1D6TA

Rnase p protein from staphylococcus aureus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
117
Chain Sequence
b'MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE P
publication title The structure of ribonuclease P protein from Staphylococcus aureus reveals a unique binding site for single-stranded RNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 19
structure length 117
sequence length 117
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1d6tA00
2UU9I 1B62A 3M6AA 5BR8I 4FWDA 1S16A 2DEIA 2R42A 3HULA 1HNXE 4LF6I 1XNQE 2BV3A 4EMDA 4DPYA 1PVGA 2NPFA 4LFCE 4B3MI 1HNXI 4R1FA 2ZM6E 5GMDA 4LFCI 1Z0WA 1FI4A 2ZM6I 3J7AG 4JI8I 4USMA 4JI4E 5A2QC 4LFAI 4YY3I 2VQFI 1EI1A 4AQYE 4JI4I 1NHHA 4DV3E 1Z0VA 3J7AM 2R3VA 1J5EE 4DR7E 3LPSA 1ZM3A 4AQYI 3T1HE 4X65E 4DV0E 4DV3I 2V34A 1IBKE 3CWVA 1N36I 4MYTA 4PRVA 1N34I 1J5EI 4DR7I 2AJ4A 4JI7I 4X65I 1KKHA 1IBKI 1Z0TA 3OTOI 2UXDE 4JI1I 4DPWA 2HKJA 4Z7YA 3H4LA 4LF7E 2HHHE 1PIEA 4DPXA 2BM0A 1Z0EA 4X66E 4URLA 4DV2E 2UUAI 1H7UA 1MG7A 3WU4A 3B78A 1Z5CA 3JAMQ 4LF7I 2BM1A 1XHKA 3T1YE 3WU6A 1H74A 1S4EA 1ELOA 4DV2I 4DV6E 1HR0I 2X36A 1Z5BA 1N32I 4XTJA 1FWKA 4LF8E 1FKAE 4KQVA 4X62E 2HK3A 1ZM9A 4ZVIA 2UXBI 3T1YI 4DV6I 4LF5E 4LF8I 5BR8E 4JI5E 4OX9I 4HACB 4X62I 4LF6E 4WUCA 4DV1E 2GS8A 1MX0A 3QT8A 4Z7CA 4KHPE 4B3ME 4JI5I 4DV1I 2V2ZA 4P7AA 1KIJA 2X7IA 4KHPI 2VQEE 1D6TA 1H7SA 4K0KE 4JI8E 3J81Q 5IT9Q 4DR4E 1PKPA 1KVKA 2UUBI 4LFAE 3ZZUA 4YY3E 2VQEI 2VQFE 4DV5E 1Z59A 4K0KI 4DR4I 2UUCI 1NZ0A 1Z0BA 2OI2A 1N0UA 2F4VI 4DV5I 2E1RA 1N36E 1N34E 2A2CA 4M1KA 1IBMI 4B3SI 3B82A 1XNRE 4JI7E 4NXME 4DV7E 1XNRI 3K17A 3OTOE 3B8HA 4B3TE 4JI1E 1XMOE 4NXMI 1ZXNA 4B3RE 1XMQI 1FWLA 4DV7I 4B3TI 2UUAE 3QT5A 1XMOI 4DPTA 4DV4I 1UEKA 3J81C 4B3RI 3Q1QA 1Z0GA 3V2UC 1HR0E 1N32E 1KTVA 1HNZI 4GKJE 2UXBE 4FWHA 3QT7A 3PYGA 1FNMA 4FN5A 2HFUA 3LTOA 4MYUA 3V5RA 3ZZ0A 4OX9E 1HNWI 4JI2E 1Z5AA 4GKJI 4ED4A 3GONA 5A2QQ 4JI2I 1NHIA 2LJPA 2HKEA 2XEXA 5LMUI 4DR6E 4DUYI 4PU9A 4DR1E 4DU8A 5FLXQ 4X64E 5LL6R 4LFBE 1BKNA 3QT6A 4DUZE 1H72C 4LF5I 4FWGA 4DR6I 1QZRA 4DR1I 2UUBE 3D4JA 4X64I 4LFBI 4DUZI 4JI3E 3ZM7A 1B63A 2UUCE 1K47A 5LMNE 3PYEA 1IBLI 2V2QA 4JI3I 2F4VE 3ZKBA 3JAMC 5IWAE 4JI0E 4JI6E 5LMNI 4DR2E 1XNQI 4DU7A 1IBME 4B3SE 2HFSA 1DARA 1I94E 1RR9A 4JG4A 2ZITA 1U2RA 5IWAI 4JI0I 4JI6I 4DR5E 1A6FA 4DR2I 2ZBKB 2WW4A 1N33E 3LNUA 4HXZA 1I94I 3ZZTA 4PRXA 4DR5I 2Q2EB 1N33I 2UXCE 1XMQE 2V8PA 1EA6A 1H73A 5FLXC 3F0NA 4DV4E 3J80Q 1ZXMA 1WUUA 4NXNE 2UXCI 4UTGA 2E5LE 3PYFA 4DXLA 4DR3E 4P52A 1HNZE 4I3HA 4YHHE 5IT9C 4NXNI 2E5LI 4DR3I 4FW9A 3T1HI 4DV0I 4WUBA 5L3JA 4USKA 4YHHI 1HNWE 1NHJA 3ZKDA 2DEJA 4DPUA 4JYAE 2A2DA 3WU5A 4HY1A 4GKKE 2CZ9A 1Z0CA 4JYAI 2UXDI 1N0VC 4LF4E 1FJGE 4JV5E 5LMUE 4GKKI 4DUYE 1ZM4A 2VF3A 2V2VA 1OJ4A 2HHHI 2EFGA 4UT4A 4X66I 4LF4I 3PYDA 4HACA 1FJGI 4JV5I 4LF9E 1VISA 4HYMA 2HK2A 4RPFA 2UU9E 3K1JA 3J80C 5GMEA 3WU3A 2J7KA 4LF9I 1RREA 4WUDA 1IBLE 1MU5A 1ZM2A
chains in the Genus database with same CATH superfamily
1Y6ZA 2UU9I 1B62A 3M6AA 5BR8I 4FWDA 1S16A 4FW6A 2DEIA 5K36D 2R42A 3HULA 1HNXE 4LF6I 1XNQE 2BV3A 4EMDA 4LPFA 1PVGA 4DPYA 2NPFA 4LFCE 4B3MI 2JEAA 2CG9A 1HNXI 4R1FA 2ZM6E 2JE6B 5GMDA 3CDIA 4LFCI 1Z0WA 5JEAD 4OO1D 1FI4A 2JEAB 5EKWA 2ZM6I 3HKMA 2NN6F 3J7AG 4JI8I 4USMA 4JI4E 5A2QC 4LFAI 4YY3I 2VQFI 4U3DA 1OYSA 1EI1A 2BA0G 4AQYE 4JI4I 1NHHA 3KRNA 4DV3E 1Z0VA 3J7AM 5C0XF 2R3VA 1J5EE 3L7ZA 4IFDE 4DR7E 3HJCA 3LPSA 1ZM3A 2Z5CA 4AQYI 3T1HE 2Z5EA 4X65E 4DV0E 4DV3I 2V34A 1UDNA 1IBKE 4MQYA 3CWVA 4QNKA 1N36I 5K36E 4MYTA 4PRVA 1N34I 1J5EI 4DR7I 2AJ4A 4MDTA 3L7ZB 5DRQA 3Q6NA 4JI7I 4X65I 2Z5CB 2Z5BA 1KKHA 1IBKI 1R6LA 2BA0D 3P3EA 1Z0TA 3OTOI 2UXDE 4JI1I 4DPWA 2HKJA 5JEAE 4OO1E 4IZJA 2Z5BB 4Z7YA 3H4LA 2GQ0A 1UDOA 4LF7E 2HHHE 1PIEA 4J3DA 4DPXA 1VI7A 1Z0EA 2BM0A 3CDJA 4URLA 4X66E 4DV2E 2UUAI 1H7UA 4AM3A 1MG7A 3WU4A 4LCGA 3B78A 2O1UA 1Z5CA 2PO0A 3JAMQ 4IZJB 4LF7I 5K36A 2BM1A 1XHKA 3T1YE 3WU6A 1H74A 1S4EA 1ELOA 4DV2I 4DV6E 4FW5A 1HR0I 2X36A 1Z5BA 1N32I 4XTJA 1FWKA 4LF8E 1FKAE 4KQVA 4FW3A 4X62E 2HK3A 3PRYA 1ZM9A 2NN6D 4ZVIA 2UXBI 2PO0B 3T1YI 4OZEA 1UDSA 5K36B 2WP8A 4DV6I 4ISAA 4AIDA 4LF5E 1R6MA 4U3BA 3M85D 5BR8E 4LF8I 4JI5E 4OX9I 2JT2A 4HACB 4OO1A 5JEAA 4X62I 4LF6E 4WUCA 4DV1E 2GS8A 5ELWA 1MX0A 3QT8A 4Z7CA 2WP8B 4KHPE 5C0XD 4B3ME 4JI5I 3PS2A 4DV1I 5JEAB 4OO1B 5K36C 2C39A 2V2ZA 3P3GA 4P7AA 1KIJA 2X7IA 4KHPI 5DNXA 1Y4SA 2VQEE 1D6TA 1H7SA 4K0KE 4JI8E 3J81Q 5IT9Q 4DR4E 1PKPA 2VESA 1KVKA 2PNMA 2C39B 2UUBI 4LFAE 3ZZUA 4YY3E 2VQEI 2VQFE 4LCHA 5JEAC 4OO1C 2O1VA 4AIMA 4DV5E 1Z59A 4K0KI 4DR4I 2UUCI 1NZ0A 1Z0BA 2OI2A 2NN6E 1N0UA 2J65A 2F4VI 4DV5I 2E1RA 3PS3A 3PS1A 5DRRA 1N36E 1N34E 3DD6A 2A2CA 4M1KA 1IBMI 4B3SI 3B82A 1XNRE 4JI7E 5C0XE 4NXME 4DV7E 1XNRI 2AE8A 3K17A 3OTOE 3B8HA 4B3TE 2IOQA 4JI1E 1XMOE 5DNLA 4NXMI 1ZXNA 5K36F 4B3RE 1XMQI 1FWLA 4DV7I 2NN6A 4B3TI 2UUAE 3QT5A 1XMOI 4DPTA 4DV4I 1UEKA 3J81C 4B3RI 1E3HA 3Q1QA 1Z0GA 2WNRA 3V2UC 4IFDA 2NN6B 1HR0E 1N32E 1KTVA 1HNZI 5C0XA 2CGEA 5JEAF 4GKJE 2UXBE 1USUA 4FWHA 3QT7A 3PYGA 3P76A 1FNMA 4FN5A 2HFUA 3LTOA 4N3OA 2WNRB 4MYUA 3V5RA 4IFDB 3P06A 3ZZ0A 4OX9E 1HNWI 4JI2E 1Z5AA 5C0XB 4GKJI 3M7NG 2CVEA 2PO1A 2NN6C 2O1WA 3GONA 4ED4A 3Q6MA 5DROA 4LCFA 5A2QQ 4JI2I 1NHIA 2LJPA 2HKEA 2XEXA 2PO1B 5LMUI 4NBQA 4DR6E 4DUYI 4IFDC 4PU9A 4DR1E 1Y60A 4DU8A 5FLXQ 5C0XC 4X64E 5LL6R 4LFBE 1BKNA 3QT6A 4DUZE 1H72C 4BA2A 4LF5I 1HK7A 1Y4UA 4FWGA 4DR6I 1QZRA 1RHYA 4MU1A 4DR1I 3M7ND 2UUBE 3D4JA 5EL9A 2C38A 4X64I 4LFBI 4DUZI 4JI3E 3GMEA 3K85A 3ZM7A 4BA2B 1B63A 2UUCE 1K47A 2JE6A 5LMNE 3PYEA 1IBLI 2V2QA 4JI3I 2F4VE 2C38B 4OKGA 3ZKBA 3JAMC 3GCMA 5IWAE 4JI0E 4JI6E 1YHCA 5LMNI 4DR2E 1XNQI 4DU7A 1IBME 2PNZA 4B3SE 2PO2A 2HFSA 1DARA 1I94E 4GQUA 1RR9A 4JG4A 2ZITA 1U2RA 5IWAI 4JI0I 4JI6I 4DR5E 1A6FA 3H1CA 4DR2I 2ZBKB 2F1DA 2WW4A 4BA1A 1N33E 3LNUA 4HXZA 3B4TA 2PNZB 1P42A 1I94I 3P3CA 2PO2B 3ZZTA 4PRXA 4DR5I 2Q2EB 1N33I 2UXCE 1XMQE 2V8PA 1EA6A 4BA1B 4IFDF 1H73A 3UHMA 1XXEA 4IZKA 5FLXC 3F0NA 2JEBA 3J80Q 4DV4E 1ZXMA 5FWKA 1WUUA 4NXNE 2UXCI 4UTGA 2E5LE 3PYFA 4DXLA 4DR3E 4P52A 4FW4A 1HNZE 4I3HA 4IZKB 4LOMA 4YHHE 5IT9C 4NXNI 2E5LI 2JEBB 4DR3I 2BR2A 1UDQA 4FW9A 3T1HI 4DV0I 3GLLA 4WUBA 2BA1G 5L3JA 4USKA 1OYRA 2PNLA 4YHHI 4OO1F 1HNWE 1NHJA 3ZKDA 2DEJA 4DPUA 4JYAE 2A2DA 3WU5A 4HY1A 1E3PA 2O1TA 2IERA 2BR2B 2O3ZA 5DRPA 4GKKE 2CZ9A 4MU3A 1Z0CA 2IOPA 3M85G 4JYAI 2UXDI 1N0VC 4QNJA 4LF4E 4MU4A 4FW7A 2IESA 3NZKA 1FJGE 3U1YA 4JV5E 5LMUE 4GKKI 4DUYE 1ZM4A 2C37A 2GO3A 2VF3A 2GO4A 2V2VA 1OJ4A 2HHHI 2EFGA 2BA1D 4UT4A 4X66I 3U1KA 4LF4I 3PYDA 4HACA 1FJGI 4JV5I 1Y5YA 4LF9E 2C37B 1VISA 4HYMA 2HK2A 4RPFA 2UU9E 3K1JA 4IZJD 3J80C 5GMEA 4MU0A 3WU3A 1YH8A 2J7KA 1USVA 4LF9I 1RREA 4WUDA 4IS9A 1IBLE 4IFDD 1OYPA 1MU5A 1ZM2A
chains in the Genus database with same CATH topology
1Y6ZA 2UU9I 1B62A 3M6AA 5BR8I 4FWDA 1S16A 2DEIA 2R42A 3HULA 1HNXE 4LF6I 1XNQE 2BV3A 4EMDA 4DPYA 1PVGA 2NPFA 4LFCE 4B3MI 2CG9A 1HNXI 4R1FA 2ZM6E 5GMDA 4LFCI 1Z0WA 1FI4A 2ZM6I 3J7AG 4JI8I 4USMA 4JI4E 5A2QC 4LFAI 4YY3I 2VQFI 1EI1A 4AQYE 4JI4I 1NHHA 4DV3E 1Z0VA 3J7AM 2R3VA 1J5EE 4DR7E 3HJCA 3LPSA 1ZM3A 2Z5CA 4AQYI 3T1HE 2Z5EA 4X65E 4DV0E 4DV3I 2V34A 1IBKE 3CWVA 1N36I 4MYTA 4PRVA 1N34I 1J5EI 4DR7I 2AJ4A 3Q6NA 4JI7I 4X65I 2Z5CB 2Z5BA 1KKHA 1IBKI 1Z0TA 3OTOI 2UXDE 4JI1I 4DPWA 2HKJA 4IZJA 2Z5BB 4Z7YA 3H4LA 2GQ0A 4LF7E 2HHHE 1PIEA 4DPXA 2BM0A 1Z0EA 4X66E 4URLA 4DV2E 2UUAI 1H7UA 1MG7A 3WU4A 3B78A 2O1UA 1Z5CA 3JAMQ 4IZJB 4LF7I 2BM1A 1XHKA 3T1YE 3WU6A 1H74A 1S4EA 1ELOA 4DV2I 4DV6E 1HR0I 2X36A 1Z5BA 1N32I 4XTJA 1FWKA 4LF8E 1FKAE 4KQVA 4X62E 2HK3A 3PRYA 1ZM9A 4ZVIA 2UXBI 3T1YI 4DV6I 4LF5E 4LF8I 5BR8E 4JI5E 4OX9I 4HACB 4X62I 4LF6E 4WUCA 4DV1E 2GS8A 1MX0A 3QT8A 4Z7CA 4KHPE 4B3ME 4JI5I 4DV1I 2V2ZA 4P7AA 1KIJA 2X7IA 4KHPI 1Y4SA 2VQEE 1D6TA 1H7SA 4K0KE 4JI8E 3J81Q 5IT9Q 4DR4E 1PKPA 1KVKA 2PNMA 2UUBI 4LFAE 3ZZUA 4YY3E 2VQEI 2VQFE 2O1VA 4DV5E 1Z59A 4K0KI 4DR4I 2UUCI 1NZ0A 1Z0BA 2OI2A 1N0UA 2F4VI 4DV5I 2E1RA 1N36E 1N34E 2A2CA 4M1KA 1IBMI 4B3SI 3B82A 1XNRE 4JI7E 4NXME 4DV7E 1XNRI 3K17A 3OTOE 3B8HA 4B3TE 2IOQA 4JI1E 1XMOE 4NXMI 1ZXNA 4B3RE 1XMQI 1FWLA 4DV7I 4B3TI 2UUAE 3QT5A 1XMOI 4DPTA 4DV4I 1UEKA 3J81C 4B3RI 3Q1QA 1Z0GA 3V2UC 1HR0E 1N32E 1KTVA 1HNZI 2CGEA 4GKJE 2UXBE 1USUA 4FWHA 3QT7A 3PYGA 1FNMA 4FN5A 2HFUA 3LTOA 4N3OA 4MYUA 3V5RA 3P06A 3ZZ0A 4OX9E 1HNWI 4JI2E 1Z5AA 4GKJI 2O1WA 3GONA 4ED4A 3Q6MA 5A2QQ 4JI2I 1NHIA 2LJPA 2HKEA 2XEXA 5LMUI 4DR6E 4DUYI 4PU9A 4DR1E 4DU8A 5FLXQ 4X64E 5LL6R 4LFBE 1BKNA 3QT6A 4DUZE 1H72C 4LF5I 1HK7A 1Y4UA 4FWGA 4DR6I 1QZRA 4DR1I 2UUBE 3D4JA 4X64I 4LFBI 4DUZI 4JI3E 3K85A 3ZM7A 1B63A 2UUCE 1K47A 5LMNE 3PYEA 1IBLI 2V2QA 4JI3I 2F4VE 3ZKBA 3JAMC 5IWAE 4JI0E 4JI6E 5LMNI 4DR2E 1XNQI 4DU7A 1IBME 4B3SE 2HFSA 1DARA 1I94E 1RR9A 4JG4A 2ZITA 1U2RA 5IWAI 4JI0I 4JI6I 4DR5E 1A6FA 4DR2I 2ZBKB 2WW4A 1N33E 3LNUA 4HXZA 1I94I 3ZZTA 4PRXA 4DR5I 2Q2EB 1N33I 2UXCE 1XMQE 2V8PA 1EA6A 1H73A 4IZKA 5FLXC 3F0NA 4DV4E 3J80Q 1ZXMA 5FWKA 1WUUA 4NXNE 2UXCI 4UTGA 2E5LE 3PYFA 4DXLA 4DR3E 4P52A 1HNZE 4I3HA 4IZKB 4YHHE 5IT9C 4NXNI 2E5LI 4DR3I 4FW9A 3T1HI 4DV0I 4WUBA 5L3JA 4USKA 2PNLA 4YHHI 1HNWE 1NHJA 3ZKDA 2DEJA 4DPUA 4JYAE 2A2DA 3WU5A 4HY1A 2O1TA 4GKKE 2CZ9A 1Z0CA 2IOPA 4JYAI 2UXDI 1N0VC 4LF4E 1FJGE 4JV5E 5LMUE 4GKKI 4DUYE 1ZM4A 2VF3A 2V2VA 1OJ4A 2HHHI 2EFGA 4UT4A 4X66I 4LF4I 3PYDA 4HACA 1FJGI 4JV5I 4LF9E 1VISA 4HYMA 2HK2A 4RPFA 2UU9E 3K1JA 4IZJD 3J80C 5GMEA 3WU3A 2J7KA 1USVA 4LF9I 1RREA 4WUDA 1IBLE 1MU5A 1ZM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 I;  1B62 A;  3M6A A;  5BR8 I;  4FWD A;  1S16 A;  2DEI A;  2R42 A;  3HUL A;  1HNX E;  4LF6 I;  1XNQ E;  2BV3 A;  4EMD A;  4DPY A;  1PVG A;  2NPF A;  4LFC E;  4B3M I;  1HNX I;  4R1F A;  2ZM6 E;  5GMD A;  4LFC I;  1Z0W A;  1FI4 A;  2ZM6 I;  3J7A G;  4JI8 I;  4USM A;  4JI4 E;  5A2Q C;  4LFA I;  4YY3 I;  2VQF I;  1EI1 A;  4AQY E;  4JI4 I;  1NHH A;  4DV3 E;  1Z0V A;  3J7A M;  2R3V A;  1J5E E;  4DR7 E;  3LPS A;  1ZM3 A;  4AQY I;  3T1H E;  4X65 E;  4DV0 E;  4DV3 I;  2V34 A;  1IBK E;  3CWV A;  1N36 I;  4MYT A;  4PRV A;  1N34 I;  1J5E I;  4DR7 I;  2AJ4 A;  4JI7 I;  4X65 I;  1KKH A;  1IBK I;  1Z0T A;  3OTO I;  2UXD E;  4JI1 I;  4DPW A;  2HKJ A;  4Z7Y A;  3H4L A;  4LF7 E;  2HHH E;  1PIE A;  4DPX A;  2BM0 A;  1Z0E A;  4X66 E;  4URL A;  4DV2 E;  2UUA I;  1H7U A;  1MG7 A;  3WU4 A;  3B78 A;  1Z5C A;  3JAM Q;  4LF7 I;  2BM1 A;  1XHK A;  3T1Y E;  3WU6 A;  1H74 A;  1S4E A;  1ELO A;  4DV2 I;  4DV6 E;  1HR0 I;  2X36 A;  1Z5B A;  1N32 I;  4XTJ A;  1FWK A;  4LF8 E;  1FKA E;  4KQV A;  4X62 E;  2HK3 A;  1ZM9 A;  4ZVI A;  2UXB I;  3T1Y I;  4DV6 I;  4LF5 E;  4LF8 I;  5BR8 E;  4JI5 E;  4OX9 I;  4HAC B;  4X62 I;  4LF6 E;  4WUC A;  4DV1 E;  2GS8 A;  1MX0 A;  3QT8 A;  4Z7C A;  4KHP E;  4B3M E;  4JI5 I;  4DV1 I;  2V2Z A;  4P7A A;  1KIJ A;  2X7I A;  4KHP I;  2VQE E;  1D6T A;  1H7S A;  4K0K E;  4JI8 E;  3J81 Q;  5IT9 Q;  4DR4 E;  1PKP A;  1KVK A;  2UUB I;  4LFA E;  3ZZU A;  4YY3 E;  2VQE I;  2VQF E;  4DV5 E;  1Z59 A;  4K0K I;  4DR4 I;  2UUC I;  1NZ0 A;  1Z0B A;  2OI2 A;  1N0U A;  2F4V I;  4DV5 I;  2E1R A;  1N36 E;  1N34 E;  2A2C A;  4M1K A;  1IBM I;  4B3S I;  3B82 A;  1XNR E;  4JI7 E;  4NXM E;  4DV7 E;  1XNR I;  3K17 A;  3OTO E;  3B8H A;  4B3T E;  4JI1 E;  1XMO E;  4NXM I;  1ZXN A;  4B3R E;  1XMQ I;  1FWL A;  4DV7 I;  4B3T I;  2UUA E;  3QT5 A;  1XMO I;  4DPT A;  4DV4 I;  1UEK A;  3J81 C;  4B3R I;  3Q1Q A;  1Z0G A;  3V2U C;  1HR0 E;  1N32 E;  1KTV A;  1HNZ I;  4GKJ E;  2UXB E;  4FWH A;  3QT7 A;  3PYG A;  1FNM A;  4FN5 A;  2HFU A;  3LTO A;  4MYU A;  3V5R A;  3ZZ0 A;  4OX9 E;  1HNW I;  4JI2 E;  1Z5A A;  4GKJ I;  4ED4 A;  3GON A;  5A2Q Q;  4JI2 I;  1NHI A;  2LJP A;  2HKE A;  2XEX A;  5LMU I;  4DR6 E;  4DUY I;  4PU9 A;  4DR1 E;  4DU8 A;  5FLX Q;  4X64 E;  5LL6 R;  4LFB E;  1BKN A;  3QT6 A;  4DUZ E;  1H72 C;  4LF5 I;  4FWG A;  4DR6 I;  1QZR A;  4DR1 I;  2UUB E;  3D4J A;  4X64 I;  4LFB I;  4DUZ I;  4JI3 E;  3ZM7 A;  1B63 A;  2UUC E;  1K47 A;  5LMN E;  3PYE A;  1IBL I;  2V2Q A;  4JI3 I;  2F4V E;  3ZKB A;  3JAM C;  5IWA E;  4JI0 E;  4JI6 E;  5LMN I;  4DR2 E;  1XNQ I;  4DU7 A;  1IBM E;  4B3S E;  2HFS A;  1DAR A;  1I94 E;  1RR9 A;  4JG4 A;  2ZIT A;  1U2R A;  5IWA I;  4JI0 I;  4JI6 I;  4DR5 E;  1A6F A;  4DR2 I;  2ZBK B;  2WW4 A;  1N33 E;  3LNU A;  4HXZ A;  1I94 I;  3ZZT A;  4PRX A;  4DR5 I;  2Q2E B;  1N33 I;  2UXC E;  1XMQ E;  2V8P A;  1EA6 A;  1H73 A;  5FLX C;  3F0N A;  4DV4 E;  3J80 Q;  1ZXM A;  1WUU A;  4NXN E;  2UXC I;  4UTG A;  2E5L E;  3PYF A;  4DXL A;  4DR3 E;  4P52 A;  1HNZ E;  4I3H A;  4YHH E;  5IT9 C;  4NXN I;  2E5L I;  4DR3 I;  4FW9 A;  3T1H I;  4DV0 I;  4WUB A;  5L3J A;  4USK A;  4YHH I;  1HNW E;  1NHJ A;  3ZKD A;  2DEJ A;  4DPU A;  4JYA E;  2A2D A;  3WU5 A;  4HY1 A;  4GKK E;  2CZ9 A;  1Z0C A;  4JYA I;  2UXD I;  1N0V C;  4LF4 E;  1FJG E;  4JV5 E;  5LMU E;  4GKK I;  4DUY E;  1ZM4 A;  2VF3 A;  2V2V A;  1OJ4 A;  2HHH I;  2EFG A;  4UT4 A;  4X66 I;  4LF4 I;  3PYD A;  4HAC A;  1FJG I;  4JV5 I;  4LF9 E;  1VIS A;  4HYM A;  2HK2 A;  4RPF A;  2UU9 E;  3K1J A;  3J80 C;  5GME A;  3WU3 A;  2J7K A;  4LF9 I;  1RRE A;  4WUD A;  1IBL E;  1MU5 A;  1ZM2 A; 
#chains in the Genus database with same CATH topology
 1Y6Z A;  2UU9 I;  1B62 A;  3M6A A;  5BR8 I;  4FWD A;  1S16 A;  4FW6 A;  2DEI A;  5K36 D;  2R42 A;  3HUL A;  1HNX E;  4LF6 I;  1XNQ E;  2BV3 A;  4EMD A;  4LPF A;  1PVG A;  4DPY A;  2NPF A;  4LFC E;  4B3M I;  2JEA A;  2CG9 A;  1HNX I;  4R1F A;  2ZM6 E;  2JE6 B;  5GMD A;  3CDI A;  4LFC I;  1Z0W A;  5JEA D;  4OO1 D;  1FI4 A;  2JEA B;  5EKW A;  2ZM6 I;  3HKM A;  2NN6 F;  3J7A G;  4JI8 I;  4USM A;  4JI4 E;  5A2Q C;  4LFA I;  4YY3 I;  2VQF I;  4U3D A;  1OYS A;  1EI1 A;  2BA0 G;  4AQY E;  4JI4 I;  1NHH A;  3KRN A;  4DV3 E;  1Z0V A;  3J7A M;  5C0X F;  2R3V A;  1J5E E;  3L7Z A;  4IFD E;  4DR7 E;  3HJC A;  3LPS A;  1ZM3 A;  2Z5C A;  4AQY I;  3T1H E;  2Z5E A;  4X65 E;  4DV0 E;  4DV3 I;  2V34 A;  1UDN A;  1IBK E;  4MQY A;  3CWV A;  4QNK A;  1N36 I;  5K36 E;  4MYT A;  4PRV A;  1N34 I;  1J5E I;  4DR7 I;  2AJ4 A;  4MDT A;  3L7Z B;  5DRQ A;  3Q6N A;  4JI7 I;  4X65 I;  2Z5C B;  2Z5B A;  1KKH A;  1IBK I;  1R6L A;  2BA0 D;  3P3E A;  1Z0T A;  3OTO I;  2UXD E;  4JI1 I;  4DPW A;  2HKJ A;  5JEA E;  4OO1 E;  4IZJ A;  2Z5B B;  4Z7Y A;  3H4L A;  2GQ0 A;  1UDO A;  4LF7 E;  2HHH E;  1PIE A;  4J3D A;  4DPX A;  1VI7 A;  1Z0E A;  2BM0 A;  3CDJ A;  4URL A;  4X66 E;  4DV2 E;  2UUA I;  1H7U A;  4AM3 A;  1MG7 A;  3WU4 A;  4LCG A;  3B78 A;  2O1U A;  1Z5C A;  2PO0 A;  3JAM Q;  4IZJ B;  4LF7 I;  5K36 A;  2BM1 A;  1XHK A;  3T1Y E;  3WU6 A;  1H74 A;  1S4E A;  1ELO A;  4DV2 I;  4DV6 E;  4FW5 A;  1HR0 I;  2X36 A;  1Z5B A;  1N32 I;  4XTJ A;  1FWK A;  4LF8 E;  1FKA E;  4KQV A;  4FW3 A;  4X62 E;  2HK3 A;  3PRY A;  1ZM9 A;  2NN6 D;  4ZVI A;  2UXB I;  2PO0 B;  3T1Y I;  4OZE A;  1UDS A;  5K36 B;  2WP8 A;  4DV6 I;  4ISA A;  4AID A;  4LF5 E;  1R6M A;  4U3B A;  3M85 D;  5BR8 E;  4LF8 I;  4JI5 E;  4OX9 I;  2JT2 A;  4HAC B;  4OO1 A;  5JEA A;  4X62 I;  4LF6 E;  4WUC A;  4DV1 E;  2GS8 A;  5ELW A;  1MX0 A;  3QT8 A;  4Z7C A;  2WP8 B;  4KHP E;  5C0X D;  4B3M E;  4JI5 I;  3PS2 A;  4DV1 I;  5JEA B;  4OO1 B;  5K36 C;  2C39 A;  2V2Z A;  3P3G A;  4P7A A;  1KIJ A;  2X7I A;  4KHP I;  5DNX A;  1Y4S A;  2VQE E;  1D6T A;  1H7S A;  4K0K E;  4JI8 E;  3J81 Q;  5IT9 Q;  4DR4 E;  1PKP A;  2VES A;  1KVK A;  2PNM A;  2C39 B;  2UUB I;  4LFA E;  3ZZU A;  4YY3 E;  2VQE I;  2VQF E;  4LCH A;  5JEA C;  4OO1 C;  2O1V A;  4AIM A;  4DV5 E;  1Z59 A;  4K0K I;  4DR4 I;  2UUC I;  1NZ0 A;  1Z0B A;  2OI2 A;  2NN6 E;  1N0U A;  2J65 A;  2F4V I;  4DV5 I;  2E1R A;  3PS3 A;  3PS1 A;  5DRR A;  1N36 E;  1N34 E;  3DD6 A;  2A2C A;  4M1K A;  1IBM I;  4B3S I;  3B82 A;  1XNR E;  4JI7 E;  5C0X E;  4NXM E;  4DV7 E;  1XNR I;  2AE8 A;  3K17 A;  3OTO E;  3B8H A;  4B3T E;  2IOQ A;  4JI1 E;  1XMO E;  5DNL A;  4NXM I;  1ZXN A;  5K36 F;  4B3R E;  1XMQ I;  1FWL A;  4DV7 I;  2NN6 A;  4B3T I;  2UUA E;  3QT5 A;  1XMO I;  4DPT A;  4DV4 I;  1UEK A;  3J81 C;  4B3R I;  1E3H A;  3Q1Q A;  1Z0G A;  2WNR A;  3V2U C;  4IFD A;  2NN6 B;  1HR0 E;  1N32 E;  1KTV A;  1HNZ I;  5C0X A;  2CGE A;  5JEA F;  4GKJ E;  2UXB E;  1USU A;  4FWH A;  3QT7 A;  3PYG A;  3P76 A;  1FNM A;  4FN5 A;  2HFU A;  3LTO A;  4N3O A;  2WNR B;  4MYU A;  3V5R A;  4IFD B;  3P06 A;  3ZZ0 A;  4OX9 E;  1HNW I;  4JI2 E;  1Z5A A;  5C0X B;  4GKJ I;  3M7N G;  2CVE A;  2PO1 A;  2NN6 C;  2O1W A;  3GON A;  4ED4 A;  3Q6M A;  5DRO A;  4LCF A;  5A2Q Q;  4JI2 I;  1NHI A;  2LJP A;  2HKE A;  2XEX A;  2PO1 B;  5LMU I;  4NBQ A;  4DR6 E;  4DUY I;  4IFD C;  4PU9 A;  4DR1 E;  1Y60 A;  4DU8 A;  5FLX Q;  5C0X C;  4X64 E;  5LL6 R;  4LFB E;  1BKN A;  3QT6 A;  4DUZ E;  1H72 C;  4BA2 A;  4LF5 I;  1HK7 A;  1Y4U A;  4FWG A;  4DR6 I;  1QZR A;  1RHY A;  4MU1 A;  4DR1 I;  3M7N D;  2UUB E;  3D4J A;  5EL9 A;  2C38 A;  4X64 I;  4LFB I;  4DUZ I;  4JI3 E;  3GME A;  3K85 A;  3ZM7 A;  4BA2 B;  1B63 A;  2UUC E;  1K47 A;  2JE6 A;  5LMN E;  3PYE A;  1IBL I;  2V2Q A;  4JI3 I;  2F4V E;  2C38 B;  4OKG A;  3ZKB A;  3JAM C;  3GCM A;  5IWA E;  4JI0 E;  4JI6 E;  1YHC A;  5LMN I;  4DR2 E;  1XNQ I;  4DU7 A;  1IBM E;  2PNZ A;  4B3S E;  2PO2 A;  2HFS A;  1DAR A;  1I94 E;  4GQU A;  1RR9 A;  4JG4 A;  2ZIT A;  1U2R A;  5IWA I;  4JI0 I;  4JI6 I;  4DR5 E;  1A6F A;  3H1C A;  4DR2 I;  2ZBK B;  2F1D A;  2WW4 A;  4BA1 A;  1N33 E;  3LNU A;  4HXZ A;  3B4T A;  2PNZ B;  1P42 A;  1I94 I;  3P3C A;  2PO2 B;  3ZZT A;  4PRX A;  4DR5 I;  2Q2E B;  1N33 I;  2UXC E;  1XMQ E;  2V8P A;  1EA6 A;  4BA1 B;  4IFD F;  1H73 A;  3UHM A;  1XXE A;  4IZK A;  5FLX C;  3F0N A;  2JEB A;  3J80 Q;  4DV4 E;  1ZXM A;  5FWK A;  1WUU A;  4NXN E;  2UXC I;  4UTG A;  2E5L E;  3PYF A;  4DXL A;  4DR3 E;  4P52 A;  4FW4 A;  1HNZ E;  4I3H A;  4IZK B;  4LOM A;  4YHH E;  5IT9 C;  4NXN I;  2E5L I;  2JEB B;  4DR3 I;  2BR2 A;  1UDQ A;  4FW9 A;  3T1H I;  4DV0 I;  3GLL A;  4WUB A;  2BA1 G;  5L3J A;  4USK A;  1OYR A;  2PNL A;  4YHH I;  4OO1 F;  1HNW E;  1NHJ A;  3ZKD A;  2DEJ A;  4DPU A;  4JYA E;  2A2D A;  3WU5 A;  4HY1 A;  1E3P A;  2O1T A;  2IER A;  2BR2 B;  2O3Z A;  5DRP A;  4GKK E;  2CZ9 A;  4MU3 A;  1Z0C A;  2IOP A;  3M85 G;  4JYA I;  2UXD I;  1N0V C;  4QNJ A;  4LF4 E;  4MU4 A;  4FW7 A;  2IES A;  3NZK A;  1FJG E;  3U1Y A;  4JV5 E;  5LMU E;  4GKK I;  4DUY E;  1ZM4 A;  2C37 A;  2GO3 A;  2VF3 A;  2GO4 A;  2V2V A;  1OJ4 A;  2HHH I;  2EFG A;  2BA1 D;  4UT4 A;  4X66 I;  3U1K A;  4LF4 I;  3PYD A;  4HAC A;  1FJG I;  4JV5 I;  1Y5Y A;  4LF9 E;  2C37 B;  1VIS A;  4HYM A;  2HK2 A;  4RPF A;  2UU9 E;  3K1J A;  4IZJ D;  3J80 C;  5GME A;  4MU0 A;  3WU3 A;  1YH8 A;  2J7K A;  1USV A;  4LF9 I;  1RRE A;  4WUD A;  4IS9 A;  1IBL E;  4IFD D;  1OYP A;  1MU5 A;  1ZM2 A; 
#chains in the Genus database with same CATH homology
 1Y6Z A;  2UU9 I;  1B62 A;  3M6A A;  5BR8 I;  4FWD A;  1S16 A;  2DEI A;  2R42 A;  3HUL A;  1HNX E;  4LF6 I;  1XNQ E;  2BV3 A;  4EMD A;  4DPY A;  1PVG A;  2NPF A;  4LFC E;  4B3M I;  2CG9 A;  1HNX I;  4R1F A;  2ZM6 E;  5GMD A;  4LFC I;  1Z0W A;  1FI4 A;  2ZM6 I;  3J7A G;  4JI8 I;  4USM A;  4JI4 E;  5A2Q C;  4LFA I;  4YY3 I;  2VQF I;  1EI1 A;  4AQY E;  4JI4 I;  1NHH A;  4DV3 E;  1Z0V A;  3J7A M;  2R3V A;  1J5E E;  4DR7 E;  3HJC A;  3LPS A;  1ZM3 A;  2Z5C A;  4AQY I;  3T1H E;  2Z5E A;  4X65 E;  4DV0 E;  4DV3 I;  2V34 A;  1IBK E;  3CWV A;  1N36 I;  4MYT A;  4PRV A;  1N34 I;  1J5E I;  4DR7 I;  2AJ4 A;  3Q6N A;  4JI7 I;  4X65 I;  2Z5C B;  2Z5B A;  1KKH A;  1IBK I;  1Z0T A;  3OTO I;  2UXD E;  4JI1 I;  4DPW A;  2HKJ A;  4IZJ A;  2Z5B B;  4Z7Y A;  3H4L A;  2GQ0 A;  4LF7 E;  2HHH E;  1PIE A;  4DPX A;  2BM0 A;  1Z0E A;  4X66 E;  4URL A;  4DV2 E;  2UUA I;  1H7U A;  1MG7 A;  3WU4 A;  3B78 A;  2O1U A;  1Z5C A;  3JAM Q;  4IZJ B;  4LF7 I;  2BM1 A;  1XHK A;  3T1Y E;  3WU6 A;  1H74 A;  1S4E A;  1ELO A;  4DV2 I;  4DV6 E;  1HR0 I;  2X36 A;  1Z5B A;  1N32 I;  4XTJ A;  1FWK A;  4LF8 E;  1FKA E;  4KQV A;  4X62 E;  2HK3 A;  3PRY A;  1ZM9 A;  4ZVI A;  2UXB I;  3T1Y I;  4DV6 I;  4LF5 E;  4LF8 I;  5BR8 E;  4JI5 E;  4OX9 I;  4HAC B;  4X62 I;  4LF6 E;  4WUC A;  4DV1 E;  2GS8 A;  1MX0 A;  3QT8 A;  4Z7C A;  4KHP E;  4B3M E;  4JI5 I;  4DV1 I;  2V2Z A;  4P7A A;  1KIJ A;  2X7I A;  4KHP I;  1Y4S A;  2VQE E;  1D6T A;  1H7S A;  4K0K E;  4JI8 E;  3J81 Q;  5IT9 Q;  4DR4 E;  1PKP A;  1KVK A;  2PNM A;  2UUB I;  4LFA E;  3ZZU A;  4YY3 E;  2VQE I;  2VQF E;  2O1V A;  4DV5 E;  1Z59 A;  4K0K I;  4DR4 I;  2UUC I;  1NZ0 A;  1Z0B A;  2OI2 A;  1N0U A;  2F4V I;  4DV5 I;  2E1R A;  1N36 E;  1N34 E;  2A2C A;  4M1K A;  1IBM I;  4B3S I;  3B82 A;  1XNR E;  4JI7 E;  4NXM E;  4DV7 E;  1XNR I;  3K17 A;  3OTO E;  3B8H A;  4B3T E;  2IOQ A;  4JI1 E;  1XMO E;  4NXM I;  1ZXN A;  4B3R E;  1XMQ I;  1FWL A;  4DV7 I;  4B3T I;  2UUA E;  3QT5 A;  1XMO I;  4DPT A;  4DV4 I;  1UEK A;  3J81 C;  4B3R I;  3Q1Q A;  1Z0G A;  3V2U C;  1HR0 E;  1N32 E;  1KTV A;  1HNZ I;  2CGE A;  4GKJ E;  2UXB E;  1USU A;  4FWH A;  3QT7 A;  3PYG A;  1FNM A;  4FN5 A;  2HFU A;  3LTO A;  4N3O A;  4MYU A;  3V5R A;  3P06 A;  3ZZ0 A;  4OX9 E;  1HNW I;  4JI2 E;  1Z5A A;  4GKJ I;  2O1W A;  3GON A;  4ED4 A;  3Q6M A;  5A2Q Q;  4JI2 I;  1NHI A;  2LJP A;  2HKE A;  2XEX A;  5LMU I;  4DR6 E;  4DUY I;  4PU9 A;  4DR1 E;  4DU8 A;  5FLX Q;  4X64 E;  5LL6 R;  4LFB E;  1BKN A;  3QT6 A;  4DUZ E;  1H72 C;  4LF5 I;  1HK7 A;  1Y4U A;  4FWG A;  4DR6 I;  1QZR A;  4DR1 I;  2UUB E;  3D4J A;  4X64 I;  4LFB I;  4DUZ I;  4JI3 E;  3K85 A;  3ZM7 A;  1B63 A;  2UUC E;  1K47 A;  5LMN E;  3PYE A;  1IBL I;  2V2Q A;  4JI3 I;  2F4V E;  3ZKB A;  3JAM C;  5IWA E;  4JI0 E;  4JI6 E;  5LMN I;  4DR2 E;  1XNQ I;  4DU7 A;  1IBM E;  4B3S E;  2HFS A;  1DAR A;  1I94 E;  1RR9 A;  4JG4 A;  2ZIT A;  1U2R A;  5IWA I;  4JI0 I;  4JI6 I;  4DR5 E;  1A6F A;  4DR2 I;  2ZBK B;  2WW4 A;  1N33 E;  3LNU A;  4HXZ A;  1I94 I;  3ZZT A;  4PRX A;  4DR5 I;  2Q2E B;  1N33 I;  2UXC E;  1XMQ E;  2V8P A;  1EA6 A;  1H73 A;  4IZK A;  5FLX C;  3F0N A;  4DV4 E;  3J80 Q;  1ZXM A;  5FWK A;  1WUU A;  4NXN E;  2UXC I;  4UTG A;  2E5L E;  3PYF A;  4DXL A;  4DR3 E;  4P52 A;  1HNZ E;  4I3H A;  4IZK B;  4YHH E;  5IT9 C;  4NXN I;  2E5L I;  4DR3 I;  4FW9 A;  3T1H I;  4DV0 I;  4WUB A;  5L3J A;  4USK A;  2PNL A;  4YHH I;  1HNW E;  1NHJ A;  3ZKD A;  2DEJ A;  4DPU A;  4JYA E;  2A2D A;  3WU5 A;  4HY1 A;  2O1T A;  4GKK E;  2CZ9 A;  1Z0C A;  2IOP A;  4JYA I;  2UXD I;  1N0V C;  4LF4 E;  1FJG E;  4JV5 E;  5LMU E;  4GKK I;  4DUY E;  1ZM4 A;  2VF3 A;  2V2V A;  1OJ4 A;  2HHH I;  2EFG A;  4UT4 A;  4X66 I;  4LF4 I;  3PYD A;  4HAC A;  1FJG I;  4JV5 I;  4LF9 E;  1VIS A;  4HYM A;  2HK2 A;  4RPF A;  2UU9 E;  3K1J A;  4IZJ D;  3J80 C;  5GME A;  3WU3 A;  2J7K A;  1USV A;  4LF9 I;  1RRE A;  4WUD A;  1IBL E;  1MU5 A;  1ZM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...