQSA 4G2PA 4R0XA 3RGCA 3TDBA 1FKTA 1Q6IA 4DH0A 4TW8A 2KFWA 4ITZA 1B6CA 2PBCA 4IPXA 4JFJA 1F40A 4ODPA 3UQIA 2KGJA 4NNRA 5BXJA 1JNTA 1PINA 5HW8A 5HKGA 4DRKA
chains in the Genus database with same CATH superfamily
3NI6A 4TW6A 5D75A 2ZQUA 3O5RA 2XPBA 1NWUA 2VCDA 4L72B 1D2KA 1FAPA 1ZBCA 3AS1A 2B31A 2DG4A 1WB0A 3O5LA 1HJXA 1FFQA 3AS0A 3O5FA 3CGNA 2XP5A 4LAWA 4ODOA 4P8VA 3TCZA 3CHDA 4Z2KA 4DWSD 3O5JA 5DIVA 2EULA 4DWSA 1ITXA 3ARQA 4NZCA 2L2SA 3O5DA 3B9AA 1M5YA 4ODNA 1UR8A 2ZR5A 1D7JA 1R9HA 4JFKA 3O5EA 2Y78A 4DRPA 1KFWA 4JFMA 3PA7A 2M08A 2K8IA 1TCOC 3G6LA 2RSEA 3O5KA 1FJDA 1ZBKA 4QT2A 1JVWA 3WIJA 1NSGA 1EQ3A 4DRMA 4J4NA 3WD3A 3O5MA 2ZQVA 1J4RA 4IT6A 2XP8A 1EHNA 4MGVA 1HKIA 1Q6UA 5HBFA 2XPAA 1RD6A 2LJ4A 3WD2A 1FD9A 3KAGA 4DRQA 1ZB5A 2AOSA 2DSZA 1FFRA 1E9LA 4JFLA 1W9VA 2DG9A 3CGMA 1X6NA 4MNJA 3I6CA 4N19A 4GGQA 2MNTA 2RUQA 2XP7A 1W26A 1IX5A 1JNSA 2ETNA 4FAPA 4KR0B 2RUCA 3TDBA 2RQSA 3RGCA 1UR9A 4MAVA 2DT3A 2PN0A 4MNMA 2KFWA 2WM0A 2PBCA 4XAKA 1F40A 3FY1A 3EY6A 4HARA 3OA5A 2IF4A 1HJVA 1ZU8A 4JFIA 4URIA 3ARTA 2KE0A 3H9RB 2XP3A 1SYTA 2RUDA 1ZL1A 3BMBA 4J4OA 2DT2A 1FKSA 4ODKA 2WK2A 3ARWA 3WL0A 2PPNA 4DRHA 2F2DA 1FKDA 2PPPA 2QF8A 4TW7A 3FAPA 2ESCA 1EDQA 1ZCNA 2FDMA 4S3KA 5DF0A 2ZR4A 1TFVA 3LUOA 4ODLA 3AS2A 3ALFA 1E6ZA 2A3BA 3KACA 4P8UA 2N87A 2ZR6A 3B9EA 3KZ7A 2YBUA 1N1AA 2JZVA 1W9UA 5HWBA 2G8ZA 4HBOA 5HWCA 3O5PA 1KT0A 4LAXA 2DT1A 4S3JA 4DZ2A 4DRIA 4U85A 1LL4A 2OLHA 2YBTA 1T11A 4LGXA 1X6LA 4DROA 3RM9A 2DSUA 1BL4A 4TX0A 2XP6A 1NMWA 2O9OA 2F23A 5HT1A 3WL1A 4Z2JA 1GRJA 2PV1A 1K9TA 4ODMA 4WJXA 3PRAA 2ZQSA 2MLZA 3AROA 1NWSA 1JCHB 1PBKA 3IHZA 1XRVA 3O5OA 5DO2A 1D7IA 1SR0A 4TNSA 1A7XA 1NH6A 4HBEA 3RM8A 3TC5A 1BKFA 4FN2A 2UZ5A 5B8IC 1ZBVA 1W1YA 4QIBA 1J6YA 3KABA 1FKRA 3ARZA 4WKFA 2AWGA 3O5GA 1FKIA 4R0XA 4G2PA 1GPFA 3WD1A 1LQ0A 1B6CA 4JFJA 2KGJA 3ARVA 4NNRA 1W9PA 4DRKA 1U79A 3RM4A 3WD0A 1ZBWA 4Q7NA 4ODQA 1LL6A 3NTPA 4DIPA 2PV2A 3ODKA 4Z2GA 3KAIA 1W1PA 2LGOA 3CHCA 5DEZA 3VAWA 3CHEA 3WKZA 1W1VA 4ZPVR 4G50A 3JXVA 1FKBA 3UF8A 2XP4A 3GTYX 5DIUA 3EIPA 1WAWA 3PRBA 4LAVA 3GPKA 4DT4A 4IQ2A 1FKLA 2A3AA 1FKGA 4AY1A 3CH9A 2DSWA 2PPOA 4Z2HA 1QZ2A 3O5QA 1NWRA 3O5IA 4PTMA 1QPFA 4W9PA 1NMVA 4GIVA 4UDMA 4U86A 3WD4A 3FXYA 4Z2IA 2KI3A 4QT3A 1L1PA 2RURA 3G6MA 3UI6A 5HW6A 3UI4A 1ROUA 1JNDA 1LJYA 4ZPTR 2PI6A 5JH8A 2Q5AA 4O2TA 3B8SA 2KO7A 1Y0OA 1KT1A 2KR7A 3QOKA 4KQZA 4W9OA 2MLXA 1Q6HA 5HTGA 5HW7A 3CZ8A 2FAPA 2M1IA 2A3CA 1O6IA 2MLYA 4W5UA 3OOBA 4NSBA 1E6RA 2DSVA 1EIBA 5GQBA 1E15A 2VN1A 4LAYA 3ARPA 1F8AB 3PR9A 4DWSC 3ARYA 4C02B 3ALGA 3IKDA 1HXVA 1EYMA 3JYMA 4WIWA 4ODRA 1D6OA 1FKTA 1Q6IA 4DH0A 1GUVA 2DT0A 1JNEA 4MTVA 4ODPA 4ML4A 5GPRA 3UQIA 1LL7A 1W1TA 2A3EA 2LPVA 1PINA 4ZS6A 2G41A 4WKAA 4P8WA 2IUZA 4JYSA 3ARRA 1LG2A 2WLZA 1YW5A 3RMEA 2DG3A 2M2AA 2MPHA 3ARUA 4WK9A 1E6NA 1GOIA 2WLYA 4DZ3A 1FKKA 1P5QA 5HUAA 3UQAA 3PRDA 2F4EA 1OWQA 3UI5A 1ZK6A 3KCEA 2XP9A 2F21A 3ARSA 2ZQTA 4TYOA 3WH0A 1HKMA 2LKNA 4ZPWR 1Q1CA 3WQWA 1J4IA 4DRNA 4Q22A 4MNLA 2OFNA 3KAFA 4R5EA 1CTNA 4WKHA 2PV3A 1LG1A 1FKFA 5J6EA 2ITKA 3AQUA 1QPLA 5DITA 3W4RA 4QZVB 4BF8A 5GPGA 1FKJA 3IK8A 1VF8A 3CHFA 3WQVA 4L3NA 4DWSB 2DPEA 4IQCA 4P8XA 1ROTA 1FKHA 4IT4A 1WNOA 3B7XA 1C9HA 1H0IA 4Z2LA 3ARXA 3KAHA 1D7HA 2D9FA 1NWTA 3RFWA 2MF9A 4U84A 3GU0A 4MPKA 3IKGA 2P4VA 4DRJA 1H0GA 2FKEA 3KADA 4MSPA 1OGGA 1HJWA 3B9DA 4W9QA 3UQBA 3NRKA 3JYJA 1J4HA 1HKJA 1OGBA 3MDYB 1YATA 5I98A 4MNKA 3BXWA 1XHGA 3AS3A 4TW8A 4ITZA 1E44A 4IPXA 2B5UB 2O92A 1HKKA 5BXJA 1E6PA 1JNTA 5HW8A 5HKGA
chains in the Genus database with same CATH topology
3NI6A 4TW6A 5D75A 2ZQUA 3O5RA 2XPBA 1NWUA 2VCDA 4L72B 1D2KA 1FAPA 1ZBCA 3AS1A 2B31A 2DG4A 1WB0A 3O5LA 1HJXA 1FFQA 3AS0A 3O5FA 3CGNA 2XP5A 4LAWA 4ODOA 4P8VA 3TCZA 3CHDA 4Z2KA 4DWSD 3O5JA 5DIVA 4DWSA 1ITXA 3ARQA 4NZCA 2L2SA 3O5DA 3B9AA 1M5YA 4ODNA 1UR8A 2ZR5A 1D7JA 1R9HA 4JFKA 3O5EA 2Y78A 4DRPA 1KFWA 4JFMA 3PA7A 2M08A 2K8IA 1TCOC 3G6LA 2RSEA 3O5KA 1FJDA 1ZBKA 4QT2A 1JVWA 3WIJA 1NSGA 1EQ3A 4DRMA 4J4NA 3WD3A 3O5MA 2ZQVA 1J4RA 4IT6A 2XP8A 1EHNA 4MGVA 1HKIA 1Q6UA 5HBFA 2XPAA 1RD6A 2LJ4A 3WD2A 1FD9A 3KAGA 4DRQA 1ZB5A 2AOSA 2DSZA 1FFRA 1E9LA 4JFLA 1W9VA 2DG9A 3CGMA 1X6NA 4MNJA 3I6CA 4N19A 4GGQA 2MNTA 2RUQA 2XP7A 1W26A 1IX5A 1JNSA 4FAPA 4KR0B 2RUCA 3TDBA 2RQSA 3RGCA 1UR9A 4MAVA 2DT3A 4MNMA 2KFWA 2WM0A 2PBCA 4XAKA 1F40A 3FY1A 3EY6A 4HARA 3OA5A 2IF4A 1HJVA 1ZU8A 4JFIA 4URIA 3ARTA 2KE0A 3H9RB 2XP3A 1SYTA 2RUDA 1ZL1A 4J4OA 2DT2A 1FKSA 4ODKA 2WK2A 3ARWA 3WL0A 2PPNA 4DRHA 2F2DA 1FKDA 2PPPA 2QF8A 4TW7A 3FAPA 2ESCA 1EDQA 1ZCNA 2FDMA 4S3KA 5DF0A 2ZR4A 1TFVA 3LUOA 4ODLA 3AS2A 3ALFA 1E6ZA 2A3BA 3KACA 4P8UA 2N87A 2ZR6A 3B9EA 3KZ7A 2YBUA 1N1AA 2JZVA 1W9UA 5HWBA 2G8ZA 4HBOA 5HWCA 3O5PA 1KT0A 4LAXA 2DT1A 4S3JA 4DZ2A 4DRIA 4U85A 1LL4A 2OLHA 2YBTA 1T11A 4LGXA 1X6LA 4DROA 3RM9A 2DSUA 1BL4A 4TX0A 2XP6A 1NMWA 2O9OA 5HT1A 3WL1A 4Z2JA 2PV1A 1K9TA 4ODMA 4WJXA 3PRAA 2ZQSA 2MLZA 3AROA 1NWSA 1PBKA 3IHZA 1XRVA 3O5OA 5DO2A 1D7IA 1SR0A 4TNSA 1A7XA 1NH6A 4HBEA 3RM8A 3TC5A 1BKFA 4FN2A 2UZ5A 5B8IC 1ZBVA 1W1YA 4QIBA 1J6YA 3KABA 1FKRA 3ARZA 4WKFA 2AWGA 3O5GA 1FKIA 4R0XA 4G2PA 1GPFA 3WD1A 1LQ0A 1B6CA 4JFJA 2KGJA 3ARVA 4NNRA 1W9PA 4DRKA 1U79A 3RM4A 3WD0A 1ZBWA 4Q7NA 4ODQA 1LL6A 3NTPA 4DIPA 2PV2A 3ODKA 4Z2GA 3KAIA 1W1PA 2LGOA 3CHCA 5DEZA 3VAWA 3CHEA 3WKZA 1W1VA 4ZPVR 4G50A 3JXVA 1FKBA 3UF8A 2XP4A 5DIUA 1WAWA 3PRBA 4LAVA 3GPKA 4DT4A 4IQ2A 1FKLA 2A3AA 1FKGA 4AY1A 3CH9A 2DSWA 2PPOA 4Z2HA 1QZ2A 3O5QA 1NWRA 3O5IA 4PTMA 1QPFA 4W9PA 1NMVA 4GIVA 4U86A 3WD4A 3FXYA 4Z2IA 2KI3A 4QT3A 1L1PA 2RURA 3G6MA 3UI6A 5HW6A 3UI4A 1ROUA 1JNDA 1LJYA 4ZPTR 2PI6A 5JH8A 2Q5AA 4O2TA 3B8SA 2KO7A 1Y0OA 1KT1A 2KR7A 3QOKA 4KQZA 4W9OA 2MLXA 1Q6HA 5HTGA 5HW7A 3CZ8A 2FAPA 2M1IA 2A3CA 1O6IA 2MLYA 4W5UA 3OOBA 4NSBA 1E6RA 2DSVA 1EIBA 5GQBA 1E15A 2VN1A 4LAYA 3ARPA 1F8AB 3PR9A 4DWSC 3ARYA 4C02B 3ALGA 3IKDA 1HXVA 1EYMA 3JYMA 4WIWA 4ODRA 1D6OA 1FKTA 1Q6IA 4DH0A 1GUVA 2DT0A 1JNEA 4MTVA 4ODPA 4ML4A 5GPRA 3UQIA 1LL7A 1W1TA 2A3EA 2LPVA 1PINA 4ZS6A 2G41A 4WKAA 4P8WA 2IUZA 4JYSA 3ARRA 1LG2A 2WLZA 1YW5A 3RMEA 2DG3A 2M2AA 2MPHA 3ARUA 4WK9A 1E6NA 1GOIA 2WLYA 4DZ3A 1FKKA 1P5QA 5HUAA 3UQAA 3PRDA 2F4EA 1OWQA 3UI5A 1ZK6A 3KCEA 2XP9A 2F21A 3ARSA 2ZQTA 4TYOA 3WH0A 1HKMA 2LKNA 4ZPWR 1Q1CA 3WQWA 1J4IA 4DRNA 4Q22A 4MNLA 2OFNA 3KAFA 4R5EA 1CTNA 4WKHA 2PV3A 1LG1A 1FKFA 5J6EA 2ITKA 3AQUA 1QPLA 5DITA 3W4RA 4QZVB 4BF8A 5GPGA 1FKJA 3IK8A 1VF8A 3CHFA 3WQVA 4L3NA 4DWSB 2DPEA 4IQCA 4P8XA 1ROTA 1FKHA 4IT4A 1WNOA 3B7XA 1C9HA 1H0IA 4Z2LA 3ARXA 3KAHA 1D7HA 2D9FA 1NWTA 3RFWA 2MF9A 4U84A 4MPKA 3IKGA 4DRJA 1H0GA 2FKEA 3KADA 4MSPA 1OGGA 1HJWA 3B9DA 4W9QA 3UQBA 3NRKA 3JYJA 1J4HA 1HKJA 1OGBA 3MDYB 1YATA 5I98A 4MNKA 3BXWA 1XHGA 3AS3A 4TW8A 4ITZA 4IPXA 2O92A 1HKKA 5BXJA 1E6PA 1JNTA 5HW8A 5HKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  1U79 A;  3NI6 A;  4JFI A;  2LPV A;  4TW6 A;  4ODQ A;  4JYS A;  3NTP A;  5D75 A;  2ZQU A;  3O5R A;  2PV2 A;  4DIP A;  3H9R B;  2KE0 A;  2XPB A;  2XP3 A;  2VCD A;  3ODK A;  2RUD A;  1YW5 A;  2DG3 A;  2M2A A;  2MPH A;  1FAP A;  3KAI A;  2DG4 A;  2LGO A;  3O5L A;  4J4O A;  4ODK A;  1FKS A;  3VAW A;  4DZ3 A;  2PPN A;  3O5F A;  4DRH A;  3CGN A;  2F2D A;  1FKD A;  1FKK A;  1P5Q A;  2XP5 A;  1FKB A;  2PPP A;  3JXV A;  4G50 A;  4ODO A;  3PRD A;  3TCZ A;  3UF8 A;  3UQA A;  2F4E A;  2XP4 A;  4TW7 A;  3O5J A;  3UI5 A;  1ZK6 A;  3FAP A;  3KCE A;  5DIU A;  3PRB A;  2XP9 A;  1ZCN A;  4LAV A;  2F21 A;  3GPK A;  4IQ2 A;  5DIV A;  2ZQT A;  4DT4 A;  4TYO A;  2ZR4 A;  2L2S A;  3WH0 A;  3O5D A;  3LUO A;  1FKL A;  4ODL A;  3KAC A;  1M5Y A;  1FKG A;  2LKN A;  2N87 A;  2ZR6 A;  4ODN A;  1Q1C A;  2ZR5 A;  3KZ7 A;  1D7J A;  1N1A A;  2JZV A;  1R9H A;  2PPO A;  5HWB A;  3EY6 A;  1J4I A;  1QZ2 A;  4JFK A;  4DRN A;  3O5E A;  2Y78 A;  4DRP A;  2OFN A;  3KAF A;  3O5Q A;  4JFM A;  3PA7 A;  3O5I A;  2M08 A;  2K8I A;  2PV3 A;  3O5P A;  5HWC A;  1KT0 A;  1QPF A;  4LAX A;  1TCO C;  1FKF A;  4W9P A;  2RSE A;  4DRI A;  4DZ2 A;  5J6E A;  1NMV A;  4U85 A;  3O5K A;  5HUA A;  2ITK A;  4GIV A;  4LAW A;  1FJD A;  1QPL A;  1T11 A;  4QT2 A;  4U86 A;  1JVW A;  5DIT A;  1NSG A;  4DRO A;  2KI3 A;  4BF8 A;  5GPG A;  1FKJ A;  1EQ3 A;  3IK8 A;  4QT3 A;  1BL4 A;  4DRM A;  2RUR A;  4TX0 A;  4J4N A;  3UI6 A;  5HW6 A;  2XP6 A;  3O5M A;  1NMW A;  3UI4 A;  1ROU A;  1J4R A;  2ZQV A;  4IQC A;  2XP8 A;  5HT1 A;  4MGV A;  1Q6U A;  1ROT A;  1FKH A;  2Q5A A;  4O2T A;  2PV1 A;  2XPA A;  3B7X A;  1C9H A;  4ODM A;  2KO7 A;  2LJ4 A;  1Y0O A;  3KAH A;  1KT1 A;  1D7H A;  2D9F A;  2KR7 A;  2MLZ A;  2ZQS A;  3RFW A;  1FD9 A;  3KAG A;  4W9O A;  4DRQ A;  2MLX A;  1Q6H A;  2MF9 A;  5HTG A;  1PBK A;  4U84 A;  3IHZ A;  5HW7 A;  3IKG A;  3O5O A;  4JFL A;  1L1P A;  1D7I A;  2FAP A;  2DG9 A;  2M1I A;  3CGM A;  4TNS A;  1A7X A;  2MLY A;  4DRJ A;  3I6C A;  4N19 A;  3OOB A;  4GGQ A;  2MNT A;  2FKE A;  3TC5 A;  1BKF A;  3KAD A;  4FN2 A;  2RUQ A;  2UZ5 A;  4MSP A;  5B8I C;  2XP7 A;  2VN1 A;  4QIB A;  4W9Q A;  1J6Y A;  3KAB A;  1W26 A;  4LAY A;  3NRK A;  3UQB A;  1FKR A;  1F8A B;  3JYJ A;  1J4H A;  5I98 A;  2AWG A;  1YAT A;  3MDY B;  4C02 B;  1JNS A;  3IKD A;  1FKI A;  3O5G A;  1HXV A;  4FAP A;  1EYM A;  3JYM A;  2RUC A;  4ODR A;  1D6O A;  2RQS A;  4G2P A;  4R0X A;  3RGC A;  3TDB A;  1FKT A;  1Q6I A;  4DH0 A;  4TW8 A;  2KFW A;  4ITZ A;  1B6C A;  2PBC A;  4IPX A;  4JFJ A;  1F40 A;  4ODP A;  3UQI A;  2KGJ A;  4NNR A;  5BXJ A;  1JNT A;  1PIN A;  5HW8 A;  5HKG A;  4DRK A; 
#chains in the Genus database with same CATH topology
 3NI6 A;  4TW6 A;  5D75 A;  2ZQU A;  3O5R A;  2XPB A;  1NWU A;  2VCD A;  4L72 B;  1D2K A;  1FAP A;  1ZBC A;  3AS1 A;  2B31 A;  2DG4 A;  1WB0 A;  3O5L A;  1HJX A;  1FFQ A;  3AS0 A;  3O5F A;  3CGN A;  2XP5 A;  4LAW A;  4ODO A;  4P8V A;  3TCZ A;  3CHD A;  4Z2K A;  4DWS D;  3O5J A;  5DIV A;  2EUL A;  4DWS A;  1ITX A;  3ARQ A;  4NZC A;  2L2S A;  3O5D A;  3B9A A;  1M5Y A;  4ODN A;  1UR8 A;  2ZR5 A;  1D7J A;  1R9H A;  4JFK A;  3O5E A;  2Y78 A;  4DRP A;  1KFW A;  4JFM A;  3PA7 A;  2M08 A;  2K8I A;  1TCO C;  3G6L A;  2RSE A;  3O5K A;  1FJD A;  1ZBK A;  4QT2 A;  1JVW A;  3WIJ A;  1NSG A;  1EQ3 A;  4DRM A;  4J4N A;  3WD3 A;  3O5M A;  2ZQV A;  1J4R A;  4IT6 A;  2XP8 A;  1EHN A;  4MGV A;  1HKI A;  1Q6U A;  5HBF A;  2XPA A;  1RD6 A;  2LJ4 A;  3WD2 A;  1FD9 A;  3KAG A;  4DRQ A;  1ZB5 A;  2AOS A;  2DSZ A;  1FFR A;  1E9L A;  4JFL A;  1W9V A;  2DG9 A;  3CGM A;  1X6N A;  4MNJ A;  3I6C A;  4N19 A;  4GGQ A;  2MNT A;  2RUQ A;  2XP7 A;  1W26 A;  1IX5 A;  1JNS A;  2ETN A;  4FAP A;  4KR0 B;  2RUC A;  3TDB A;  2RQS A;  3RGC A;  1UR9 A;  4MAV A;  2DT3 A;  2PN0 A;  4MNM A;  2KFW A;  2WM0 A;  2PBC A;  4XAK A;  1F40 A;  3FY1 A;  3EY6 A;  4HAR A;  3OA5 A;  2IF4 A;  1HJV A;  1ZU8 A;  4JFI A;  4URI A;  3ART A;  2KE0 A;  3H9R B;  2XP3 A;  1SYT A;  2RUD A;  1ZL1 A;  3BMB A;  4J4O A;  2DT2 A;  1FKS A;  4ODK A;  2WK2 A;  3ARW A;  3WL0 A;  2PPN A;  4DRH A;  2F2D A;  1FKD A;  2PPP A;  2QF8 A;  4TW7 A;  3FAP A;  2ESC A;  1EDQ A;  1ZCN A;  2FDM A;  4S3K A;  5DF0 A;  2ZR4 A;  1TFV A;  3LUO A;  4ODL A;  3AS2 A;  3ALF A;  1E6Z A;  2A3B A;  3KAC A;  4P8U A;  2N87 A;  2ZR6 A;  3B9E A;  3KZ7 A;  2YBU A;  1N1A A;  2JZV A;  1W9U A;  5HWB A;  2G8Z A;  4HBO A;  5HWC A;  3O5P A;  1KT0 A;  4LAX A;  2DT1 A;  4S3J A;  4DZ2 A;  4DRI A;  4U85 A;  1LL4 A;  2OLH A;  2YBT A;  1T11 A;  4LGX A;  1X6L A;  4DRO A;  3RM9 A;  2DSU A;  1BL4 A;  4TX0 A;  2XP6 A;  1NMW A;  2O9O A;  2F23 A;  5HT1 A;  3WL1 A;  4Z2J A;  1GRJ A;  2PV1 A;  1K9T A;  4ODM A;  4WJX A;  3PRA A;  2ZQS A;  2MLZ A;  3ARO A;  1NWS A;  1JCH B;  1PBK A;  3IHZ A;  1XRV A;  3O5O A;  5DO2 A;  1D7I A;  1SR0 A;  4TNS A;  1A7X A;  1NH6 A;  4HBE A;  3RM8 A;  3TC5 A;  1BKF A;  4FN2 A;  2UZ5 A;  5B8I C;  1ZBV A;  1W1Y A;  4QIB A;  1J6Y A;  3KAB A;  1FKR A;  3ARZ A;  4WKF A;  2AWG A;  3O5G A;  1FKI A;  4R0X A;  4G2P A;  1GPF A;  3WD1 A;  1LQ0 A;  1B6C A;  4JFJ A;  2KGJ A;  3ARV A;  4NNR A;  1W9P A;  4DRK A;  1U79 A;  3RM4 A;  3WD0 A;  1ZBW A;  4Q7N A;  4ODQ A;  1LL6 A;  3NTP A;  4DIP A;  2PV2 A;  3ODK A;  4Z2G A;  3KAI A;  1W1P A;  2LGO A;  3CHC A;  5DEZ A;  3VAW A;  3CHE A;  3WKZ A;  1W1V A;  4ZPV R;  4G50 A;  3JXV A;  1FKB A;  3UF8 A;  2XP4 A;  3GTY X;  5DIU A;  3EIP A;  1WAW A;  3PRB A;  4LAV A;  3GPK A;  4DT4 A;  4IQ2 A;  1FKL A;  2A3A A;  1FKG A;  4AY1 A;  3CH9 A;  2DSW A;  2PPO A;  4Z2H A;  1QZ2 A;  3O5Q A;  1NWR A;  3O5I A;  4PTM A;  1QPF A;  4W9P A;  1NMV A;  4GIV A;  4UDM A;  4U86 A;  3WD4 A;  3FXY A;  4Z2I A;  2KI3 A;  4QT3 A;  1L1P A;  2RUR A;  3G6M A;  3UI6 A;  5HW6 A;  3UI4 A;  1ROU A;  1JND A;  1LJY A;  4ZPT R;  2PI6 A;  5JH8 A;  2Q5A A;  4O2T A;  3B8S A;  2KO7 A;  1Y0O A;  1KT1 A;  2KR7 A;  3QOK A;  4KQZ A;  4W9O A;  2MLX A;  1Q6H A;  5HTG A;  5HW7 A;  3CZ8 A;  2FAP A;  2M1I A;  2A3C A;  1O6I A;  2MLY A;  4W5U A;  3OOB A;  4NSB A;  1E6R A;  2DSV A;  1EIB A;  5GQB A;  1E15 A;  2VN1 A;  4LAY A;  3ARP A;  1F8A B;  3PR9 A;  4DWS C;  3ARY A;  4C02 B;  3ALG A;  3IKD A;  1HXV A;  1EYM A;  3JYM A;  4WIW A;  4ODR A;  1D6O A;  1FKT A;  1Q6I A;  4DH0 A;  1GUV A;  2DT0 A;  1JNE A;  4MTV A;  4ODP A;  4ML4 A;  5GPR A;  3UQI A;  1LL7 A;  1W1T A;  2A3E A;  2LPV A;  1PIN A;  4ZS6 A;  2G41 A;  4WKA A;  4P8W A;  2IUZ A;  4JYS A;  3ARR A;  1LG2 A;  2WLZ A;  1YW5 A;  3RME A;  2DG3 A;  2M2A A;  2MPH A;  3ARU A;  4WK9 A;  1E6N A;  1GOI A;  2WLY A;  4DZ3 A;  1FKK A;  1P5Q A;  5HUA A;  3UQA A;  3PRD A;  2F4E A;  1OWQ A;  3UI5 A;  1ZK6 A;  3KCE A;  2XP9 A;  2F21 A;  3ARS A;  2ZQT A;  4TYO A;  3WH0 A;  1HKM A;  2LKN A;  4ZPW R;  1Q1C A;  3WQW A;  1J4I A;  4DRN A;  4Q22 A;  4MNL A;  2OFN A;  3KAF A;  4R5E A;  1CTN A;  4WKH A;  2PV3 A;  1LG1 A;  1FKF A;  5J6E A;  2ITK A;  3AQU A;  1QPL A;  5DIT A;  3W4R A;  4QZV B;  4BF8 A;  5GPG A;  1FKJ A;  3IK8 A;  1VF8 A;  3CHF A;  3WQV A;  4L3N A;  4DWS B;  2DPE A;  4IQC A;  4P8X A;  1ROT A;  1FKH A;  4IT4 A;  1WNO A;  3B7X A;  1C9H A;  1H0I A;  4Z2L A;  3ARX A;  3KAH A;  1D7H A;  2D9F A;  1NWT A;  3RFW A;  2MF9 A;  4U84 A;  3GU0 A;  4MPK A;  3IKG A;  2P4V A;  4DRJ A;  1H0G A;  2FKE A;  3KAD A;  4MSP A;  1OGG A;  1HJW A;  3B9D A;  4W9Q A;  3UQB A;  3NRK A;  3JYJ A;  1J4H A;  1HKJ A;  1OGB A;  3MDY B;  1YAT A;  5I98 A;  4MNK A;  3BXW A;  1XHG A;  3AS3 A;  4TW8 A;  4ITZ A;  1E44 A;  4IPX A;  2B5U B;  2O92 A;  1HKK A;  5BXJ A;  1E6P A;  1JNT A;  5HW8 A;  5HKG A; 
#chains in the Genus database with same CATH homology
 3NI6 A;  4TW6 A;  5D75 A;  2ZQU A;  3O5R A;  2XPB A;  1NWU A;  2VCD A;  4L72 B;  1D2K A;  1FAP A;  1ZBC A;  3AS1 A;  2B31 A;  2DG4 A;  1WB0 A;  3O5L A;  1HJX A;  1FFQ A;  3AS0 A;  3O5F A;  3CGN A;  2XP5 A;  4LAW A;  4ODO A;  4P8V A;  3TCZ A;  3CHD A;  4Z2K A;  4DWS D;  3O5J A;  5DIV A;  4DWS A;  1ITX A;  3ARQ A;  4NZC A;  2L2S A;  3O5D A;  3B9A A;  1M5Y A;  4ODN A;  1UR8 A;  2ZR5 A;  1D7J A;  1R9H A;  4JFK A;  3O5E A;  2Y78 A;  4DRP A;  1KFW A;  4JFM A;  3PA7 A;  2M08 A;  2K8I A;  1TCO C;  3G6L A;  2RSE A;  3O5K A;  1FJD A;  1ZBK A;  4QT2 A;  1JVW A;  3WIJ A;  1NSG A;  1EQ3 A;  4DRM A;  4J4N A;  3WD3 A;  3O5M A;  2ZQV A;  1J4R A;  4IT6 A;  2XP8 A;  1EHN A;  4MGV A;  1HKI A;  1Q6U A;  5HBF A;  2XPA A;  1RD6 A;  2LJ4 A;  3WD2 A;  1FD9 A;  3KAG A;  4DRQ A;  1ZB5 A;  2AOS A;  2DSZ A;  1FFR A;  1E9L A;  4JFL A;  1W9V A;  2DG9 A;  3CGM A;  1X6N A;  4MNJ A;  3I6C A;  4N19 A;  4GGQ A;  2MNT A;  2RUQ A;  2XP7 A;  1W26 A;  1IX5 A;  1JNS A;  4FAP A;  4KR0 B;  2RUC A;  3TDB A;  2RQS A;  3RGC A;  1UR9 A;  4MAV A;  2DT3 A;  4MNM A;  2KFW A;  2WM0 A;  2PBC A;  4XAK A;  1F40 A;  3FY1 A;  3EY6 A;  4HAR A;  3OA5 A;  2IF4 A;  1HJV A;  1ZU8 A;  4JFI A;  4URI A;  3ART A;  2KE0 A;  3H9R B;  2XP3 A;  1SYT A;  2RUD A;  1ZL1 A;  4J4O A;  2DT2 A;  1FKS A;  4ODK A;  2WK2 A;  3ARW A;  3WL0 A;  2PPN A;  4DRH A;  2F2D A;  1FKD A;  2PPP A;  2QF8 A;  4TW7 A;  3FAP A;  2ESC A;  1EDQ A;  1ZCN A;  2FDM A;  4S3K A;  5DF0 A;  2ZR4 A;  1TFV A;  3LUO A;  4ODL A;  3AS2 A;  3ALF A;  1E6Z A;  2A3B A;  3KAC A;  4P8U A;  2N87 A;  2ZR6 A;  3B9E A;  3KZ7 A;  2YBU A;  1N1A A;  2JZV A;  1W9U A;  5HWB A;  2G8Z A;  4HBO A;  5HWC A;  3O5P A;  1KT0 A;  4LAX A;  2DT1 A;  4S3J A;  4DZ2 A;  4DRI A;  4U85 A;  1LL4 A;  2OLH A;  2YBT A;  1T11 A;  4LGX A;  1X6L A;  4DRO A;  3RM9 A;  2DSU A;  1BL4 A;  4TX0 A;  2XP6 A;  1NMW A;  2O9O A;  5HT1 A;  3WL1 A;  4Z2J A;  2PV1 A;  1K9T A;  4ODM A;  4WJX A;  3PRA A;  2ZQS A;  2MLZ A;  3ARO A;  1NWS A;  1PBK A;  3IHZ A;  1XRV A;  3O5O A;  5DO2 A;  1D7I A;  1SR0 A;  4TNS A;  1A7X A;  1NH6 A;  4HBE A;  3RM8 A;  3TC5 A;  1BKF A;  4FN2 A;  2UZ5 A;  5B8I C;  1ZBV A;  1W1Y A;  4QIB A;  1J6Y A;  3KAB A;  1FKR A;  3ARZ A;  4WKF A;  2AWG A;  3O5G A;  1FKI A;  4R0X A;  4G2P A;  1GPF A;  3WD1 A;  1LQ0 A;  1B6C A;  4JFJ A;  2KGJ A;  3ARV A;  4NNR A;  1W9P A;  4DRK A;  1U79 A;  3RM4 A;  3WD0 A;  1ZBW A;  4Q7N A;  4ODQ A;  1LL6 A;  3NTP A;  4DIP A;  2PV2 A;  3ODK A;  4Z2G A;  3KAI A;  1W1P A;  2LGO A;  3CHC A;  5DEZ A;  3VAW A;  3CHE A;  3WKZ A;  1W1V A;  4ZPV R;  4G50 A;  3JXV A;  1FKB A;  3UF8 A;  2XP4 A;  5DIU A;  1WAW A;  3PRB A;  4LAV A;  3GPK A;  4DT4 A;  4IQ2 A;  1FKL A;  2A3A A;  1FKG A;  4AY1 A;  3CH9 A;  2DSW A;  2PPO A;  4Z2H A;  1QZ2 A;  3O5Q A;  1NWR A;  3O5I A;  4PTM A;  1QPF A;  4W9P A;  1NMV A;  4GIV A;  4U86 A;  3WD4 A;  3FXY A;  4Z2I A;  2KI3 A;  4QT3 A;  1L1P A;  2RUR A;  3G6M A;  3UI6 A;  5HW6 A;  3UI4 A;  1ROU A;  1JND A;  1LJY A;  4ZPT R;  2PI6 A;  5JH8 A;  2Q5A A;  4O2T A;  3B8S A;  2KO7 A;  1Y0O A;  1KT1 A;  2KR7 A;  3QOK A;  4KQZ A;  4W9O A;  2MLX A;  1Q6H A;  5HTG A;  5HW7 A;  3CZ8 A;  2FAP A;  2M1I A;  2A3C A;  1O6I A;  2MLY A;  4W5U A;  3OOB A;  4NSB A;  1E6R A;  2DSV A;  1EIB A;  5GQB A;  1E15 A;  2VN1 A;  4LAY A;  3ARP A;  1F8A B;  3PR9 A;  4DWS C;  3ARY A;  4C02 B;  3ALG A;  3IKD A;  1HXV A;  1EYM A;  3JYM A;  4WIW A;  4ODR A;  1D6O A;  1FKT A;  1Q6I A;  4DH0 A;  1GUV A;  2DT0 A;  1JNE A;  4MTV A;  4ODP A;  4ML4 A;  5GPR A;  3UQI A;  1LL7 A;  1W1T A;  2A3E A;  2LPV A;  1PIN A;  4ZS6 A;  2G41 A;  4WKA A;  4P8W A;  2IUZ A;  4JYS A;  3ARR A;  1LG2 A;  2WLZ A;  1YW5 A;  3RME A;  2DG3 A;  2M2A A;  2MPH A;  3ARU A;  4WK9 A;  1E6N A;  1GOI A;  2WLY A;  4DZ3 A;  1FKK A;  1P5Q A;  5HUA A;  3UQA A;  3PRD A;  2F4E A;  1OWQ A;  3UI5 A;  1ZK6 A;  3KCE A;  2XP9 A;  2F21 A;  3ARS A;  2ZQT A;  4TYO A;  3WH0 A;  1HKM A;  2LKN A;  4ZPW R;  1Q1C A;  3WQW A;  1J4I A;  4DRN A;  4Q22 A;  4MNL A;  2OFN A;  3KAF A;  4R5E A;  1CTN A;  4WKH A;  2PV3 A;  1LG1 A;  1FKF A;  5J6E A;  2ITK A;  3AQU A;  1QPL A;  5DIT A;  3W4R A;  4QZV B;  4BF8 A;  5GPG A;  1FKJ A;  3IK8 A;  1VF8 A;  3CHF A;  3WQV A;  4L3N A;  4DWS B;  2DPE A;  4IQC A;  4P8X A;  1ROT A;  1FKH A;  4IT4 A;  1WNO A;  3B7X A;  1C9H A;  1H0I A;  4Z2L A;  3ARX A;  3KAH A;  1D7H A;  2D9F A;  1NWT A;  3RFW A;  2MF9 A;  4U84 A;  4MPK A;  3IKG A;  4DRJ A;  1H0G A;  2FKE A;  3KAD A;  4MSP A;  1OGG A;  1HJW A;  3B9D A;  4W9Q A;  3UQB A;  3NRK A;  3JYJ A;  1J4H A;  1HKJ A;  1OGB A;  3MDY B;  1YAT A;  5I98 A;  4MNK A;  3BXW A;  1XHG A;  3AS3 A;  4TW8 A;  4ITZ A;  4IPX A;  2O92 A;  1HKK A;  5BXJ A;  1E6P A;  1JNT A;  5HW8 A;  5HKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...