1D7AA

Crystal structure of e. coli pure-mononucleotide complex.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli PurE, an unusual mutase in the purine biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE
total genus 47
structure length 161
sequence length 161
chains with identical sequence B, C, D, L, M, N, O
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1d7aA00
2NSHA 3OPQA 4YCDA 5CTJA 5CLJA 2FW6A 4ZMBA 1O4VA 4GRDA 3OOWA 2FW7A 3RG8A 2NSLA 5C5DA 4ZC8A 2FWIA 4ZJYA 4AY3A 1XMPA 2NSJA 4AY4A 2YWXA 4YCJA 3KUUA 1QCZA 3TRHA 1U11A 2ATEA 2FW9A 3LP6A 5CVTA 5BORA 4Z7JA 1D7AA 5CLHA 4ZK2A 2FWPA 2FWBA 4JA0A 5BOSA 2FW8A 5CLFA 5BOSB 5CLIA 2FWAA 5CLGA 4YCBA 2FW1A 3ORSA 2H31A 3RGGA 4YCCA 2FWJA 4B4KA
chains in the Genus database with same CATH superfamily
4BWVA 1HZJA 1TO1E 3BA1A 4G6ZA 5BSEA 1CNEA 1F51E 3QVWA 2WYWA 4MA4A 5AHWA 2LNDA 3PHGA 1C7JA 2RHHA 5ELXA 2GOYA 1U0EA 3O9VA 1PL0A 4MNTA 4UTPA 3SM9A 5CFMA 1AKUA 2W2OA 1S8FA 3WGLA 1H4QA 3LOUA 3CZPA 3MWDA 1MQSA 5J2UB 3DOCA 1EX6A 3K8QA 4KXLA 4PO9A 4AD8A 4K9NA 4F3RA 4XI9A 3CSSA 3ENZA 3IELA 5CURA 4DYDA 1Q19A 1CLUA 4MWGA 3GNLA 5ICMA 3ZVNA 6GPBA 3CUSA 4GQAA 4TSKA 1M7BA 2QX9A 4I5GA 1I9GA 5JS2A 4HBGA 1NW5A 1C1XB 3F5MA 3LU1A 3OZVA 1PJ4A 4M76B 5IUKC 3ZNNA 2VP2A 4GLOA 4R1UA 3REGA 2F55A 4NWIA 2ZM5A 2BCJQ 4YDHB 3AEUA 3H8WA 3HKEA 4AJ1A 5A4KA 3EZLA 2XECA 1ZD9A 4ME6A 2FSPA 3GLIA 3DO5A 3R0VA 3MJEA 4PHGA 3PNSA 4NARA 2P9TA 5I7SA 5KQSA 2BZ1A 4ZCIA 4ER5A 4IILA 4H31A 3TR5A 1W5BA 5IZCA 1SU8A 4XDHA 2QUZA 3BXGA 3R3YA 5LN1A 4X8MA 1BROA 3V8EA 1L7BA 3UENA 3DM5A 1BA3A 1ID1A 1Z5WA 1PHPA 3FTCA 4JBGA 4JJKA 2AXPA 4CXMA 5B6JA 3VPCA 3WHLA 1PYGA 1EVEA 1OUMA 3E1KA 1QHXA 3SLKA 2DTEA 3TGLA 5HMLA 3K9BA 1Z45A 3C2QA 3KSMA 1OH7A 4N54A 2V55B 1GCOA 3C6XA 3QM1A 2WSLA 3MTAA 4KO4S 4NJEA 4DE5A 3H4VA 3W8EA 1JDUA 2UUOA 4ZZ0A 4PE5B 4MVJP 5DNVA 3NETA 2OV4A 3MJDA 2XIQA 4B17A 4F4DA 3JYPA 5KVAA 1I51A 2EJUA 4I4CA 4YP5A 2W6ZA 1CQWA 3LGAA 1O0CA 2QTVA 4GXRA 3G9ZA 1QYXA 4PC6A 2HW8A 1JPNA 2ZCJA 5TXGA 3S2YA 5AVKA 1E64A 1Z13A 3N53A 1H1TA 1VHJA 2P5SA 4BJ5A 1RXCA 2JFWA 1PGPA 3LYLA 4HQFA 3LX4A 5G3YA 4HYYA 3HN7A 1Z26A 3AR5A 1DKOA 3O8CA 3U3DA 2Y1DA 2VJDA 2E1PA 3PGLA 1JX6A 4RJ2A 1TAUA 4P3YA 1TT7A 4DBLE 2LCFA 2ZJOA 3DGEC 5J4VA 1JT9A 2PGXA 1AQNA 1E2GA 4J90A 1KNXA 3LOQA 3RYHB 5TQ0A 4KYTA 3KOOA 1WHTA 2VCEA 3TXYA 3G88A 3DOEA 1Q0TA 1OU0A 5IAAA 3ZHYA 2PZKA 1KZ9A 4EX7A 2IUEA 4V3BA 3V3TA 5HKOA 1QPZA 1PWXA 3R3XA 4TN1A 1YZLA 5J2TB 1V71A 3FNGA 4IV0A 4G89A 2CY0A 3FDZB 4N0MA 2B21A 3BXPA 4IIHA 5IJAA 1EK6A 1Z83A 3C70A 2B4AA 3BRWD 5FAXA 1N3BA 4GF5A 3BIOA 1TADA 4MIEA 2PRIA 3CLRC 4WLVA 1QIMA 4HZIA 3AY7A 1ZMBA 3DW1X 2RBKA 3P9QA 4AO7A 2FN4A 2R62A 3UW3A 1V4NA 1RLJA 2HI0A 3JVEA 2ZIXA 2DTDA 4ZZ1A 2B4RO 4F45A 3CG4A 1AS0A 4RHFA 5BWLA 5I4IA 4YI3A 1ZNYA 3HCFA 3O95A 1SVIA 1YR1A 4HXGA 3DLHA 4BMCA 5K3CA 3MA0A 3PFFA 1C9NA 2VZEA 2JGDB 4H9GA 4LBYA 1VMEA 1J4AA 2IEZA 1H2EA 4MW2A 2AC4A 4Z4GA 2KLBA 2QRQA 4NPCA 2FOXA 4NBTA 1P60A 5AM5A 4E5YA 3ZYCA 1S0UA 3AF4A 5F64A 4DUYB 3K94A 4ZK6A 3FYHA 3QG5A 2HX1A 2V5VA 3IPCA 3RUHA 1FFXA 4R8SA 5IRCD 2OYSA 2XZOA 1FS6A 3HMQA 4Q5IA 4MEJA 1U0BB 3QELB 1BXGA 3ESAA 5E3IA 4KIUA 5BVGB 4EMBA 2Z6QA 1EUDA 3ENWA 3O8BA 4M9SA 5JCZA 2XB9A 5AOAA 3AF1A 3R44A 4J0QA 1WXXA 3TNJA 3FPJA 4ZI7F 4YWHA 4Z3KA 3NWBA 1JDBB 3MFQA 2VHJA 1XHEA 3GIWA 3RF6A 1M9NA 4QECA 1WULS 5U4QA 3V2UA 4PIPA 4DQDA 4LE2A 5JLAA 2P6PA 2GN8A 4NZMA 4C7JA 1Z6ZA 1LF5A 4X62B 4LDZA 2BSAA 4UNNA 1FFDA 2EP5A 1OYVA 1BH6A 1RW4A 2NUTB 2OCDA 3PD1A 4TLDA 5A6SB 5B12A 3KQNA 1IY8A 2J07A 1GN8A 3CO5A 3MMSA 4LC9A 1AQLA 1QOQB 1YULA 2VTDA 4Y0AA 2V6BA 2ADMA 2HHCA 3MRTA 3IQXA 1GV0A 5LBIA 1KSGA 4HH1A 4TUYF 4RVCA 5AVXA 2QZJA 3RUIA 4MVWA 1Q1EA 4RIEA 3LDFA 3A7DA 3N7UA 1P2GA 1LSUA 1MQ9A 3BCUA 4QOHA 2DCMA 2XE8A 1E94E 1J0CA 4FLMA 1FOEB 1NBOA 2V97A 1U7ZA 4GQBA 1I1NA 5T6BA 5A5VA 3OZXA 1INLA 1G8JA 1OXVA 1DQPA 1OLOA 2XRYA 1XMPA 4HTFB 3EC7A 4AT1A 4MUJA 4UEOA 2YX1A 5KYWB 3NBXX 4QBHA 4MLZA 2JLWA 4KXYA 1Z36A 2YJ6A 4B34A 1W52X 1M2VB 2XNJA 3HFRA 3RRFA 2VPZA 1L3CA 2REBA 3JARA 1SXJD 3GL9A 4LPKA 3S99A 4IQ8A 1X77A 5AVRA 4IGAA 1IRIA 4JSRA 3PWZA 4HLNA 1ULBA 3M3PA 4JROA 3MWLA 5LL6P 1CEXA 1N4AA 2WTBA 3RYHA 5EXSA 4QDUA 3K0CC 2O3QA 2GHIA 2C5SA 2WG2A 1CUZA 3V80A 2RC6A 4UTNA 2PD6A 3V42A 1TEVA 2LR0A 4U63A 4KTVE 1IXRC 2EKQA 1Z8FA 2WJJA 3M33A 4D8XA 2Z6VA 3GDOA 3ND7A 2FRDC 3CVOA 4WOPA 3UMSA 4BO2A 4B79A 3KUUA 2HQRA 5H4GA 2BFCB 2J4CA 1IMOA 1V11A 3NEYA 1K08A 4Q15A 3ODGA 1N32B 3CRVA 3QBJA 2DPLA 1FTGA 1HL3A 2PL1A 3ZD8A 3K9FC 4FFBA 5LP1A 3GA7A 5JISA 4YQEA 4JJ4A 4E5DA 4CL0A 4BLOA 2EEZA 3H0KA 4KAFA 4BFZA 1BOOA 2GUWA 3I5UA 1UADA 3TEMA 2B1QA 1Y7PA 2OMKA 2R1TB 4FE3A 3RRNA 1RAIA 5I47A 1JG7A 1SNYA 2NZVG 2WJ3A 2DQKA 3OEWA 3P1JA 4MJ3A 1FEZA 2ATIA 1KK1A 1E3SA 1NXXA 2IP2A 2VNJA 1HLDA 1FFGA 2X5OA 3EDMA 5EXPA 1HQKA 5GGYA 1N78A 4PSCA 1Z6QA 2IEGA 4BEJA 1P2FA 4FYVA 2GFIA 5AKYA 5EMHA 3N1UA 3Q7SA 1R0BA 4NZNA 1GZ5A 1O94D 1MIHA 5DLQC 5AVOA 3TDMA 2I4RA 4RJTA 3KQPA 3S40A 1CHDA 1XK6A 1BZYA 1RYZA 5TMDA 3GFBA 1L8QA 1PJBA 1GTZA 3VC1A 1P4RA 2ALJA 3IX7A 1XKQA 1L5VA 1KP2A 2QW0X 4MI9A 2GF2A 1YBFA 5DJ5A 5CFZA 3RBAA 1E7YA 1YMQA 4NC9A 2VAPA 3I01M 2H59A 4FPXA 3IP1A 4NE7A 2GHTA 2BR3A 1P7CA 2FN8A 1U8ZA 2IBMA 3GDGA 3L93A 3BERA 4Y7DA 1AO0A 5FF9A 4G1EB 1NM5A 1YACA 4W1PA 1I32A 4JI5B 4YAIA 3I3OA 3HWWA 3DFKA 2IDZA 2C1EA 1X9GA 3H2HA 5GP1A 4MUHA 2JFGA 2PLWA 5FUBA 2FGJA 3B3QA 4RESA 2HPZA 3FKQA 4D57A 4NJMB 1YZTA 3ST7A 1W8DA 3KHUA 2EIXA 3EEBA 3M6LA 5TJ9A 3ER9A 2PKYX 3FFTA 4M21A 3WSWA 2FXVA 3MXTA 2XMZA 4DW8A 4YUZA 2Y2UA 5A9SB 2WG0A 4U0KA 1J24A 4XWTA 2V7XA 2CNBA 4HDMB 1Y6JA 1H6AA 1R8YA 2VR1A 4GRIA 1RJDA 3QVGA 3KYDB 1UC5B 1RI3A 1UOOA 3SFVA 3TFWA 3WLKX 3WSTA 4JJFA 1IK6A 4BAGA 1M34B 3PNOA 3PZRA 3MS2A 2VYVD 4EPXA 1U9ZA 2ZRAA 3U4GA 2Y27A 4U8HA 4GGPA 4K46A 4RY8A 2G9NA 3LD9A 3ZWDA 2CLSA 1L5OA 3IC5A 2VJPA 3FSGA 1OBFO 3I73A 3U4IA 4JJ7A 3NO4A 4ZWNA 1D1QA 1PJ3A 2OWDA 1CQZA 1FDWA 1QX4A 1G63A 3QWAA 3IQWA 4W8OA 1WPXA 1NC1A 2GEFA 3L0ZA 3OU7A 1WL8A 4L4UA 2Q7XA 1ZGCA 3IBFA 4KE8A 4KQGA 2PMFA 2YZKA 3F6BX 3THWA 1WY5A 4KHZA 1GD1O 5IKEA 4TYWA 1CZHA 2YXLA 1A72A 3HU5A 3C39A 3JRXA 4OVKA 3TVYA 4XTRA 2C84A 4U7HA 1JAHA 4KXXA 2CLLB 3AINA 2GYVA 1B42A 2J67A 4IAOA 4CHGA 4GOOD 5C7OO 4ED9A 1IULA 4QPZA 1R6DA 4BUZA 1MT0A 3ABZA 3BRQA 1PG0A 1E7QA 1YNOA 3FMGA 4MVJE 4X54A 5DTMA 5CX1B 3ZHSA 3MILA 3EQ7A 1U7UA 1D7AA 5ALLA 3U7FB 4Q05A 4WVLA 3GG9A 4P83A 3CLSD 1I4DD 4BEBA 3B3JA 1GRVA 3SZMA 1KI9A 4KXFB 1X7ZB 5A6VA 1QQ6A 1U9YA 3AR9A 4MICA 2NXCA 1B14A 4P7JA 1EFKA 2OBYA 4YRDA 4P38A 3EEOA 2Q1UA 3WFJA 5KOHA 1RJGA 4Q9KA 3NEJA 5IYZA 1OQAA 3SFTA 2C57A 1PZEA 3D5QA 3GEPA 3IBYA 3CF4G 1QPBA 3NHAA 1NUPA 3KAKA 4JN6B 4NZOA 4P4TA 2KJQA 4Y1EA 3FNIA 1GFIA 3WGKA 1XIVA 2PUDA 1PJLA 1SIUA 2H57A 3CEHA 1YAJA 4GO1A 4OG2A 4QUGA 3AV0B 4X61A 5ERXA 1V9CA 1A5ZA 2Q1YA 3OESA 1Z17A 4V1CA 5M34A 4YJ3F 5EERA 4OSOA 1UT8A 2NU7A 2YWHA 2R8EA 1C9YA 1CJUC 2KBFA 4CMIA 3UPUA 5ALSA 4BZWA 4H17A 3GFVA 2O8FA 3DMYA 3DYVA 2PVSA 3PRYA 3ANYB 4UHCA 4RDIA 1U8UA 2OHOA 1T91A 3IUQA 1JJ7A 1TZ2A 2NU8A 1J42A 5LZ8A 4H1UA 2HK7A 4JODA 1WMSA 1YFJA 4L5AA 3KKNA 1X7WA 1IY0A 2A5YB 2R8RA 2VQDA 3DZDA 3BDIA 3IJPA 3OWXA 4Q3DA 1AO3A 1DAMA 2JKZA 3F7MA 4Z0PA 1AQJA 4PV7A 2YYSA 2X9QA 5KJ6A 2VQ6A 3T0FA 2JFNA 1SCIA 3OJCA 4DV3B 1FXWF 2WABA 4O4JA 4RZUA 3H9GA 5LDGA 4YRQA 4B83A 1NSTA 3VU9B 1QUEA 5FKJA 2V4ZA 2C94A 3L6DA 3Q10A 4BFCA 5KNDA 4NBWA 1OTYA 1E2BA 1AQUA 1XN1A 1M67A 4RQBA 4FM9A 4KLCA 4EVQA 4GLJA 3VZDA 1O9BA 1SUWA 1XNHA 3OCVA 2ZUVA 4IGIA 3I9JA 5F21A 3JSAA 2ZI7A 4PPGA 4BMZA 3AVQA 1XLTA 4BNHA 2AG0A 1W8IA 2QE7A 3PG5A 4B80A 3E35A 5HJ5A 2XVZA 3ZBPA 1LLFA 2W4IA 5ABPA 5EJIA 1VHQA 4WEOA 1RHKA 1WB6A 3OUTA 4RQTA 5DYYA 4B5LA 4AM8A 2PBLA 3GNSA 2QXUA 4DPLA 5EE9A 4AW9A 4QYSA 1RC8A 2WTUA 4JB2A 2CZQA 2AYZA 3NOOA 2P9HA 4JDPA 2X5KO 3AF3A 2MJLA 1KEEA 3RUCA 1Y9JA 3HB1A 1W34A 1N6KA 3EXHC 1U0NA 1GKYA 4S2UA 3SS8A 3EFHA 3TMKA 1TM2A 4J3JA 4LV5B 1U1CA 4OMUA 5CTAA 1XEAA 2VFAA 3S5JA 1BHSA 4E5PA 3LUCA 2GF0A 1PZNA 2GCPA 2SCUA 3MWYW 3ZN2A 3O2JA 2NYAA 4CKYA 3WK5A 4ZQFA 2EGUA 1ZI6A 4GWKA 2H54A 1EZ1A 2Z4TA 2H3EA 1CCWA 3VI3B 3GJ4A 1IG0A 1LK0A 4M0DA 3RT7A 5KCZA 1QRSA 1M1YA 3MTJA 2Y1CA 2I6GA 4GMHA 5JC8A 1TLFA 1MT3A 3N0TA 3T3GA 4PC3A 2JZNA 4YCMA 2FR0A 1E6WA 4FBMA 2AQHA 2BMEA 2JFUA 4HMOA 1USUA 5JJ5A 3LDHA 3ZWVA 1UQUA 1YZGA 4D0LB 3F8WA 5TVKA 2QJRA 1RXIA 4NULA 5FTLA 3DO8A 2CHGA 1JLHA 5EJ6A 2TRSB 1O7JA 2AZTA 3N6RA 1PJ8A 1N6HA 4LRTB 3JZIA 1LTHR 4U6NA 5AJHA 4RWZA 4BECA 1VLLA 2CJYA 1ZH6A 3WDKA 2H9IA 2I0FA 1ZKMA 4WOCA 3PPXA 1O6CA 2NW6A 1Z62A 1ZNQO 3K4HA 3G85A 1EIWA 3AVOA 3NRCA 3PD7A 1KQNA 1ZVJA 16PKA 4HPWA 5ALWA 5B4VA 4MB6A 2A8YA 1GITA 4MYRA 2I67A 1V8BA 4URYR 4HYQA 1X80A 2VCHA 2Y99A 1A7JA 3GHYA 5CCBA 2VDPB 4WNIA 3ZE1B 2AKAB 5FIUA 4WK2B 5CVCA 1SB9A 2I4LA 4TLEA 3O91A 5JLJA 4PCVA 4L4XA 5KSYA 3T0GA 3H5VA 3HI4A 1PR3A 3R7WB 4Q1BA 2FPGA 2OBFA 4DSUA 3U19A 2L17A 1SKYE 1E5VA 1BCSB 4DLVA 2QG4A 3V6MA 2VJMA 4J1QA 4EYKA 4P92A 5EP4A 2CGEA 5LLSA 1VA5A 2OYCA 1COWA 5KNBH 1L4LA 5M2QA 5BR1A 2ACVA 3NJ4A 1T3ZA 2YUTA 3X44A 3HCAA 2NP6A 2GPYA 1VBNA 3LC7O 4AMYA 5KYUB 1WXEA 3OFND 4AJEA 1TEHA 1FPQA 1VCMA 1X7YA 2P30A 3COVA 3N2EA 4LHVA 3VR6A 4OQPA 5CA1F 4F2WA 1GEGA 1C3JA 1DAFA 3CH7A 5EP3A 3UVEA 1GAQA 2ZBGA 4IS3A 4CMJA 3SVLA 1BJTA 1OE0A 4X3PA 4BNTA 1NI5A 3CSDA 4M54A 2QRJA 3GRPA 5JS7A 2PSJA 1OIWA 2UU9B 2OAQ1 2I6UA 4RD4A 2NYRA 2PU7A 4KXNA 2AK2A 2WB2A 1KEKA 2BMFA 1ZL0A 2QQFA 4FVTA 3V32A 3VYUB 2ODBA 3ZV4A 1O4VA 2R60A 3EWNA 2BLNA 1FX1A 4FQ8A 3I9NA 1LNQA 4YONB 1CFZA 3DWGA 3FWPA 4UCQA 5JD5A 3CVUA 3LPMA 2PLAA 4I3HA 1FDVA 3GVIA 2WAAA 4NFLA 1S2GA 1TCUA 3KS9A 3DMTA 3JALB 1VLMA 3L7IA 5IHXA 1U3TA 4RNDB 5IH3A 3T99A 1L7PA 2AEFA 3BG5A 4L5IA 4H77A 3B82A 1YQWA 2OQRA 3ZWAA 1JHOA 1L8LA 3GXBA 3LUGA 3BMCA 1VL5A 2YY7A 5HWSA 5JECA 4BMOB 3P4UA 3DPSA 4MIYA 4J6EA 5TQ2A 2AYYA 4ZOQI 1RLTA 4HN4B 4MYDA 5HDQA 1NDQA 4RSHA 3O83A 4LRSB 2XB4A 1BW9A 1GQ2A 1D5CA 2RHBA 3PGA1 1Q7TA 4YJ2B 2O7SA 4IJQA 1NJ6A 3BE5A 1F17A 1JR3A 2Q4BA 4EKGA 3K6SB 3HADA 1LJ8A 1UC9A 2YWCA 1CRWG 4G0ZA 1HKUA 2QV7A 5TVGA 1XSEA 3FSRA 3MTDA 5GWXA 1KARA 1V2GA 2OO3A 4KPUA 5LZ4A 2XGJA 1GA4A 3W5CA 2AC2A 3EGDB 3L7AA 4HGRA 1K0FA 5I8ZA 5BY2A 1RJ9B 1Z34A 1N5MA 1EFUA 2I2AA 2IXTA 2QPOA 3BIXA 3KSUA 4PLGA 3W7BA 3ZV5A 1SKMA 2OZVA 4UTRA 1Y8CA 4CLRB 1T43A 2FOIA 2RJNA 4XJVA 5EHQA 5DP1A 5KAPA 2XW6A 3WISA 2LCIA 1M74A 5K3FA 3NVDA 3LCUA 4N65A 4QDTA 3U7RA 5GONB 1FTNA 2NVUA 5EGSA 4DLKA 1HBJA 3F67A 3GZNB 3OLCX 4NS1A 5AUNB 5K1ZA 4B35A 4C04A 3A3NA 4LJ9A 2DR2A 3COPA 4AN4A 2C04A 3PSHA 1DL5A 2G5CA 5BQPA 1XTVA 2FK7A 5TQ0B 1L4YA 3IMGA 5E2IA 3PUIA 3HVKA 1ADYA 1QYRA 1RJFA 3A37A 1DRJA 4NE9A 5DMHA 1PI3A 2GXAA 2MSDB 3OTOB 1G6HA 1YZYA 1XXHA 4LXXA 3LY9A 4KSBA 2FPPA 3LRPA 4PLPA 3DBHB 1AN9A 2ECPA 1SXJE 5EWMA 4YRMA 5CLLA 3SEAA 5K0BA 3HA2A 1U2TA 2YZ7A 3IERA 4PXAA 4AECA 1TTQB 4ETMA 1SOVA 1JE0A 2VWPA 5K3AA 4W5QA 1G9SA 2Q5LA 2VF7A 5IANA 1CLEA 1EFVB 4TLLB 1CWUA 3NANA 3ZXSA 2PO7A 4LSWA 4BWYA 4CLEA 1YJAA 2WWRA 1JDTA 1VCNA 3FRHA 3N3AC 1NW8A 4MHSA 4R7ZA 3N75A 4X3CA 3O8OB 3JAKA 4MVJA 1YDGA 2F3SA 2IZ6A 3OM8A 5JAUA 3V1MA 3V2HA 4X7RA 4IZIA 4G1BA 1CUSA 3SYKA 3IAM1 3B6EA 5DT9A 3IJRA 3AFHA 3KL4A 4YAUA 4TV8B 1J2TA 3I2IA 4BGDA 3CH6A 3OLYA 5KTTA 1SCDA 3ODPA 4KEAA 1XU7A 1KVUA 3MJHA 3FJOA 1H4VB 4RV9A 4Q12A 3O4RA 1RCUA 1W4AA 3JYQA 4JI7B 1PWHA 1P73A 1BMDA 1XZNA 2ODAA 4YRTA 3CRNA 3NGMA 5JPDA 1TUBA 4YDQA 2DE0X 3P26A 1U94A 1X87A 5C8YF 2HO5A 1BS1A 1V5FA 4Y1RA 1AZLA 4BKMA 5TR9A 2XRZA 3ZLTA 4MI1A 1L1QA 1FYVA 4Y9TA 2Q6LA 1EK0A 3S55A 1E9BA 3ROXA 3TQQA 5JEEA 4GSKA 2OZKA 2W6IA 3KTFA 4ZYTA 1UWKA 1T2NA 4OUDB 1CE8A 4BPRA 5J4LA 2XHZA 3U40A 1CP3A 3EW7A 1DQNA 2PRSA 2JFBA 2PLRA 1W94A 3D3WA 4YNBA 2YQ4A 2O2IA 4HBZA 2Z09A 3SIPA 2H0AA 3JQFA 1NW9B 4NU0A 5KIAA 3SZOA 3TGPA 4WZAE 3KYCA 1WVGA 5H70A 4B73A 2IP4A 2PANA 4AFNA 5JO9A 3O8NA 4FB5A 5D3MA 2Z57A 1PGQA 1QV7A 3BMNB 3CZ4A 4JUBA 2ZT6A 1NZFA 4XVCA 4CQMB 4HL6A 3Q40A 2EIHA 1GRNA 3U3ZA 5FEUA 2VRCA 2BKUA 4IVQA 3UJBA 3S2SA 5TNXA 4A8TA 5A1JA 1W4BA 4KUGA 3H5IA 1J23A 5C3UA 1TAQA 2EKZA 3FMPB 5KNDH 4KN8A 3NHBA 1Q77A 1PS9A 1YMUA 2XKJE 3IAEA 5C1DA 3OTIA 1XD2B 2IV3A 4F97A 3WGTA 2X9GA 3FAZA 2V98A 3AM4A 1N5KA 4NMXB 1YHNA 1BHQ1 1WNTA 3SBEA 3MQ2A 2DBRA 3FB1A 1E1RA 4Q3OA 2Q62A 5EZYA 4YGXB 2ZJ8A 4PNEA 3DYIA 1OHHA 2WPNA 1AN0A 1KI3A 1QSGA 2HNKA 3T7TA 3U44B 1FJXA 4ND5A 4YMHA 2I4IA 1QZZA 1QTRA 4YDSA 5KYXA 4HDAA 2FSIA 4QODA 1EJBA 1LPBB 2GM5A 1YQDA 2XD4A 4LSZA 4EENA 3EH2A 4F04A 2RHOA 3QY9A 5KCMA 5G40A 3U26A 3DULA 4BJ1A 1L7QA 3KZMA 3LPCA 4ZQCB 2AJDA 5GIPE 4WY5A 1B00A 4H7PA 3W2IA 1MC4A 1SELA 4YJGB 4DCUA 3W78A 3H0CA 4FFNA 4BNWA 3EARA 5DNEA 1AY0A 4QOSA 1P2DA 4MV9A 3IOMA 1U4OA 2Y6UA 1M34E 3DOFA 4OHUA 1MXFA 2JEYA 3KVRA 3L01A 3UAVA 3WGQA 4JBXA 6NULA 1HT2E 1SPXA 1YCHA 4UC0A 1N2SA 5EUQB 2O06A 1M8GA 3SJ7A 4HC4A 3RTAA 2QD4A 4DKJA 3L41A 1VLVA 3HCCA 1ZL2A 1R6BX 3EMDA 1DWOA 5JXIA 2FI1A 2QI9C 2WSBA 3ILVA 1M10A 3DMPA 3ICOA 4BLRA 4HNAA 2CMDA 1Q91A 2JA2A 2GD1O 3PGMA 4HFMA 3DAHA 1ZD3A 4JA0A 4PCUA 4RD1A 3D8BA 4ZRDA 3VKUA 2H06A 2QTHA 3SD7A 2VT3A 1FMJA 1XCOA 1SMKA 2PQ6A 4ML3A 3O9MA 1QWOA 2QPLA 1ZMTA 3HP4A 2WZCA 1I13A 1GPMA 4N8SA 1MRZA 2CDCA 1SPBS 4GECA 2ZIUB 4HAWA 5BSTA 3H2BA 1DUVG 4YECA 3ZU6A 2W11A 4QULA 2ATXA 3OZCA 3FRIA 3AIKA 1H6BA 2BKXA 3I53A 1X38A 2BGLA 2IDJA 2ORYA 4MX8A 2G25A 5F5XA 3U3JA 3GVHA 2WQ7A 2VYVA 3ZY3A 2HA4A 3O8RA 1R16A 3AIMA 1LWNA 4IFIA 1ZIXA 1ZCAA 2GR9A 1FP1D 3GJ0A 5CAEB 1JYFA 1TEZA 3QOFA 4LRXA 3HKCB 1ULUA 1WVMA 3EVZA 5CEFA 4QYTA 4R31A 3DBHA 4UFPA 3OWHA 1CULC 2ZR8A 1PU2A 3FVWA 4C2TA 4R71A 2A0UA 1VIVA 3L07A 3O3CA 4MMYB 5KVVA 3OLZA 3OD5A 3OQMA 3EYWA 4JNCA 1CNFA 3VKGA 4MK4A 4ALNA 1ADBA 2M32A 1J25A 3BFJA 1BDHA 4BXOA 3O2QB 3RK4A 1KAEA 2Z04A 4P3NA 3OUZA 1IN8A 1N9ZA 3MJRA 2QDKA 1Z74A 3UV6A 5KQPA 4RVOA 1R66A 2XT6A 4JR2A 4I36A 4MPPA 1A9ZA 2AL7A 3KJFA 4PAQA 5HCNA 5THKA 2B2NA 5DYIA 1H2YA 1WIWA 4CM9A 2NU9B 4FSXA 4OQFA 3UJ7A 2Z08A 5BURA 1SA0A 2QTLA 3FY4A 2NZ8A 4MUFA 5JBQA 1BRTA 4DLLA 2NZWA 3BKXA 2ERXA 3IIKA 4H1WA 1FSZA 2PO5A 2X0EA 3EOZA 2H11A 2XWJI 2B99A 1E3DA 1YA8A 3VZBA 3R7NA 5A7FA 1IHPA 2A0YA 5LXTF 2ZYSA 2FWJA 4UJ3A 5LU9A 1PDWA 3MINA 5L3VA 3HM2A 3MMPA 4P58A 1X0VA 3AW8A 4PINA 4DIBA 2OFOA 3TLYA 2XUIA 2XIJA 3R7BA 3S68A 4YACA 3O82A 3UAGA 4BRWA 1GAJA 3ENVA 1VFPA 4DEVA 2CDAA 4OFZA 1MAWA 4ND1A 3TRHA 5AHOA 4EDFA 4YXWD 1GPAA 3DT9A 4DZTA 5DNYB 4CT4B 4EB6A 2ERCA 2TMYA 5K3BA 3ZGOA 1PL8A 4GOLD 2C98A 2HH9A 4Q9AA 1L9KA 4BKPA 4FYKA 4M6WB 4ZI7A 2UZ1A 1KNQA 1WCIA 3RE1A 1NVBA 3WLMA 1A96A 2VQ3A 2YXEA 3X1DA 3IHKA 2EQBA 2JDIA 3LQKA 3HDHA 1GZVA 2PH3A 1KWKA 5G0VA 1Z6AA 4P4LA 1PD0A 3LHDA 2YWEA 3JWJA 4R6WA 1PK9A 1TVKB 4GD3Q 4WBNB 3I9FA 5FXMA 1NLYA 2DQZA 1UEIA 3P4YA 1GNSA 1AKVA 2ZTMA 1XVUA 4PCLA 4XQGA 1R0WA 1XEWX 1Z0SA 3VMFA 1IY2A 1NW6A 3BZBA 1RMYA 2Z4RA 4D02A 5LQMA 3NDIA 3ER8A 1ZHHA 1ZM7A 4BC1A 1FW8A 1KI7A 3RWOA 2DY1A 2MR5A 3C48A 4ZT2A 4K88A 1ZM2A 4BNIA 1QHNA 3CXUA 4GXQA 1JRLA 3PXEA 1PL7A 5EIEA 3PHIA 4U3JA 2GA9A 3O1HB 1WXDA 1CETA 2YMMA 1KH1A 3OOJA 1ZSYA 4BLSA 5C7LO 5KPJA 1CG6A 2EZ9A 4JLWA 1YRWA 2I4TA 4HQRA 1PN3A 1RI2A 4NBUA 5T41A 2A88A 3GV0A 1T0BA 3ROQA 5IAOA 4M99A 4QXQA 3U0VA 1WW8A 4UFNA 5ARDA 3WK8A 3K0EA 1BIFA 2PM8A 4IO0A 1VYHA 3MELA 5FWDA 2P7HA 2PX4A 2VA9A 3RDPA 1KERA 1NBMA 2ODTX 4B4WA 4F5YA 4TVBA 4MUBA 3RVJA 4QKQA 3DHWC 3C4VA 5BWNA 4OHYA 3KVNA 4JVSB 4HXYA 1CFJA 3HCBA 1GZSA 4B3GA 1FU4A 1MTOA 1R0LA 9MHTA 2A1TS 4KSCA 3CB4A 2CNOA 2R4QA 2ZJZA 2ZJ6A 3AY0A 3E2IA 3GQBA 3I6BA 1HPLA 1OWOA 2NT3A 2ZIZA 4M89A 2JJMA 3FIUA 4FGWA 4GX5A 1NPTO 2WMYA 3LC0A 4KAXA 4Y7CA 2HC9A 2EGHA 1ISGA 2QG9A 3AESA 2DUUA 4OPMA 3S2ZA 4RHCA 4WN9B 2ZE6A 3EVEA 3FKSA 2WOJA 2ZYGA 3B36A 1ZUNA 3QHAA 4BQRA 1T8TA 2P9CA 4OHBA 3T54A 3DAGA 3QJGA 1C0PA 1T4CA 3KXDA 3R5FA 5AWFC 5L45A 2BJHA 2XXBA 4GX1A 2GHQA 1RQ2A 3HACA 3ESBA 1NW4A 1TKCA 4LJ7A 2V7QD 3PGJA 1WW2A 5AW7A 4JJ8A 4YCCA 3VJKA 5L7YA 2QSJA 2NLOA 1E2PA 1C9JA 3IODA 4TTPA 3CT6A 3OOWA 1EVQA 2OXCA 1J0XO 4X64B 1CUYA 2VDWB 3TW6A 4F7DA 4LG1A 4G67A 2J0UB 4LC0A 4N3BA 4U2DA 4H18A 4D74A 3FG9A 2R87A 4QBIA 4XKJA 2O2ZA 3CXRA 1J8FA 4FCWA 2I66A 4IHAA 4Q82A 2ZREA 4Y6PA 2PSDA 4H4DA 3DBLA 5HF6A 4CL2A 1GPWB 3T7IA 1EBUA 4M0PA 4MW7A 4ASUA 4URUR 3DDCA 3IP7A 3RS5A 1Q6YA 4AMGA 3IUNA 2LIVA 4KPYA 1JSXA 4FDTA 3A6PC 1DKPA 1XRJA 2ISSD 3RTDA 5CNJA 3D8SA 4WA8A 1XXHB 1GG8A 2VQSA 5ALKA 4BQEA 3NG1A 4I99A 4DLXA 2WKQA 3PUYA 1UPTA 1V5GA 4B3IA 4EA6A 5LQJA 1P2BA 4P3XA 4EQ6A 3SGLA 3PLAE 2Z83A 5KB3A 2YL2A 1Z6YA 2I7TA 3VR2D 3FCOA 4LJ4A 4LS3A 4OOEA 1XNJA 5DHQA 1APBA 3GW8A 2DR0A 3EF0A 5IP5A 1OV4A 2ZRNA 1VL0A 1GG9A 3DXZA 2O4UX 3W8FA 1CW2B 4Q47A 2UAGA 2IX3A 4X95A 3V8QA 3H04A 5DWVA 3AU8A 4DR1B 2XTZA 2AR9A 2D2VA 2ZBRA 3ZW8A 5BMVA 1YL7A 4P81A 3PFKA 2YJGA 3KU1A 2QLLA 5A9RA 2QRVB 4YMLA 1T5DX 3N2GA 4LXGA 1W0CA 4I6GA 2JI7A 3H1EA 4XD7A 5PNTA 1GZ7A 3SLGA 2RG1A 2PRJA 4NESA 1YZFA 4RJJA 1CR2A 1EG7A 3BXHA 3NP7A 1KC1A 4PEVA 3SQLA 4Z4IA 4JYZA 4JYAB 1Y9DA 3LLSA 2X40A 3KT6A 1WUJS 3HP1A 2E7ZA 3SR0A 4ZHQB 1ZK1A 5AT1A 1DC6A 4ZCLA 4XSHA 4YFVA 2AT1A 2C1XA 5TE9A 4ES6A 1W30A 3QENA 1F2TB 3PUVA 4WK4B 3TQSA 2QMOA 2YXBA 2AOTB 1BX1A 2BOVA 1MUUA 5DCYA 1KJQA 2OQ2A 1F4LA 1PEKE 1NU8A 2O07A 3Q0EA 4NSNA 1JKFA 1JR4A 1Z8DA 4ZOLB 1U5CA 4A1FA 3U56A 2VJBA 2GM3A 3PCRB 2QD2A 4LZJA 1W48A 3RC7A 1WVIA 1ZLXA 2PD3A 3BK1A 1MP0A 1U9JA 3OJLA 4XA8A 1FVOA 3W06A 4U7GA 1QYVA 3N2YA 1PDOA 1P5HA 4YT2A 3VSDA 1P5ZB 3IFSA 3Q1KA 3GLFB 2I5PO 1VCIA 4UNQA 2CLDX 4WASA 3P32A 4GFDA 2YICA 3QU2A 1GQFA 1XMOB 3GRFA 1W93A 1ANKA 1FDUA 2SKCA 5I7EA 3PF9A 4MW6A 2ATVA 4O6VA 1BMQA 3D7RA 3ZW9A 3OU6A 1K4YA 3B1YA 3RV4A 4WCFA 1M33A 2EFYA 2GERA 3DOJA 4P5DA 5GIOE 4EJ2A 1O3YA 2I7VA 3IPYA 4RD0A 4IDNA 3WLSA 1QG4A 2LDXA 3LWZA 1IHUA 3P8ZA 4P84A 4B2YA 2HSJA 3IEUA 4FHDA 4M88A 4CKEB 2F1KA 1R2QA 1P8JA 1UPBA 3TQTA 5I4BA 3Q7PA 4R83A 1RQRA 2I8LA 3D2BA 2YC4C 3CONA 1DIOB 2VJMB 3K0CA 5BNIA 5HDBB 3IILA 1HQDA 1U8CB 1FDTA 1UBOS 1GKLA 1UMCA 2PYDA 3ABRB 3ASYA 4WKPA 1ZC3A 3VV2A 5AW3A 3USZA 3F6YA 5SY4A 1C30B 4DV1B 1QR2A 3FLEA 4L8VA 3VTKA 3RUDA 1T8PA 5AK3A 2VXYA 1YVRA 2W9XA 3IHLA 4ZIRA 4HNVA 5AVJA 1N5JA 1R0ZA 5CTJA 2A67A 3U3KA 2O7NA 4XR4A 4W5RA 1JDBC 1EM8A 2IHYA 4TS3A 2Z0MA 3Q7IA 4EJ0A 1CU1A 4G8DA 1L6RA 3B8HA 3TL6A 1EXDA 5ALEA 1OASA 1RWQA 2RIPA 4S1NA 1ARZA 2P1DA 3RRMA 4UUNA 3WAKA 1FRNA 2AOXA 4NK4A 2NUAA 3A9SA 3IOBA 4XUDA 2E4VA 5A4IS 1YBAA 1BXKA 1KYQA 5CYPA 1OWPA 2H18A 1P7VA 2ON6A 3BQMB 3HHPA 2AFIB 3VPHA 1B2LA 3A58B 1GU0A 1HDRA 4XD2A 1C8KA 1JKIA 2H1OA 4E31A 1T25A 1GL6A 3A36A 4EA9A 3M9XA 1XPUA 4JP3A 4GVPA 2ROQA 2VLIA 3DNFA 2VAVA 2Y05A 3VSEA 2C3UA 1SQ5A 5AJUA 4L9SA 2R1VB 5KNLA 1SRRA 1H0HA 2EX0A 2JFHA 3AEKB 4HUJA 4KDCA 5FJIA 5BYBA 1IXKA 4BB9A 1HV8A 3DE4X 4WW0A 2ORIA 3HCRA 2QBYB 3A05A 3UA4A 2B6HA 2FW9A 2C5BA 1ML3A 1COWD 2CYAA 4MVJG 4MYHA 4WY2A 2MHCA 1I2CA 2PKEA 4FMDF 2XF8A 2PVPA 4NAUA 3JRNA 5LKRA 2DCUA 2VWGA 5FWYA 1YFLA 3EQ8A 3ZE9A 2B8WA 3KJXA 1WD5A 1FB5A 4LUCA 4GPD1 1UDBA 4TT3D 2Y0CA 3GROA 3E27A 3EDOA 5D85A 1NE7A 2AWNA 2A1UA 3PIRA 4ESEA 3FXAA 1NDHA 2ASVA 1RIIA 3DE3X 3FPLA 4I8DA 1SQFA 4WGFA 4C4YA 4EYSA 1KEEB 1WV0A 4E3WA 4K5QA 1OHHD 5LMCA 4GPTA 2GJSA 4BO8A 4HPXB 4UAUA 1MC1A 2NNLD 3AYXB 3DKIA 1Q0RA 3ORRA 2VA8A 2H52A 4EOGA 3WGVA 2PPVA 1N6OA 3U4AA 5JMOA 2QQ5A 5KTRA 1H3EA 1TAGA 5L4SA 1M8FA 2C88A 3QTTA 4EUNA 2VI5A 1ZVMA 5AI4A 2OBBA 2QR5A 2FWPA 1PBNA 1WLYA 3KQWA 3O8OA 4QG7A 2FEWB 5ALNA 4MLDA 3T0IA 1G6OA 4NLLA 3CLUD 4WMLA 1U5BA 1H8ED 5JNSA 3W04A 1W5EA 1L7VC 4C4RA 2R8PA 4Q4LA 3R77A 1DINA 3ORQA 4MPTA 1HE4A 2YH2A 4IF4A 4TXHA 1WSWA 1OY1A 3JW8A 1K63A 1Z0AA 1NVVQ 4HN2A 3A1UA 1DHTA 3I1IA 1ACMA 3L7KA 4GYYA 1JDZA 1M1UA 2BFEA 4NPHA 5DFAA 3QA9A 3A6ZA 4KFRA 2Q3BA 2W2KB 4F21A 2DFPA 3LG2A 4KP7A 2PJZA 4R01A 2Z2ZA 4UBLA 4MCJA 4LHWA 5DK4A 2IW3A 4C0BA 4Z4EA 4F2GA 1AA9A 1SIBE 4E03A 5ITWA 1XZPA 1FA9A 3QLTA 1J2UA 4UE3S 1PR2A 1KTVA 4IKEA 4FFMA 3VSAA 4BBPA 1TM7E 5FNVA 1LVGA 5KHOC 1H66A 2CJWB 1FDRA 1YVEI 3EVDA 2FW8A 3I72A 1GT6A 1R6XA 2GSDA 2WHPA 3OLWA 4N8DA 1JHDA 3I28A 4QTUB 1K3UB 1ABBA 2FZ4A 3QUCA 2WMNB 4H6PA 4UQLA 3QUBA 4B8YA 2CEAA 4C0WA 4LDJA 4DQVA 1JGTA 4RSRA 4JS0A 1FQOA 4QBTA 2PGOA 4DM4A 4HLUA 4ECEA 5E4YA 3E23A 4Y6GB 3W77A 1U2DA 2JIZA 2EP8A 1SBYA 4QJ4A 2P5TB 4QXRA 5KNCD 1QP7A 4G56A 4X0EA 2XMCA 1XCJA 3L0CA 3LDUA 4I9NA 4O4JF 1E69A 3B5JA 5H8WA 5H3CA 1IB0A 1YB1A 2LKDA 2OHJA 2W48A 3M9LA 3WGNA 3L7YA 3H2GA 2JCGA 4DWOA 3PTZA 4WV3A 3GUCA 2DY0A 1GPH1 5B7NA 2QTVB 1VMKA 4HLUC 4W9MC 1MJHA 2X86A 4CL3A 4YP7A 3V9PA 4OFXA 4A4DA 4RS3A 4FW8A 4IJMA 1DRKA 1Q22A 1IOWA 1YT5A 4KRGA 4BP3A 2A1IA 1KVQA 4HUTA 2ZFUA 4OHPA 4QJIA 2IYNA 3SQMA 3GGOA 1Z5NA 3ZH9B 3AM1A 2QIPA 3AT1A 1BWSA 1K6JA 3KSRA 4Y9SA 3BTSA 3O75A 2XLBA 4GM4A 4XM2A 4LOJA 1FXWA 1QIGA 5HS6A 4CM9D 3NIFB 4NP6A 5DX0A 4WDQA 4DTIA 2C2OA 3IQDB 1T9ZA 3LNCA 4PPFA 4RW0A 1H93A 2PZGA 3CYFA 3H65A 4B82A 2BBSA 1K92A 3OWOA 4JJIA 2C4VA 3K9LA 1NSFA 3U16A 1EUDB 1YI1A 2CXQA 2DPXA 2G4VA 1GIAA 1PQWA 1T4BA 2WF7A 2ZWPA 5GM1A 1EFRA 1A7UA 3RREA 3MOIA 4EHJA 1WS6A 3DBOB 5LA6F 1IBMB 2OESA 4EWLA 2B5OA 5A5DA 3ZD6A 3D0RA 2RK4A 1VE9A 4HTAA 4J0DA 4LOLA 2WJIA 3ZKWB 4AU1A 2E4YA 5DLYA 4DJJA 2AN5A 4AZ0A 1X1CA 2I78A 1EESA 3PZBA 4RKEA 4ZANA 3ZHRA 3COWA 2IHBA 4RHTA 1E9DA 1VTKA 3R7AA 2IYQA 2P4EA 3OZSA 3QA3E 1C8LA 2F1RA 1H2BA 4KGZA 2IBTA 1VJ5A 1FSPA 2Q3MA 1N3LA 1QIJA 3RS9A 3TLEA 1FVFA 3BTUA 5KBYA 1NYRA 3FUTA 2C95A 1C0EA 2JLVA 2REQA 4ZAZA 1I3OA 1NXQA 1FFYA 4B75A 3GFOA 2HZBA 3KYCB 2IUYA 4O4HB 4OJMX 3ZQKA 3PC8A 5DYTA 3V00A 5IC4A 3QE2A 4CV2A 1TCBA 2GX6A 1ORIA 2J3IA 2QS9A 1T3SA 1L5HA 1QRTA 2FPOA 2WM8A 3IUYA 2GAJA 4I1YA 4F9EA 5FV4A 2ZS9A 2CJWA 3FOEC 2VH1A 3TOSA 3CFYA 3WL5A 4AZ0B 4PG8A 5BQ3A 4JYMA 3C15C 4H0NA 2RGYA 5SZIA 4IDCA 3JVIA 4YAWA 2AG1A 3DZBA 3SIWA 1ZK2A 2UVQA 4BP8A 4IDBA 3I5XA 4FKZA 4KL8S 4JXZA 2PCJA 3PQ2A 3PQ4A 2ODQA 1QFMA 2XUPA 5KVCA 5CCXA 4R0VA 3M7IA 1POWA 5HKLA 1X80B 2GD2A 1Y1RA 1X2BA 1RAFA 2XXJA 3V5NA 5K4AA 4TV8A 2R5NA 3VR5A 1EWYA 3VYRB 4B48A 5AESA 1PT7A 5K3EA 4DCGA 1GPYA 4HY3A 3F3YA 4PRYA 3EGCA 2HEGA 3KSBC 2V6JA 3ZD7A 2IWHA 3TZQA 4DYVA 1RRFA 1K98A 2VXOA 4CMCA 1AUPA 2HF7A 4Z4CA 1VBFA 2G04A 4JVLA 5AM2A 1DCKA 4E46A 4TL9A 1W75A 1A4IA 1J49A 3SOPA 4HQKA 3ETGA 3GU3A 4FNGA 3TIXB 3WP0A 3D6NB 4E2XA 5I8WA 3OKAA 1O6GA 1NN0A 4L8WB 3KQTA 2ZVPX 3FGOA 3UMFA 3L1KA 3URMA 4DIEA 4X24A 5CLFA 3BUSA 3WGYA 4N7BA 5K6AA 1JIJA 2X9VA 2XYPA 1NRJB 4UM9B 1XMIA 2GPAA 2C83A 2DHDA 1S96A 1XWIA 4MS4B 5F4ZA 3OCYA 3TQCA 4DWJA 3REOA 2AJLI 3ZCRA 3EZFA 2B8JA 5JD6A 5LZ2A 5CLJA 3UGJA 4KXWA 4EA8A 3NRJA 2HJSA 2LVBA 4OB6A 1I4EB 1FSFA 4JYBA 5E4JA 5JALA 1ZD1A 3DCNA 3PGKA 1VKZA 2YYAA 3UMMA 3QE9Y 1TKRA 2HQ1A 3NKVA 4MOWA 3AO0B 2FPPB 1LQ2A 2QM7A 2NO9A 2EEPA 4O02B 4D0SA 3E7FA 1RYEA 3I1YA 3NBMA 2I4MA 2CN1A 4IHJB 2DF8A 8LDHA 2F59A 2ZKLA 3KB6A 4KCGA 3FKJA 4NZ9A 1SZDA 5KVSA 3LWNA 1Z35A 2Z30A 2NZJA 3H1PA 4ZAVA 3BWVA 3PPWA 2C42A 4KWIA 3CVYA 5C34B 3GDHA 1RPTA 1SCJA 4C08A 1GZUA 3T7DA 3NW9A 2JCYA 1JG2A 3T9AA 4CG2A 1Q7CA 1Y9ZA 3CB2A 1QGDA 5ADHA 4NATA 4B76A 2B7CA 1PLLA 4W9NA 1OGYA 2BHLA 2GPJA 1QZTA 1HT3A 1EEHA 1II9A 3PI7A 4KWCA 5CDUA 5U9CA 1KY2A 1JJBA 1OIVA 3N2GB 1HT1E 4A6DA 1T1JA 5EWJA 3QWFA 2AUTA 2XHEA 1XLTC 2YNMC 4B7XA 4N48A 1FF9A 1Z5ZA 2X22A 3CEAA 2YHIB 2J0SA 3ZWYA 4DY4A 5KX5B 5KOIA 1C4XA 4RVDA 4RPIA 4MAMA 5F7OA 2FE1A 3Q7EA 1GPNA 4DQKA 3FWNA 5BT8A 4XQCA 3RRJA 1JH8A 4TL6A 1F2UB 5AXCA 3S2UA 2PVCA 2YWRA 4Q7EA 5CDGA 3A0RB 4BL5A 1VGQA 4ZN6A 1JHMA 3KDAA 5KNDD 1Z7BA 1BAPA 4KDFA 4AWAA 4BNUA 4V0KA 3AUSA 2J46A 3AL0C 3IV6A 3O31A 4Y2XA 4A0GA 4I4LA 5TT1A 3GJSA 1Z2EA 2PZAA 4ZPJA 2MSKA 5E7QA 2J6IA 3GVXA 4IWNA 3URKA 1UFKA 1QZXA 4DR5B 2BEWA 3C98A 3ES9A 5MN5A 2HAEA 3V4SA 3UANA 4IR7A 2D7DA 5T67A 5HUHA 3QELA 1XZ8A 1VRVA 4OATA 5B3LA 1MHPA 4EG0A 4Q37A 2PEYA 5CW2A 6ABPA 4EG3A 4MV5A 3G7SA 4YS6A 4A6XA 4NEHB 4OF4A 3TQOA 1EDBA 2QTRA 2G0NA 4HX9A 4PSAA 1JQKA 1ZVKA 3LUFA 2E49A 4IMRA 4LNHA 3B70A 5DOVA 5HIIA 5J5AA 2Q1XA 4D3DA 2XA1A 1HFEL 5HIAA 2HDHA 1BE8A 3SF0A 2P69A 1X42A 4M8SA 3HCEA 1CHNA 2YVKA 4MUIA 4N5IX 3VPSA 4C7VA 1LQUA 2IK8A 2YMPA 3ZGLA 4CM1A 4CEIB 2Y1EA 3U60B 1O96B 4PXYA 1E5LA 3WL8A 2ZYAA 4A2PA 5IEJA 3W6PA 4BNGA 3FZYA 2ZLBA 1AKQA 2IKSA 5IM4F 1RYBA 5JQGF 2UUCB 2IHTA 1T8UA 4JSYA 3T38A 3E3OA 4Y0VA 3IAUA 5IC6A 3L7CA 1T4CB 3A3PA 5CVVA 3LT0A 1N2CB 1W5SA 1F5NA 5CJJA 3TVTA 4CETA 2YIJA 3UB4A 2UYHA 1OBHA 1P8AA 4OYYA 1FTQA 1W36B 1H42A 4JENA 1NMYA 3U5ZB 4I1OA 5IMSA 3PNQA 4IIDA 3VO9A 4IWXA 3ME5A 3ZVKA 3BE4A 4PLWA 4LQDA 2B34A 1E0KA 1GTL1 3MTQA 1A9XA 3C5CA 5SYAA 2FFHA 3HJRA 2HMAA 1ZGHA 1T3HA 4GT1A 4ODIA 4G8BA 3X2SA 4E1AA 4NDZA 1NW3A 1EXMA 2DP4E 1Z18A 1WZNA 3HNOA 2Q7OE 3WWDA 2HLPA 3ZWBA 4JHLA 1CUIA 4II3A 2IHVA 1F0KA 1MIOA 3U4HA 1L3IA 1TOAA 5P8WA 5BNWA 2B92A 3EXHB 2K2QB 3V4RA 1M7HA 1S4MA 2VOJA 1Y6FA 5TPZA 2NNWB 1P4SA 2JD1A 2H2WA 2YCLA 3AEXA 3DZHA 4KV7A 4QYXA 2O8CB 4D1YA 1VJRA 5FPQA 4RLSA 1Q84A 4B71A 5EJ8A 4FKMA 1E98A 3KZVA 4P53A 4MIOA 1BE6A 3F9IA 5BRJA 3VDQA 3B1XA 3ZCTA 1G7RA 4BCBA 5KWJA 4JLVA 3P5BA 3MAGA 1G2IA 1TYZA 1R4MB 5JXGA 3CZ9A 3WMRA 5C5CA 4RTKA 2W4MA 2XUFA 3FE2A 4CMEC 3LHIA 4E5SA 2FV8A 4D97A 5B58T 5LYJB 2BRUA 1YGPA 3GPDG 4KQ6A 1FK8A 3LQYA 3K0HA 5ALOA 2GBLC 3S28A 1EIZA 4WUVA 4RO0A 4AJPA 4G5GA 1NR1A 1YASA 2XVMA 4KQIA 2P1RA 2HBYA 4LZOA 2BIFA 4EHNA 4MROA 4PYKA 2ZANA 1I0LA 4K9MA 2IOFA 2QTNA 4B4VA 5I7RA 5EZSA 5C8XA 3HPRA 1H1LB 1NKTA 2BGMA 2G67A 3FCAA 4KWTA 4Z51A 2UYQA 3ZHUA 4EW6A 3V34A 4URHA 2HO4A 2FQXA 3IQFA 3RRBA 2PV0A 3TQRA 1EA7A 3IVAA 3OICA 1T1SA 5KKNB 2Y92A 4GC5A 3KYJB 3K4PA 4U7PB 4KQXA 2HYIC 2A1TR 2WKPA 3QKRA 4JBIA 2DGDA 2AOVA 1TXGA 2JI6A 4N4AA 1EMDA 1MZPA 5IKMA 2BV3A 1GZDA 1VE1A 2NTVA 3K6JA 3KE8A 4MS3A 4HNHA 4C05A 4MS3B 4Z1MA 1G8AA 3L05A 2R1VA 4LF7B 1J7JA 3I6YA 4BMYA 3LLUA 4M37A 4MKHA 4KOEC 2D74A 3CE9A 3Q8WA 1ZVQA 1QP8A 1VXRA 4Q16A 1GGNA 3ETCA 4B9AA 3O6VA 2C20A 2GBFA 2OM2A 2ZYVX 3OIFA 3FLMA 3VVBA 1O08A 3RWBA 1FNCA 4CKBB 3H99A 1C2YA 2LGJA 4JLUA 1EE2A 2JAHA 1YDWA 2L69A 3CNQS 3KKQA 3MYYA 2HSEA 1U7XA 2I71A 3FSEA 3HQ4O 1G38A 2P9ZA 4E11A 1MMFB 1DBWA 3L6BA 1XA3A 3L79A 1UT6A 3HU2A 1Z33A 5B7QA 4MRPA 1FVHA 3RO7A 2B25A 1C29B 1OI4A 3KNZA 3STUA 4PS0A 4XARA 3SPXA 3HEBA 3UK1A 3QF7A 3PHLA 1THGA 2WYUA 3M5CA 2YW9A 2YZGA 1OLUB 1VPDA 1XZEA 3M4NA 3QFRA 4NPAA 3RPEA 2A9OA 5JNWA 3OE5A 1OFGA 1OSNA 1VIDA 5K0SA 2G4CA 3HJUA 3TW8B 2FFAA 3KXPA 5IBRA 3PEUA 3TK1A 1C30A 4H15A 4DMRA 2C7RA 1D0SA 4O3MA 1DRWA 3IPLA 4H60A 3VUEA 2GCGA 4B6JA 4EAAA 1KIFA 3TDKA 5JBIA 3G9QA 4JLNA 5DBOA 5CNKA 1NP3A 1FMLA 4LVUA 2ACWA 1OMOA 7MHTA 2HWWA 3KB2A 4MGKR 5DBHX 4NG4A 2BR5A 3LFHA 5LR6A 3OZFA 3JATB 4RK4A 5KI6A 2HT1A 1RDFA 3L04A 4KQKA 4MVJD 4KWEA 4CIAA 2IH5A 4CKEA 1KMCA 3OQIB 3L7MA 2O48X 2J9FA 2VZ9A 1KWGA 3L43A 3PX2A 4JBYA 1VDZA 4DMUB 1TUGA 3RBVA 1MNQA 3BIFA 3KEOA 1P1FA 1ZY2A 2IPLA 4DR6B 1C14A 2BHSA 4OHCA 5HCUA 2XCUA 2G08A 4F3KA 5KQGA 1NOKA 5BWCA 2FMKA 5C53B 4KVFA 4TZ0A 2JZCA 3VOSA 4GXTA 1HURA 4RLHA 2Z8YA 2HLHA 3BWEA 2YASA 1P7ZA 1LDGA 2CK3D 2RGXA 4IMJB 4DLAA 5C32A 5FTMA 4G0MA 4L76A 2GH1A 5SYMA 1IM2A 2Y1GA 4DJFC 4MKRA 4CMBA 5E38A 1NIJA 2EWMA 3PLNA 5I9BA 3PC3A 3EPPA 2B6NA 4EF5A 2GESA 1I7SB 3ECSA 1H85A 1I2AA 3G23A 3M2PA 3PUKA 4X9XA 5ER9A 4IV5A 2HUNA 2IQIA 2V7EA 5A0FA 3WRVA 5LXTA 1JH9A 3QRWA 4EKYA 4D9JA 2VRCD 1P9NA 4OHFA 1ZFNA 1EI9A 3ICQB 1E1LA 3SKXA 4N12A 1VKHA 1XVLA 4RYLA 3R9KA 3NWPA 4FGLA 1GOTA 4CJXA 1NRXA 2I29A 3ADOA 1T15A 3DDOA 1OWMA 3SYNA 2BHNA 4ZRMA 5EVJA 1C0KA 3WV4A 3GJ5A 1ULZA 1Q50A 1SC6A 2VKTA 5DULA 1DVRA 5JCOA 4AKSA 3E53A 9ABPA 3ZGXA 1S8OA 1V16A 3WRYA 4ZYWA 4PPYA 4P0QB 3L1UA 1EXNA 1A50B 1SHZA 4K0KB 3QBTA 5LMNB 1UJ4A 2BMJA 3DE7X 1LDYA 4JX8A 5DYWA 2NO7A 5G4KB 3O4HA 2PFSA 1FYDA 5D8DA 5JC1A 2V03A 4CV3A 3Q7QA 1F1BA 1A9RA 2EZUA 4HQ6A 4GBMA 4LZAA 5TARA 3S1SA 4BY9E 2P62A 5CNMA 1VP9A 5HTOA 1C9KA 2PFKA 2H5IA 4R84A 5TF0A 4NENB 3TE6A 4MHOA 4FYPA 3P5SA 1WBJB 3QOYA 4EW3A 2RB4A 3KX2A 4M49A 5DGTA 3WQHA 1MR3F 4XB2A 1PEYA 4XUGB 2A92A 3ZQUA 4F5DA 3JAMA 4DCSA 4BLTA 6ADHA 1QHHB 2OCBA 2VRWA 4V38A 5ESDA 1JVSA 3G2HA 4UXIA 1WUTA 4WADA 2CFRA 5ALUA 3MSCA 2HKIA 4MLCA 1ORTA 2REXB 3EEYA 4FEYA 4H3KB 4LX8A 4O4LB 1E6EA 3TTXA 5NLLA 4HS4A 3RG2A 2FY8A 3G8BA 4R9UC 1TPYA 4MWOA 1Y4ZA 5ECGC 2N9UA 1JE1A 1LTQA 1MLDA 2WICA 4M0EA 3HCPA 2EGGA 2C3YA 2ZTHA 2EWVA 2JJQA 3GFTA 1K5DA 3OURA 4Q02A 4ZQHA 1TLLA 4W5OA 3PLRA 4C3UA 1H0SA 3T1VA 5AUPB 5EC8A 1O94C 2ZJ3A 3CJQA 4RM3A 4G84A 4UOZA 4JC8A 3CLVA 1MAVA 1UBNA 4WKOA 2WZDA 1KEUA 1WUIS 3JZMA 4YCJA 4MR8A 1LY1A 5JXJA 4ARIA 3FWHA 2C3MA 2Q3CA 3GA0A 3PNBA 1KS9A 5BNFA 3DTVB 3ZDYB 5AVYA 3K71B 1G8MA 2B69A 2VUTA 2PBZA 1Y4UA 3JAWB 3PWSA 2IV7A 2CV1A 1X7ZA 3FSJX 4G1MB 5KYTA 3LBYA 1RWWA 4PZDA 4UAJA 3B48A 1L7EA 5LBTA 2C58A 1E2DA 2FEPA 1CYDA 1GSAA 1W6RA 3X1MA 1GGJA 3ZI0A 4S05A 2VHXA 3R0QA 4U02A 3AVUA 1UJBA 3AERA 5F78A 3WYFA 5C4MA 2XA9A 1G8HA 2Q4OA 4Q1FA 1NVDA 3RLIA 1J1UA 3GBPA 1SC3A 1W29A 3HCNA 4JI3B 2Q2NA 3WFIA 4MWCA 5CHEA 3ZLJA 4S1VA 3F71A 2JH3A 3JD3A 3I2FA 4V0ME 4B7CA 2W2VA 4DC9A 1NQ5A 5SV2A 4H7EA 1N7GA 4C03A 3PR1A 2G83A 1JLLB 1NI4A 1KQPA 4NABA 3PKIA 3SXJA 4JP8A 2PT9A 1OILA 3C8UA 4XW2A 4MW1A 1Q0LA 4HKTA 4EUEA 1Y1QA 2JI8A 1L3BA 5BSMA 1HXHA 3D9QX 1N2HA 2ZU0C 4LC1A 2O6LA 1E6CA 1Q0UA 2YCBA 2ZUBA 3CQ9A 4FP9A 4X20A 1DTSA 5LQNA 5H1YA 3EEFA 1SVMA 3QPUA 5LBUA 4QE3A 1DQSA 4EPRA 2GAFA 4OXIA 3WMXA 5B4UA 1V6CA 3G02A 3GFRA 4DNOA 4GI7A 1IJEA 1IC6A 5CA0F 4D26A 4GYKA 4F8EA 3B51X 3UMVA 1TCVA 1G60A 2NO6A 5HZGA 3EXIA 5CA1B 3IRUA 2OGTA 4Y6OA 2QRHA 2AUNA 2BC9A 4BIIA 4BQQA 4GBED 3UMYA 1VIMA 2ZYRA 1IEWA 4DA0A 3F8TA 3G2MA 3LQ2A 4MRAA 4ZGGA 5JS8A 2X5JO 1LV8A 4ZODA 4NU8X 4AS2A 3EMKA 1H5QA 4BNXA 5ES4B 1IATA 2GK3A 2O9JA 2R4UA 2CNNA 3P2IA 3EZ6A 4JLKA 2F1OA 2G80A 3NIDB 2Z95A 2BISA 4PYMA 4QUEA 3T5BA 1D1PA 4XJSA 4WLEA 4Q0MA 4DDWA 5D51S 2H92A 2ZXEA 5JD3A 5K03A 1R27A 2E4XA 1KFKB 2QN7A 1XAGA 1YS6A 2BZ0A 2Q3JA 3OMWA 1MG5A 1IHXA 2VPXA 4MINA 4QHTA 3RSHA 4ZYUA 3OOYA 2I3DA 3IAXA 4C89A 3MG9A 5F23A 3KXIA 1YRQA 2FMUA 4ZAFA 4OY3A 3WQRA 4ESOA 5ITVA 3DFIA 3AM3A 1K9SA 3RSLA 2Q50A 4LJKA 4ND2A 4O5OA 2XE7A 2IU6A 4NOLA 4HTFA 5KYWA 5CDFA 2IE0A 2EHJA 1E4EA 1O95D 1QO9A 3OHPA 1BKSB 3USCS 4DDVA 2C99A 4DANA 1U0JA 2PH1A 1N6NA 5ALPA 1PNQA 3AR7A 4GKKB 2E82A 3HJCA 3BSFA 2I03A 4MKZA 2AV6A 2J9XB 3R3HA 4F4CA 1AZTA 2UZ1B 4TKMA 4V0MA 2HJ9A 3ETNA 5BSWA 3DCIA 5FPKA 3SX0A 3CIFA 2BFDB 2VF5X 4RWEA 3T7CA 3DWFA 3W7AA 4DY6A 2GEDA 5BNZA 2NYVA 5I4KA 4DLNA 3DLCA 2R1TA 1ZLYA 5DN6D 4KPFC 1XELA 2I91A 3M6MD 3D6JA 1ZNXA 1FFXB 6YASA 3C16C 1I1HA 4EG4A 4G25A 1MEOA 3IESA 4ARSA 3AHEA 3PVZA 2OFPA 5BWOA 5K8IA 3OPYB 1Y3AA 1YDHA 3O92A 4GKVA 3ROPA 5KNCH 1DDGA 1LKZA 2FUNB 5DGHA 4LFCB 4AJLA 3M6FA 4HSEA 4IJUA 2IFTA 1C81A 4ZOEA 1XCBA 3GZ4A 1H4TA 1FNMA 5AMXA 3LO8A 4PAWA 1XTZA 5REQA 3HCWA 4MUEA 3VO1A 5IT5A 2JFOA 1JEYB 3ETLA 4HNTA 4OYRA 1V7QA 2C9YA 2QTMA 3OPXA 2VRBA 4LF8B 2PN1A 3JQ7B 4JBWA 1PNRA 3EIWA 5CA0B 1RQNA 3T5TA 4I50B 2ZJ5A 2EV9A 2EOAA 5CHYA 4UHEA 3BSWA 1IYZA 4YK7A 4B9EA 1XTRA 3MBOA 5HQJA 1WKCA 5CCDA 1JBEA 3TUZC 1Z7GA 2JI4A 4GYJA 5K8CA 4RTNA 1RD4A 2V9PA 4O63O 3WNCA 1QDLB 1X0XA 3PNMA 1R8SA 1YE5A 3RAJA 2P3OA 1IVNA 1KDTA 2WSSD 3DCYA 2A5LA 2BEVA 2QOEA 4OFWA 3WZMA 5IS2A 3RV3A 4F46A 1GILA 4L6IA 4JI4B 2BW0A 2YBDA 2A9JA 1Q0ZA 2PUAA 3UYKA 4U7TB 1N2CE 3VR4A 4PG5A 4PXSA 1Y3DE 1E3WB 1B43A 3IIJA 2G1PA 2PUHA 2ONYA 2W4QA 2BGRA 2XEDA 3JVUA 4DA6A 5HKKA 4OTZA 4D4HA 1C4KA 5F9MA 3NLLA 3HJFA 2J5QA 1XDWA 4J7UA 3O93A 3WV5A 4CM7A 4YRIA 1KZ6A 4UM8B 1C8BA 3WZ2A 3OLQA 4QAJA 3UNXA 3K0SA 4JKIA 1VSTA 2Z4SA 5B3JA 4LFAB 1CQPA 2ECKA 2QPTA 4RGYA 4TM7A 1JW9B 3IKLA 1GNRA 1YR6A 3R7WA 4D9EA 4L4ZA 3HV2A 4B3BA 1OB2A 5J1SB 3BOSA 2P9QA 1YD7A 1NNEA 3HA3A 3QV1A 4Q4HA 4XIFA 4EEXA 3R0JA 1H2ZA 1QONA 2TMGA 4TXNA 2BFMA 3G1WA 2JFQA 4NV3A 4BNLA 3GY0A 4AZ3B 3B8EA 4WESA 3S0JA 2Y66A 3CCFA 3GG2A 4L75A 4NZPA 1AS3A 3RHFA 1R8JA 4BX2A 2GLUA 3B7PA 3I9LA 4LW8A 2PUBA 5TSDA 3EHDA 3HYNA 2FWRA 5DNDA 2FPXA 2A14A 1UBEA 2V9ZA 4ID9A 4INAA 4EY3A 1DXYA 3SDSA 3KKPA 4GG1A 4LY3A 2OFWA 5G0SA 5K0CA 1BWQA 4G4SP 4F9GA 3Q9NA 5L7WA 2X6TA 1KVRA 3D7NA 2RGWA 2CNWD 2FWBA 8OHMA 3RYCB 2VSOA 3L7OA 4B87A 1AKTA 5MF6A 2WIFA 2QYTA 1B8UA 5DIFA 3LMKA 4ESVA 1JDSA 2PKRA 4TS1A 3JTMA 2P2GA 1PJ2A 5A4DA 2R7AA 3AF5A 3PWKA 3CF6R 1OZHA 3MJ4A 3BDAA 4D0RA 1G2OA 1EB8A 1OJ7A 3O7WA 4JT9A 1V41E 1P9OA 2WYOA 4L3WA 4LKOA 4Y6QA 4NDNE 5LPNA 3AR3A 4NNPA 2JLAA 4X85A 5IWCA 2F43B 3L0SA 5IWAB 1RKVA 1L6IA 1XXHE 5CH3A 3BAZA 3UHFA 2EDCA 4DAOA 5C8YA 3ZD9A 2P91A 1N7HA 2QNRA 2WINI 2ZSBA 4KXQA 4QDJA 4V0OA 1NVEA 2FUG6 2PZFA 1YU6A 1TX4B 2VKQA 2ATCA 3CM0A 2R00C 2APJA 2HDWA 5JANA 3DH0A 5CBPB 1R74A 5GJCA 3CVVA 1RYYA 2WF9A 2ZATA 3EA4A 2IUUA 4NCAA 5DWQA 5DEIA 2QX8A 2Q41A 4H7DA 5BVHA 2H51A 3EY9A 4FHCA 4TLAA 4EQZA 4M9UA 4M2LA 4KMSA 1C1HA 3A9CA 2NG1A 4D9GA 3RG8A 1TF2A 2FMHA 5FHQA 1PJRA 2CUKA 1QRRA 1V8PA 2RH8A 4J0FA 4Q7QA 4JXKA 4EL5A 2WD7A 1JECA 4I9GA 2XVXA 1ADFA 3EWIA 4R05A 1KDPA 5FB3A 1UXHA 4ZOAA 2IOHA 3UN1A 4RVGA 4GICA 3D54D 3O8DA 1IONA 5E6UB 4YQZA 2C2HA 4QX6A 3THSA 2C2BA 3QEMB 2GCOB 1NUQA 1BKDR 4G3XA 3A4TA 3HJAA 3I5MA 3TI9A 5AVSA 2K2WA 1T0HB 3H11B 4NCKA 1I7PA 3PDWA 4DNQA 1T9BA 3HY3A 3MOSA 4D44A 1KYZA 3AQIA 5DHFA 2PYZA 1KU6A 3VDXA 3K7EA 1DTEA 1GFWA 3JWGA 1T0JB 3A6KA 3P9IA 1Q12A 4I5IA 4RTQA 3QPDA 1WY7A 4LVNA 2QT1A 3I6ZA 3PFWO 2HJRA 4L50A 5LJIA 1GUFA 3W8DA 1E0JA 4MKGA 5C4IA 4LF4B 1E2MA 1U65A 4EMTA 2PTGA 2H1RA 4CNBA 1L1RA 5TDHA 2LIPA 4RTJA 4CGYA 2OUKA 1E3JA 3RYIA 4R3NA 4IEEA 5H68A 3L6RA 1IPHA 1PAUA 2CBZA 2PXHA 3DHYA 3U7JA 4A73A 2PWAA 2QX4A 5EMNA 4O4IA 2J5RA 4HMQA 5L3ZA 3K9HA 5D1HA 1FJ2A 1XOIA 4WLFA 3B60A 4U6QA 2QL9A 1XEXA 4RVSA 5AI8A 1RJ9A 1FUYB 3HEMA 1AXGA 1W0JA 1LFAA 4UDXX 4OJTA 3V4LA 3QPCA 2ZUDA 4N5DA 4Q21A 3O74A 2PS1A 1MDFA 1WNFA 4QVGA 2HMTA 4NBSA 2DULA 2PL5A 2PSEA 1JAYA 1W73A 3WMWA 1UANA 3FZGA 3HBMA 1XDBA 1SAYA 1HFJA 1PUXA 4JNKA 1LZLA 2C92A 3INRA 1OXSC 4FQ7A 2NUBA 3H84A 1YTLA 4YYZA 2H0QA 4POOA 5I9NA 5JAZA 1DJMA 3PVCA 4NCIA 2ZZMA 1W36C 4NS4A 4B1FA 2MYPA 2Z2XA 4FFRA 2GNOA 2ZIGA 1SUFA 2OG2A 4N5LA 2DFKB 5HXAA 2EDAA 3FBTA 3ZWNA 3DUWA 3IT0A 1IZ7A 2IWRA 1P1RA 2JGIA 1QYWA 3WWEA 3FYUA 3ZCPA 1VMDA 4PPQA 4CWAA 4CEHB 4UW9A 3UK6A 3DAPA 1XJCA 5DXAA 2CKDA 1CUWA 5AH0A 3QKRB 4B3DA 1IY1A 4BVAA 4CR8A 4DCPA 4EY7A 4UUAA 2PUCA 1XJQA 1PW7A 3GLFA 3HY4A 4V0QA 4ERNA 1SU4A 2GETA 2NYUA 4CR6A 1G5IA 1KVSA 2XWQA 3FSGD 1V2HE 4HAIA 4L9WA 3QMMA 4DIMA 4YX9A 1J22A 2HRZA 2WUWE 1OT5A 2TMKA 3ZZTA 1L7XA 3PYLA 2H2FA 2IH2A 3NM6B 1HLFA 4IWYA 3KPJA 1P6UA 4DLRA 4IVNA 2NPIA 3IL2A 3NT5A 4RF3A 2BLLA 5IK2A 3UWOA 1J07A 2XSZD 4GL4A 4BN5A 5C81A 1D5WA 1UP4A 1KK2A 1YS4A 2AR7A 1SCUB 1B7GO 5JAMA 4ZVOA 2I1LA 2AJTA 2F8SA 1F2TA 1ZUNB 2QVLA 4LF9B 2X0IA 2DR3A 3O73A 3NJ8A 1Q16A 2EW8A 1VE6A 2ECFA 4N49A 5HFJA 1ACLA 1JA9A 3LBNA 4XX0A 4LRWA 5FA6A 4CKWB 3L46A 2I6XA 1WWKA 2WVAA 3JQFC 3GPCA 4DQLA 3A26A 4QO7A 3PQFA 5CG1A 1JAXA 4L7QA 421PA 1KMIY 1G291 3I01A 1Z4QA 3BQNB 4J4BA 1D2RA 2L42A 5IDVA 1J2RA 1O89A 1YJ8A 2K87A 1USVA 3FF1A 2BGJA 3LX5A 2XDAA 5E2BA 3RRYA 3L40A 4NYIR 4RH0A 1QF9A 1YONA 3EQ2A 4B3XA 1Z3IX 1WO8A 3QEOA 5FORA 1JHPA 5T4HA 3EDQA 2WJZB 1UQRA 1WB9A 5BQ5A 1QE5A 3NKLA 4DARA 1G8PA 1WQ3A 2OHVA 1NIPA 2QN6A 4ZKEA 1FMTA 3IVXA 4D9HA 4MTLA 1KOLA 4YV2A 5TS3A 2CXSA 4CKBA 1OREA 5KYGA 3A9RA 1T5HX 2BFAA 3DL0A 2AE2A 1BWRA 3CUYA 5LZ7A 4MJ7A 1F4PA 1XT6A 4R8RA 1ZCZA 4A1OA 5HKBA 3RYFB 3E48A 3K1ZA 1M2HA 2WF8A 3OZAA 2H4FA 4I50F 4XR9A 5IM5A 4EARA 2WJYA 2B36A 2HDNB 3B6IA 2VK1A 3D3EA 3H86A 1QV9A 1MU0A 4H1TA 4K1XA 4NAHA 4RK1A 1QLHA 3STWA 4K6HA 4C3VA 2C1ZA 1UT5A 1M54A 3NJRA 3ZWMA 2WWXA 5HW0A 3L3BA 1NQTA 2AJCA 4O2LA 2IYYA 3EF1A 3M49A 4QGGA 5GVRA 3V7WA 5A3RA 5JHGB 4XYEA 1B3RA 3GLHA 2X1HA 1RT9A 1IAVA 1NFRA 3ESDA 3N87A 3I8SA 1JP7A 1E1MA 3OTGA 2OD7A 1UBRS 4G5HA 4PO3X 3TCKA 3WE7A 5DOZA 2Q49A 2W6MA 1IOLA 4HN9A 3DVLA 4D80A 5DYGA 1NQAO 4LI0A 1R6UA 1TGYA 1U0TA 5B2EA 1I80A 1HNNA 2ZPAA 3OQ6A 2UUPA 4IV8A 2WWGA 3SJZA 1DC5A 3ZK9A 3AWDA 1YZVA 3RD5A 3X1WA 1ICEA 2EKLA 4WN3A 4C0HA 2WLSA 4KTTE 5D86A 1UFRA 2PIAA 4I4IA 2P2CA 1WF3A 4N76A 2PWPA 2NZ2A 3V6LA 4B3TB 1ACJA 1O5OA 3CUVA 3BJRA 1DXQA 2FWMX 3V55A 4GSLA 1QS0B 5CYOA 1YIOA 5LQRA 3AVWA 4CF7A 2FNAA 3OJXA 1XCGB 4FI3C 4R6XA 4YP9A 1S01A 3E8SA 1WB4A 1BMFA 1JQ5A 4U00A 2QM3A 2J5XA 2WJWA 3W2TA 1E6LA 4RDHA 2DETA 1U8FO 3MWEA 4QOEA 3LO5A 2Q5EA 4I1PA 5KAMA 2GMWA 1WOMA 1ABFA 5K6AC 1C1YA 4KN6A 2QZ9A 2MDTA 1YSCA 1COZA 1FTWA 3ESXA 3DOIA 3WGMA 1XCPA 3ZDDA 1OJLA 1C9DB 1CXZA 5T57A 1USGA 4EGQA 1D2CA 1G41A 2FX2A 4C0KA 3KQVA 1QTQA 3EJWA 4LYYA 1RI1A 1RAAA 4YJFB 4RMGA 3WDMA 4RELA 1WF6A 2XUOA 2CYCA 1SK9A 2XKKA 1TO6A 1Q3KA 3V7NA 1DZ3A 2ZWMA 3R7FA 2JBAA 1CUFA 1Q1QA 2ZPTX 4NOKA 3DTTA 4R40A 1L1EA 1UMCB 4MQUA 4KVAA 4YMSA 5GMOA 3IEMA 4LHEA 4J0JA 1T24A 1TQ2A 3DVQX 3VU9A 1DELA 2EKBA 3PHJA 3KO8A 1UKCA 3K0AB 5EPUA 1GL9B 4DJTA 3STVA 1HDIA 3CZRA 1LF0A 5IBCA 5EJGA 1E59A 1R4NB 1G2QA 2AN9A 2W7TA 3DE6X 5DSTA 3HWRA 3K6KA 1H0KA 5EIHA 1Z2PX 4TTQA 1XPJA 5G0TA 3IGFA 4ZJPA 2JKYA 1E3QA 4MA5A 1OLXB 2J3LA 3BTVA 6REQA 3BHMA 1P4AA 3DSRA 2ZB2A 3N8GA 3G5MA 1XDDA 1RJWA 2ZYIA 3N2IA 5K4GA 5BP7A 3S3TA 3WKEA 1RXWA 5DM1A 3C6MA 3CKLA 4K8OA 2X58A 3ORSA 3GELA 4FMCB 2BELA 4OQEA 2RG7A 3PNLA 1YUMA 4TKVA 2IYZA 5I7FA 1T3LA 1G0NA 1JAZA 1PQUA 2RHDA 3FMIA 3N76A 2RKBA 3NUQA 4RLFA 1Q1GA 2JKVA 1G64A 2Q1SA 4Z8XA 3TKAA 1O54A 3BZUA 3A1DA 2PXAA 1F0PA 3W9SA 2YTZA 4O5AA 2JAQA 3AP1A 3L1IA 4DM3A 2ZROA 2AVDA 4OYHA 4TYNA 1ZVVA 4RSGA 3FDFA 3HL4A 1AIPA 3CE6A 3FH0A 1E58A 1ZQ1A 3F7NA 4R8LA 1JEQB 1H94A 3QU5A 1EFCA 2V7PA 2Y0EA 4XYMA 3IV9A 2VTBB 2BPOA 5BW6B 1L8XA 2RI1A 1JZSA 4P9NA 1XA0A 5L9AA 1XPOA 2VJCA 3TN7A 2OY0A 1NBHA 1DUIA 2YXPX 1R4MA 2C4NA 3UJPA 1QH1B 3VR4H 1YDMA 4TQ9A 3FHLA 4F2HA 1A4UA 1PE0A 2BCGY 3HN6A 3QKTA 3RQSA 1DDOA 2FQYA 2FOLA 5DI3A 3WGOA 3C3PA 2ACKA 3U7QB 1GZHB 4UNSA 1W0KA 4BE4A 2XMDA 1O0BA 3LKDA 4GU5A 3ZPXA 3VJRA 4EO4A 1HYHA 4E09A 1NQXA 4D8TA 1ZN9A 2DUNA 2ZZKA 1E0AA 2ZIXB 3PUZA 2BEUB 4QTXA 3GN2A 2AEEA 4V0SA 2GRJA 2CXPA 1XP8A 2GARA 3UK2A 1J9GA 1EP3B 3E82A 3LYUA 4WNYA 4ABYA 4KR2A 2WIKA 4G4SO 3G79A 1C3EA 5IN4A 2C7PA 1OWNA 1T4DA 2QJWA 4WT7A 4BO0A 1WD7A 3I2JA 3NCHA 1FMFA 1MO5A 1RWKA 1VHLA 4Z3DA 4IHQA 2PKCA 3V2IA 5JO0A 5K05A 3BH6A 1SKQA 2PT5A 1GQYA 4IHJA 3LP6A 1Y5IA 1ZD8A 5A9TA 3ZY5A 4BNMA 1Z15A 1GNLA 3JD1A 1UP6A 4A8PA 1DAGA 2BFNA 1FUIA 2RHCA 4ZAXA 5TF4A 3GLFE 2HJHA 1QH9A 2CHVA 2I3AA 5A4AA 2LBPA 4NMMA 1VL2A 4CODB 5FA8A 4AZWA 4D3ZA 1LK5A 3LP5A 1SQ0A 1Z4IA 3NM5A 3LVQE 3IMKA 2PX2A 3LF1A 1URPA 3AI2A 2IEIA 4RK7A 1EUQA 5DHUA 4RPCA 1Q0QA 1S7GA 5L53A 2YV5A 4P0TA 2QW1A 1BG6A 2EBWA 2CCJA 5B64A 1PFVA 1QK3A 2VPIA 3M83A 2HWUA 2GN9A 4M1MA 4X1IB 1Y8ZA 1F7VA 2RH9B 5CD1A 1RVDA 4LBVA 3W3AA 1ZCFA 3KWFA 2LKCA 3BBPA 2Z2IA 4JH0A 5E4FA 2ZRHA 4DLWA 1S5PA 1QAQA 3GOHA 4UEKA 4XQ0A 2X8JA 2WJAA 4KX3A 5CDYA 1CB7A 1CBUA 2I8AA 1TFUA 1TUBB 1U28C 2D54A 3H2IA 4PVCA 4Q34A 1D3AA 1SRQA 2Z58A 3Q0TA 1PG5A 5DIZA 3ZBUA 5CR9A 1F6BA 2CXXA 3SY8A 1FQWA 1E92A 1PLKA 1W25A 4TYMA 3L1JA 5JSYA 1QYCA 3V1UA 2WA2A 1K7EB 2QNIA 2A5JA 2IXEA 3DMNA 4L3VA 3OX4A 1LLDA 2I4OA 1A3CA 3RCBA 1P19A 4M4SA 3WLPA 3OF5A 4LDRA 1I9CA 5COQA 4X8HA 2IZ5A 1TA4A 1XE3A 1OZGA 5AJXA 5D6OA 1Y6GA 4E12A 1F7UA 2OQIA 4AUMA 5AVZA 1A5SB 1QMGA 1JI3A 1T9AA 1SVOA 3HU1A 4OXRA 2H3HA 3A6LA 3RKRA 1NUSA 3T3EA 3GP8A 2ZQ5A 1PV4A 4B4UA 2GN1A 3ISTA 3WL3A 4LF6B 2DERA 5TEVA 1NF8A 4RL6A 1YRLA 3TQFA 4KR0A 2LD4A 3R4CA 3UK0A 2Y0DA 5AKHA 4DPKA 2OEPA 2FPIB 3F2IA 4IY1A 1UIMA 1IE3A 5CFRA 3FTEA 3ABIA 3LBHA 4GRDA 1L7MA 1RI5A 4IDPA 3EGOA 5KQRA 4S24A 4ALKA 4C7BA 1E8MA 3VKWA 5HF8A 3ZIUA 2UKDA 4KE6A 1XNQB 5KPDA 3NVKI 4D98A 2BRUC 3GLSA 2YVQA 3L18A 4Q7JB 5LC1A 2VHZA 2WBLC 5E8JA 3I37X 3ZR4B 1NSYA 2GZ2A 2QTBA 3IA2A 5JR3A 3I5YA 4D82A 1TM1E 4RHUA 5TX7A 5AKZA 1S2NA 1L5RA 2PAFA 4AKIA 3L1VA 1TK2A 1TL7C 5JAHA 4S35A 3USES 1P9LA 3ZTWA 2GWRA 4GP6A 2RGRA 1SEVA 1ULSA 1ZH2A 3SEZA 2PL9A 3UAYA 3H9JA 5ICSA 4E07A 2OORC 2PG3A 3IR6A 1DV1A 1QCDA 4YTEA 2KYRA 1ILWA 5T4FA 1G18A 1SHUX 3QVXA 1ND5A 4OK5A 4I08A 3MCAA 2DH6A 4DLPA 3BE6A 4EDHA 3U4QB 3TZ6A 3E1GA 2JNWA 1U7HA 2AZ4A 1SBNE 3IDZA 4DM7A 2QLMA 4LBZA 1T2CA 3P2MA 3T3DA 3W3AD 1AGRA 2ZB7A 1JJFA 2D62A 2WT9A 2YXDA 5H80A 1MQ8B 3K30A 3KEFA 1HRDA 4U9UA 2WU4A 3VX3A 1L5QA 2GPTA 3MTEA 4OAOA 3K2QA 2CXHA 2I7DA 3AMVA 3T1QA 3FF4A 3VMMA 2R9VA 2IDMA 2O2JA 4EI9A 5FBQB 4ZZIA 4OIFA 1GN9A 1YCGA 2OGSA 2RHWA 1PJQA 1U8TA 3CZAA 4MQLA 4PYIA 5JADA 5JMWA 2Z1DA 3KWMA 4D9MA 3EVNA 5LQCA 3GDWA 2Q21A 4YUVA 5J2TA 4C2UA 3F4BA 3LOPA 3EFOA 4BP1A 1UL1X 1N5OX 2G9QA 2IHUA 4FK8A 4WY8A 2NM0A 2OP0A 5ES3A 1DP4A 1SHKA 4RXMA 1ND6A 5FR2A 2Y3IA 3DPIA 5BORA 4KI7A 2FKNA 2VNHA 1PFGA 4BKUA 4OJYA 2CLKB 3Q3VA 3PTLA 4R8VA 3HVRA 3P9RA 4ILKA 4E5UA 1XPRA 1LJUA 3RFFA 4C0XA 1LPMA 4JVOA 2A35A 1H5NA 4OKIA 4AICA 4LZNA 4GMKA 4C5AA 3TGWA 3EVFA 3ITKA 1B8OA 1UM9B 4UBNA 2C7QA 2H4WA 3CHYA 3Q6NA 4TRJA 2C9BA 4ZTBA 4JR1A 3T41A 1UEXC 4KLNA 1DUSA 3CZ5A 5DNWA 3TR0A 2OZEA 2Y67A 1AMNA 1KGDA 1WV1A 1ZSNA 3V7YA 4F1JA 2WI8A 1UMDA 1W49A 1JZQA 2VYFA 1Z82A 4PG6A 1W88B 1UWCA 2AG8A 2WQZA 1P1BA 3FVTA 1W0JD 3NHYA 3WJ2A 3SI7A 3GD5A 1LWOA 4P35A 5LDDC 1XZKA 5F7JA 2QRUA 1QFJA 1PVDA 1TC2A 2VYCA 2FU5C 2QQEA 3BCSA 4JBHA 4QPDA 3ELBA 2HM7A 3I04M 3UXMA 3E9QA