1D6TA

Rnase p protein from staphylococcus aureus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
117
Chain Sequence
MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of ribonuclease P protein from Staphylococcus aureus reveals a unique binding site for single-stranded RNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords RIBONUCLEASE P
total genus 19
structure length 117
sequence length 117
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1d6tA00
1MX0A 4RPFA 4DR4E 1ZXMA 4LF6I 4JI2E 4JI6I 1WUUA 2UXDE 1XNQE 1FJGI 1N0VC 1N33E 1KVKA 1XMOE 1MG7A 1UEKA 4DUZI 4LF4E 4I3HA 4X66E 4GKJI 2E5LE 3T1YI 2VQEE 2VQFI 1ZM3A 5IWAE 3J81Q 2UUCE 4P52A 5IWAI 1Z0VA 4KQVA 4DU7A 4HXZA 4MYTA 4DV2E 3T1YE 4JI0I 1EA6A 2LJPA 4JV5I 4NXME 2X7IA 1PKPA 4DPXA 3D4JA 4LFBI 4LF8E 4DV1I 1I94I 1H73A 1ZM4A 2BV3A 4DR3I 1Z0CA 4JI2I 3OTOI 3V2UC 4PU9A 5LL6R 4DV0I 2UXDI 1H7UA 3ZKBA 4YY3I 1FNMA 1J5EE 4JI5E 4USMA 1HNWI 4PRXA 4X65I 1PIEA 1RREA 2HKEA 4DV3I 2WW4A 4DV0E 4JI7I 4YHHE 1H72C 4M1KA 2A2CA 1DARA 5A2QC 4DR3E 1N36I 2HHHE 4B3SE 1N32E 5IT9C 4LFBE 3CWVA 4UT4A 4NXMI 5LMNI 4PRVA 3PYGA 2ZM6E 2HFSA 1B63A 4DV7I 1N34I 4JYAE 1NHHA 4DV1E 4DV2I 1I94E 3T1HI 4JI1I 4DPWA 2R42A 4DR5E 4JI4E 2OI2A 2E1RA 4JI3I 4FN5A 2GS8A 1Z5AA 4WUCA 3V5RA 2V2ZA 4LF5E 1KIJA 4JYAI 1IBKI 1HR0I 4B3RI 4LF4I 4DPTA 5LMNE 1XMOI 3ZM7A 4DR1I 4DV4E 2VF3A 2VQEI 3WU4A 4OX9E 1HNZI 4JI8I 4DUYE 2UUAI 2E5LI 1Z0TA 4HY1A 4DUZE 4DR7I 4DUYI 4JI8E 3JAMQ 4NXNE 2R3VA 3PYEA 2HFUA 1XNQI 1KTVA 5BR8I 4DR1E 3QT7A 4DXLA 1B62A 1KKHA 3LPSA 3J81C 2UU9I 4X65E 5L3JA 4WUBA 1IBKE 4FWGA 3B78A 4LF5I 1H7SA 4X64E 1FWKA 4AQYE 1IBME 4DPUA 4JI1E 4HYMA 3H4LA 1HNXI 4B3TE 2ZM6I 4DV7E 4DU8A 3OTOE 3K17A 5LMUI 1OJ4A 4K0KI 4DV5E 4LF8I 1ZM9A 1ZXNA 1A6FA 4R1FA 1Z0EA 1IBMI 3J80Q 4WUDA 4LFCI 4DR6I 1K47A 2A2DA 2UXCE 1EI1A 4B3TI 2AJ4A 4X62I 1Z0WA 1FKAE 3J7AM 4KHPE 1XHKA 2V2QA 5GMEA 1XMQI 2VQFE 4ZVIA 3GONA 2Q2EB 1FI4A 4EMDA 4FWHA 2CZ9A 1NHIA 4DV6I 4LF7E 4FW9A 4JI6E 1D6TA 4DR4I 2EFGA 2UUAE 3HULA 5FLXC 3ZZTA 4P7AA 2F4VE 3WU3A 4JI3E 4LFAI 2X36A 4KHPI 4JV5E 2V8PA 3WU5A 2UXBI 1NHJA 2XEXA 1BKNA 2DEJA 1ZM2A 5IT9Q 4X62E 4GKKE 4LF9I 1N36E 2HHHI 5LMUE 4JG4A 3Q1QA 5FLXQ 4LFCE 4DR6E 4HACA 4YHHI 4XTJA 4JI7E 1N33I 1FJGE 3JAMC 4UTGA 1FWLA 4LF6E 3ZZ0A 1S4EA 4JI5I 1J5EI 4GKKI 3PYFA 3QT6A 1RR9A 2UUBI 4NXNI 2UXBE 2HK2A 4DR2E 4B3MI 4URLA 4DR7E 4YY3E 2HK3A 1IBLI 3J7AG 2BM0A 2F4VI 3ZKDA 3K1JA 4DV4I 1IBLE 3B82A 1PVGA 1Z0GA 4DPYA 4JI0E 1HR0E 3WU6A 4B3RE 5GMDA 1HNZE 4OX9I 1QZRA 4LF7I 4DV6E 2UUCI 4USKA 1Z5BA 1Z0BA 2UUBE 4Z7CA 3T1HE 1U2RA 1XNRE 4GKJE 1XNRI 1Z5CA 1Z59A 3QT5A 1XMQE 3ZZUA 3LNUA 2V2VA 1N0UA 4DR5I 4JI4I 2ZITA 2V34A 4MYUA 1N32I 3M6AA 1S16A 4B3SI 3QT8A 2UXCI 4K0KE 4X66I 1ELOA 1N34E 3F0NA 3LTOA 1VISA 3J80C 3B8HA 4FWDA 4LF9E 4HACB 2DEIA 3PYDA 1MU5A 4DV5I 4AQYI 4ED4A 1H74A 1HNWE 4DR2I 4B3ME 5A2QQ 2HKJA 2NPFA 1HNXE 2UU9E 2J7KA 4LFAE 5BR8E 4DV3E 2BM1A 2ZBKB 4Z7YA 4X64I 1NZ0A
chains in the Genus database with same CATH superfamily
1MX0A 4RPFA 4DR4E 1ZXMA 5DNXA 4LF6I 4JI2E 4JI6I 1WUUA 2UXDE 1XNQE 1FJGI 1N0VC 2WP8A 1N33E 1KVKA 1XMOE 3H1CA 4OZEA 2WNRA 1MG7A 1UEKA 4DUZI 5C0XD 5C0XB 5K36E 4LF4E 4I3HA 4X66E 4GKJI 2E5LE 3P06A 3T1YI 2VQEE 2VQFI 3NZKA 1ZM3A 2BA1D 5IWAE 3J81Q 2UUCE 4P52A 5IWAI 1Z0VA 2C37B 4KQVA 4LCFA 1OYPA 4DU7A 4HXZA 1Y4UA 4MYTA 4DV2E 4LCHA 3T1YE 5K36D 4JI0I 1EA6A 5K36F 2LJPA 4JV5I 4NXME 2X7IA 1PKPA 4DPXA 3D4JA 1UDOA 4LFBI 4LF8E 4DV1I 1I94I 2IERA 5DROA 1H73A 1ZM4A 2O3ZA 2BV3A 4DR3I 1Z0CA 4JI2I 3OTOI 3V2UC 4IFDD 4PU9A 2C39A 1UDNA 5LL6R 5K36B 4LOMA 4DV0I 2BA0G 2UXDI 1H7UA 3ZKBA 4YY3I 1FNMA 1J5EE 4JI5E 4USMA 1HNWI 4PRXA 4X65I 1PIEA 1RREA 2HKEA 5JEAB 5K36C 4DV3I 5ELWA 2WW4A 2O1TA 4DV0E 5DRRA 2NN6F 4QNJA 4JI7I 2BA0D 2BR2A 1OYRA 4YHHE 4OO1E 1H72C 4M1KA 2A2CA 1DARA 5A2QC 5K36A 4DR3E 1N36I 2HHHE 4B3SE 3P3GA 2Z5CB 1N32E 5IT9C 1HK7A 4LFBE 3CWVA 2BA1G 5JEAF 4MU4A 4UT4A 2Z5BA 4NXMI 5LMNI 2JT2A 4PRVA 3PYGA 2ZM6E 2HFSA 1B63A 4DV7I 1N34I 2PO1A 4JYAE 1NHHA 4DV1E 4DV2I 1I94E 4N3OA 3T1HI 4DPWA 4JI1I 5EKWA 2R42A 1E3PA 3L7ZB 2OI2A 4DR5E 2E1RA 4JI4E 2PO2A 4J3DA 2PO0B 4JI3I 4FN5A 2GS8A 1Z5AA 4WUCA 3V5RA 2V2ZA 4LF5E 1KIJA 2O1UA 4JYAI 1IBKI 1HR0I 4B3RI 4LF4I 4DPTA 2Z5CA 5LMNE 1XMOI 3ZM7A 3DD6A 4DR1I 4DV4E 2C38B 2VF3A 2VQEI 4LPFA 3WU4A 2F1DA 2WNRB 4AIDA 3K85A 1HNZI 4OX9E 4JI8I 4DUYE 2UUAI 2E5LI 1Z0TA 4IZJB 4HY1A 4DUZE 1YHCA 4DR7I 4DUYI 4JI8E 3PS1A 3JAMQ 4NXNE 2R3VA 3PYEA 2HFUA 5JEAC 1XNQI 1KTVA 5BR8I 2IOQA 4DR1E 1R6MA 4IZKA 5C0XE 2NN6D 3QT7A 4DXLA 4MDTA 1B62A 1KKHA 3LPSA 3J81C 2UU9I 4X65E 1Y5YA 5L3JA 2CGEA 4WUBA 1VI7A 1IBKE 4FWGA 4BA2B 3B78A 4OO1A 4LF5I 1H7SA 2VESA 4X64E 1FWKA 4AQYE 3GMEA 1IBME 2NN6E 4DPUA 4MQYA 4JI1E 4IZJA 4HYMA 3H4LA 1HNXI 4FW3A 2Z5EA 3GCMA 4B3TE 3P3EA 5DRPA 2O1WA 2ZM6I 4DV7E 4DU8A 3OTOE 1USUA 3K17A 5LMUI 1OJ4A 4K0KI 4DV5E 4LF8I 1ZM9A 4IZJD 4FW6A 4AIMA 1ZXNA 1A6FA 4R1FA 1Z0EA 1IBMI 3J80Q 4OKGA 4WUDA 4LFCI 3M85D 2NN6C 4DR6I 1K47A 2A2DA 2UXCE 1EI1A 4B3TI 2AJ4A 4X62I 1Z0WA 1FKAE 3J7AM 2PO1B 4KHPE 5EL9A 1XHKA 2V2QA 5GMEA 1XMQI 2VQFE 4ZVIA 3GONA 2NN6B 2PO2B 2Q2EB 2PO0A 1FI4A 2C37A 5JEAE 4MU3A 3HJCA 4EMDA 4GQUA 3U1YA 4FW7A 4AM3A 4FWHA 2CZ9A 1NHIA 2PNZB 4DV6I 2AE8A 4LF7E 4FW9A 3U1KA 5C0XA 4MU1A 4JI6E 1D6TA 4FW5A 1Y60A 4DR4I 2O1VA 2EFGA 2UUAE 3HULA 5FLXC 4QNKA 3ZZTA 4P7AA 2F4VE 1USVA 3WU3A 4JI3E 3Q6MA 2NN6A 4LFAI 2X36A 4KHPI 4JV5E 4IFDF 4IZKB 2V8PA 5FWKA 3WU5A 2UXBI 2GO3A 1NHJA 4BA2A 2XEXA 3M7NG 2J65A 1BKNA 1ZM2A 2DEJA 5IT9Q 4OO1C 4X62E 4OO1F 4GKKE 4LF9I 4IFDE 1N36E 2HHHI 5LMUE 2JEBA 3GLLA 4JG4A 3Q1QA 5FLXQ 4LFCE 2CVEA 4DR6E 4HACA 1RHYA 4YHHI 4XTJA 4JI7E 1N33I 2IESA 1FJGE 3JAMC 5DNLA 4UTGA 1FWLA 1Y4SA 4LF6E 4OO1B 3PS2A 2Z5BB 4ISAA 3ZZ0A 1S4EA 1UDQA 5JEAA 3B4TA 1J5EI 4JI5I 2PNMA 3M85G 4BA1A 2JEAB 4GKKI 3PYFA 3QT6A 1RR9A 2UUBI 2BR2B 4NXNI 2UXBE 4OO1D 2HK2A 3Q6NA 4DR2E 4B3MI 4URLA 4DR7E 4YY3E 2CG9A 1R6LA 2HK3A 3CDJA 5DRQA 2WP8B 1IBLI 3J7AG 3PRYA 2BM0A 4U3DA 2F4VI 3ZKDA 2PNZA 3K1JA 4DV4I 1IBLE 3B82A 1PVGA 1Z0GA 4BA1B 4DPYA 4JI0E 1HR0E 3WU6A 4B3RE 5GMDA 1HNZE 4OX9I 4FW4A 4MU0A 1QZRA 4LF7I 4DV6E 1XXEA 4NBQA 2UUCI 4USKA 1Z5BA 1Z0BA 4IS9A 5C0XC 3KRNA 2GO4A 2UUBE 4Z7CA 3T1HE 1P42A 1U2RA 3PS3A 1XNRE 4GKJE 4IFDA 1Y6ZA 2IOPA 1XNRI 1Z5CA 1Z59A 2C38A 3QT5A 1XMQE 3ZZUA 3LNUA 2V2VA 1N0UA 4DR5I 4JI4I 2ZITA 2V34A 4MYUA 5JEAD 1N32I 3M6AA 1S16A 4B3SI 3QT8A 2UXCI 4K0KE 2GQ0A 4X66I 1ELOA 1N34E 4IFDC 3CDIA 3F0NA 1E3HA 2C39B 5C0XF 2JE6B 3LTOA 1VISA 3J80C 3B8HA 4FWDA 4LF9E 4HACB 2DEIA 3HKMA 1MU5A 3PYDA 4DV5I 4AQYI 4IFDB 3P3CA 4ED4A 2PNLA 1H74A 1HNWE 4DR2I 4B3ME 3UHMA 5A2QQ 2HKJA 2NPFA 3P76A 1HNXE 2UU9E 2J7KA 4U3BA 3M7ND 2JEAA 4LFAE 4LCGA 1UDSA 5BR8E 1OYSA 1YH8A 4DV3E 2BM1A 2ZBKB 3L7ZA 4Z7YA 4X64I 2JEBB 1NZ0A 2JE6A
chains in the Genus database with same CATH topology
1MX0A 4RPFA 4DR4E 1ZXMA 4LF6I 4JI2E 4JI6I 1WUUA 2UXDE 1XNQE 1FJGI 1N0VC 1N33E 1KVKA 1XMOE 1MG7A 1UEKA 4DUZI 4LF4E 4I3HA 4X66E 4GKJI 2E5LE 3P06A 3T1YI 2VQEE 2VQFI 1ZM3A 5IWAE 3J81Q 2UUCE 4P52A 5IWAI 1Z0VA 4KQVA 4DU7A 4HXZA 1Y4UA 4MYTA 4DV2E 3T1YE 4JI0I 1EA6A 2LJPA 4JV5I 4NXME 2X7IA 1PKPA 4DPXA 3D4JA 4LFBI 4LF8E 4DV1I 1I94I 1H73A 1ZM4A 2BV3A 4DR3I 1Z0CA 4JI2I 3OTOI 3V2UC 4PU9A 5LL6R 4DV0I 2UXDI 1H7UA 3ZKBA 4YY3I 1FNMA 1J5EE 4JI5E 4USMA 1HNWI 4PRXA 4X65I 1PIEA 1RREA 2HKEA 4DV3I 2WW4A 2O1TA 4DV0E 4JI7I 4YHHE 1H72C 4M1KA 2A2CA 1DARA 5A2QC 4DR3E 2HHHE 1N36I 4B3SE 2Z5CB 1N32E 5IT9C 1HK7A 4LFBE 3CWVA 4UT4A 2Z5BA 4NXMI 5LMNI 4PRVA 3PYGA 2ZM6E 2HFSA 1B63A 4DV7I 1N34I 4JYAE 1NHHA 4DV1E 4DV2I 1I94E 4N3OA 3T1HI 4JI1I 4DPWA 2R42A 4DR5E 4JI4E 2OI2A 2E1RA 4JI3I 4FN5A 2GS8A 1Z5AA 4WUCA 3V5RA 2V2ZA 4LF5E 1KIJA 2O1UA 4JYAI 1IBKI 1HR0I 4B3RI 4LF4I 4DPTA 2Z5CA 5LMNE 1XMOI 3ZM7A 4DR1I 4DV4E 2VF3A 2VQEI 3WU4A 3K85A 1HNZI 4OX9E 4JI8I 4DUYE 2UUAI 2E5LI 1Z0TA 4IZJB 4HY1A 4DUZE 4DR7I 4DUYI 4JI8E 3JAMQ 4NXNE 2R3VA 3PYEA 2HFUA 1XNQI 1KTVA 5BR8I 2IOQA 4DR1E 4IZKA 3QT7A 4DXLA 1B62A 2UU9I 1KKHA 3LPSA 3J81C 4X65E 5L3JA 2CGEA 4WUBA 1IBKE 4FWGA 3B78A 4LF5I 1H7SA 4X64E 1FWKA 4AQYE 1IBME 4DPUA 4JI1E 4IZJA 4HYMA 3H4LA 1HNXI 2Z5EA 4B3TE 2O1WA 2ZM6I 4DV7E 4DU8A 3OTOE 1USUA 3K17A 5LMUI 1OJ4A 4K0KI 4DV5E 4LF8I 1ZM9A 4IZJD 1ZXNA 1A6FA 4R1FA 1Z0EA 1IBMI 3J80Q 4WUDA 4LFCI 4DR6I 1K47A 2A2DA 2UXCE 1EI1A 4B3TI 2AJ4A 4X62I 1Z0WA 1FKAE 3J7AM 4KHPE 1XHKA 2V2QA 5GMEA 1XMQI 2VQFE 4ZVIA 3GONA 2Q2EB 1FI4A 3HJCA 4EMDA 4FWHA 2CZ9A 1NHIA 4DV6I 4LF7E 4FW9A 4JI6E 1D6TA 4DR4I 2O1VA 2EFGA 2UUAE 3HULA 5FLXC 3ZZTA 4P7AA 2F4VE 1USVA 3WU3A 4JI3E 3Q6MA 4LFAI 2X36A 4KHPI 4JV5E 4IZKB 2V8PA 5FWKA 3WU5A 2UXBI 1NHJA 2XEXA 1BKNA 2DEJA 1ZM2A 5IT9Q 4X62E 4GKKE 4LF9I 1N36E 2HHHI 5LMUE 4JG4A 3Q1QA 5FLXQ 4LFCE 4DR6E 4HACA 4YHHI 4XTJA 4JI7E 1N33I 1FJGE 3JAMC 4UTGA 1FWLA 1Y4SA 4LF6E 2Z5BB 3ZZ0A 1S4EA 1J5EI 4JI5I 2PNMA 4GKKI 3PYFA 3QT6A 1RR9A 2UUBI 4NXNI 2UXBE 2HK2A 3Q6NA 4DR2E 4B3MI 4URLA 4DR7E 4YY3E 2CG9A 2HK3A 1IBLI 3J7AG 3PRYA 2BM0A 2F4VI 3ZKDA 3K1JA 4DV4I 1IBLE 3B82A 1PVGA 1Z0GA 4DPYA 4JI0E 1HR0E 3WU6A 4B3RE 5GMDA 1HNZE 4OX9I 1QZRA 4LF7I 4DV6E 2UUCI 4USKA 1Z5BA 1Z0BA 2UUBE 4Z7CA 3T1HE 1U2RA 1XNRE 4GKJE 1Y6ZA 2IOPA 1XNRI 1Z5CA 1Z59A 3QT5A 1XMQE 3ZZUA 3LNUA 2V2VA 1N0UA 4DR5I 4JI4I 2ZITA 2V34A 4MYUA 1N32I 3M6AA 1S16A 4B3SI 3QT8A 2UXCI 4K0KE 2GQ0A 4X66I 1ELOA 1N34E 3F0NA 3LTOA 1VISA 3J80C 3B8HA 4FWDA 4LF9E 4HACB 2DEIA 3PYDA 1MU5A 4DV5I 4AQYI 4ED4A 2PNLA 1H74A 1HNWE 4DR2I 4B3ME 5A2QQ 2HKJA 2NPFA 1HNXE 2UU9E 2J7KA 4LFAE 5BR8E 4DV3E 2BM1A 2ZBKB 4Z7YA 4X64I 1NZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX0 A;  4RPF A;  4DR4 E;  1ZXM A;  4LF6 I;  4JI2 E;  4JI6 I;  1WUU A;  2UXD E;  1XNQ E;  1FJG I;  1N0V C;  1N33 E;  1KVK A;  1XMO E;  1MG7 A;  1UEK A;  4DUZ I;  4LF4 E;  4I3H A;  4X66 E;  4GKJ I;  2E5L E;  3T1Y I;  2VQE E;  2VQF I;  1ZM3 A;  5IWA E;  3J81 Q;  2UUC E;  4P52 A;  5IWA I;  1Z0V A;  4KQV A;  4DU7 A;  4HXZ A;  4MYT A;  4DV2 E;  3T1Y E;  4JI0 I;  1EA6 A;  2LJP A;  4JV5 I;  4NXM E;  2X7I A;  1PKP A;  4DPX A;  3D4J A;  4LFB I;  4LF8 E;  4DV1 I;  1I94 I;  1H73 A;  1ZM4 A;  2BV3 A;  4DR3 I;  1Z0C A;  4JI2 I;  3OTO I;  3V2U C;  4PU9 A;  5LL6 R;  4DV0 I;  2UXD I;  1H7U A;  3ZKB A;  4YY3 I;  1FNM A;  1J5E E;  4JI5 E;  4USM A;  1HNW I;  4PRX A;  4X65 I;  1PIE A;  1RRE A;  2HKE A;  4DV3 I;  2WW4 A;  4DV0 E;  4JI7 I;  4YHH E;  1H72 C;  4M1K A;  2A2C A;  1DAR A;  5A2Q C;  4DR3 E;  1N36 I;  2HHH E;  4B3S E;  1N32 E;  5IT9 C;  4LFB E;  3CWV A;  4UT4 A;  4NXM I;  5LMN I;  4PRV A;  3PYG A;  2ZM6 E;  2HFS A;  1B63 A;  4DV7 I;  1N34 I;  4JYA E;  1NHH A;  4DV1 E;  4DV2 I;  1I94 E;  3T1H I;  4JI1 I;  4DPW A;  2R42 A;  4DR5 E;  4JI4 E;  2OI2 A;  2E1R A;  4JI3 I;  4FN5 A;  2GS8 A;  1Z5A A;  4WUC A;  3V5R A;  2V2Z A;  4LF5 E;  1KIJ A;  4JYA I;  1IBK I;  1HR0 I;  4B3R I;  4LF4 I;  4DPT A;  5LMN E;  1XMO I;  3ZM7 A;  4DR1 I;  4DV4 E;  2VF3 A;  2VQE I;  3WU4 A;  4OX9 E;  1HNZ I;  4JI8 I;  4DUY E;  2UUA I;  2E5L I;  1Z0T A;  4HY1 A;  4DUZ E;  4DR7 I;  4DUY I;  4JI8 E;  3JAM Q;  4NXN E;  2R3V A;  3PYE A;  2HFU A;  1XNQ I;  1KTV A;  5BR8 I;  4DR1 E;  3QT7 A;  4DXL A;  1B62 A;  1KKH A;  3LPS A;  3J81 C;  2UU9 I;  4X65 E;  5L3J A;  4WUB A;  1IBK E;  4FWG A;  3B78 A;  4LF5 I;  1H7S A;  4X64 E;  1FWK A;  4AQY E;  1IBM E;  4DPU A;  4JI1 E;  4HYM A;  3H4L A;  1HNX I;  4B3T E;  2ZM6 I;  4DV7 E;  4DU8 A;  3OTO E;  3K17 A;  5LMU I;  1OJ4 A;  4K0K I;  4DV5 E;  4LF8 I;  1ZM9 A;  1ZXN A;  1A6F A;  4R1F A;  1Z0E A;  1IBM I;  3J80 Q;  4WUD A;  4LFC I;  4DR6 I;  1K47 A;  2A2D A;  2UXC E;  1EI1 A;  4B3T I;  2AJ4 A;  4X62 I;  1Z0W A;  1FKA E;  3J7A M;  4KHP E;  1XHK A;  2V2Q A;  5GME A;  1XMQ I;  2VQF E;  4ZVI A;  3GON A;  2Q2E B;  1FI4 A;  4EMD A;  4FWH A;  2CZ9 A;  1NHI A;  4DV6 I;  4LF7 E;  4FW9 A;  4JI6 E;  1D6T A;  4DR4 I;  2EFG A;  2UUA E;  3HUL A;  5FLX C;  3ZZT A;  4P7A A;  2F4V E;  3WU3 A;  4JI3 E;  4LFA I;  2X36 A;  4KHP I;  4JV5 E;  2V8P A;  3WU5 A;  2UXB I;  1NHJ A;  2XEX A;  1BKN A;  2DEJ A;  1ZM2 A;  5IT9 Q;  4X62 E;  4GKK E;  4LF9 I;  1N36 E;  2HHH I;  5LMU E;  4JG4 A;  3Q1Q A;  5FLX Q;  4LFC E;  4DR6 E;  4HAC A;  4YHH I;  4XTJ A;  4JI7 E;  1N33 I;  1FJG E;  3JAM C;  4UTG A;  1FWL A;  4LF6 E;  3ZZ0 A;  1S4E A;  4JI5 I;  1J5E I;  4GKK I;  3PYF A;  3QT6 A;  1RR9 A;  2UUB I;  4NXN I;  2UXB E;  2HK2 A;  4DR2 E;  4B3M I;  4URL A;  4DR7 E;  4YY3 E;  2HK3 A;  1IBL I;  3J7A G;  2BM0 A;  2F4V I;  3ZKD A;  3K1J A;  4DV4 I;  1IBL E;  3B82 A;  1PVG A;  1Z0G A;  4DPY A;  4JI0 E;  1HR0 E;  3WU6 A;  4B3R E;  5GMD A;  1HNZ E;  4OX9 I;  1QZR A;  4LF7 I;  4DV6 E;  2UUC I;  4USK A;  1Z5B A;  1Z0B A;  2UUB E;  4Z7C A;  3T1H E;  1U2R A;  1XNR E;  4GKJ E;  1XNR I;  1Z5C A;  1Z59 A;  3QT5 A;  1XMQ E;  3ZZU A;  3LNU A;  2V2V A;  1N0U A;  4DR5 I;  4JI4 I;  2ZIT A;  2V34 A;  4MYU A;  1N32 I;  3M6A A;  1S16 A;  4B3S I;  3QT8 A;  2UXC I;  4K0K E;  4X66 I;  1ELO A;  1N34 E;  3F0N A;  3LTO A;  1VIS A;  3J80 C;  3B8H A;  4FWD A;  4LF9 E;  4HAC B;  2DEI A;  3PYD A;  1MU5 A;  4DV5 I;  4AQY I;  4ED4 A;  1H74 A;  1HNW E;  4DR2 I;  4B3M E;  5A2Q Q;  2HKJ A;  2NPF A;  1HNX E;  2UU9 E;  2J7K A;  4LFA E;  5BR8 E;  4DV3 E;  2BM1 A;  2ZBK B;  4Z7Y A;  4X64 I;  1NZ0 A; 
#chains in the Genus database with same CATH topology
 1MX0 A;  4RPF A;  4DR4 E;  1ZXM A;  5DNX A;  4LF6 I;  4JI2 E;  4JI6 I;  1WUU A;  2UXD E;  1XNQ E;  1FJG I;  1N0V C;  2WP8 A;  1N33 E;  1KVK A;  1XMO E;  3H1C A;  4OZE A;  2WNR A;  1MG7 A;  1UEK A;  4DUZ I;  5C0X D;  5C0X B;  5K36 E;  4LF4 E;  4I3H A;  4X66 E;  4GKJ I;  2E5L E;  3P06 A;  3T1Y I;  2VQE E;  2VQF I;  3NZK A;  1ZM3 A;  2BA1 D;  5IWA E;  3J81 Q;  2UUC E;  4P52 A;  5IWA I;  1Z0V A;  2C37 B;  4KQV A;  4LCF A;  1OYP A;  4DU7 A;  4HXZ A;  1Y4U A;  4MYT A;  4DV2 E;  4LCH A;  3T1Y E;  5K36 D;  4JI0 I;  1EA6 A;  5K36 F;  2LJP A;  4JV5 I;  4NXM E;  2X7I A;  1PKP A;  4DPX A;  3D4J A;  1UDO A;  4LFB I;  4LF8 E;  4DV1 I;  1I94 I;  2IER A;  5DRO A;  1H73 A;  1ZM4 A;  2O3Z A;  2BV3 A;  4DR3 I;  1Z0C A;  4JI2 I;  3OTO I;  3V2U C;  4IFD D;  4PU9 A;  2C39 A;  1UDN A;  5LL6 R;  5K36 B;  4LOM A;  4DV0 I;  2BA0 G;  2UXD I;  1H7U A;  3ZKB A;  4YY3 I;  1FNM A;  1J5E E;  4JI5 E;  4USM A;  1HNW I;  4PRX A;  4X65 I;  1PIE A;  1RRE A;  2HKE A;  5JEA B;  5K36 C;  4DV3 I;  5ELW A;  2WW4 A;  2O1T A;  4DV0 E;  5DRR A;  2NN6 F;  4QNJ A;  4JI7 I;  2BA0 D;  2BR2 A;  1OYR A;  4YHH E;  4OO1 E;  1H72 C;  4M1K A;  2A2C A;  1DAR A;  5A2Q C;  5K36 A;  4DR3 E;  1N36 I;  2HHH E;  4B3S E;  3P3G A;  2Z5C B;  1N32 E;  5IT9 C;  1HK7 A;  4LFB E;  3CWV A;  2BA1 G;  5JEA F;  4MU4 A;  4UT4 A;  2Z5B A;  4NXM I;  5LMN I;  2JT2 A;  4PRV A;  3PYG A;  2ZM6 E;  2HFS A;  1B63 A;  4DV7 I;  1N34 I;  2PO1 A;  4JYA E;  1NHH A;  4DV1 E;  4DV2 I;  1I94 E;  4N3O A;  3T1H I;  4DPW A;  4JI1 I;  5EKW A;  2R42 A;  1E3P A;  3L7Z B;  2OI2 A;  4DR5 E;  2E1R A;  4JI4 E;  2PO2 A;  4J3D A;  2PO0 B;  4JI3 I;  4FN5 A;  2GS8 A;  1Z5A A;  4WUC A;  3V5R A;  2V2Z A;  4LF5 E;  1KIJ A;  2O1U A;  4JYA I;  1IBK I;  1HR0 I;  4B3R I;  4LF4 I;  4DPT A;  2Z5C A;  5LMN E;  1XMO I;  3ZM7 A;  3DD6 A;  4DR1 I;  4DV4 E;  2C38 B;  2VF3 A;  2VQE I;  4LPF A;  3WU4 A;  2F1D A;  2WNR B;  4AID A;  3K85 A;  1HNZ I;  4OX9 E;  4JI8 I;  4DUY E;  2UUA I;  2E5L I;  1Z0T A;  4IZJ B;  4HY1 A;  4DUZ E;  1YHC A;  4DR7 I;  4DUY I;  4JI8 E;  3PS1 A;  3JAM Q;  4NXN E;  2R3V A;  3PYE A;  2HFU A;  5JEA C;  1XNQ I;  1KTV A;  5BR8 I;  2IOQ A;  4DR1 E;  1R6M A;  4IZK A;  5C0X E;  2NN6 D;  3QT7 A;  4DXL A;  4MDT A;  1B62 A;  1KKH A;  3LPS A;  3J81 C;  2UU9 I;  4X65 E;  1Y5Y A;  5L3J A;  2CGE A;  4WUB A;  1VI7 A;  1IBK E;  4FWG A;  4BA2 B;  3B78 A;  4OO1 A;  4LF5 I;  1H7S A;  2VES A;  4X64 E;  1FWK A;  4AQY E;  3GME A;  1IBM E;  2NN6 E;  4DPU A;  4MQY A;  4JI1 E;  4IZJ A;  4HYM A;  3H4L A;  1HNX I;  4FW3 A;  2Z5E A;  3GCM A;  4B3T E;  3P3E A;  5DRP A;  2O1W A;  2ZM6 I;  4DV7 E;  4DU8 A;  3OTO E;  1USU A;  3K17 A;  5LMU I;  1OJ4 A;  4K0K I;  4DV5 E;  4LF8 I;  1ZM9 A;  4IZJ D;  4FW6 A;  4AIM A;  1ZXN A;  1A6F A;  4R1F A;  1Z0E A;  1IBM I;  3J80 Q;  4OKG A;  4WUD A;  4LFC I;  3M85 D;  2NN6 C;  4DR6 I;  1K47 A;  2A2D A;  2UXC E;  1EI1 A;  4B3T I;  2AJ4 A;  4X62 I;  1Z0W A;  1FKA E;  3J7A M;  2PO1 B;  4KHP E;  5EL9 A;  1XHK A;  2V2Q A;  5GME A;  1XMQ I;  2VQF E;  4ZVI A;  3GON A;  2NN6 B;  2PO2 B;  2Q2E B;  2PO0 A;  1FI4 A;  2C37 A;  5JEA E;  4MU3 A;  3HJC A;  4EMD A;  4GQU A;  3U1Y A;  4FW7 A;  4AM3 A;  4FWH A;  2CZ9 A;  1NHI A;  2PNZ B;  4DV6 I;  2AE8 A;  4LF7 E;  4FW9 A;  3U1K A;  5C0X A;  4MU1 A;  4JI6 E;  1D6T A;  4FW5 A;  1Y60 A;  4DR4 I;  2O1V A;  2EFG A;  2UUA E;  3HUL A;  5FLX C;  4QNK A;  3ZZT A;  4P7A A;  2F4V E;  1USV A;  3WU3 A;  4JI3 E;  3Q6M A;  2NN6 A;  4LFA I;  2X36 A;  4KHP I;  4JV5 E;  4IFD F;  4IZK B;  2V8P A;  5FWK A;  3WU5 A;  2UXB I;  2GO3 A;  1NHJ A;  4BA2 A;  2XEX A;  3M7N G;  2J65 A;  1BKN A;  1ZM2 A;  2DEJ A;  5IT9 Q;  4OO1 C;  4X62 E;  4OO1 F;  4GKK E;  4LF9 I;  4IFD E;  1N36 E;  2HHH I;  5LMU E;  2JEB A;  3GLL A;  4JG4 A;  3Q1Q A;  5FLX Q;  4LFC E;  2CVE A;  4DR6 E;  4HAC A;  1RHY A;  4YHH I;  4XTJ A;  4JI7 E;  1N33 I;  2IES A;  1FJG E;  3JAM C;  5DNL A;  4UTG A;  1FWL A;  1Y4S A;  4LF6 E;  4OO1 B;  3PS2 A;  2Z5B B;  4ISA A;  3ZZ0 A;  1S4E A;  1UDQ A;  5JEA A;  3B4T A;  1J5E I;  4JI5 I;  2PNM A;  3M85 G;  4BA1 A;  2JEA B;  4GKK I;  3PYF A;  3QT6 A;  1RR9 A;  2UUB I;  2BR2 B;  4NXN I;  2UXB E;  4OO1 D;  2HK2 A;  3Q6N A;  4DR2 E;  4B3M I;  4URL A;  4DR7 E;  4YY3 E;  2CG9 A;  1R6L A;  2HK3 A;  3CDJ A;  5DRQ A;  2WP8 B;  1IBL I;  3J7A G;  3PRY A;  2BM0 A;  4U3D A;  2F4V I;  3ZKD A;  2PNZ A;  3K1J A;  4DV4 I;  1IBL E;  3B82 A;  1PVG A;  1Z0G A;  4BA1 B;  4DPY A;  4JI0 E;  1HR0 E;  3WU6 A;  4B3R E;  5GMD A;  1HNZ E;  4OX9 I;  4FW4 A;  4MU0 A;  1QZR A;  4LF7 I;  4DV6 E;  1XXE A;  4NBQ A;  2UUC I;  4USK A;  1Z5B A;  1Z0B A;  4IS9 A;  5C0X C;  3KRN A;  2GO4 A;  2UUB E;  4Z7C A;  3T1H E;  1P42 A;  1U2R A;  3PS3 A;  1XNR E;  4GKJ E;  4IFD A;  1Y6Z A;  2IOP A;  1XNR I;  1Z5C A;  1Z59 A;  2C38 A;  3QT5 A;  1XMQ E;  3ZZU A;  3LNU A;  2V2V A;  1N0U A;  4DR5 I;  4JI4 I;  2ZIT A;  2V34 A;  4MYU A;  5JEA D;  1N32 I;  3M6A A;  1S16 A;  4B3S I;  3QT8 A;  2UXC I;  4K0K E;  2GQ0 A;  4X66 I;  1ELO A;  1N34 E;  4IFD C;  3CDI A;  3F0N A;  1E3H A;  2C39 B;  5C0X F;  2JE6 B;  3LTO A;  1VIS A;  3J80 C;  3B8H A;  4FWD A;  4LF9 E;  4HAC B;  2DEI A;  3HKM A;  1MU5 A;  3PYD A;  4DV5 I;  4AQY I;  4IFD B;  3P3C A;  4ED4 A;  2PNL A;  1H74 A;  1HNW E;  4DR2 I;  4B3M E;  3UHM A;  5A2Q Q;  2HKJ A;  2NPF A;  3P76 A;  1HNX E;  2UU9 E;  2J7K A;  4U3B A;  3M7N D;  2JEA A;  4LFA E;  4LCG A;  1UDS A;  5BR8 E;  1OYS A;  1YH8 A;  4DV3 E;  2BM1 A;  2ZBK B;  3L7Z A;  4Z7Y A;  4X64 I;  2JEB B;  1NZ0 A;  2JE6 A; 
#chains in the Genus database with same CATH homology
 1MX0 A;  4RPF A;  4DR4 E;  1ZXM A;  4LF6 I;  4JI2 E;  4JI6 I;  1WUU A;  2UXD E;  1XNQ E;  1FJG I;  1N0V C;  1N33 E;  1KVK A;  1XMO E;  1MG7 A;  1UEK A;  4DUZ I;  4LF4 E;  4I3H A;  4X66 E;  4GKJ I;  2E5L E;  3P06 A;  3T1Y I;  2VQE E;  2VQF I;  1ZM3 A;  5IWA E;  3J81 Q;  2UUC E;  4P52 A;  5IWA I;  1Z0V A;  4KQV A;  4DU7 A;  4HXZ A;  1Y4U A;  4MYT A;  4DV2 E;  3T1Y E;  4JI0 I;  1EA6 A;  2LJP A;  4JV5 I;  4NXM E;  2X7I A;  1PKP A;  4DPX A;  3D4J A;  4LFB I;  4LF8 E;  4DV1 I;  1I94 I;  1H73 A;  1ZM4 A;  2BV3 A;  4DR3 I;  1Z0C A;  4JI2 I;  3OTO I;  3V2U C;  4PU9 A;  5LL6 R;  4DV0 I;  2UXD I;  1H7U A;  3ZKB A;  4YY3 I;  1FNM A;  1J5E E;  4JI5 E;  4USM A;  1HNW I;  4PRX A;  4X65 I;  1PIE A;  1RRE A;  2HKE A;  4DV3 I;  2WW4 A;  2O1T A;  4DV0 E;  4JI7 I;  4YHH E;  1H72 C;  4M1K A;  2A2C A;  1DAR A;  5A2Q C;  4DR3 E;  2HHH E;  1N36 I;  4B3S E;  2Z5C B;  1N32 E;  5IT9 C;  1HK7 A;  4LFB E;  3CWV A;  4UT4 A;  2Z5B A;  4NXM I;  5LMN I;  4PRV A;  3PYG A;  2ZM6 E;  2HFS A;  1B63 A;  4DV7 I;  1N34 I;  4JYA E;  1NHH A;  4DV1 E;  4DV2 I;  1I94 E;  4N3O A;  3T1H I;  4JI1 I;  4DPW A;  2R42 A;  4DR5 E;  4JI4 E;  2OI2 A;  2E1R A;  4JI3 I;  4FN5 A;  2GS8 A;  1Z5A A;  4WUC A;  3V5R A;  2V2Z A;  4LF5 E;  1KIJ A;  2O1U A;  4JYA I;  1IBK I;  1HR0 I;  4B3R I;  4LF4 I;  4DPT A;  2Z5C A;  5LMN E;  1XMO I;  3ZM7 A;  4DR1 I;  4DV4 E;  2VF3 A;  2VQE I;  3WU4 A;  3K85 A;  1HNZ I;  4OX9 E;  4JI8 I;  4DUY E;  2UUA I;  2E5L I;  1Z0T A;  4IZJ B;  4HY1 A;  4DUZ E;  4DR7 I;  4DUY I;  4JI8 E;  3JAM Q;  4NXN E;  2R3V A;  3PYE A;  2HFU A;  1XNQ I;  1KTV A;  5BR8 I;  2IOQ A;  4DR1 E;  4IZK A;  3QT7 A;  4DXL A;  1B62 A;  2UU9 I;  1KKH A;  3LPS A;  3J81 C;  4X65 E;  5L3J A;  2CGE A;  4WUB A;  1IBK E;  4FWG A;  3B78 A;  4LF5 I;  1H7S A;  4X64 E;  1FWK A;  4AQY E;  1IBM E;  4DPU A;  4JI1 E;  4IZJ A;  4HYM A;  3H4L A;  1HNX I;  2Z5E A;  4B3T E;  2O1W A;  2ZM6 I;  4DV7 E;  4DU8 A;  3OTO E;  1USU A;  3K17 A;  5LMU I;  1OJ4 A;  4K0K I;  4DV5 E;  4LF8 I;  1ZM9 A;  4IZJ D;  1ZXN A;  1A6F A;  4R1F A;  1Z0E A;  1IBM I;  3J80 Q;  4WUD A;  4LFC I;  4DR6 I;  1K47 A;  2A2D A;  2UXC E;  1EI1 A;  4B3T I;  2AJ4 A;  4X62 I;  1Z0W A;  1FKA E;  3J7A M;  4KHP E;  1XHK A;  2V2Q A;  5GME A;  1XMQ I;  2VQF E;  4ZVI A;  3GON A;  2Q2E B;  1FI4 A;  3HJC A;  4EMD A;  4FWH A;  2CZ9 A;  1NHI A;  4DV6 I;  4LF7 E;  4FW9 A;  4JI6 E;  1D6T A;  4DR4 I;  2O1V A;  2EFG A;  2UUA E;  3HUL A;  5FLX C;  3ZZT A;  4P7A A;  2F4V E;  1USV A;  3WU3 A;  4JI3 E;  3Q6M A;  4LFA I;  2X36 A;  4KHP I;  4JV5 E;  4IZK B;  2V8P A;  5FWK A;  3WU5 A;  2UXB I;  1NHJ A;  2XEX A;  1BKN A;  2DEJ A;  1ZM2 A;  5IT9 Q;  4X62 E;  4GKK E;  4LF9 I;  1N36 E;  2HHH I;  5LMU E;  4JG4 A;  3Q1Q A;  5FLX Q;  4LFC E;  4DR6 E;  4HAC A;  4YHH I;  4XTJ A;  4JI7 E;  1N33 I;  1FJG E;  3JAM C;  4UTG A;  1FWL A;  1Y4S A;  4LF6 E;  2Z5B B;  3ZZ0 A;  1S4E A;  1J5E I;  4JI5 I;  2PNM A;  4GKK I;  3PYF A;  3QT6 A;  1RR9 A;  2UUB I;  4NXN I;  2UXB E;  2HK2 A;  3Q6N A;  4DR2 E;  4B3M I;  4URL A;  4DR7 E;  4YY3 E;  2CG9 A;  2HK3 A;  1IBL I;  3J7A G;  3PRY A;  2BM0 A;  2F4V I;  3ZKD A;  3K1J A;  4DV4 I;  1IBL E;  3B82 A;  1PVG A;  1Z0G A;  4DPY A;  4JI0 E;  1HR0 E;  3WU6 A;  4B3R E;  5GMD A;  1HNZ E;  4OX9 I;  1QZR A;  4LF7 I;  4DV6 E;  2UUC I;  4USK A;  1Z5B A;  1Z0B A;  2UUB E;  4Z7C A;  3T1H E;  1U2R A;  1XNR E;  4GKJ E;  1Y6Z A;  2IOP A;  1XNR I;  1Z5C A;  1Z59 A;  3QT5 A;  1XMQ E;  3ZZU A;  3LNU A;  2V2V A;  1N0U A;  4DR5 I;  4JI4 I;  2ZIT A;  2V34 A;  4MYU A;  1N32 I;  3M6A A;  1S16 A;  4B3S I;  3QT8 A;  2UXC I;  4K0K E;  2GQ0 A;  4X66 I;  1ELO A;  1N34 E;  3F0N A;  3LTO A;  1VIS A;  3J80 C;  3B8H A;  4FWD A;  4LF9 E;  4HAC B;  2DEI A;  3PYD A;  1MU5 A;  4DV5 I;  4AQY I;  4ED4 A;  2PNL A;  1H74 A;  1HNW E;  4DR2 I;  4B3M E;  5A2Q Q;  2HKJ A;  2NPF A;  1HNX E;  2UU9 E;  2J7K A;  4LFA E;  5BR8 E;  4DV3 E;  2BM1 A;  2ZBK B;  4Z7Y A;  4X64 I;  1NZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...