1D6RA

Crystal structure of cancer chemopreventive bowman-birk inhibitor in ternary complex with bovine trypsin at 2.3 a resolution. structural basis of janus-faced serine protease inhibitor specificity
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Crystal structure of cancer chemopreventive Bowman-Birk inhibitor in ternary complex with bovine trypsin at 2.3 A resolution. Structural basis of Janus-faced serine protease inhibitor specificity.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1d6rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1d6rA02
1Y8TA 3QUMP 1SMFE 4BNRA 3MNXA 1C5MD 3E1XB 1HIAB 2TGAA 1ZMNA 1SGYE 4YZUA 1D4PB 2FIRH 1DITH 3SUFA 4OS4A 4X8UH 5F8TA 1NROH 3A7TA 4KKDA 5I25A 1DICA 3ZYDA 2XTTB 2WYGA 4E05H 1DXPA 2GVFA 1XXDA 3E16B 1QL8A 1EATA 1VGCC 3TH3H 4ABJA 2WINI 1KDQB 1A0LA 3BTME 1PQ7A 2BD7A 1EASA 5BRRE 1XKBC 2NU1E 1ELAA 5FX6A 1GHYH 3SGAE 2P94A 1Z8IB 1LHFH 3K6YA 1C9PA 1ZHRA 3RU4E 1DDJA 1GWAA 1RIWB 2ZNKH 2J94A 2BHGA 2BDYA 1TNIA 1YCPK 1ZJKA 1T4UH 3DA9B 2VIDA 2GV7A 1O3CA 2FYQA 1ZR0A 1YPHE 2VINA 3Q3KA 3VEQB 4X6PA 2BOHB 4K60A 1FUJA 1O3GA 4X6MA 4YTAA 1HAVA 6CHAC 1UJ1A 1ZMLA 4THNH 2VH6A 1GL1A 2WUBA 1GJCB 2SFAA 2Q6GA 1A2CH 1H8IH 2VB0A 3LH1A 1EQ9A 1GJBB 1OYQA 1NU9A 5FBEA 1FY4A 2PWXA 3UWJH 3K65B 2ANWA 2Y6TA 4TWYA 2J34A 1CA8B 1HUTH 1MU6B 5E2OA 5DPAA 2OQ5A 5FPYA 3LJOA 1G3BA 1DLKB 1UTKA 1O2HA 8LPRA 4FXGH 3LKWA 1ZSKA 2D1JA 3T25A 1BMAA 2IN2A 2ZGBH 2VWOA 4XSKU 4XDEA 1ELFA 1C1UH 3ZVBA 3GCHC 5G4BA 2FESH 2BD5A 2OBQA 3RXLA 3VB5A 1D9IA 1ZYOA 1TPAE 3RM2H 1L1NA 2UWOA 2F9PA 1V2VT 2FOAA 1C5SA 2EA3A 3ZV9A 3HKIB 5DG6A 1W2KH 3UIRA 4O9VA 1ZTJA 1NRRH 1C1SA 3SGBE 3GDVA 4I33A 1VCQA 5F8ZA 3FANA 3VGCB 1HAZB 4ZAEA 4H6TA 1K1LA 1ZGVA 2ZQ2A 1C1NA 1FY8E 3AW1A 5ETXA 5HM2A 3URCA 2BLQA 5JBCS 2ZWLH 1TYNA 2PGQB 5GJ4B 1O2GH 4Q7YA 3P92A 1MZDA 1GGDC 5JBTA 3LC3A 1K1JA 1AGJA 3OSYA 3STIA 2FLBH 1P2NA 4BANB 3P8NA 2SGPE 4AFQA 1GI3A 1CA0B 5EW1H 1T8OA 5JDUB 1DT2A 1C2LA 4YOGA 1SQTA 5CMXH 4TPIZ 1C2FA 1Q3XA 2BY9X 4NIWA 1GJ4H 2F91A 1NZQH 3PMAB 3RXRA 2VGCB 1AKSB 4MNYA 1GMCF 4Y10E 1Z7KA 4GHQA 2Z9KA 3TJVA 5K7RA 1HV7A 1E35B 2IJOB 1TNHA 2VNTA 1TPPA 1O3OA 1D6RA 1FY1A 1C5OH 1G36A 1C1VH 1SGFG 3BIVH 1GHAG 1P06A 3FFGA 2CV3A 4HFPB 1MKWK 1D3TB 1Y5AT 4K1TA 3SU1A 4CRDA 3LGYA 3M5NA 3RXBA 3RMMH 3O8DA 1W14U 2GZ7A 2K1QA 4INLA 3LGIA 2NWNA 2J4IA 3PB1E 1XUKA 2BDCA 1BMMH 4RKJB 4IN1A 3T29A 3ZYEA 4K1EA 3A89A 2FWWA 2HPPH 1O3JA 2PUXB 3A86A 2CF9H 3NXPA 7KMEH 3AAVA 1BMLA 2FODA 1EZQA 2VVCA 4MPVA 2NU4E 2HNTC 3LH3A 3STJA 3NWUA 1GI4A 3KHVA 2PSYA 2BDGA 3SV6A 1NO9H 2J38A 2ZU3A 1MTUA 4NA9H 2Z3DA 1UVOA 2ZQ1A 1K1MA 1YPLH 3RXMA 1NC6A 1TX8A 1ZRBA 1GHXH 1CT4E 4IS5A 1OWIA 3I29A 3M3VA 3SOSA 3ZVEA 3EA9A 5LPRA 2FEQH 2VIVA 3QTOH 1P10A 1Z1JA 2DUCA 2ZPRA 2A5IA 1F92A 1IQLA 1MUEB 4CBNA 1INCA 1P2QA 1PPEE 1EUFA 2PKSC 4A1VA 3ZZDA 4JYUH 4DOQA 1QBVH 1Y3VA 4B74A 1C5ZB 1ANEA 2PW8H 4GVUA 1HYLA 2GTBA 4B71A 1P11E 1O2OA 1KXFA 3TPIZ 1C9TA 1O2UA 1VITG 1AHTH 2CMYA 1QQUA 1LVBA 3TU7H 1QGFA 1QB6A 2F9UA 1QA7A 1HJAC 1ELEE 3K9XB 4CHAC 1NY22 3M5LA 5HMAA 1EX3A 3R0FA 3R3GB 3RXKA 1HAXB 4E7RG 2BD3A 1B7XB 3ZVCA 1PQAA 2ZTZA 1KXBA 4O3UA 1FY3A 1RXPA 1TFXA 4ABBA 2OLGA 1CO7E 4AG2A 2BDIA 1TQ7B 1HAVB 1C1QA 2SGAA 1BA8B 5EQRA 1WTHD 2HNTE 1GJ8B 3GISB 3RLYH 4DIIH 4ISIH 2XNIA 1DY9A 1Q2WA 1A5GH 4NA7A 2AMDA 3M7TA 4OS2A 5FBIA 2HGTH 1IQGA 1O30A 2BY5X 2VH0A 2FOCA 1A0HB 1P2IA 1ZMJA 2V6NA 3M7QA 3V0XA 3UNSA 2CF8H 3T5FH 2ZHDA 2IOTA 3N7OA 3LT3A 2G8TA 1CHGA 2AMPA 1NS3A 4GLYA 4JZ1A 4ZMAH 2QGRA 1TA2A 1O3LA 1GBDA 1BHXB 5C5NA 4BAKB 1EAUA 4AORA 4XBDA 2NU3E 4HGCA 1N1LA 1SGQE 1FJSA 3SU0A 2D2DA 4VGCB 4Y71A 1C1PA 1QL9A 3SUEA 1C2DA 3KQDA 3OY5U 1ORFA 2A5AA 2FP7B 1HNEE 2C8ZB 3S9CA 3SHCH 2ZU5A 1K22H 1HXEH 6GCHF 2ZDKA 4R8TB 2FS8A 2FMJA 4SGAE 4D7GA 1FIZA 3UR6A 1WQVH 2AS9A 1TRNA 3A83A 1O2ZA 2AEIH 4UE7H 3SU4A 1S0QA 2WV4A 3F9EA 5C67A 4MG3A 1V2KT 2H5CA 1FDPA 1NFYA 1S83A 1HJ9A 1SFQB 1EB1H 2OC7A 4O97A 2ZU1A 1NT1A 4WH8A 1QJ7B 4MNWA 3T28A 1AFQB 2FLRH 2FX4A 4M7GA 1T7CA 1QBOA 1F7ZA 3RMOH 1BTYA 5CE1A 1JXPA 1TGTA 4ABEA 1BIOA 3ITIA 4Y79A 3BG8A 1ELCA 3TGKE 2CJIA 5TCAA 2PUQH 3NKKA 1K1NA 4FUFA 1V2OT 1AD8H 4PROA 7LPRA 2R0LA 3ATWA 5DP7A 4AFSA 2GV6A 5DP5A 1MTWA 6ESTA 9ESTA 2CHAC 1L1GA 4FUGA 3BG4C 3K6ZA 3M35A 1PQ5A 3W94A 1AVGH 1V3XA 1SQOA 3P8GA 1LKBA 1OSSA 1O3MA 2Y7XA 2WYJA 2EC9H 3LC5A 4DGJA 2CN0H 3KQCA 4A6LA 3M61U 1TNLA 2O8UA 1YP9A 1BUIA 1GJ6A 4ABAA 2G55A 1AFEH 3D65E 2CXVA 2FI5E 1ANCA 3MH7A 2YOLA 1TBRH 1TGNA 4A1TA 2ZC9H 2Y7ZA 4ZUHA 4UFGH 5EODA 1SLXB 4Y11E 3LGWA 1UTOA 1BBRH 1C4Y2 2VIPA 3KF2A 3QZRA 3RXEA 1FMGA 2ODYB 2HPQH 1AWHB 1O3HA 3LGVA 1GI8B 4CH2B 2ALPA 3SN8A 1A3BH 2VVVA 2XC5A 1JIRA 2PV9B 3GICB 2ALVA 2FZZA 1BMNH 1L4ZA 1O3EA 1Z8JB 3JZ1B 4AYVB 3UNRA 1GHVH 2FOBA 1DWCH 3QWCH 3VB4A 3PV4A 2OCVB 5FHTA 1UVPA 3TJOA 1CBWC 4I8JA 1GHZA 1F0SA 1KYNA 1LDTT 1AVWA 3HK3B 4FUJA 1TALA 1TB6H 2G4UA 3G01A 2O8LA 2P8OB 4MPXA 5EXLA 3MOCA 3TITA 4MNXA 2XC4A 1JMOH 2C8XB 2UUKB 1LPKB 3HGNA 5DP6A 3FP7E 4ABIA 4D9RA 1YCPM 3UR9A 2JH5D 1AKSA 4KGAA 2C8YB 1FN8A 3BTQE 1ANBA 1GMHF 4GSOA 4Y0ZE 5PTPA 4BOHA 1TPSA 1FLEE 1KXCA 5A8XA 4QT8C 3SNCA 3KEEA 1NFXA 1E37B 1MKWH 1F0TA 1ELBA 4YOIA 3L3TA 4TYDA 1DWDH 3H7TA 1J14A 3Q77A 2XRCA 1O32A 1J9CH 3KGPA 3URDA 2XYAA 1JRSA 2SNVA 3RC5A 2RDLA 4DG4A 1PYTD 1FIWA 3BTHE 5AHGH 1GMDG 1YLCA 3B23B 3KL6A 1O0DH 3NZIA 1QJ6B 2HALA 3EYDA 1P12E 1X7AC 1XVOA 2TIOA 2OXSA 4YLUA 3SNBA 1UK2A 3LONA 1EPTB 1O36A 3FP8E 1WBGB 1MAXA 2STBE 4CRCA 1FPHH 2ZDNA 3MFJA 1ELVA 1EOJA 4H4FA 1OOKB 1MTNB 3QX5H 1O34A 4AB8A 4FU7A 1MCTA 1Y5UT 1XMNB 1C5RA 1S85A 3TGJE 4Y8ZA 2ODQA 3RMNH 2BX4A 2C3SA 1CSOE 1UCYH 1YBWA 4TY6A 3IWMA 1IOEA 1WSSH 1GI1A 3B9FH 5LPFA 1EB2A 2OINA 1BRAA 4ZKRU 1DWEH 2ZHFH 1V2PT 1QRZA 3OX7U 1WOFA 4WH6A 4NA8A 2VU8E 4ZHAA 1YPKH 1QY6A 4CBOA 4Q7XA 7GCHG 3EA8A 5E0JA 1LHCH 3RXPA 2WPMS 3EDXB 5T3HA 2GMTB 1GBEA 1LVYA 2I6QA 3SGQE 1T8MA 1EOLA 4OS5A 3UPEA 1BBRE 1BTUA 1ZTKA 4NFEA 2Z3EA 3DFJA 2UUFB 1RTFB 1C1MA 1N6YA 3SNDA 1J15A 2BY6X 3D49H 3MU8A 1EAIA 3P6ZB 3RXIA 4WXVA 1GHBG 1GCTC 2ZFTA 3EE0B 1GBBA 2G51A 1IQJA 2A0QB 1IQFA 2PLXA 2ZTYA 2KAIA 3TIUA 1FI8A 2WPIS 1ZTLA 1C5NH 1UK3A 1J16A 1UVTH 4GCHF 2G81E 5EU8A 3BIUH 1S0RA 3M5MA 1VR1H 1P04A 3SU3A 4NSYA 3GY7A 2O9QA 1E38B 3ZZAA 2XCNA 2ZGXH 3KCGH 3SJ9A 1Y5BT 1VZQH 1UVUH 3DFLA 3MO6A 4DW2U 5GCHF 3SO3A 3C1KA 3L33A 1XUGA 1HB0B 1ZSJA 2ZCHP 3OY6U 1OP2A 3RXTA 2HNTF 1V2UT 1W3CA 1ZOMA 4X2WA 5F8XA 2Z9LA 4Y8YA 2ZHQH 4UFFH 4TWWA 1B0FA 1O3AA 1TRYA 1O2JA 1PFXC 2SNWA 5JBAS 1EXFA 2BDHA 2P16A 3P8OA 3QO6A 3RU4T 2ZFPH 3PO1B 4JZIA 1A0JA 2GD4B 2FOMB 2FYRA 1A7SA 1VCPA 1GVZA 2SGQE 5C1UA 5J4SA 1N8OC 2FX6A 3GOVB 4CR5A 4B2CA 4MNVA 4ABFA 5E2PA 1TNJA 3ZZ9A 3D23A 3PWBA 1NESE 1H9IE 1Y59T 2XBVA 2ODPA 1YF4A 1XVMA 2Y81A 3AASA 4X1NU 1KLIH 5A8ZA 1VITH 1TBQH 1XUIA 4FUCA 2ZU4A 3HGPA 4UDWH 4AX9H 1T8LA 1A46H 1FQ3A 1QRWA 1UO6A 4WMFA 5A8YA 3ZZ6A 4E06H 3A80A 1PQ8A 3RXQA 2F9VA 3V13A 4ZH8A 1O2YA 1KXDA 3TNTA 1Z71A 1TMTH 2BOKA 5ABWA 1TIOA 4HZHA 1P9SA 8ESTE 3CS0A 1QB1A 2WPJS 1BBRK 1SHYA 3P8FA 1GBHA 1LMWB 1V6DA 4NFFA 4JYTA 1UCYE 3SU2A 1NU7B 2Y5FA 2GDDA 1WUNH 3ZVFA 4Y6DA 4Z0KA 2BQWB 1MU8B 4OS6A 1AE5A 2GCHG 2BD9A 2WPLS 1UMAH 1PPZA 1O38A 5FAHA 3ZZ7A 5JYIA 1ANDA 3V3MA 1Z6EA 1BTXA 1OPHB 5FPSA 2W7UA 2A5KA 4UONA 1O5BB 2FS9A 3A84A 4AYYB 2FTMA 3MU5A 1SFIA 1AVXA 4HI3A 4I8KA 3RXHA 2V0BA 1BZXE 3QN7A 3SV9A 2BM2A 3U8OH 5GXPA 2A7HA 1A3EH 5FX5A 2WUCA 2BDAA 5L2YH 1TBZH 4A1XA 4WJG2 2RCEA 1DLEA 1V2MT 1BTPA 3NPSA 2ZTXA 3VFEA 2AIPA 5FCRA 5HYOA 1THRH 5BPEA 1JOUB 3QK1A 4K8YA 1O5GH 3MTYA 4FUBA 1O2NA 1ETTH 1O31A 2BQ6B 1W7XH 1TX6A 1F0UA 3GY5A 1HAYB 1WYKA 3RXCA 1ESAA 1LQEA 1OXGA 3BN9A 1GBMA 1FY5A 2F9BH 4FUIA 1RIWC 2OQUA 2VIQA 3OYPA 5EXMA 4K1SA 1FV9A 1W10U 3BEFB 3RUOA 2GCTB 2BLWA 2G5VA 1NPMA 1TABE 2C8WB 5TCCA 2OTVA 1PYTC 2XW9A 2RG3A 3PMHB 1N6XA 2P93A 5AF9H 4I8GA 3P70B 4R0IA 1MKXH 2R9PA 5JB9S 1GHWH 1ETRH 3TH2H 4INHA 1LQDB 5EOKA 1AWFH 2BMGB 4BAQB 5GWZA 2BZ6H 2ZHEH 1FXYA 1V2TT 1UCYK 3GCOA 3VB7A 4GHTA 1P03A 2JH6D 1UTPA 1QHRB 3ENSB 1O2PA 4CRGA 3MH4A 1RJXB 2A31A 1C5PA 3OTJE 2ZGCA 1ABIH 1SGCA 2F83A 2R3UA 3T62A 9LPRA 4Q2KA 3BV9B 2ZCLP 1IHTH 3AW0A 2A2QH 3KNXA 1ELTA 1BITA 4WF8A 3UNQA 5DP8A 1G3CA 4I32A 1A1RA 3PTNA 1HCGA 4DIHH 3VGCC 1MTSA 1AN1E 2I6SA 2KAIB 2W5EA 4KELA 4A5TS 4D76A 2P3FH 1P3EA 4KTSA 1EKBB 1ESBA 1WQSA 4H6SB 1CHOG 1RFNA 5JPMH 5CHAB 2G4TA 1GI2A 3BTDE 3HPTB 3SJKA 1TONA 3PM3A 1S6HA 1THSH 1C5VA 3FAOA 3UOPA 4Y7BA 3RXGA 4GAWA 1C5WB 3A85A 5DP4A 2WV5A 2VIWA 1FPCH 5DKMA 1EPTA 1KSNA 2B7DH 3L6PA 3S9BA 1SGIB 5E0GA 1CA0C 1IQNA 5C5OA 1W7GH 2JETB 3Q76A 1W0ZU 2QY0B 2ZGJA 4Q80A 3ZVDA 2A4QA 1VJ9U 3DHKH 4ABDA 1KXAA 2VGCC 3SI3H 2BDBA 3ZZ5A 2O8TA 1SGRE 3GY6A 2PSXA 4A92A 2FOEA 2BYAX 1OWJA 4K2YA 3UREA 1SLVB 5C1XA 4Q7ZA 2J95A 2F9NA 1GI7B 4DT7B 4YOJA 5B6OA 3RXSA 4E7NA 1AB9B 4IBLH 3BTEE 5I46H 2A4GA 3S7KB 5C3NA 3SJOA 3TK9A 1SQAA 1A5HA 1KTTB 2Z7FE 4Y8XA 2H2ZA 2ILNA 4MDSA 4D8NA 2VWLA 1HAGE 2UWPA 2ZFSA 4O3TA 1ZHMA 5F6MA 3RXFA 3NK8A 3LU9B 4BTIB 2OBOA 4B2BA 2H5DA 3GDSA 3GY3A 5C2ZA 3QLPH 5EQQA 4CREA 3AVZA 1HDTH 4X8TH 1TE0A 5DJ7A 2SGDE 4X1PU 1AY6H 1SL3A 3SBKA 1H9HE 4XBCA 2A7CA 3HKJB 1NRSH 2B0FA 2AGEX 1SGPE 4X1SU 1XM1A 2SGFE 2TGPZ 1UHBA 3GY4A 3TLOA 1SGDE 1GBLA 4X0WU 2ZF0H 3GYLB 4Z6AH 4WY3A 1ARCA 1A5IA 1DUAA 1Y3XA 3BSQA 1XX9A 4ZKSU 3A82A 1E36B 1VCWA 1XKAC 4TY7A 3CP7A 4ISHH 5DP9A 1O2TA 1SC8U 3SUDA 4KTUA 2ZO3H 3ATLA 5FPTA 1PPBH 1C5QA 1YPJH 3FVFB 1QFKH 1Z8GA 1ZRKA 4LZ1H 1G37A 1M9UA 3ATMA 2QC2A 2VWNA 2ZP0H 2ULLA 2EI6A 1MD7A 4HTCH 5J4QA 5GDSH 2BD4A 1K2I1 1A4WH 3QTVH 1H9LB 4JZFH 3UQOA 3A8DA 3CS7A 3E6PH 1ZZZA 1CVWH 1ELDE 4FU9A 3DUXH 2A2XH 1PPFE 4NIXA 2PKAB 1RGQA 4YO9A 1UK4A 4K69A 2ZIQH 4DURA 1ZJDA 1JIMA 3UTUH 1O2XA 1GG6B 4RN6A 4AGKA 4UEHH 3T26A 4ZKNU 1GI0A 4F49A 3RXDA 2H6MA 1WU1A 4J1YA 2D26C 3U9AH 1UTNA 1SLUB 2M5TA 5A09A 1QBNA 3S69A 1G32B 1DSUA 4WVPE 1AZ8A 4LK4A 4X2XA 3UOUA 1O37A 1GMCG 1O2LA 1YYY1 4KTCA 3VPKA 3GDUA 3EQ0H 1MKXK 3EAJA 4JZEH 3RXOA 2QIQA 2XWAA 1VGCB 2OD3B 1AE8H 4I31A 1EZUC 1F0RA 4X2YA 1VJAU 1QRXA 3A88A 1K9OE 4BTTB 2BVXH 3A7YA 1S5SA 1TMBH 5TJXA 4IMQA 2FPZA 1DXWA 1D3QB 1O2VA 1MAYA 3EA7A 3ELAH 1KTSB 4BXSA 1BQYA 1G2LA 4AB9A 3BTGE 1V2LT 1P2JA 3GYMA 1DWBH 4VGCC 3RC6A 1GHAF 4I8HA 2UWLA 4D9QA 4ABGA 4LOYH 1P3CA 4BXWA 3AAUA 4ASHA 4LXBH 3UUZA 4OS7A 1L4DA 1MTVA 1QIXB 2SGEE 1SHHB 1HRTH 2ZCKP 3P17H 3QGNB 1O2SA 5F03A 1V2WT 4NZLA 4AN7A 6CHAB 3ZZBA 1BRCE 1V2ST 1K21H 2A1DB 1ID5H 3PLBA 2P95A 1SGNE 1FAKH 4H42U 4NZQA 1AUTC 1P2OA 1SSXA 3MI4A 2WPHS 1O3PB 2AERH 1V2RT 1G2MA 1UTQA 1LVOA 1AFQC 2V35A 4JK5A 4AG1A 3GCHB 3JZ2B 4JCNA 4UFEH 4CRFA 1DPOA 4NIYA 2XWBI 2B8OH 3K2UA 3U8RH 2GGVB 1C2JA 3BTFE 3VB3A 1P9UA 4DY7B 3MMGA 3SJIA 1JRTA 3TVJB 1OP0A 3MH6A 1HPGA 4NWKA 1MQ5A 3SV8A 1MCVA 1OS8A 3PROA 3Q00A 2FO9A 1S82A 1W12U 1W13U 2ANYA 5GIBA 2H9HA 2V3OH 1YPGH 5HM9A 2BLVA 1QL7A 3VXFH 1QCPA 5LPEA 3SNAA 1VITF 1OWHA 1O5EH 3GCTG 3ZVGA 2FDAA 3C27B 1F5LA 3KQBA 1GGDB 1C5TA 3ESTA 1BB0B 1D3DB 1CHOF 1IQMA 1AIXH 4LZ4B 2Q6FA 1LO6A 3VB6A 3UQVA 3SW2B 3TK5A 4IC6A 1S84A 2GDEH 1NRQH 1A61H 1RRKA 3SI4H 5IDKA 4XFQA 1GI9B 1GBAA 2ZPSA 1HFDA 1IQIA 3V12A 3WY8A 1D3PB 1EAXA 1FN6A 1QQ4A 2GZ9A 1SOZA 3M7UA 2P3UB 1C1WH 1BCUH 3M36A 3ZZ4A 5EPYA 4BAHB 1YPEH 4YT7H 3MHWU 1MBQA 3RP2A 5JB8S 3MNCA 1V2QT 1QR3E 3V7TA 4FUHA 4ESTE 1ZGIA 1JWTA 3SQHE 1C2KA 2UUJB 1OWEA 4OS1A 3A7XA 1QB9A 1GDQA 1UHBB 1P05A 2ZG0H 1C1OA 1DM4B 1QURH 5T6FA 5A2MH 1LPGB 1IHSH 1O3KA 3SQEE 1RTLA 1EAWA 4JZDH 3BEUA 3E3TA 2P8OC 3A8AA 2ZFFH 2QYIA 4B76A 6GCHG 1ZPCA 3MO3A 4WMDA 2AMQA 2Q6DA 1DFPA 1GBJA 3SUGA 1MH0A 2FOGA 8GCHG 4O03A 2NU2E 5L30H 1THPB 3I78A 3SZNA 3A7ZA 3TJNA 1FAXA 3GY2A 1OP8A 5EPNA 2ZU2A 1FNIA 1O39A 2ZPQA 4MPUA 1SVPA 3NUMA 1C4U2 1O5CB 1RTKA 3OU0A 1CU1A 2A4RA 4BAMB 2QXJA 1G30B 2CGAA 1LKAA 2QXIA 1Y3UA 2R0KA 1O3BA 1EJAA 1C4V2 3VXEH 5EQSA 1NFWA 1MD8A 1SPJA 1EZSC 1HAIH 5L2ZH 2AIQA 2OP9A 4ISNA 4WMEA 2BLOA 3LPRA 3ATIA 4WWYA 1AUJA 2C90B 3Q3YA 1BRUP 1P57B 3LIWA 3SJ8A 4XOJA 1H1BA 3BF6H 3SHAH 2BTCE 2BXTH 1EPTC 1T32A 4YLQH 2LPRA 2GP9B 2J92A 4UD9H 4X8VH 2W7SA 1SG8B 3EGKH 1L0ZA 1ZHPA 1W8BH 3E0NB 3SORA 1MTNC 2PKSB 1TNKA 1SGEE 3U69H 1LPZB 2ANKH 3RXJA 5HXFA 2XBWA 1CT2E 1LTOA 2BY7X 4RSPA 1G3EA 1P0SH 4X2VA 2FOFA 2J2UA 1C2MA 2NU0E 5FCKA 1HJAB 1B5GH 1GI5A 3A8CA 1NN6A 4MLFB 4CHAB 3UWIA 4FVDA 2B9LA 1SBWA 3A7WA 1NM6A 4Y76A 1C1RA 3E0PB 1TRMA 2GX4A 3KIDU 1C5UA 2PGBB 5T6GA 1NRNH 1TGCA 4NCYA 2Z9GA 1IAUA 1TPOA 2GMTC 1O3FA 1K1PA 2FOHA 1Y3YA 4NSVA 3H7OA 3F1SB 1O2KA 5L6NH 4ISOA 4CRAA 1TLDA 1WAYB 3A81A 2H9EH 2HVXA 5A0BA 5DP3A 1IQKA 1T4VH 1UTLM 2QN5T 4B1TA 1DSTA 2PKAA 4CR9A 4Y7AA 2QF3A 3FZDA 3F6UH 4K5ZA 2QCYA 1O5FH 1OWKA 2Y5GA 1GBCA 2V3HH 2XBXA 1O2MA 3MH5A 2XCFA 3PWCA 1K1OA 4U32A 5A0CA 2QA9E 3ZZ3A 1PJPA 2H9TH 4J2YB 1IQHA 4CRBA 3MNBA 4OGYA 2PTCE 2AYWA 2ZDVH 5FXLA 4ZXYH 3RXVA 1GDUA 3LJJA 3A7VA 4RKOB 4NIVA 4X1QU 3O8CA 1SI5H 1GMHG 1PPGE 1GBTA 1T31A 3FZZA 3LGUA 8KME2 2YNBA 2OC0A 1TOMH 2BD8A 4JMYA 5SGAE 2HOBA 2ZHWH 2ZDAH 5AVDA 3I77A 3PLPA 3PO1C 1RS0A 2Z3CA 3ZVAA 4TPYA 1P8VC 3F9FA 1V2JT 1ELGA 2ZI2H 1BOQA 1HAHH 1G9IE 4MPWA 4DJZB 4F4OC 2IPHA 4CH8B 2Q1JA 5AFZH 2F9OA 1L1JA 1MMJN 1O2WA 2BVSH 3Q3XA 1WV7H 3U98H 1XUHA 3W95A 1BTHH 3MYWA 3E8LA 1C5YB 4FU8A 1QA0A 3F9GA 4NG9H 5LGOA 2FM2A 1ARBA 1DS2E 1HJ8A 2C93B 2EI8A 2OC8A 3IG6B 4GPGA 1MBMA 5C20A 1AZZA 1GI6A 1SOTA 4X6OA 1GMDF 2WPKS 1Z6JH 1P01A 1W0YH 2BZAA 1CGHA 2H1UA 1ETSH 3PTBA 3HK6B 1B0EA 4FUDA 2A4OA 3M5OA 3TGIE 2Y5HA 5C1YA 1SGFA 2R2MB 1RD3B 1EJNA 2FXRA 1HAPH 3MWIU 1GVLA 2A45B 5H4IB 1ESTA 3QZQA 1TA6A 2AH4X 2BB4A 2EI7A 2P3TB 2CHAB 4ABHA 2ZFQH 1EP5A 3BG4B 4IN2A 5EG4A 1OX1A 3RXAA 1QTFA 5DGJA 4ZXXH 1TWXB 3SV7A 3RU4D 3A8BA 3U8TH 1AO5A 2QF0A 2ZECA 3PYHA 2RA0A 1P09A 1MZAA 1J17T 1YPMH 3MU1A 1V2NT 1DY8A 3MO9A 2G52A 2VWMA 5EXNA 2Z94A 1HLTH 1GJ5H 2A32A 1C5LH 1BTWA 1P2KA 2AGGX 7GCHF 2F3CE 1O3NA 4U30A 2GZ8A 3GCTF 1O35A 4X8SH 1XUJA 3S0NA 1WCZA 1GVKB 3T2NA 1AQ7A 3KN2A 3H5CB 4MVNA 1Z1IA 2G5NA 3F68H 3RXUA 1BHXF 4GCHG 1GDNA 1O2IA 4KP0A 1XXFA 1FZZA 1GJ7B 1TQ0B 2VIOA 4IC5A 2Y82A 4K8BA 4JYVH 4I7YH 1GHBF 2ZDMA 3LGTA 2P59A 2ANMH 3ODDA 1BDAA 1T8NA 1HAOH 1L2EA 2GCTC 5GCHG 1LHDH 1CBWB 4DCDA 3MU4A 5JBBS 1ZSLA 2YNAA 3ODFA 5DO4H 7ESTE 1FONA 1HIAA 2GKVE 3CENA 1GBKA 1GPZA 2VJ1A 2QXGA 1TOCB 4FUEA 2C4FH 2XXLA 2FI4E 3D62A 1O5DH 1D6WA 3T27A 4IGDA 1G3DA 1LHEH 2J9NA 1O3DA 1C2GA 1K1IA 1AI8H 2ZZUH 1CGIE 1BJVA 3E90B 1MQ6A 2W26A 1QNJA 8GCHF 1KDQA 3A87A 3NCLA 1GJDB 5AFYH 3GY8A 1P2MA 1U6QA 5LH8A 1GJ9B 2THFB 1W11U 2ZGHA 2R3YA 2R2WU 2ZEBA 1PPCE 3MU0A 5ESBA 4Y0YE 1YCPH 2AGIX 1Q31A 1H8DH 3IITA 2Z9IA 3BTWE 2PR3A 1DUEA 4FVBA 2QXHA 2ZDLA 1CE5A 1Y3WA 1K28D 1TGSZ 4WXIA 4B75A 2O8MA 2Z6BD 2Z9JA 4XBBA 2HLCA 3B8JA 1LVMA 1O3IA 1GL0E 3TJUA 2EEKA 5GPIB 2O8WA 2FI3E 3UY9A 4IMZA 3PMBB 1SLWB 3S9AA 2ZKSA 1O2QA 1J8AA 2STAE 4UFDH 2JH0D 2UUYA 1BRBE 3BTTE 4B2AA 1SR5C 2PTNA 4ZROA 1S81A 1YC0A 2HWLB 2QV1A 3M3TA 4NWLA 2BY8X 2GT8A 1QJ1B 3FP6E 1DOJA 1KLJH 2PHBA 4A7IB 1LHGH 5CHAC 4AGJA 3ATKA 1P02A 1HXFH 4MTBA 1TX7A 1EZXC 1YGCH 1YLDA 1ZPZA 4JK6A 5E8EH 1TGBA 2GCHF 3PMJA 1ZLRA 1GCDA 1OKXA 1F5RA 1O2RA 5EW2H 1O33A 4IW4E 1WTGH 1SGTA 3QDZB 3SU5A 3TNSA 2GT7A 3TH4H 1YKTA 1IQEA 1KLTA 2JETC 3BEIB 1TAWA 3RLWH 2B5TB 1C2IA 1CT0E 3PLKA 1HGTH 3UFAA 2XBYA 1BTZA 1CGJE 1CQQA 1GJAB 1Z8RA 4ISLA 1TNGA 4I8LA 1GCTB 1DANH 4X6NA 4BAOB 4ZHMU 5DK1A 2OUAA 4AFZA 2W3KA 3BTKE 3KQEA 4YM9A 6LPRA 5E0HA 4YT6H 3M3SA 3S7HB 3MNSA 2ZA5A 2W3IA 1AB9C 1GBFA 5ESTE 4XE4A 3QGJA 4YESB 1YM0A 5K0HA 4D7FA 4U2WA 4AFUA 1E34B 1O5AB 3HATH 1OWDA 5IYTA 2BD2A 1JBUH 4B73A 2VVUA 4K3JA 1DE7H 2TPIZ 3RDZA 1GBIA 1UVSH 4DVAU 4GUXA 2HRVA 1EJMA 4ZHLU 4INKA 3RMLH 1NRPH 2G00A 5HGGA 1XUFA 2BX3A 3E91A 1C1TA 2TRMA 3DT0H 3ZZ8A 3ZV8A 1E0FD 2XC0A 1BT7A 3O8RA 3GCNA 1ACBE 1F2SE 1EP6A 1H4WA 5A0AE 3LDXH 1HBTH 2AFQB 2QAAA 1ABJH 2OC1A 2RA3A 3TK6A 1N8OB 2ASUB 2Y80A 1KXEA 2TGDA 1C2HA 1DVAH 2TBSA 2JKHA 3SNEA 4ZKOU 1NTPA 2BXUH 4MQAA 3F9HA 3U1IB 3U1JB 2A7JA 2BVRH 4BTUB 2ESTE 3LOXA 2PFEA 1KY9A 1S6FA 4SGBE 1NFUA 1TMUH 1DX5M 4OGXA 1KIGH 3O8BA 5T6DA 3SU6A 1OYTH 3P95A 3ZZCA 2BQ7B 1UTMA 1YPHC 1ZPBA 1UTJA 1SB1H 1AU8A 1PPHE 4AZ2B 3SV2H 5EGMA 3RC4A 4X1RU 4U01A 1AMHA 2DE8A 3DD2H 2TGTA 3RM0H 2LNCA 1C2EA 4NGAH 2ZFRH 4AOQA 1C5XB 2DE9A 1GG6C 3M37A 1LCYA 1BJUA 2D8WA 2FTLE 1F5KU
chains in the Genus database with same CATH superfamily
1Y8TA 3QUMP 1SMFE 4BNRA 3MNXA 1C5MD 3E1XB 1HIAB 2TGAA 1ZMNA 1SGYE 4YZUA 1D4PB 2FIRH 4P02A 1DITH 3SUFA 4OS4A 4X8UH 5F8TA 1NROH 3A7TA 4KKDA 5I25A 1DICA 3ZYDA 2XTTB 2WYGA 4E05H 1DXPA 2GVFA 1XXDA 3E16B 1QL8A 1EATA 1VGCC 3TH3H 4ABJA 2WINI 1KDQB 1A0LA 3BTME 1PQ7A 2BD7A 1EASA 5BRRE 1XKBC 2NU1E 1ELAA 5FX6A 1GHYH 3SGAE 2P94A 1Z8IB 1LHFH 3K6YA 1C9PA 1ZHRA 3RU4E 1DDJA 1GWAA 1RIWB 2ZNKH 4RI0A 2J94A 2BHGA 2BDYA 1TNIA 1YCPK 1ZJKA 1T4UH 3DA9B 2M2AA 2VIDA 2GV7A 1O3CA 1MABB 2FYQA 1ZR0A 1YPHE 2VINA 3Q3KA 3VEQB 4X6PA 2IPQX 2BOHB 4K60A 1FUJA 2YMSB 1O3GA 4X6MA 4YTAA 1HAVA 6CHAC 1UJ1A 1ZMLA 4THNH 2VH6A 1GL1A 2WUBA 1GJCB 2SFAA 2Q6GA 1A2CH 1H8IH 2VB0A 3LH1A 3DSGA 1EQ9A 1GJBB 1OYQA 1NU9A 5CHBA 5FBEA 1FY4A 2PWXA 3UWJH 3K65B 2ANWA 2Y6TA 4TWYA 2J34A 3N7EA 1CA8B 1HUTH 1MU6B 5E2OA 5DPAA 2OQ5A 5FPYA 3LJOA 1G3BA 2RFKC 1DLKB 1UTKA 1O2HA 8LPRA 3WWFA 4FXGH 3LKWA 1ZSKA 2D1JA 2F43B 3T25A 1BMAA 2IN2A 2ZGBH 2VWOA 4XSKU 4XDEA 1ELFA 1C1UH 3ZVBA 3GCHC 5G4BA 2FESH 2BD5A 2OBQA 3RXLA 3VB5A 1D9IA 1ZYOA 1TPAE 2KCAA 1L1NA 2QF4A 3RM2H 3FKSD 2UWOA 1H8ED 2F9PA 1V2VT 2FOAA 1C5SA 2EA3A 3ZV9A 3HKIB 5DG6A 1W2KH 3UIRA 4O9VA 1ZTJA 1NRRH 1C1SA 3SGBE 3GDVA 4I33A 1VCQA 5F8ZA 3FANA 3VGCB 1HAZB 4ZAEA 4H6TA 1K1LA 1ZGVA 2ZQ2A 3KYGA 1C1NA 1FY8E 4I86A 3AW1A 5ETXA 5HM2A 3URCA 2BLQA 5JBCS 2ZWLH 1TYNA 2PGQB 5GJ4B 1O2GH 4Q7YA 3P92A 2J98B 1MZDA 1GGDC 5JBTA 3LC3A 5EIYA 1K1JA 1AGJA 3OSYA 3STIA 2FLBH 1P2NA 4BANB 3P8NA 2SGPE 4AFQA 1GI3A 1CA0B 5EW1H 1T8OA 5JDUB 1DT2A 1C2LA 4YOGA 1SQTA 3OEHD 2EY4C 5C0UA 5CMXH 4TPIZ 1C2FA 1Q3XA 2BY9X 4NIWA 1GJ4H 1E1RD 1NZQH 2F91A 3PMAB 3RXRA 2VGCB 1AKSB 4MNYA 1GMCF 4Y10E 1Z7KA 4GHQA 2Z9KA 3TJVA 5K7RA 1HV7A 1E35B 2IJOB 1TNHA 2VNTA 1TPPA 1O3OA 1D6RA 1FY1A 1C5OH 1G36A 1C1VH 1SGFG 3BIVH 1GHAG 1P06A 3FFGA 2CV3A 4HFPB 1MKWK 1D3TB 1Y5AT 4K1TA 3SU1A 2QE7D 4CRDA 3LGYA 3M5NA 3RXBA 3RMMH 3O8DA 1W14U 2GZ7A 2K1QA 4INLA 5T1VA 3LGIA 2NWNA 2J4IA 3PB1E 1XUKA 2BDCA 1BMMH 4RKJB 4IN1A 3T29A 3ZYEA 4K1EA 3A89A 2VBCA 2FWWA 3SZEA 2HPPH 1O3JA 2PUXB 3A86A 2CF9H 3NXPA 7KMEH 3AAVA 1BMLA 2FODA 1BMFD 1EZQA 2VVCA 4MPVA 2NU4E 2HNTC 3LH3A 3STJA 3NWUA 1GI4A 3KHVA 2PSYA 2BDGA 3SV6A 1NO9H 2J38A 2ZU3A 1MTUA 4NA9H 2Z3DA 1UVOA 2ZQ1A 1K1MA 1YPLH 3RXMA 1NC6A 1TX8A 1ZRBA 5C17A 1GHXH 1CT4E 4IS5A 1OWIA 3I29A 3M3VA 3SOSA 5B6LA 3ZVEA 3EA9A 5LPRA 2FEQH 2VIVA 3QTOH 1P10A 3N99A 1Z1JA 2DUCA 2ZPRA 2A5IA 1F92A 1IQLA 1MUEB 4CBNA 1INCA 1P2QA 1PPEE 1EUFA 2PKSC 5F53A 4A1VA 3ZZDA 1SKYE 4JYUH 4DOQA 1QBVH 1Y3VA 4B74A 1C5ZB 1ANEA 2PW8H 4GVUA 1HYLA 2GTBA 4B71A 1P11E 1O2OA 1KXFA 3FO8D 3TPIZ 1C9TA 1O2UA 1VITG 1AHTH 2CMYA 1QQUA 3F0PA 1LVBA 3TU7H 1QGFA 1QB6A 2F9UA 1QA7A 1HJAC 1ELEE 3K9XB 4CHAC 1NY22 3M5LA 5HMAA 1EX3A 3R0FA 3R3GB 3RXKA 1HAXB 4E7RG 2BD3A 1B7XB 3ZVCA 1PQAA 2ZTZA 1KXBA 4O3UA 1FY3A 1RXPA 1TFXA 4ABBA 2OLGA 1CO7E 4AG2A 2BDIA 1TQ7B 1HAVB 1C1QA 2SGAA 1BA8B 5EQRA 1WTHD 2HNTE 1GJ8B 3GISB 3RLYH 4DIIH 4ISIH 2XNIA 1DY9A 1Q2WA 2KM0A 1A5GH 4NA7A 2AMDA 4TT3D 2OK5A 3M7TA 4OS2A 5FBIA 5HIYA 2HGTH 1IQGA 1O30A 2BY5X 2VH0A 2FOCA 1A0HB 1P2IA 1ZMJA 2V6NA 3M7QA 3V0XA 3UNSA 2CF8H 3T5FH 2ZHDA 2IOTA 3N7OA 3LT3A 2G8TA 1CHGA 2AMPA 1NS3A 4GLYA 4JZ1A 4ZMAH 2QGRA 1FX0B 1TA2A 1O3LA 1GBDA 1BHXB 5C5NA 2K8IA 4BAKB 1EAUA 4AORA 4XBDA 2NU3E 4HGCA 1N1LA 1SGQE 1FJSA 3SU0A 2D2DA 4VGCB 4Y71A 1C1PA 1QL9A 3SUEA 1C2DA 3KQDA 3OY5U 1ORFA 2A5AA 2FP7B 1HNEE 2C8ZB 3S9CA 3SHCH 2ZU5A 1K22H 1HXEH 6GCHF 2ZDKA 4R8TB 2FS8A 2FMJA 4SGAE 4D7GA 1FIZA 3UR6A 1WQVH 2AS9A 1TRNA 3UB0A 3A83A 2XOKD 1O2ZA 2AEIH 4UE7H 3SU4A 2W6ID 1S0QA 2WV4A 3F9EA 5C67A 4MG3A 1V2KT 1WDIA 2H5CA 1FDPA 1NFYA 1S83A 1HJ9A 1SFQB 1EB1H 2OC7A 4O97A 2ZU1A 1NT1A 4WH8A 4ZCNA 1QJ7B 4MNWA 3T28A 1AFQB 2FLRH 2FX4A 4M7GA 1T7CA 1KMHB 1QBOA 1F7ZA 3RMOH 1BTYA 5CE1A 2V3MA 1JXPA 1TGTA 4ABEA 1BIOA 3OE7D 3ITIA 4Y79A 3BG8A 1ELCA 3TGKE 2CJIA 5TCAA 2PUQH 3NKKA 1K1NA 4FUFA 1V2OT 1AD8H 4PROA 7LPRA 2R0LA 3ATWA 5DP7A 4AFSA 2GV6A 5DP5A 1MTWA 6ESTA 9ESTA 2CHAC 1L1GA 4FUGA 3BG4C 3K6ZA 3M35A 1PQ5A 3W94A 1AVGH 1V3XA 1SQOA 3P8GA 1LKBA 1OSSA 1O3MA 2Y7XA 2WYJA 2EC9H 3LC5A 4DGJA 2CN0H 3KQCA 4A6LA 3M61U 1TNLA 2O8UA 1YP9A 1BUIA 1GJ6A 4ABAA 2GJGA 2G55A 1AFEH 3D65E 2CXVA 2FI5E 5IK2D 1ANCA 3MH7A 2YOLA 4HG6A 1TBRH 1NBMD 1TGNA 4A1TA 2ZC9H 2Y7ZA 4ZUHA 4UFGH 5EODA 1SLXB 4Y11E 3LGWA 1UTOA 1BBRH 1C4Y2 2VIPA 3KF2A 3QZRA 3RXEA 1FMGA 2ODYB 2HPQH 1AWHB 1O3HA 3LGVA 1GI8B 4CH2B 2ALPA 3SN8A 1A3BH 1EFRD 2VVVA 2XC5A 1JIRA 2PV9B 3GICB 2ALVA 2FZZA 1BMNH 1L4ZA 1O3EA 1Z8JB 3JZ1B 4AYVB 3UNRA 1GHVH 2FOBA 1DWCH 3QWCH 3VB4A 2KZ4A 3PV4A 2OCVB 5FHTA 1UVPA 3TJOA 1CBWC 4I8JA 1GHZA 1F0SA 1KYNA 1LDTT 1AVWA 4FETA 3HK3B 4FUJA 1TALA 1TB6H 2G4UA 3G01A 2O8LA 2P8OB 4MPXA 5EXLA 3MOCA 3TITA 4MNXA 2XC4A 1JMOH 2C8XB 2UUKB 1LPKB 3HGNA 5DP6A 3FP7E 4XD7D 4ABIA 4D9RA 1YCPM 3UR9A 2JH5D 1AKSA 4KGAA 2C8YB 1FN8A 3BTQE 1ANBA 1GMHF 4GSOA 4Y0ZE 5PTPA 3U28C 1TPSA 4BOHA 1FLEE 1KXCA 5A8XA 4QT8C 3SNCA 3KEEA 1NFXA 1E37B 1MKWH 1F0TA 1ELBA 4YOIA 3L3TA 4TYDA 1DWDH 3H7TA 1J14A 3Q77A 2XRCA 1O32A 1J9CH 3KGPA 3URDA 2XYAA 1JRSA 2SNVA 3RC5A 2RDLA 4DG4A 1SQRA 1PYTD 3GS9A 1FIWA 3BTHE 5AHGH 1GMDG 1YLCA 3B23B 2IJD1 3KL6A 2WZQA 1O0DH 3NZIA 1QJ6B 2HALA 3EYDA 1P12E 1X7AC 1XVOA 2TIOA 2OXSA 4YLUA 3SNBA 1UK2A 3LONA 1EPTB 1O36A 3FP8E 1WBGB 1MAXA 2STBE 4CRCA 1FPHH 2ZDNA 3MFJA 1ELVA 1EOJA 4H4FA 1OOKB 1MTNB 3QX5H 1O34A 4AB8A 4FU7A 1MCTA 1Y5UT 1XMNB 1C5RA 1S85A 3TGJE 4Y8ZA 2ODQA 3RMNH 2BX4A 2C3SA 1CSOE 1S6LA 1UCYH 1YBWA 4TY6A 3IWMA 1IOEA 1WSSH 1GI1A 3B9FH 5LPFA 1EB2A 2OINA 1BRAA 4ZKRU 1DWEH 2ZHFH 1V2PT 1QRZA 3OX7U 1WOFA 4WH6A 4NA8A 2VU8E 4ZHAA 1YPKH 1QY6A 4CBOA 4Q7XA 7GCHG 3EA8A 5E0JA 1LHCH 3RXPA 2WPMS 3EDXB 5T3HA 2GMTB 1GBEA 1LVYA 2I6QA 3SGQE 1T8MA 1EOLA 1H8HD 4OS5A 3UPEA 1BBRE 1BTUA 1ZTKA 4NFEA 2Z3EA 3DFJA 2UUFB 1RTFB 1C1MA 1N6YA 3SNDA 1J15A 2BY6X 3D49H 3MU8A 1EAIA 3P6ZB 3RXIA 4WXVA 1GHBG 1GCTC 2ZFTA 3EE0B 1GBBA 2G51A 1IQJA 2A0QB 1IQFA 3PV5A 2PLXA 2ZTYA 2KAIA 3TIUA 1FI8A 2WPIS 1ZTLA 1C5NH 1UK3A 1J16A 1UVTH 4GCHF 2G81E 5EU8A 3BIUH 1S0RA 3M5MA 1VR1H 1P04A 3SU3A 4NSYA 1E1QD 3GY7A 2O9QA 1E38B 3ZZAA 2XCNA 2ZGXH 3KCGH 3SJ9A 1Y5BT 1VZQH 3PRBA 1UVUH 1W0JD 3DFLA 3MO6A 4DW2U 5GCHF 3SO3A 3C1KA 3L33A 1XUGA 1HB0B 1ZSJA 2ZCHP 3OY6U 1OP2A 3RXTA 2HNTF 1V2UT 1W3CA 1ZOMA 4X2WA 5F8XA 2Z9LA 4Y8YA 2ZHQH 4UFFH 4TWWA 1B0FA 1O3AA 1TRYA 1O2JA 1PFXC 4OM9A 2SNWA 5JBAS 1EXFA 2BDHA 2P16A 3P8OA 3QO6A 3RU4T 2ZFPH 3CNRA 3PO1B 4JZIA 1A0JA 2GD4B 2FOMB 2FYRA 1A7SA 1VCPA 1GVZA 2SGQE 5C1UA 5J4SA 1N8OC 2FX6A 3GOVB 4CR5A 4B2CA 4MNVA 4ABFA 5E2PA 1TNJA 3ZZ9A 3D23A 3PWBA 1NESE 1H9IE 1Y59T 2XBVA 2ODPA 1YF4A 1XVMA 2Y81A 3AASA 4X1NU 1KLIH 5A8ZA 1VITH 1TBQH 1XUIA 4FUCA 2ZU4A 3HGPA 4UDWH 4AX9H 1T8LA 1A46H 1FQ3A 1QRWA 1UO6A 4WMFA 5A8YA 3ZZ6A 4E06H 3A80A 1PQ8A 3RXQA 2F9VA 3V13A 4ZH8A 1O2YA 1KXDA 3TNTA 1Z71A 1TMTH 2BOKA 5ABWA 1TIOA 4HZHA 1P9SA 8ESTE 3CS0A 1QB1A 2WPJS 1BBRK 1SHYA 3P8FA 1GBHA 1LMWB 3ZIAD 1V6DA 3DSOA 4NFFA 4JYTA 1UCYE 3SU2A 1NU7B 2Y5FA 2GDDA 4ACAA 1WUNH 3ZVFA 4Y6DA 4Z0KA 2BQWB 1MU8B 4OS6A 1AE5A 2GCHG 2BD9A 3F2HA 2WPLS 1UMAH 1PPZA 1O38A 5FAHA 3ZZ7A 5JYIA 1ANDA 3V3MA 2L74A 3AK5A 1Z6EA 1BTXA 1OPHB 3NRLA 5FPSA 5HIZA 2W7UA 2A5KA 4UONA 1O5BB 2FS9A 3A84A 4AYYB 2FTMA 3MU5A 1SFIA 1AVXA 4HI3A 4I8KA 3RXHA 2V0BA 1BZXE 3QN7A 3SV9A 2BM2A 3U8OH 2QF5A 2J97A 5GXPA 2A7HA 1A3EH 5FX5A 2WUCA 2BDAA 5L2YH 1TBZH 4A1XA 4WJG2 2RCEA 1DLEA 1V2MT 1BTPA 3NPSA 2ZTXA 3VFEA 2AIPA 5FCRA 5HYOA 1THRH 5BPEA 1JOUB 3QK1A 4K8YA 3F0OA 1O5GH 3MTYA 4FUBA 1O2NA 1ETTH 1O31A 2BQ6B 1W7XH 1TX6A 1F0UA 3GY5A 1HAYB 1WYKA 3RXCA 1ESAA 1LQEA 1OXGA 3BN9A 1GBMA 1FY5A 2F9BH 4FUIA 1RIWC 2OQUA 2VIQA 3OYPA 5EXMA 4K1SA 1UW7A 1FV9A 1W10U 3BEFB 3RUOA 2GCTB 2BLWA 2G5VA 3PV2A 1NPMA 1TABE 5KECA 2C8WB 5TCCA 2OTVA 2YMSC 1PYTC 2XW9A 2RG3A 3PMHB 1N6XA 2P93A 1NBME 5AF9H 4I8GA 3P70B 4R0IA 1MKXH 2R9PA 5JB9S 1GHWH 1ETRH 3TH2H 4INHA 1LQDB 5EOKA 1AWFH 2BMGB 4BAQB 5GWZA 2BZ6H 2ZHEH 1FXYA 1V2TT 1UCYK 3GCOA 3VB7A 4GHTA 1P03A 2JH6D 5EJLA 1UTPA 1QHRB 3ENSB 1O2PA 4CRGA 3MH4A 1RJXB 2A31A 1C5PA 3OTJE 4ASUD 2XNDD 2ZGCA 1ABIH 1SGCA 2F83A 2R3UA 3T62A 9LPRA 4Q2KA 3BV9B 2ZCLP 1IHTH 3AW0A 2A2QH 3KNXA 1ELTA 1BITA 4WF8A 3UNQA 5DP8A 1G3CA 1VKYA 4I32A 1A1RA 3PTNA 1HCGA 3WW7A 4DIHH 3VGCC 1MTSA 1AN1E 2I6SA 2KAIB 2W5EA 4KELA 4A5TS 4D76A 2P3FH 1P3EA 4KTSA 1EKBB 1ESBA 1WQSA 4H6SB 1CHOG 1RFNA 5JPMH 5CHAB 2G4TA 1GI2A 3BTDE 3HPTB 3SJKA 1TONA 3PM3A 1S6HA 1THSH 1C5VA 3FAOA 3H09A 3UOPA 4Y7BA 3RXGA 4GAWA 1C5WB 3A85A 5DP4A 2WV5A 2VIWA 1FPCH 5DKMA 1EPTA 1KSNA 3DCLA 2B7DH 3L6PA 3S9BA 1SGIB 5E0GA 1CA0C 1IQNA 3EE7A 5C5OA 1W7GH 2JETB 3Q76A 1W0ZU 2QY0B 2ZGJA 4Q80A 3ZVDA 2A4QA 1VJ9U 3DHKH 4ABDA 1KXAA 2VGCC 3SI3H 2BDBA 3ZZ5A 2O8TA 1SGRE 3GY6A 2PSXA 4A92A 2FOEA 2BYAX 1OWJA 4K2YA 3UREA 1SLVB 5C1XA 4Q7ZA 2J95A 2F9NA 1GI7B 4DT7B 4YOJA 5C0TA 5B6OA 3RXSA 4E7NA 1AB9B 4IBLH 3BTEE 5I46H 2A4GA 3S7KB 2L6OA 5C3NA 3SJOA 3TK9A 1SQAA 1A5HA 1KTTB 2Z7FE 4Y8XA 2H2ZA 2ILNA 4MDSA 4D8NA 2VWLA 1HAGE 2UWPA 2ZFSA 4O3TA 1ZHMA 5F6MA 3RXFA 3NK8A 3LU9B 4BTIB 2OBOA 4B2BA 2H5DA 3GDSA 3GY3A 5C2ZA 3QLPH 5EQQA 4CREA 3AVZA 1HDTH 4X8TH 1TE0A 5DJ7A 2SGDE 4X1PU 1AY6H 1SL3A 3SBKA 1H9HE 4XBCA 2A7CA 3HKJB 1NRSH 2B0FA 2AGEX 1SGPE 4X1SU 1XM1A 2SGFE 3OTPA 2TGPZ 1UHBA 3GY4A 1YY3A 3TLOA 1SGDE 1GBLA 4X0WU 2ZF0H 3GYLB 4Z6AH 4WY3A 1ARCA 1A5IA 1DUAA 1Y3XA 3BSQA 1XX9A 4ZKSU 3A82A 1E36B 1VCWA 1XKAC 4TY7A 3CP7A 4ISHH 5DP9A 1O2TA 1SC8U 3SUDA 4KTUA 3UAIC 2ZO3H 3ATLA 5FPTA 5HKKD 1PPBH 1C5QA 1YPJH 3FVFB 1QFKH 1Z8GA 4Q63A 4Q4LA 1ZRKA 4LZ1H 1G37A 1M9UA 3ATMA 2LELA 2QC2A 2VWNA 2ZP0H 2ULLA 2EI6A 1MD7A 4HTCH 5J4QA 2HLDD 5GDSH 2BD4A 1K2I1 1A4WH 3QTVH 1H9LB 4JZFH 3UQOA 3A8DA 3CS7A 3E6PH 1ZZZA 1CVWH 1ELDE 4FU9A 3DUXH 2A2XH 1PPFE 4NIXA 2PKAB 1RGQA 4YO9A 1UK4A 4K69A 2ZIQH 4DURA 1ZJDA 1JIMA 3UTUH 1O2XA 1GG6B 4RN6A 4AGKA 4UEHH 3T26A 4ZKNU 1GI0A 4F49A 3RXDA 2H6MA 1WU1A 4J1YA 2D26C 3U9AH 1UTNA 1SLUB 2M5TA 5A09A 1QBNA 3S69A 1G32B 1DSUA 4WVPE 1AZ8A 4LK4A 4X2XA 3UOUA 1O37A 1GMCG 1O2LA 1YYY1 4KTCA 3VPKA 3GDUA 3EQ0H 1MKXK 3EAJA 4JZEH 3RXOA 2QIQA 1QZ8A 2XWAA 1VGCB 2OD3B 1AE8H 4I31A 1EZUC 1F0RA 4X2YA 1VJAU 1QRXA 3A88A 1K9OE 4BTTB 2BVXH 3A7YA 1S5SA 1TMBH 5TJXA 4IMQA 2FPZA 1DXWA 1D3QB 1O2VA 1MAYA 3EA7A 3ELAH 1KTSB 4BXSA 1BQYA 1G2LA 4AB9A 3BTGE 3F3BA 1V2LT 1P2JA 3GYMA 1DWBH 4VGCC 3RC6A 1GHAF 4I8HA 2UWLA 4D9QA 4ABGA 4LOYH 1P3CA 4BXWA 3AAUA 4ASHA 4LXBH 3UUZA 4OS7A 1L4DA 1MTVA 1QIXB 2SGEE 1SHHB 4XRNA 1HRTH 2ZCKP 3P17H 3QGNB 1O2SA 5F03A 1V2WT 4NZLA 4AN7A 3W1EA 6CHAB 3ZZBA 3KYFA 1BRCE 1V2ST 1K21H 2A1DB 1ID5H 1E79D 3PLBA 2P95A 1SGNE 5C94A 1FAKH 4H42U 4NZQA 1AUTC 1P2OA 1SSXA 2YMSD 3MI4A 2WPHS 1O3PB 2AERH 1YWUA 1V2RT 1G2MA 1UTQA 1LVOA 1AFQC 2V35A 4JK5A 4AG1A 3GCHB 3JZ2B 4JCNA 4UFEH 4CRFA 1DPOA 4NIYA 2XWBI 2B8OH 3K2UA 3U8RH 2GGVB 1C2JA 3BTFE 3VB3A 1P9UA 4DY7B 3MMGA 3WWBA 2K0QA 3SJIA 1JRTA 3TVJB 1OP0A 3MH6A 1HPGA 4NWKA 1MQ5A 3SV8A 1MCVA 1OS8A 3PROA 3Q00A 2FO9A 1S82A 1W12U 1W13U 2ANYA 5GIBA 3N7DA 4B6EA 2H9HA 2V3OH 1YPGH 3KQ5A 2CK3D 5HM9A 2BLVA 1QL7A 3VXFH 1QCPA 5LPEA 1OHHD 3SNAA 3OFND 1VITF 1OWHA 1O5EH 3GCTG 3ZVGA 2FDAA 3C27B 1F5LA 3KQBA 1GGDB 1C5TA 2WV9A 3ESTA 1BB0B 1D3DB 1CHOF 1IQMA 1AIXH 4LZ4B 2Q6FA 4Z1MD 1LO6A 3VB6A 3UQVA 3SW2B 3TK5A 4IC6A 1S84A 2GDEH 1NRQH 1A61H 1RRKA 3SI4H 5IDKA 4XFQA 1GI9B 1GBAA 2ZPSA 1HFDA 1IQIA 3V12A 3WY8A 1D3PB 1EAXA 1FN6A 1QQ4A 2GZ9A 2V7QD 1SOZA 3M7UA 2P3UB 1C1WH 1BCUH 3M36A 3ZZ4A 5EPYA 4BAHB 1YPEH 4YT7H 3MHWU 1MBQA 3RP2A 5JB8S 3MNCA 1V2QT 5GNDA 1QR3E 3V7TA 4FUHA 4ESTE 1ZGIA 1JWTA 3SQHE 1C2KA 2UUJB 1OWEA 4OS1A 3A7XA 1QB9A 1GDQA 1UHBB 1P05A 2ZG0H 1C1OA 1DM4B 1QURH 5T6FA 5A2MH 1K0HA 1LPGB 1IHSH 1O3KA 3SQEE 1RTLA 1EAWA 4JZDH 3BEUA 3E3TA 2F4LA 2P8OC 3A8AA 2ZFFH 2QYIA 4B76A 6GCHG 1ZPCA 3MO3A 4WMDA 2AMQA 2Q6DA 1DFPA 1GBJA 3SUGA 1MH0A 2FOGA 8GCHG 4O03A 2NU2E 5L30H 1THPB 3I78A 3SZNA 3A7ZA 3TJNA 1FAXA 3GY2A 1OP8A 5EPNA 2ZU2A 1FNIA 1O39A 2ZPQA 4MPUA 1SVPA 3NUMA 1C4U2 1O5CB 1RTKA 3OU0A 3OAAD 1CU1A 2A4RA 4BAMB 2QXJA 1G30B 2CGAA 1LKAA 2QXIA 1Y3UA 2R0KA 4AC9A 3FOAA 1O3BA 1EJAA 1C4V2 3VXEH 5EQSA 1NFWA 1MD8A 1SPJA 1EZSC 1HAIH 5L2ZH 2AIQA 2KCPA 2OP9A 4ISNA 4WMEA 2BLOA 5EJ1A 3LPRA 3ATIA 4WWYA 5KGOA 1AUJA 2C90B 3Q3YA 1BRUP 1P57B 3LIWA 3SJ8A 4XOJA 1H1BA 3BF6H 3SHAH 2BTCE 2BXTH 1EPTC 1T32A 3F2FA 4YLQH 2LPRA 2GP9B 2J92A 4UD9H 4X8VH 2W7SA 1SG8B 3EGKH 1L0ZA 1ZHPA 1W8BH 3E0NB 3SORA 1MTNC 2PKSB 1TNKA 1SGEE 3U69H 1LPZB 3SYJA 2ANKH 3RXJA 5HXFA 2XBWA 1CT2E 2HVYB 1LTOA 2BY7X 4RSPA 1G3EA 1P0SH 4X2VA 2FOFA 2J2UA 1C2MA 2NU0E 5FCKA 1HJAB 1B5GH 1GI5A 3A8CA 1NN6A 4MLFB 4CHAB 3UWIA 4FVDA 2B9LA 1SBWA 3A7WA 1NM6A 4Y76A 1C1RA 3E0PB 1TRMA 2GX4A 3KIDU 1C5UA 2PGBB 5T6GA 1NRNH 1TGCA 4NCYA 2Z9GA 1IAUA 1TPOA 2GMTC 1O3FA 1K1PA 2FOHA 1Y3YA 4NSVA 3H7OA 3F1SB 1O2KA 5L6NH 4ISOA 4CRAA 5CDFE 1TLDA 1WAYB 3A81A 2H9EH 2HVXA 2EQNA 5A0BA 5DP3A 1IQKA 4F48B 1T4VH 1UTLM 2QN5T 4B1TA 1DSTA 2PKAA 4B6FA 4CR9A 4FOUC 4Y7AA 2QF3A 3FZDA 3F6UH 4K5ZA 2QCYA 1O5FH 1OWKA 2Y5GA 1GBCA 2V3HH 2XBXA 1O2MA 3MH5A 2XCFA 3PWCA 1K1OA 4U32A 5A0CA 2QA9E 3ZZ3A 1PJPA 2H9TH 4J2YB 1IQHA 4CRBA 2LP6A 2RDEA 3MNBA 4OGYA 2PTCE 2AYWA 2ZDVH 5FXLA 4ZXYH 3RXVA 1GDUA 3LJJA 3A7VA 3OEED 4RT0A 4DT4A 4RKOB 4NIVA 4X1QU 3O8CA 1SI5H 1GMHG 1PPGE 1GBTA 1T31A 3FZZA 3FN8A 3LGUA 8KME2 2YNBA 2OC0A 1TOMH 2BD8A 4JMYA 5SGAE 2HOBA 2ZHWH 2ZDAH 5AVDA 3I77A 3PLPA 3PO1C 1RS0A 2Z3CA 3ZVAA 1YLNA 4TPYA 1P8VC 3F9FA 1V2JT 1ELGA 2ZI2H 1BOQA 1HAHH 1G9IE 4MPWA 4DJZB 4F4OC 2IPHA 2WSSD 2KCYA 4CH8B 2Q1JA 5AFZH 1COWD 1L1JA 1MMJN 1O2WA 2F9OA 2BVSH 3Q3XA 1WV7H 3U98H 1XUHA 3W95A 1BTHH 3MYWA 3E8LA 5FL7D 1C5YB 4FU8A 1QA0A 3F9GA 4NG9H 5LGOA 2FM2A 1ARBA 1DS2E 1HJ8A 2C93B 2EI8A 2OC8A 3IG6B 4GPGA 1MBMA 5C20A 1AZZA 1GI6A 1SOTA 4X6OA 1GMDF 2WPKS 1Z6JH 1P01A 1W0YH 2BZAA 1CGHA 2H1UA 1ETSH 3PRDA 3HK6B 3PTBA 1B0EA 4FUDA 2A4OA 2KFWA 3M5OA 3TGIE 2Y5HA 5C1YA 1SGFA 2R2MB 1RD3B 1EJNA 2FXRA 1HAPH 3MWIU 1GVLA 2A45B 5H4IB 1ESTA 3QZQA 1TA6A 2AH4X 3VG8A 2BB4A 2EI7A 2P3TB 2CHAB 4ABHA 2ZFQH 1EP5A 3BG4B 4IN2A 5EG4A 1OX1A 3RXAA 1QTFA 5DGJA 4ZXXH 1TWXB 3SV7A 3RU4D 3A8BA 3U8TH 1AO5A 2QF0A 2ZECA 3PYHA 2RA0A 1P09A 1MZAA 1J17T 5EJZA 2WPDD 1YPMH 3MU1A 1V2NT 1DY8A 3MO9A 2G52A 2VWMA 5EXNA 2Z94A 1HLTH 1GJ5H 2A32A 1C5LH 3MQKC 1BTWA 1P2KA 2AGGX 7GCHF 2F3CE 1O3NA 4U30A 2GZ8A 3GCTF 2JIZD 1O35A 4X8SH 1XUJA 3S0NA 1WCZA 1GVKB 3T2NA 1AQ7A 3KN2A 3H5CB 4MVNA 1Z1IA 2G5NA 3F68H 3RXUA 1BHXF 4GCHG 1GDNA 1O2IA 4KP0A 1XXFA 1FZZA 1GJ7B 1TQ0B 2VIOA 4IC5A 2Y82A 4K8BA 4JYVH 4I7YH 1GHBF 2ZDMA 3LGTA 2P59A 2AHME 2ANMH 1BDAA 3ODDA 4TSFD 1T8NA 1HAOH 1L2EA 2GCTC 5GCHG 1LHDH 1CBWB 4DCDA 3MU4A 5JBBS 1ZSLA 2YNAA 3ODFA 5DO4H 7ESTE 1FONA 1HIAA 2GKVE 3CENA 1GBKA 1GPZA 2VJ1A 2QXGA 1TOCB 4FUEA 4YXWD 2C4FH 2XXLA 2FI4E 3D62A 1O5DH 1D6WA 3T27A 4IGDA 1G3DA 1LHEH 2J9NA 1O3DA 1C2GA 1K1IA 1AI8H 2ZZUH 1CGIE 1BJVA 3E90B 1MQ6A 4M9FA 2W26A 1QNJA 8GCHF 1KDQA 3A87A 3F2GA 1GJDB 3NCLA 5AFYH 3GY8A 1P2MA 1U6QA 5LH8A 1GJ9B 2THFB 1W11U 2ZGHA 2R3YA 2R2WU 2ZEBA 1PPCE 2KR7A 3MU0A 5ESBA 4Y0YE 1YCPH 2AGIX 1Q31A 1H8DH 3IITA 3DSPA 2Z9IA 3BTWE 2PR3A 1DUEA 4FVBA 2QXHA 2ZDLA 1CE5A 1Y3WA 1K28D 1TGSZ 4WXIA 4B75A 2O8MA 2Z6BD 2Z9JA 4XBBA 2HLCA 3B8JA 1LVMA 1O3IA 1GL0E 3TJUA 5DN6D 2EEKA 5GPIB 2O8WA 2FI3E 3UY9A 4IMZA 3PMBB 1SLWB 3S9AA 2ZKSA 1O2QA 1J8AA 2STAE 4UFDH 2JH0D 2UUYA 1BRBE 3BTTE 4B2AA 1SR5C 2PTNA 4ZROA 1S81A 1YC0A 2HWLB 2QV1A 3M3TA 4NWLA 2BY8X 2GT8A 1QJ1B 3FP6E 1DOJA 1KLJH 2PHBA 4A7IB 1LHGH 5CHAC 4ACBA 4AGJA 3ATKA 1P02A 1HXFH 4MTBA 1TX7A 1EZXC 1YGCH 1YLDA 1ZPZA 4JK6A 5E8EH 1TGBA 2GCHF 3PMJA 1ZLRA 1GCDA 1OKXA 1F5RA 1O2RA 5EW2H 1O33A 4IW4E 1WTGH 1SGTA 2W6JD 2JJ2D 3QDZB 3SU5A 3TNSA 2GT7A 3TH4H 5DSFA 1YKTA 1IQEA 1KLTA 2JETC 2WHXA 1TAWA 3BEIB 3RLWH 2B5TB 1C2IA 1CT0E 3PLKA 1HGTH 3UFAA 2KX4A 2XBYA 1BTZA 1CGJE 1CQQA 1GJAB 1Z8RA 2J5UA 4ISLA 1TNGA 4I8LA 1GCTB 1DANH 4X6NA 4BAOB 4ZHMU 5DK1A 2OUAA 4AFZA 2W3KA 3BTKE 3KQEA 4YM9A 6LPRA 5E0HA 4YT6H 3M3SA 3S7HB 3MNSA 2ZA5A 5KEDA 2W3IA 1AB9C 1GBFA 5ESTE 4XE4A 3QGJA 4YESB 1YM0A 5K0HA 4D7FA 4U2WA 4AFUA 2J98A 1E34B 1O5AB 3HATH 1OWDA 5IYTA 2BD2A 1JBUH 4B73A 2VVUA 4K3JA 1DE7H 2JDID 2TPIZ 3RDZA 1GBIA 1UVSH 4DVAU 4GUXA 2HRVA 1EJMA 4ZHLU 4INKA 3RMLH 1NRPH 2G00A 5HGGA 1XUFA 2BX3A 3E91A 1C1TA 2TRMA 3DT0H 4P00A 3ZZ8A 3ZV8A 1E0FD 2XC0A 1BT7A 4RT1A 3O8RA 3GCNA 1ACBE 1F2SE 1EP6A 1H4WA 5A0AE 3LDXH 1HBTH 2AFQB 2QAAA 1ABJH 2OC1A 2PP6A 2RA3A 3TK6A 2JJ1D 1N8OB 2ASUB 2Y80A 1KXEA 2TGDA 1WXRA 1C2HA 1DVAH 2TBSA 2KCOA 2JKHA 3SNEA 4ZKOU 1NTPA 2BXUH 4MQAA 3F9HA 3U1IB 3U1JB 2A7JA 2BVRH 4BTUB 2ESTE 3LOXA 2PFEA 4F55A 1KY9A 1S6FA 4SGBE 1NFUA 1TMUH 1DX5M 4OGXA 1KIGH 3O8BA 5T6DA 3SU6A 1OYTH 3P95A 3ZZCA 2BQ7B 1UTMA 1W0KD 1YPHC 1ZPBA 1UTJA 1SB1H 1AU8A 1PPHE 4AZ2B 3SV2H 5EGMA 3RC4A 4X1RU 4U01A 1AMHA 2DE8A 3DD2H 2TGTA 3RM0H 2LNCA 1C2EA 4NGAH 2ZFRH 4AOQA 1C5XB 2DE9A 1GG6C 3M37A 1LCYA 1BJUA 2D8WA 2FTLE 1F5KU
chains in the Genus database with same CATH topology
1Y8TA 3QUMP 1SMFE 4BNRA 3MNXA 1C5MD 3E1XB 1HIAB 2TGAA 1ZMNA 1SGYE 4YZUA 1D4PB 2FIRH 1DITH 3SUFA 4OS4A 4X8UH 5F8TA 1NROH 3A7TA 4KKDA 5I25A 1DICA 3ZYDA 2XTTB 2WYGA 4E05H 1DXPA 2GVFA 1XXDA 3E16B 1QL8A 1EATA 1VGCC 3TH3H 4ABJA 2WINI 1KDQB 1A0LA 3BTME 1PQ7A 2BD7A 1EASA 5BRRE 1XKBC 2NU1E 1ELAA 5FX6A 1GHYH 3SGAE 2P94A 1Z8IB 1LHFH 3K6YA 1C9PA 1ZHRA 3RU4E 1DDJA 1GWAA 1RIWB 2ZNKH 2J94A 2BHGA 2BDYA 1TNIA 1YCPK 1ZJKA 1T4UH 3DA9B 2VIDA 2GV7A 1O3CA 2FYQA 1ZR0A 1YPHE 2VINA 3Q3KA 3VEQB 4X6PA 2BOHB 4K60A 1FUJA 1O3GA 4X6MA 4YTAA 1HAVA 6CHAC 1UJ1A 1ZMLA 4THNH 2VH6A 1GL1A 2WUBA 1GJCB 2SFAA 2Q6GA 1A2CH 1H8IH 2VB0A 3LH1A 1EQ9A 1GJBB 1OYQA 1NU9A 5FBEA 1FY4A 2PWXA 3UWJH 3K65B 2ANWA 2Y6TA 4TWYA 2J34A 1CA8B 1HUTH 1MU6B 5E2OA 5DPAA 2OQ5A 5FPYA 3LJOA 1G3BA 1DLKB 1UTKA 1O2HA 8LPRA 4FXGH 3LKWA 1ZSKA 2D1JA 3T25A 1BMAA 2IN2A 2ZGBH 2VWOA 4XSKU 4XDEA 1ELFA 1C1UH 3ZVBA 3GCHC 5G4BA 2FESH 2BD5A 2OBQA 3RXLA 3VB5A 1D9IA 1ZYOA 1TPAE 3RM2H 1L1NA 2UWOA 2F9PA 1V2VT 2FOAA 1C5SA 2EA3A 3ZV9A 3HKIB 5DG6A 1W2KH 3UIRA 4O9VA 1ZTJA 1NRRH 1C1SA 3SGBE 3GDVA 4I33A 1VCQA 5F8ZA 3FANA 3VGCB 1HAZB 4ZAEA 4H6TA 1K1LA 1ZGVA 2ZQ2A 1C1NA 1FY8E 3AW1A 5ETXA 5HM2A 3URCA 2BLQA 5JBCS 2ZWLH 1TYNA 2PGQB 5GJ4B 1O2GH 4Q7YA 3P92A 1MZDA 1GGDC 5JBTA 3LC3A 1K1JA 1AGJA 3OSYA 3STIA 2FLBH 1P2NA 4BANB 3P8NA 2SGPE 4AFQA 1GI3A 1CA0B 5EW1H 1T8OA 5JDUB 1DT2A 1C2LA 4YOGA 1SQTA 5CMXH 4TPIZ 1C2FA 1Q3XA 2BY9X 4NIWA 1GJ4H 2F91A 1NZQH 3PMAB 3RXRA 2VGCB 1AKSB 4MNYA 1GMCF 4Y10E 1Z7KA 4GHQA 2Z9KA 3TJVA 5K7RA 1HV7A 1E35B 2IJOB 1TNHA 2VNTA 1TPPA 1O3OA 1D6RA 1FY1A 1C5OH 1G36A 1C1VH 1SGFG 3BIVH 1GHAG 1P06A 3FFGA 2CV3A 4HFPB 1MKWK 1D3TB 1Y5AT 4K1TA 3SU1A 4CRDA 3LGYA 3M5NA 3RXBA 3RMMH 3O8DA 1W14U 2GZ7A 2K1QA 4INLA 3LGIA 2NWNA 2J4IA 3PB1E 1XUKA 2BDCA 1BMMH 4RKJB 4IN1A 3T29A 3ZYEA 4K1EA 3A89A 2FWWA 2HPPH 1O3JA 2PUXB 3A86A 2CF9H 3NXPA 7KMEH 3AAVA 1BMLA 2FODA 1EZQA 2VVCA 4MPVA 2NU4E 2HNTC 3LH3A 3STJA 3NWUA 1GI4A 3KHVA 2PSYA 2BDGA 3SV6A 1NO9H 2J38A 2ZU3A 1MTUA 4NA9H 2Z3DA 1UVOA 2ZQ1A 1K1MA 1YPLH 3RXMA 1NC6A 1TX8A 1ZRBA 1GHXH 1CT4E 4IS5A 1OWIA 3I29A 3M3VA 3SOSA 3ZVEA 3EA9A 5LPRA 2FEQH 2VIVA 3QTOH 1P10A 1Z1JA 2DUCA 2ZPRA 2A5IA 1F92A 1IQLA 1MUEB 4CBNA 1INCA 1P2QA 1PPEE 1EUFA 2PKSC 4A1VA 3ZZDA 4JYUH 4DOQA 1QBVH 1Y3VA 4B74A 1C5ZB 1ANEA 2PW8H 4GVUA 1HYLA 2GTBA 4B71A 1P11E 1O2OA 1KXFA 3TPIZ 1C9TA 1O2UA 1VITG 1AHTH 2CMYA 1QQUA 1LVBA 3TU7H 1QGFA 1QB6A 2F9UA 1QA7A 1HJAC 1ELEE 3K9XB 4CHAC 1NY22 3M5LA 5HMAA 1EX3A 3R0FA 3R3GB 3RXKA 1HAXB 4E7RG 2BD3A 1B7XB 3ZVCA 1PQAA 2ZTZA 1KXBA 4O3UA 1FY3A 1RXPA 1TFXA 4ABBA 2OLGA 1CO7E 4AG2A 2BDIA 1TQ7B 1HAVB 1C1QA 2SGAA 1BA8B 5EQRA 1WTHD 2HNTE 1GJ8B 3GISB 3RLYH 4DIIH 4ISIH 2XNIA 1DY9A 1Q2WA 1A5GH 4NA7A 2AMDA 3M7TA 4OS2A 5FBIA 2HGTH 1IQGA 1O30A 2BY5X 2VH0A 2FOCA 1A0HB 1P2IA 1ZMJA 2V6NA 3M7QA 3V0XA 3UNSA 2CF8H 3T5FH 2ZHDA 2IOTA 3N7OA 3LT3A 2G8TA 1CHGA 2AMPA 1NS3A 4GLYA 4JZ1A 4ZMAH 2QGRA 1TA2A 1O3LA 1GBDA 1BHXB 5C5NA 4BAKB 1EAUA 4AORA 4XBDA 2NU3E 4HGCA 1N1LA 1SGQE 1FJSA 3SU0A 2D2DA 4VGCB 4Y71A 1C1PA 1QL9A 3SUEA 1C2DA 3KQDA 3OY5U 1ORFA 2A5AA 2FP7B 1HNEE 2C8ZB 3S9CA 3SHCH 2ZU5A 1K22H 1HXEH 6GCHF 2ZDKA 4R8TB 2FS8A 2FMJA 4SGAE 4D7GA 1FIZA 3UR6A 1WQVH 2AS9A 1TRNA 3A83A 1O2ZA 2AEIH 4UE7H 3SU4A 1S0QA 2WV4A 3F9EA 5C67A 4MG3A 1V2KT 2H5CA 1FDPA 1NFYA 1S83A 1HJ9A 1SFQB 1EB1H 2OC7A 4O97A 2ZU1A 1NT1A 4WH8A 1QJ7B 4MNWA 3T28A 1AFQB 2FLRH 2FX4A 4M7GA 1T7CA 1QBOA 1F7ZA 3RMOH 1BTYA 5CE1A 1JXPA 1TGTA 4ABEA 1BIOA 3ITIA 4Y79A 3BG8A 1ELCA 3TGKE 2CJIA 5TCAA 2PUQH 3NKKA 1K1NA 4FUFA 1V2OT 1AD8H 4PROA 7LPRA 2R0LA 3ATWA 5DP7A 4AFSA 2GV6A 5DP5A 1MTWA 6ESTA 9ESTA 2CHAC 1L1GA 4FUGA 3BG4C 3K6ZA 3M35A 1PQ5A 3W94A 1AVGH 1V3XA 1SQOA 3P8GA 1LKBA 1OSSA 1O3MA 2Y7XA 2WYJA 2EC9H 3LC5A 4DGJA 2CN0H 3KQCA 4A6LA 3M61U 1TNLA 2O8UA 1YP9A 1BUIA 1GJ6A 4ABAA 2G55A 1AFEH 3D65E 2CXVA 2FI5E 1ANCA 3MH7A 2YOLA 1TBRH 1TGNA 4A1TA 2ZC9H 2Y7ZA 4ZUHA 4UFGH 5EODA 1SLXB 4Y11E 3LGWA 1UTOA 1BBRH 1C4Y2 2VIPA 3KF2A 3QZRA 3RXEA 1FMGA 2ODYB 2HPQH 1AWHB 1O3HA 3LGVA 1GI8B 4CH2B 2ALPA 3SN8A 1A3BH 2VVVA 2XC5A 1JIRA 2PV9B 3GICB 2ALVA 2FZZA 1BMNH 1L4ZA 1O3EA 1Z8JB 3JZ1B 4AYVB 3UNRA 1GHVH 2FOBA 1DWCH 3QWCH 3VB4A 3PV4A 2OCVB 5FHTA 1UVPA 3TJOA 1CBWC 4I8JA 1GHZA 1F0SA 1KYNA 1LDTT 1AVWA 3HK3B 4FUJA 1TALA 1TB6H 2G4UA 3G01A 2O8LA 2P8OB 4MPXA 5EXLA 3MOCA 3TITA 4MNXA 2XC4A 1JMOH 2C8XB 2UUKB 1LPKB 3HGNA 5DP6A 3FP7E 4ABIA 4D9RA 1YCPM 3UR9A 2JH5D 1AKSA 4KGAA 2C8YB 1FN8A 3BTQE 1ANBA 1GMHF 4GSOA 4Y0ZE 5PTPA 4BOHA 1TPSA 1FLEE 1KXCA 5A8XA 4QT8C 3SNCA 3KEEA 1NFXA 1E37B 1MKWH 1F0TA 1ELBA 4YOIA 3L3TA 4TYDA 1DWDH 3H7TA 1J14A 3Q77A 2XRCA 1O32A 1J9CH 3KGPA 3URDA 2XYAA 1JRSA 2SNVA 3RC5A 2RDLA 4DG4A 1PYTD 1FIWA 3BTHE 5AHGH 1GMDG 1YLCA 3B23B 3KL6A 1O0DH 3NZIA 1QJ6B 2HALA 3EYDA 1P12E 1X7AC 1XVOA 2TIOA 2OXSA 4YLUA 3SNBA 1UK2A 3LONA 1EPTB 1O36A 3FP8E 1WBGB 1MAXA 2STBE 4CRCA 1FPHH 2ZDNA 3MFJA 1ELVA 1EOJA 4H4FA 1OOKB 1MTNB 3QX5H 1O34A 4AB8A 4FU7A 1MCTA 1Y5UT 1XMNB 1C5RA 1S85A 3TGJE 4Y8ZA 2ODQA 3RMNH 2BX4A 2C3SA 1CSOE 1UCYH 1YBWA 4TY6A 3IWMA 1IOEA 1WSSH 1GI1A 3B9FH 5LPFA 1EB2A 2OINA 1BRAA 4ZKRU 1DWEH 2ZHFH 1V2PT 1QRZA 3OX7U 1WOFA 4WH6A 4NA8A 2VU8E 4ZHAA 1YPKH 1QY6A 4CBOA 4Q7XA 7GCHG 3EA8A 5E0JA 1LHCH 3RXPA 2WPMS 3EDXB 5T3HA 2GMTB 1GBEA 1LVYA 2I6QA 3SGQE 1T8MA 1EOLA 4OS5A 3UPEA 1BBRE 1BTUA 1ZTKA 4NFEA 2Z3EA 3DFJA 2UUFB 1RTFB 1C1MA 1N6YA 3SNDA 1J15A 2BY6X 3D49H 3MU8A 1EAIA 3P6ZB 3RXIA 4WXVA 1GHBG 1GCTC 2ZFTA 3EE0B 1GBBA 2G51A 1IQJA 2A0QB 1IQFA 2PLXA 2ZTYA 2KAIA 3TIUA 1FI8A 2WPIS 1ZTLA 1C5NH 1UK3A 1J16A 1UVTH 4GCHF 2G81E 5EU8A 3BIUH 1S0RA 3M5MA 1VR1H 1P04A 3SU3A 4NSYA 3GY7A 2O9QA 1E38B 3ZZAA 2XCNA 2ZGXH 3KCGH 3SJ9A 1Y5BT 1VZQH 1UVUH 3DFLA 3MO6A 4DW2U 5GCHF 3SO3A 3C1KA 3L33A 1XUGA 1HB0B 1ZSJA 2ZCHP 3OY6U 1OP2A 3RXTA 2HNTF 1V2UT 1W3CA 1ZOMA 4X2WA 5F8XA 2Z9LA 4Y8YA 2ZHQH 4UFFH 4TWWA 1B0FA 1O3AA 1TRYA 1O2JA 1PFXC 2SNWA 5JBAS 1EXFA 2BDHA 2P16A 3P8OA 3QO6A 3RU4T 2ZFPH 3PO1B 4JZIA 1A0JA 2GD4B 2FOMB 2FYRA 1A7SA 1VCPA 1GVZA 2SGQE 5C1UA 5J4SA 1N8OC 2FX6A 3GOVB 4CR5A 4B2CA 4MNVA 4ABFA 5E2PA 1TNJA 3ZZ9A 3D23A 3PWBA 1NESE 1H9IE 1Y59T 2XBVA 2ODPA 1YF4A 1XVMA 2Y81A 3AASA 4X1NU 1KLIH 5A8ZA 1VITH 1TBQH 1XUIA 4FUCA 2ZU4A 3HGPA 4UDWH 4AX9H 1T8LA 1A46H 1FQ3A 1QRWA 1UO6A 4WMFA 5A8YA 3ZZ6A 4E06H 3A80A 1PQ8A 3RXQA 2F9VA 3V13A 4ZH8A 1O2YA 1KXDA 3TNTA 1Z71A 1TMTH 2BOKA 5ABWA 1TIOA 4HZHA 1P9SA 8ESTE 3CS0A 1QB1A 2WPJS 1BBRK 1SHYA 3P8FA 1GBHA 1LMWB 1V6DA 4NFFA 4JYTA 1UCYE 3SU2A 1NU7B 2Y5FA 2GDDA 1WUNH 3ZVFA 4Y6DA 4Z0KA 2BQWB 1MU8B 4OS6A 1AE5A 2GCHG 2BD9A 2WPLS 1UMAH 1PPZA 1O38A 5FAHA 3ZZ7A 5JYIA 1ANDA 3V3MA 1Z6EA 1BTXA 1OPHB 5FPSA 2W7UA 2A5KA 4UONA 1O5BB 2FS9A 3A84A 4AYYB 2FTMA 3MU5A 1SFIA 1AVXA 4HI3A 4I8KA 3RXHA 2V0BA 1BZXE 3QN7A 3SV9A 2BM2A 3U8OH 5GXPA 2A7HA 1A3EH 5FX5A 2WUCA 2BDAA 5L2YH 1TBZH 4A1XA 4WJG2 2RCEA 1DLEA 1V2MT 1BTPA 3NPSA 2ZTXA 3VFEA 2AIPA 5FCRA 5HYOA 1THRH 5BPEA 1JOUB 3QK1A 4K8YA 1O5GH 3MTYA 4FUBA 1O2NA 1ETTH 1O31A 2BQ6B 1W7XH 1TX6A 1F0UA 3GY5A 1HAYB 1WYKA 3RXCA 1ESAA 1LQEA 1OXGA 3BN9A 1GBMA 1FY5A 2F9BH 4FUIA 1RIWC 2OQUA 2VIQA 3OYPA 5EXMA 4K1SA 1FV9A 1W10U 3BEFB 3RUOA 2GCTB 2BLWA 2G5VA 1NPMA 1TABE 2C8WB 5TCCA 2OTVA 1PYTC 2XW9A 2RG3A 3PMHB 1N6XA 2P93A 5AF9H 4I8GA 3P70B 4R0IA 1MKXH 2R9PA 5JB9S 1GHWH 1ETRH 3TH2H 4INHA 1LQDB 5EOKA 1AWFH 2BMGB 4BAQB 5GWZA 2BZ6H 2ZHEH 1FXYA 1V2TT 1UCYK 3GCOA 3VB7A 4GHTA 1P03A 2JH6D 1UTPA 1QHRB 3ENSB 1O2PA 4CRGA 3MH4A 1RJXB 2A31A 1C5PA 3OTJE 2ZGCA 1ABIH 1SGCA 2F83A 2R3UA 3T62A 9LPRA 4Q2KA 3BV9B 2ZCLP 1IHTH 3AW0A 2A2QH 3KNXA 1ELTA 1BITA 4WF8A 3UNQA 5DP8A 1G3CA 4I32A 1A1RA 3PTNA 1HCGA 4DIHH 3VGCC 1MTSA 1AN1E 2I6SA 2KAIB 2W5EA 4KELA 4A5TS 4D76A 2P3FH 1P3EA 4KTSA 1EKBB 1ESBA 1WQSA 4H6SB 1CHOG 1RFNA 5JPMH 5CHAB 2G4TA 1GI2A 3BTDE 3HPTB 3SJKA 1TONA 3PM3A 1S6HA 1THSH 1C5VA 3FAOA 3UOPA 4Y7BA 3RXGA 4GAWA 1C5WB 3A85A 5DP4A 2WV5A 2VIWA 1FPCH 5DKMA 1EPTA 1KSNA 2B7DH 3L6PA 3S9BA 1SGIB 5E0GA 1CA0C 1IQNA 5C5OA 1W7GH 2JETB 3Q76A 1W0ZU 2QY0B 2ZGJA