1D7BA

Cytochrome domain of cellobiose dehydrogenase, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
b'ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
molecule tags Oxidoreductase
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7bA00
1D7DA 1PL3A 1D7CA 4QI3A 1D7BA
chains in the Genus database with same CATH superfamily
1F00I 3NJJA 3DVIA 5GRJL 1LXMA 2F58H 4TOYL 1T1XB 4EMZA 5IM7A 4J6RH 4OCWL 1W0VB 1DQDH 4M00A 4LLQB 3MRIB 2BNQD 4OZFH 2BP8B 1FVEA 3KWUA 3N40F 1U2YA 4U49A 2C9AA 4C47A 5L7XH 1WFMA 4LARH 3UPAA 2JF1A 4HIQA 1GHFH 12E8L 4N0RA 1KCLA 4TYUA 1HXYA 2VDQL 3DSFL 3EOAB 1IT9H 2IDFA 2CALA 2XWEA 5MEPA 4FLSA 1R3IH 1G7LA 1CTNA 3D0VB 1U92B 2YMXH 5C0BB 2YPKA 5D1ZA 2WJ5A 4GSQA 4X0KB 1SMDA 3IU3A 3KLSA 2ZX9A 4RH4A 1DVSA 2F19L 3ZYOA 3X3GH 3QHTC 2EDOA 4X6DE 4ZUUA 4W9DC 3NJMA 3ARFB 4P59L 1BM3H 2C26A 2YD3A 1C16A 3W0WA 3AZUA 3E7JA 1RJCA 1XCTB 1CD1A 1UB5A 4E0RB 5BMFL 3FF8A 2H2SD 5DJXA 4FERA 5INDB 1E5CA 2QVMA 3OD3A 5C07D 2WBJC 3LX9A 3U0TA 1D7FA 2WQ8A 2BNRD 2W0FA 2EDBA 2NCMA 4GMSL 4X4MA 5MENA 2YPKB 1QFOA 5D1ZB 2KYIA 2CO2A 3CFEA 3CK0L 3HZVA 3JVGA 4JY4A 2GJ6E 1OGSA 2MPAL 4X7EC 1YLBB 2Q9OA 4NAMA 1MXDA 4U0QB 4ZSOE 3U9WA 3JWOC 1CXKA 3QJXA 4AM0Q 3STLB 3BQUA 3NP3A 2GCYB 4ZOEA 2BY1A 1U4FA 4M7KH 4PJCE 5IKCA 1YYLL 2HN7A 2ESVB 2AC0A 1JZHA 3LKNB 1AHKA 4PRHA 3QDME 2BNRB 4BZ1H 4CILA 3T65A 4NAJA 2R0WH 1OSZB 2EIDA 2EC8A 1UM5H 1C5DA 1EHKB 1SUJA 4K07A 1T1XA 3GSRB 3DK0A 5DUMH 3PQYE 1MELA 3RNKA 4XWOD 2IALB 1OWWA 5IOPB 4IKLA 4JKNA 2CR3A 3GMQB 4U6HA 4Z3IA 8PAZA 4JQIL 3JWNE 4APQC 2X4UA 3QIBB 3PF2A 2N7BA 1LE9A 1OAQH 1F2XK 3MLYL 3VXPA 3KPMA 3VFOA 4YMPA 3IDIA 4TLTA 3HZMA 1X5AA 5IB1B 4M6NH 5GRXG 4P2QE 4W9EC 4WEBH 5GQBA 4IBSA 3OZ9H 2W0FB 4U7SA 1XT5A 3ZQXA 1KWKA 5KAQG 5IREA 1NCAL 4EOWH 2XN9E 2YN3A 4TNWF 2YA2A 3AWEA 2RD0A 4GG6F 3SQRA 2PCPA 2D7MA 3SGEH 1ETJA 1NTDA 2BVPB 4Z8FL 1E67A 1RZ8B 2RA1A 1EX0A 4RGNE 1P7KB 4G6KL 4LEXH 3OKNB 2V9TA 4HZLB 3FT1A 3O2DL 1TJGL 4JFFA 5SWSD 5ACLA 3ZTEA 1DBBL 3QFJB 2JKJA 4XVJH 3VM7A 3LD8B 4WO4D 2C4FT 3UBHA 4Y16D 2OSLA 4Y2LA 2GEQA 4PJBA 3TTYA 3KCWA 4PD4K 4QRUA 1GTFA 4G43A 1ZCRA 4S1DD 2G60H 4HU2A 1CF8H 3VXQB 3GMQA 4M5YH 5CCHE 1JZ5A 3D09A 4ZTOH 2X6CA 1GS7A 3G6DH 2D3LA 4JO1L 3GRWL 2WWKT 2ARJB 4BE6A 2VDRB 1VEMA 2J8UE 3BPLB 2EE9A 4BWTA 2AJXH 2BIIA 4FNTA 1PZCA 4XHJC 1JYNA 2N7AA 3QNYB 4TUJB 3HZ3A 2GT9B 15C8L 3DJZA 1A9EB 1FF5A 5DYOA 3WDHA 1TVHA 3ATAA 3H42H 5D7HA 1YQVH 1M42A 3OSVA 1ZVNA 1U8HB 2R56L 3CU1A 4KK6C 2Q8AL 4OW6A 1BZOA 3VFGL 3S5ZA 5AL0A 1UWXK 1PIFA 2BPBA 2XKNA 3NG5A 4OIIH 5DEGB 5JO5A 3UCRA 3TF4A 4DWHA 3B5TA 1OAXL 2VITB 3S4SG 3D39A 4GW1A 1RUPH 2R0ZH 4M1GH 5K39A 3WIHA 4XMVA 4BBWA 1NBZB 1HZKA 4L4VD 4FFWC 4WWKA 3VB8A 5EO1B 2YEZB 4J4PC 4NNPL 3MV8E 3CPLA 4OGAC 5F1SA 1F4AA 2X6BA 2KL6A 3VXUA 2VW6A 2IJ0C 1H5BB 1PKOA 4OZFA 2QKSA 1MFDL 1OE2A 4WTZA 3IJ9A 1A7OL 3LXAA 3FMGH 3MACH 1HQ4B 2CPCA 4EI0A 5CZKA 3K80A 2X6UA 4GSUA 3CVHL 1WFUA 3K8LA 3W0WB 5BQ7A 1KBKA 4QEGA 4G8GB 2FJFA 2HWZH 4QLWA 1KN2H 4BV1A 3LZRA 2EXWD 2O5ZL 3W1ZA 2NUPB 4GI8A 5D71L 4IS6B 2W9DH 5HVFB 3U46B 4G83A 1GYAA 2ATKA 3FCTA 3VRLF 1JNLH 2ALWA 2HLFC 1SJVA 5GRJH 2F2HA 4X8CA 5LAXB 4WI9A 5GS0L 3QJFB 3KYAA 4LRIC 2MHAB 5LBGA 4AYID 1H3TA 3MU3A 1DCLA 1JV5B 4PTUB 5DJ8B 2JLLA 3SDAB 3V2AR 5TPWL 2HRPH 3QHZH 4HUUB 4HGWB 3MA7A 4JNXA 4W4NA 12E8H 2DBJA 5IOPA 1YJDH 1F58H 1A4KA 1T5WB 2AQ2A 3HN3A 5FB8B 5E94A 3DSFH 1JP5A 1JG9A 2EDKA 3QUKB 4PWGA 1P7QD 2B1AL 1D5MB 1ZJBA 3ULUD 4M1CD 4OSUL 3L08A 1ZRUA 2FK9A 5J11C 1ZXQA 3U6RB 1T83C 4MMYA 2NX5D 3QUXC 4AEIL 4L8DA 4P8QA 4F37F 3FQXA 3G6JA 3RZCC 2L8AA 1LEKB 3FQTB 4YPJA 4OF3A 3MBXH 4DT2A 2H5UA 3MNVB 4H8HA 5ACZA 4BINA 1KV3A 5KANI 1NC2B 1VSCA 1CCZA 1UEYA 4NSKB 1XGRA 4KKCD 3RX8A 2R9HC 3ESMA 3QQNA 1K2DB 5AW7B 4YDZA 3G5YB 4KVPA 5A2LH 2WLJA 4NN5C 3RNQA 1N7ML 1Z5LB 4MAYD 3RX7A 1EVUA 3KMDA 4M61B 2G0KA 5H2BB 3LXCA 3BUYA 1UKQA 3CZEA 3CK0H 1U8OA 4M9OA 4M4RB 4KKBC 2VLKD 2E6JA 4WO4C 2E47A 2AZAA 1T5KA 2WP3T 3FRUB 1UASA 2Z92B 3SDYH 4F8LA 2ICWA 1BD2B 5FYKU 4JK0D 2VDOL 3WFZA 1E4XH 4X5XA 5E6IB 4BFBD 3QIWD 1CFTA 2Q7NA 3CZSA 2AK1H 2GFBA 3TNNA 5ICXA 3PPEA 4PG9A 3WFCL 4TQ8A 4NZUL 4KX9A 2CDEA 5DUML 4OLVH 4U1LB 3WUZA 3TBCA 2VLJB 2BVQA 3DTUB 4XAKD 3C6SA 4G6FD 5T3XD 3VFPB 4U6XB 5E56A 3MRHB 3OR7B 2F54B 2VABB 1RUMH 1KCRL 1T22A 1ZHBB 4P49A 4YL4A 3PFQA 5C0CB 5J5EA 1QSED 4JCMA 2NSQA 4YGVB 3UAJD 4DVBB 1H15A 5GSVA 2YXWA 1HQ4A 2ZKXA 1BVLB 4HJSA 5J12C 1OAQL 4G8AC 4IHBA 3L9RB 4FI7A 3CVHB 2VLKE 3M46A 4M03A 2ZOKA 1KTKE 2J12B 4I3GA 2IFFH 4WJKB 3U82B 4F91B 5IP4A 4YR6A 5KJRL 5JMRA 1UACH 3VQ1C 1O7DE 2V37A 4P2RE 1VGKB 4YDNA 2IPUK 5K39B 3RZCD 1HFUA 2KZ1B 5DZLA 3U9UA 2VOTA 4ZTEA 4BWUA 1JHTA 2WWOA 4HCRA 2HUHA 4LOUD 1AGBA 1WAAF 1L0XA 5CGBA 1CN4A 1I82A 1VZIA 3B1TA 3FUIA 2NW2B 3SYCA 2OAAA 1JDCA 4HXAH 4KRPB 5T8IA 5KG9A 2PW1B 1ACZA 1MCWW 2PCFA 2VDNB 3RUGF 5ITFA 1K6QH 2FUTA 1EFXB 2WOYA 2VZ1A 1E5UI 4KBPA 1HH9A 3O2DH 2C4FU 3TNMA 1UM4H 2WXRA 1KZQA 3TA3D 5DS8A 4ZYKA 1UB6B 3RPBA 4Y8DC 2JCWA 2PR4L 3T6XA 3ZIMA 4EVNB 4ZOBA 2NY0D 2EC9T 5AENA 1FL6A 4P57A 1QBMH 1RZFL 3QWRD 1FGNL 3FB6A 2YKLL 5MEOB 1UD4A 1IMHC 3ROLA 2E7LA 4KQ4H 3SDDB 1HHGA 1E27B 1IAIM 4APQB 3CDYA 1I53A 2WIIA 3IFLH 5I1IH 3SDAA 3N50A 4P5RA 4XMPH 1BOGB 5JORB 2IQAB 4ZDHA 1QTSA 3B37A 4X4ME 5MENE 3ARED 4S0HA 1J7VR 1JGIA 2H1XA 4KXCA 4J23A 1FSKB 3D4ZA 3D34A 1T7YA 4XNUH 2XQ0A 1T6BX 2Z31A 1I7ZA 3HR5B 2D03L 2LLLA 2NY2B 4JN2A 1DANT 1C12A 3H42L 4PV1C 2YAHA 3DSNA 1KEMH 1A4JB 3I3BA 3MJGX 2R56H 4U1HB 4RNRA 4XNBA 4O02B 4XVSL 3PIQA 1WT5C 1A4JA 5EU7E 1AH1A 3G5ZB 4K7PH 5IJKA 2KKQA 1QLEL 5AYQA 4EKXA 1OAXH 4U1MB 3L3OA 1GCFA 1PY9A 3NESA 1RZGB 3QISA 4GIOA 3DWTA 1WEJL 3LIZA 4YDIH 1TZAA 3TFBA 1X5KA 3ZZLA 3PWUA 5DGQA 1F1AA 1EPFA 1J1OL 3MBEA 5F96L 3SDXA 3MRPB 2W9EL 2R23B 2BERA 4XMTA 4QUOA 2HJKB 1MFDH 1YZZA 2Y1AA 5CLWA 3FT3A 1BLIA 3T3MB 1PTZA 2CR0A 2IG2H 4LHUA 1HE8A 4CC4A 3NH7H 1KN2L 5FDYA 3BZFA 3LMJH 5C07E 1CXHA 1AMXA 1TVDA 2W9DL 1E6JL 4U3XA 2P8LA 5KOVC 1JNLL 1S7XB 1OSZA 3CBRA 1CFSB 4HJGB 1CFNB 3E3QC 2GJ6B 1D2OA 2DYPB 5IB3B 1DVFC 3AROA 2RFXA 4Q2ZB 4Q7DA 2P5EE 5IFJB 3GDCA 2AJSL 4YO0B 1JGVL 3JYCA 3MCYA 2YPVA 3FUNA 3SCMD 1F6FB 3MNZB 5A3ID 4IRZL 4TPRH 1AGBB 4LSRH 1CYWA 4JFEB 2JKTM 3VCLB 5KBMA 4NX0A 1FLRL 4E9QA 2WQSA 4UTAL 4EN3C 3P9LA 1FG2A 4ZO9A 5EBWA 2F1BA 4X2UA 4R9HA 1DL7H 1KJVB 1WYJA 1XF4A 4NUQA 1HU8A 1DBKL 4N8CL 1PZDA 3WN5A 2AQTA 2F5AL 4MVBD 4XVTH 1OT1A 3OKNA 2X3AA 1WJ3A 1RK1B 5AW8B 3TA4D 3NOIA 4AQ1B 1F1GA 2KQMA 2H0EA 4R90H 3N6YA 1FZMB 1QBLH 3BLBA 3O8XC 4F7MA 2FT8A 4M56A 4Y4FA 5F1NB 3AQXA 4OF0A 1WF5A 1GC1L 1SMAA 3EBAA 5C09A 4A2DA 3N1FC 1A7QL 1RZKC 3VI3E 3KPNA 5JHLA 2NY5H 3MC0A 3STBA 4LL9A 5J8OA 1EO5A 4LSPL 4GAGH 2BNRE 1N7MH 2WTRA 1AMYA 4FNQA 4RRPG 1YC7A 4M7ZC 2VRAA 4HW6A 3DHJA 1MCLA 4J3OD 4U0RB 1D7BA 2XQBH 4PJ7A 3ZHLA 1HXYB 3L4XA 2YGNA 3BGAA 1LO2L 5HY9A 3U0PB 1JIBA 3OR6A 4A6YL 1CD0A 2DTML 4ZX5A 4J2QA 1NUGA 4L3FA 3TYFB 3S8FB 3JBG7 4QAMB 2X09A 2IOIA 5FLVA 1EAPB 3RVTD 4M9PA 4LBAA 4LLQA 4MZ3A 4XMKH 1FE8L 3CHSA 3U7WL 3CX5K 3H56A 4Y9GA 5FA3A 4QOKD 2Q7YB 3PAUA 3QE5A 2QVKA 5EIIA 4OJYA 1T80A 4AV5A 1S5HB 4YSCA 3DKHA 3FB8B 5D6DC 5FR3A 4AQAB 1OAUH 2NNAB 4LDEB 2EE6A 4XPTH 2RTTA 5EUOB 2H0JA 2CHWA 1EJOH 1ED3B 1KTJA 4OZHF 3MNDA 2PO6A 5LGJB 3UGEA 2F8IA 2OR9L 1NGXB 3ARUA 3JZ7A 1WA1X 4OUOA 1AFVH 1BYPA 4PEEA 4UIMA 2NTSP 5EEUA 1IFGA 1QBBA 4K7PX 4TF4A 3EJUA 1J0IA 2VN7A 3GIVB 2XT1B 3EOBB 3O4OB 2OP4L 5FGBA 4XVOA 4GRLD 1NIBA 3LEYH 2YAPA 1H3PH 1J0KA 4X6EA 4OT1H 5CINL 3Q8CA 5GHWL 5G2NA 2WBWB 2WMPA 4ODSH 5CEZH 3U0TB 5KS9E 3QJRB 3WTXA 2XIBA 5KVFL 1UJ3B 3N0PB 1S7TA 4BUQA 1ZANH 2Y36L 4AQ1C 4BZ2H 1UT2A 1OP3K 3WKPA 3LEXA 5AWNL 2FX7H 4A2HA 5L88H 3LZNA 2H32B 2FHFA 3U1SL 5F2FA 2HTKC 5BS0A 2DWSA 3LNFA 3NEXA 4DP2X 1HHGB 5IJCC 3K2IA 2OM5A 4UZSA 3PWVB 3KWTA 3AAZA 4MWFB 3QUXA 1LNUA 3GIZH 1QSFB 5D2NB 5HGAA 5I2IA 4ZODA 2TRHA 5ALBL 3IS1X 4YHNB 2FR4A 1IGFH 1OPGL 3BXNA 4YHIB 2E59A 1KIUB 1KIPA 4PRPB 1FGNH 1J9TA 2DLFH 4LEEA 4XAKE 4K23H 3W5NA 3ECBB 1W0WB 1T89A 1NQBA 3ZL4L 1GMIA 2Z93A 5JTWA 3I6LD 5I1IL 1J48A 4Z3HA 5TE7H 2VL4A 5I74B 1SJHB 5EUKA 2VXVL 2B4CC 3E6HA 3L3HB 5E9AA 4FFYA 5SWQB 3GMPB 1U6AL 3OMZA 5EUKB 4I0CC 1S9XB 3FNKA 4BDVA 1QVOA 5FUOL 1N0LB 2Z3FA 4IJTA 1ZT7B 3ARYA 5B4MD 4I3SH 4ESKA 2FJGA 4XVSH 1OTTC 4GRWB 1WD9A 3HE7A 4I0PB 2WNXA 5EULV 2R2EB 4FQCL 4G42B 1O6VA 3DMMB 5I0XA 2CJTA 3ECBA 1YEFL 3FN9A 1P5UC 2ARWA 2FO8A 3APDA 3J07A 1JPST 4JRYB 5E1AB 4YNYB 3VFPA 1AVAA 4M5ZL 3N55A 1R0AL 1UD2A 3KBHE 3MV8D 4BUHA 2CKBA 4NT6A 2OZNA 3QO0A 3LQMA 5B38A 4AZUA 5AZEH 3CLFH 5IEKA 3CE1A 4K5NA 2GITA 4JG0L 4JQVA 2GAZB 3HE6D 4X6CE 4YX2H 1W2KT 4N3TA 3AGWA 2BNQA 5HDRA 1NGWA 2AV7A 1X7SA 4FFZH 5C8JB 1LK2B 3S98A 1P69B 1N2RA 3V6FB 2K3TA 3C75A 4X6FA 3LMJL 5J89A 2ICWI 3DX6A 3IJEB 1QG3A 4HF5H 1INDL 3BSGA 1MH5A 3M86A 4JM2F 5J12B 3MUGB 1AGDA 1AKJA 3P2DA 4PRDA 5DRWB 3MJ8A 3T0BA 2RHEA 2CKBB 4NT6B 2QSTA 4PREA 5AVRB 5D1XC 3Q01A 5TE4L 2CKNA 4HQQL 2WY3B 4LVHC 2ATAA 2DQFB 2AS5M 4YNYA 4OFKA 1F4WH 1CIUA 4AL8L 4HFUH 1S7UA 2XY1A 2ZSWA 3EYOA 1OTUD 3GSNB 3JV6B 4UDUB 1EHLH 2FWOB 4JM0A 3MMEA 4L0PB 2Q1EA 5BXFB 2JKWA 4ETYA 1FLRH 1MI5D 3FQNA 5C0GA 4KDVA 1XH1A 1PX3A 3D4YA 4KFZC 5CMAB 4WENB 2DQIL 3UPRA 5F9OH 2CA4A 2D7QA 3ALWA 2AHIA 3FTZA 1FO0H 4LASH 1I9RH 5IBTL 4AJYV 5ESAB 1XH3A 3H7LA 2Q7YA 4FCHA 1SM3H 3QIBA 3V0VA 1MLCB 2UY6A 4LF3A 1R24A 3GEFA 1OGAE 1F97A 1YY8B 2VISA 5I8EA 1A6UL 4ZFQA 1MLCA 1JTOA 2UY6B 4LF3B 2F7IA 2O5YH 3TCLA 4FI6A 4YDMA 1ZXKA 5FCUL 3B2VL 1AQDB 4F58H 2ED7A 2A9DA 2VSCA 2F5BL 2PO6D 4MMZB 1E0OB 4WIQA 5L9DL 3BKCL 3X12B 4HCGA 4PJIF 4XP9H 3DK2A 1LO2H 4CSSA 5AVSB 5MP6H 3KPTA 4JCLA 3UJJH 4NZJA 4QO1B 5KYYA 1LK2A 4UV4L 5AOKA 4G3YH 1XCXA 4Z7QB 2P3YA 1XXFC 3EFOB 2EEDA 4RMBA 4X7DC 2Z8RA 2IGTA 3FKUS 2P42B 1ASOA 3BQUD 4FYQA 3S36L 1HL8A 3LNEA 3WBDA 4ALAC 3L5XH 4ZFFA 1CBVH 2DW5A 2R2BB 3H54A 2OSYA 3O0RL 2OJEA 1EJOL 2Z8SA 2R2BA 3ARQA 1UFGA 1OSEA 4WO4B 3MCKB 1U8LB 4Q6KA 4E0RA 5FKPA 3D39B 4GW1B 4R6UA 3ESOA 3S0PA 2OK0L 5HYQB 3EOTL 4P3DB 2BZCA 3WS6A 4ZUSB 4CC4C 3UCQA 2YRPA 4MKMA 5T1MA 5TQ0H 3RBGA 1MHEB 2EDHA 2X88A 5ACZB 5I0DA 3E3QE 2EE0A 4PGZA 4UOQA 5IESL 3ZDXB 3LEYL 3SQOH 3PWLA 4Q2ZA 3P3TA 2N01B 1KWGA 4OT1L 3QNZB 4YXKH 4RFNC 3AU1B 1KTDB 2G5BB 3BWZA 1QSEB 4BKLA 3HBPA 2R69A 1U0QA 3EH1A 3HC3H 5E8DL 2IAMC 5HYFA 2R29A 5KW9L 4LAQH 4GBXA 5E95B 2OMWA 4WUKL 5E8OA 1XCWA 2Z4QA 3DV6B 3T2QA 2OMNA 1BG9A 2HT4D 2ZP9A 3FSVA 3UIYA 1IGJA 4ZPTA 1A1MA 4JG5A 4UB0H 3O3EA 1N5YH 1IC0A 3S48A 4PIBA 2XXFA 3WKMH 4OGAD 4K94H 3GD1C 1INQA 4K9EC 4L3CB 4P5TD 3WJMA 5E99H 3QUGA 3UP6A 1G7PA 2DZEA 2R1YB 3A6BH 4QRPB 4RGNB 2MCMA 3BEWB 3JTSA 2BSEA 2OSLB 5JHLH 4Y0GA 3UTSB 5I1DA 1EXHA 1U8JB 3O4LD 2CD0A 1A02N 2P43B 2NTFA 3CDFA 2H2PC 3JQOB 4N2OA 1AQMA 3HVNA 3L2MA 3UIZA 3MJ6A 1YEDA 3BWSA 1KXQE 4PPTA 4K23L 5DTFA 1YJDC 1A3ZA 5KVDL 1MNUH 3P0YL 4OLZH 3HS8A 1EGJL 3D9AH 3WEXB 3V4UL 1QNIA 2QJDA 4XI5D 3F6IA 3TM6A 1EUTA 2IWFA 3OQRA 4IU2A 3VXSD 5TH2A 4JPIA 3MXVL 4GAJH 3ZKMC 4QXVA 3RWHB 3LRKA 1H5BA 1V10A 4MMZC 4PIRF 2C9SA 4Y19D 1AZZC 2FB4L 4QRTB 2K8MA 3TH3T 4G80B 3W9DB 4FTVE 4DGVL 1ET8A 4EUPA 3CC5A 1ES0A 3TA3B 1NLDH 3VFSA 1JF5A 3QRFM 3IU4H 4QCIA 3WEXA 1RZ7L 1ZTXE 3BH8A 3CSYA 2ZCHL 4WK0B 1D2PA 3IJHA 1NGWB 2MNWA 2PKDA 5A6MA 5KVEH 2J25A 1JF1A 1ED3A 2QFPA 2N56A 1QI4A 4JKLA 4GUPA 4AK2A 1PLCA 4U1KA 5EU5A 4UTBH 4N9GA 3CDZB 2BOCB 2W81C 3OKOB 4YXHH 1DQML 3N1PC 4LVEA 3WENA 3BAEH 4NO0B 5DI8B 5A2KH 1SN2A 1FQ9C 4WRLA 1FIEA 4WQOA 2WQAA 4I89A 1M57B 2I5YH 3HUJA 4M7LL 4MJID 2XPGB 1X9QA 3ZY7A 3KYKH 3Q6FA 3AM8C 1L0PA 3LPWA 3IDJA 4CJ1A 2VR5A 5ADOH 5C7XH 4R4NC 4WZ9A 1MFMA 4J8RA 1MSPA 4NZTH 4XPHL 4X5QA 4DZBA 2XX1A 3ARDC 3D3VB 1WFTA 1JCKA 3TIDA 5IVXF 1B0GB 2NW3B 3VGAC 3CDZA 3IN0A 3DJSA 4NEHB 5EB9A 2YQ2A 5A2CA 4X6CA 1KDJA 1JF1B 2PYFA 2Y07H 3BCFA 1I1FA 5K9OA 4DPAX 4UQEA 2G9KA 4N5UA 3R8QA 5EO0A 5K69A 2N1KA 4OCMC 3RVUC 5H37H 3VDBA 1Z1WA 3ZRCC 3D69B 1ZLWH 2OL3H 3ZKSD 1A1NB 1BFOA 3LTVA 3QVAA 1N4XL 3TYFA 1NC4D 3U7YH 4UZGA 2ISDA 1XB3A 4YHIA 4JN2B 1OP5K 4Y4HA 2DY2A 5HHOA 1BDYA 3SYQA 5HGGS 3C60D 4XN9A 1F11B 4B6ZA 3J2PA 1I9RL 2KS0A 3E0GA 2FDBP 1XIWB 1HT6A 1X4ZA 4FHJA 4G5ZL 5CN2A 3D0AA 3FB7A 3CZFB 5IB5A 2BIHA 4KROD 4JFYB 2BHUA 1FFNB 4NJ9L 4B5ZA 5D7JB 5F88A 3QUYA 4OZHE 5CLYA 4FTVA 1E50A 3RIFF 5AW9B 2O5YL 4R3SA 4QIRA 5J13B 1XH2A 3DX8B 5E6SB 4JY5L 2W1NA 4F58L 1V7MH 4YSUA 1FNSH 1S3KL 1X7TA 2QDVA 2DLEA 3MUY1 4W6YB 3EH5B 1JOIA 1MEXL 2BRRL 4TUUA 3CX2A 3WIHL 3WJMB 3JV4B 3P40A 5DMYA 3BPCB 1DBML 4PM1A 2KPNA 5EBWB 5MP6L 1A9BB 4P4RB 4QRFA 4R0LC 5EO0B 3MRCA 4KGLA 3HRPA 1G6RA 4H40A 4NN7C 5GPRA 2A4EA 1NUDA 3SBRA 4MLIA 2HJKA 4OLUL 1TNMA 3OGCA 3O4LA 3V5KA 2WK2A 4TULL 3I3DA 4HIJA 4JO8A 5D7SH 2D3NA 1JHTB 4EUPH 3NAAH 2X6AA 3LVTA 2W60A 1S2EA 2B1HL 3BKMH 3HAEG 4XNZC 2B59A 3ZGIA 1MJ8H 3N41B 1G6VK 2P8LB 4YZWA 2AK4A 5I6XB 5FGBC 4RRPA 4LSQH 1JK8B 3QSKB 4NI6A 4AW4A 3RGHA 4CDGC 1I75A 2DQUH 4GBXD 2VDMB 1SHWA 2KBGA 2E5EA 3CZLA 1BPLB 1OAJA 3SIKA 3VFVB 3KPQA 3RAJL 4Q8BA 5AVUB 1XSOA 5FW6A 4HWUA 3HAEH 3BGMA 2DQHL 1SHXA 5AUMB 4OUUB 4ZRGA 4OZIA 2CMRL 3GFUA 4X4ZA 5BV7C 4GQRA 5IHBA 1HSAA 3F65A 3QQ4A 1CF1A 1GAFL 2CDEB 4BRVA 3MBEB 4UDTB 5B39B 3NABL 2YSSA 4YSDA 2R4SL 4WNSA 4ZZFA 5DK0A 3BD4A 3NRPA 1WWWX 2X4NB 4YE4L 2AVGA 3KAAA 1JXKA 3I9IA 2JK5B 1XGYH 3LV3A 4N20A 1FNEB 3WIIH 2P52A 1GIGH 4LBEA 2ICWB 3KDPB 4LPXA 4IRSC 2HTLC 2F15A 3F7YA 3WKML 5I1GH 5EU6E 4YHYB 4BCZA 2BLFA 3GQFA 3WLWD 3A0OA 3LDBC 1JPFB 5D6CA 1O6SA 4ONGL 4MA8L 4PV8B 5FGSA 2OZ4L 1CURA 3ZMRA 1SVZA 3Q48A 4A7GF 4D9RD 1T7VA 3KEDA 4YHOL 5CM1A 1F90L 1FDLH 3NZHH 2Z64C 1NAMB 4WUUB 4TS6A 1MHPL 4HXBL 4ZXBD 1OTTD 3UZEC 1MNUL 4OLZL 1MXGA 4ZI8A 4OCSH 1QSVA 3ME0B 4WDIB 2I24N 3FXIC 3ZW3A 1HI6B 1U91A 2ZOWA 3FUFA 3HPJA 2UUDK 2MCPH 3ZMEA 3BW9B 5HHVL 3SO5A 2VIRB 4NO3A 3LYRA 1MJJA 2JVUA 3LPOA 1B0GA 2NW3A 2B5IB 3FUKA 1KPVA 1WP6A 1A65A 2YD5A 1OM9A 2H9GA 3SYPA 3ZHFA 3V0EA 1H15B 5SV3A 4XPAH 1D7DA 4UBDD 4BFGA 3QEQA 1RZ7H 4TUKL 3B2MA 1NAMH 1P84K 3BIBX 3E8VA 2ZCHH 4EE2A 3MV01 2MRYA 3K1DA 4G7SB 2J5WA 5E8EB 4CNIB 1JE6A 5GZND 4JANA 3DX9B 4FFYL 4ZFOA 7TAAA 3DMMD 4NWUH 2XRAL 4UTBL 2EXSA 4KY1L 2OS7A 2P49B 4JUSA 1OZUA 3U4KA 1NC4A 5EU7C 4NS0A 2V2WA 3VI4B 1HWWA 5F0PB 5HYJB 2A3TA 1I8IB 4MX7B 3CZGA 1TVBB 1GPOH 1JDDA 3DARA 4JFOB 4EN3B 3WS6C 1DJYA 1MCPL 3NIFF 1XGTA 4YSQA 4F7TB 3LZOA 4FJ6A 1HQRA 3ZDXE 3I9GH 1P5VB 3MROA 4GRWH 2NZ9D 4U1GC 4JFDA 3VXSE 4AXWB 5D9SA 4NQVB 3QZWA 4BSWA 4W6XB 4OF8A 1KXQA 3PL6D 2VRQA 1O6SB 1RI8A 2BSTB 1UWYA 1Z5LA 3INUL 3L4ZA 5FAAA 1S7SA 1I7UA 3QA3B 2DQGH 5EPMA 2WYTA 1GZPA 4NZRH 3X1NA 4PWJA 5JA8B 2Q0ZX 2YAMA 3GIVA 3GBML 3S97C 3LZFH 4YH6A 3DC0A 3UEZA 3BKYL 4O2EB 2PPFA 3KVDD 5FYKL 4NB7A 1XR9A 4PBVC 4PRID 3RWJB 3JV5A 1C5CL 4IMKA 3KHOA 4MSWA 4PBXA 5CJOL 1BD2A 1TVBA 1KIRB 1R3JB 5IBUG 4EN3A 4L18A 4QHMA 3RUGA 2ZXWB 5BV7L 2WXFA 3FUMA 5HVWA 1QQDA 4YHKH 3KYMB 1J5HA 4GS7B 3DGCR 5C0FA 1F45A 1WAAA 3RNKB 2C1PA 5HJBA 3UPCA 1NPNA 3SY0B 4LFHD 1Q72H 5AB9A 5EZLB 4ZNCD 5AAPA 5E23A 5DT1L 2QLVB 2XFXB 3PWJA 3CHPA 2NQ3A 3RIAK 4KX7A 4V2CB 1V27A 2JI3A 2B59B 2DL9A 2H32H 3CFBA 4ADJA 3CJJA 5J9PA 4P9MH 4C54A 3FQXB 3JYBA 3ARFD 4NO3B 3WNLA 1AC6A 2BRRH 3WIHH 2FSEB 4HS8L 1RHHA 2IPTL 4KTYA 5IWLA 1RH8A 2VERN 5T3ZD 2AW2A 1WC7B 5GRVK 5DHVB 2X4QB 1JZGA 2R1XB 3QNXA 1QWHA 3E9TA 1PZSA 1AC0A 3M1CA 1BBDL 3OKMB 2M83A 2IQ9H 4WO4A 6FABL 2I26N 4L8CA 3EGSA 1XF2A 1FH5H 1NIDA 4OCNC 5CNHA 5J6GB 1Q94A 4LEOB 4ZMYA 5CFHA 3D6GA 4F5CE 4Z9KB 3A4EA 4QYAA 4PJHB 5F0LB 4Y5YB 3GSOB 4XNZB 3UROR 5C71A 2J8UA 4JFXB 1WUZA 3NFNA 4WWNA 1UH3A 1LO4H 1U8HA 3S88L 3PLYA 2OTWA 2VDNH 3W3BA 3TEWA 1ECZA 2BW4A 3RAJH 4CJ0A 2X44D 3ZSTA 3RWIB 4ODWB 2AXFA 2NR6D 2R0LL 5EBGA 3F7RA 3NJFA 4FXGB 5F9WB 5F70A 3LKSA 1GAFH 3K6SA 1HSBB 5DJ2B 3TP4A 4F57H 4PG2C 4M6OH 5D4JA 3OAWA 1L6PA 1JGDB 1SFDA 5B7EA 3BP4A 1G0YR 4ELMB 3EZ8A 1EO7A 1MVUB 5CR1A 1IIIA 2NY7H 4FQXC 3WAJA 4LVNB 3I50L 3BP6A 3GWJA 5DEGA 3BZ4A 3MV9D 4XO8A 4FA8A 2OTWB 2A1WH 4MDIA 5A6IA 1LYQA 4ANKA 1MRDH 2HXAA 1HESA 2OJZL 1ZLUK 1O9VA 2Z8VC 3RGBA 4I2XE 5I1GL 3OKKA 1U9KA 4R8WH 1J9QA 5I8CB 2F7QA 4F1SA 3BISA 3B3IB 4JQXC 3V6OE 2KDYA 3MAWA 1VACB 1W72H 2E7CA 1KTBA 1BWMA 3EO9H 4CBPA 1KCUH 5FW8A 5LDSA 1ZHKA 4B96A 5JW4N 4ZXBB 4F9LC 3VWJA 4XE5B 3BJLA 4KDTC 3NFPA 3X1BA 2D4FA 3EO0A 2ARJA 1MHPH 2F08A 2WKLA 1T89C 5E9NA 1MRCH 3L3IA 3QCTL 5E7BA 1BZ8A 4WEEA 3F12B 1CDUA 2WBKA 2NNCA 1GGBL 1XD0A 1RIVL 2VR3A 3NBNA 3HUJB 4HGWA 2Q87A 1JGUH 2Y4SA 4JFOA 3T0EE 4J3XA 4PREB 1ZA6A 2YD1A 3IFNH 4N68A 3QORB 3HE6A 1IQWL 3EJTA 1ML0A 4BIKA 1VFBA 4ETQB 3H85A 5L2JB 5IVNA 3QORA 5HBBA 3L17A 2FJHA 2XNAB 1S78D 1TTCA 4U7KA 1DLHA 3GI8H 4Z3JA 2G5RA 2APBA 4F8OA 2D3JA 2ARJQ 4CL7A 4QRPD 4JFYA 4G9FE 3F04A 3KLHC 2BXYA 4BQ8A 2IALA 5ALCH 5BO0D 5ILTL 4OLEA 1DFXA 2JV6A 4OM1L 5M95B 1YC8A 4HLZG 2JJWA 4E9VA 3SY6A 3BUDA 5GS0C 3MRDB 1FZOB 4NQDA 1ZLVH 3TZVB 4YDKL 1KTLA 4P2OB 1S9WA 1JWMA 1NBYA 1BD2E 4FYTA 5CSGA 1Y6KR 3DGDA 2CRMA 4JPIB 5CU5A 2WUCL 5DC0A 4HLEA 2W0LA 1JNJA 4PJ9A 1AXSA 1M7XA 2G0LA 3VFWB 2C3XA 4KXDA 4PGBA 4LLUB 4GXUN 1BEXA 4PB9L 2EYRA 1GYUA 1TYEB 1J0HA 2IIJA 3I9GL 4LLUA 2IGFL 3OAYK 4NO0D 3SKOB 5J1AB 4ONFL 4AYGA 3QFJD 4JY6A 3SDXB 3NJVA 2DQTH 2TRYA 4Z7IA 4TTDC 2WBJA 2X2JA 5I17B 2P45B 4ALAH 4Y19E 5BO1L 2LFGA 4PY8J 4ATWA 1FO0B 5C2UB 4WV1B 4FXGA 4HJUA 1EANA 5DJXB 4B9IA 5DFVC 1AZCA 3O6KH 3GBMH 1RIUL 4G59C 2GQHA 4L4TE 5HI5C 3Q6GL 2EZ0C 3BKYH 4UNIA 5FYKH 2HN7B 3DX4A 3BUTA 5E00A 2Y2YA 1FNGA 5EU6A 4LGPB 4PJEA 1C5CH 1DQLL 4Z7VA 1QFUH 5LHDA 1LP9A 4I5BA 4POZD 3FFCB 1S8DA 3VRJB 1QW9A 5DDHA 5F89A 3IT8D 3RVWC 1E3ZA 2NNXA 1RZIB 1BWWA 4FOMA 4IIQA 2HFGH 4P5SA 5EZIH 5KSBE 5ABDE 1ZY9A 1TU2B 2VKXA 3JWDL 5T5NF 3VD3A 2BHFA 4QTIH 1DSFL 1JD7A 4JG1L 1ILSA 4GUPB 3EGSB 2BWIA 4YVUA 3QQXA 4KKLD 3MCG1 4LU5H 4M93C 4E9YA 4XNDA 4IBVA 4ONHB 2CWRA 1XEUA 3UZEA 2XVLA 4OZIE 5T1MB 3VD9A 1GGUA 1ZEAH 4XX1G 3TV3L 4UQIM 3VW3L 2VB5A 1N59A 3DGGB 43C9A 3M88A 1HWHB 3MYJA 4JX0A 3THMH 3GHPA 2FATH 1WC7A 4BFJA 4O58H 2GBVA 3BDYL 4Z7OB 5AB0A 4TLKA 4MYPA 3TURA 4AIOA 4G6AD 1JRHI 2Y7QA 4N2GA 2B0SH 2ESVD 2H1PH 4E41D 3T71A 1AO7E 1Q9KA 2OW6A 2XOTA 2YPLB 7PAZA 1E28A 2VIRA 5I15H 1CC3A 1WZ1L 3EJRA 3SDCB 3MNZA 2YC1B 4K2UH 2X2IA 2WLKA 4KAQL 4QNPF 2WM0A 3EJYD 2X9XA 2FQEA 4YFLF 4AMXA 3D3VD 3OAYH 4WDIA 3V9FA 2R4RH 1SEBA 3UJIH 4A68A 6FABH 3QYCA 1BAFL 1RVFL 5FECA 4JPWL 4AVKA 3NMEA 4ELMA 5DMJB 5IMLB 5HP5A 2PTVA 1H6EA 1TZGL 2VUOA 3EH4B 1N10A 1RCYA 3PDGA 1G4RA 4MNHA 4U1JB 3WUWA 1KV7A 3B1UA 5ERWB 2HKFH 1IZJA 3PGCA 4R5TA 1AD0B 5L2KA 1AQKL 2BNRA 2UXTA 4PWHA 3CZKA 1MFCL 5HDQH 1U8QA 4EIGB 2VDPH 3SPGA 1YN6B 4EDWH 2XTJC 1HHHB 2MWCA 3P4NB 1OL0A 4PVMA 4JREB 4CN4A 1I1AC 2WLIB 4NQEB 3ZJAA 5DD1H 4BKTC 1PD1A 2JKXA 3G5WA 2B7DT 3HBZA 2DQCH 2HFFA 1Q8MA 1TTFA 3WNOA 5D2LE 3LXUX 4QRSB 3WXVL 2Y7QB 4XC3L 4PS7A 4KZCA 3IPEA 5C92A 2R39A 1FFOA 2DWXA 4LVOB 4BSWB 3B7YA 3IKCA 5AOJA 3MRGB 3WLWC 4NOBA 4PCYA 4PWEA 2W80C 3NYKA 2A9NL 2AK4D 3B3BA 4AH2B 3VYOA 1G5AA 3IGAB 3EBGA 3L5WB 3HZKA 1QRNB 2P8MB 4P3CL 4XN5A 2OJZH 4QHLB 4AQEB 4R4FL 1SY6L 4AJWA 4AG4H 2YEZA 1ZJAA 4HC1A 3DX7A 4NKMB 1W72L 2VC2L 1K5NB 3EO9L 4GO8A 3WGUB 1OK0A 3MO1B 1IVTA 5KN5B 3ABGA 3QJUB 3ATFA 1AJ7H 2WBJD 5DJYA 3O4LB 2Y69B 3KEHA 2ENSA 1Z5YD 5BRPA 3ZE1F 2GKIA 4GO9A 3V0DA 4FHBD 5HYSG 3HCVA 2AXWA 1F1DA 1LP9F 4H88H 2AJVH 2VZSA 3V4VH 2V4LA 4GXUM 5B7MA 1Z9MA 3WUWG 4LRNL 1IUZA 5LLIC 3TVMB 1DFBH 1D9KA 1G5GA 2VQ1A 4GT7A 3WUWB 2EVHA 5FYKE 4HSAC 4TVSa 1P5UA 3TT1L 3OKDB 4LRIA 4OKDA 5ELIA 1GC1C 4J39A 3GI8L 3IJHB 3IGFA 2XV6B 3QXAA 3LH9A 2CAKA 3O45B 3O2WL 5JW3H 4YAQA 4ELMF 1JV5A 3QCUL 4POZC 4OM1H 3VFSB 4B9ZA 3PV7A 1V3LA 3BPOB 3D12B 1OB1A 3KPRB 1ZK5A 4KUZL 4CBZA 4ECNA 1JPTL 2AJUH 2IMMA 4HIIB 3VD7A 5EZPA 1T3FA 4D9RE 4IBZA 2CO7B 1ECYA 2WLLB 3PL6C 2CDFB 1YNTF 2Y06H 1AS6A 4L3ED 4PP1D 4I3RL 3V0IA 4LQFL 4CVXA 3HB3B 2HG0A 3SBWC 4GRMA 4AH2A 1T7ZA 4XO4A 4CMMB 4NRZA 2B3IA 4UWQB 2MKWA 3IFPA 3DXAB 4PJ7E 1E65A 3QDGA 4KXAA 1WBYB 2I60H 2VLJA 1J86A 4Y2NA 4QRRA 5GJSL 2ZJSH 3GB7B 5FO9B 4J3OH 1WGOA 3FO1B 5DJAB 1ZTXL 5GS2D 2QQKL 1S3RA 4J6RL 3VWJD 3IDIB 4W93A 5H35B 1YVLA 5LQBH 1TU2A 1O0VA 4DCQA 4I77H 4JFZL 1TQTA 5D1QE 1RIUH 1ZS8A 1DQDL 3DX9A 3L5HA 4ZFOB 3Q6GH 5GZNC 1UZ8A 4ABQA 1EZSA 2JKRM 1VKXA 1GSMA 5GJTL 3MLSL 1G7QB 4JFHD 1I9EA 1SQ2N 2E7DA 3X11B 1CUOA 5E4EB 3BHBA 3PWNB 3EH2A 1H8SA 4LCUB 5KVGE 3ZHNA 4Y4HC 5J6HA 4A2FA 1K4CB 4PY8I 4OGXH 4HJEA 4X6EB 4QTIL 1DSFH 2WXHA 5FFLA 3OKLB 3QJSB 5JHDB 3UAFA 1Z9OA 3KGRA 5SWZE 2ICWJ 5DRZA 1EXUA 5L0QB 4JHZA 3CFDA 4CADA 3REVA 4FG2A 5AW3B 3SDCA 3THML 4JKKA 3KBEA 2AJ3B 2RIKA 3G6JB 4HAFA 1KJ3L 3ZE2E 2I9TA 1YEGH 43CAB 3D50A 1AOHA 5D7JD 3QDJA 3AREA 3OAZK 5T1LA 1YQ2A 3FYEB 4OD3H 2OQJB 3NTCL 1BX2A 2C4XA 3RVXD 3IF1B 3VWKD 5JA9A 2XWXA 4N5EC 3L9RA 1TCRA 3QC6X 2FO1A 2Z0UA 3FHAA 5EMYA 4OJEH 1DE4A 5LWYH 1KBGH 3EKCA 4HLJA 3MRNB 4PRIE 1W0WA 4CU8A 5CBAB 5C97A 3SBQA 3K0YA 4MBOA 3UJIL 5GGRB 2F54D 2KLTA 3TO4B 1RVFH 2BC4B 4GH7B 4J2XA 3MBWA 4DW2H 3HC4L 3FSZA 5E08H 1MHHA 4JFFD 1F86A 2IV8A 2ICCA 3GJFB 4LNRB 2X1XR 4FKHA 3PP4H 3UC0H 5A7EA 4IGBC 3HE6B 5CO1A 3QYNA 2PYEA 1ONQB 1CDCA 3O3AA 3PP3H 5JYMA 1W8NA 4PRBB 1EXGA 5DS1A 3GTTA 1BFOB 3WY1A 3PJNA 4AT6A 1NFAA 4ZNEA 1AO7A 3GHEH 3FBKA 4LSUL 2C3HA 1IAOB 1HH6B 3JWOL 2XBTA 3MLYH 3OJDA 3HRZA 2Y1ZA 3NEOA 1Q9WA 2C34A 3VVVA 3DIFB 5IROD 3SO3C 3APCA 1OAZH 2NY6D 3OZ9L 1Z0NA 3F83A 4A7TA 1J11A 5T5FH 4UU9B 2C9PA 1FH2A 3AS1A 1Z32X 1E9PB 3R0NA 3OGCB 2YQ3A 3LKRA 3M1BB 1NANH 5L2KD 1NFDA 3BVVA 4YO0A 3CFJA 1HINL 4NUJB 5GGTA 1OAKL 4DQOH 3AQZA 3II2A 3B2UD 4M3JA 4E41B 1KB9K 1TQBB 3NIGB 5GRYA 2DYPA 3QPKA 1ADQA 2J57A 4KDTA 3IXAA 1TJGH 4FLOA 4QOKE 5I16A 3OAZH 1IAKB 4X83A 2IADA 5EIIB 3OKOA 3MJ8B 3KLDA 5BUGA 2EEAA 4V33A 2XN0A 4IJ3B 2BFVL 3WD5L 4D9LL 1T1WB 3VFMA 4UQAA 1T20B 2XV0A 3RUGB 1U33A 1OCWH 1XCTA 4NP4H 3PXJA 4HG4K 3FUHA 4JQXA 3ZO0A 2TAAA 5D1XE 1HZLA 5DGRA 3KM2A 4Y2OB 4WNQB 4KRMB 4M5YL 5C6WH 2NUTB 1ZS8B 3AS0A 4XBEH 4PI0A 2FJHB 5K33A 2R23A 3DX3A 3FOMA 1PLGL 5KSAA 2GUOB 4BE5A 4M1DH 5DUJA 1OTSD 1HAUA 1U92A 4MB3A 5T1KD 2YBGA 1A8ZA 1U8MB 2VM4A 1C5BL 2JB6B 4U6VH 4XN4A 3VD0A 2GTWB 1BZQK 2AQSA 4H1LB 5AB2A 3UYRH 3G08A 1NINA 3H2QA 1M2OA 2G3ZA 2V3DA 3OG4B 2AQ3A 4MCMA 5E1AA 1BOYA 4AXWA 3R8BB 1FYTA 1I8AA 4ZS6D 3LKQA 4R0LB 3NDYE 1RJYA 1TENA 4OIIL 4JRXB 3UEQA 4N6RB 2FJGB 1TPXC 2QSVA 3QO1B 2FEDD 4HD5A 5I1LB 4NQDE 4A37A 5LG6A 5C0JA 2EDLA 3ECWA 3LH8A 4ZUWA 3WL9B 3VFNB 4EZLA 4EDXB 1JNNL 2FWLB 4FLQA 1B4RA 2BVYA 3HKZA 2GUOA 1KT2A 1NJ9A 3BRFA 4LCWB 4IEFB 3K6DA 2WIIB 2XKNB 1MAML 4NHCL 3HG1B 1DVXA 4LCIH 4R7VA 2HLEB 1S7VB 1MG2C 1A47A 3CFDB 3NZSA 3SGDI 4JHAH 4DETA 4KNSA 1A14L 6PAZA 2HWZL 3H8NA 2MOGA 2VLRE 4NBXB 2G3MA 3BP4B 4RVBA 1A9EA 5D71H 4OZIF 3UYPB 1NIAA 2B15A 4TSCH 3T0VA 1AZRA 2ZJSL 1A3LL 3UG5A 4NNXA 5AAMA 4UYPA 3E9UA 3VI3B 5IY5B 2ERJB 3VXRE 4KKLC 3ARGB 3BVXA 4MNGE 1JFHA 2UWEB 4HUMB 2GTQA 4JFZH 3PWVA 1B90A 3K72A 3KYNA 1K4DB 1TSRA 2CRIA 2HRPL 4MJIA 4PJ5E 1LO5B 2MQ3A 3REWA 3F5WB 4R26L 1G94A 1UWEH 1S7VA 1KIRA 1XSKA 2WUBL 4HA1A 3A4DA 4L1HA 3HPJB 3RWCA 5GJTH 2VJXA 1U58B 1E9PA 1J0JA 5EORL 4N8UA 1MI5E 2H32A 4LCWA 1A25A 1IAMA 3NJNA 5GRUH 5FWRA 3T4AA 3WTTA 2BNQB 2P5WE 5C3LD 3PWPE 1J8KA 4L5FH 3LEVH 2EDRA 5AZ2H 4AQ8C 5E9DB 5DFVD 2X4TA 4OSUH 3VFNA 1G1YA 2BSRB 1WWAX 4R2GB 5G4NA 1ZLVK 1BXUA 2WXIA 4KQ3H 4F7PA 1UENA 3OKMA 4Q9RL 1JL8A 1DQKA 4HV8A 3V9EA 1E5AA 4NZDA 4Y5VC 4RAUA 3EOBA 1JPGB 5BUAA 4EI5D 1YA5A 4R2GD 3X14B 1CU4L 4WJG3 1XGUB 3V6ZA 1WITA 3VG0L 3UDWC 5KSVA 1KCVH 3QXTA 2AAAA 4ICWA 2PYEB 3C6EA 2ZKYA 2F18A 4LCVA 2JWYA 2DWEA 1W72B 2BCKB 3SB3A 2ADGA 1VJSA 1QO3A 4OD3L 3FFCD 3UX9B 5HYJA 5L4FA 5KYXB 3QQ4B 5C0AA 1QWNA 1WZAA 1A5FL 1FRGL 1JZEA 5C09E 4YSSA 4JM2B 3WEMA 3TS8A 1T6VN 2P5WD 4MYWB 1JZ6A 3SJVE 4D0BA 4I18C 2MIZA 2UZIL 4MFHA 4KROC 1D5XA 5E9DE 3RGVA 2BP8A 1KF9B 3IYLW 4QHNA 4DUWA 2X7LB 2ZUSA 4PCTA 3UC2A 5TFSL 4KZ0A 5E1HB 4PHXA 3LVEA 1IV8A 1CTOA 1ETB1 1N64L 1M71B 1YEIL 3DA0A 5B7FA 1ILUA 3TN0B 5K59E 3OR6B 3HC4H 4KK8D 4NAQA 1CFVL 3ATDA 3DHPA 2VW7A 3WN5C 4L37B 4UYQA 1KFGA 3KYMA 4Y5XC 4ZO8A 3T65B 3P30L 1XSIA 4M02A 4E41A 3GJFH 4CVZA 4IKJA 3D87B 3HFML 3CFMA 3ALXA 3PV6B 1MZYA 4G6JH 4PRAB 4UT6L 5AVZB 1JD9A 1ZLEA 1YEJL 2WNGA 3I85A 3VXMA 3ZOAA 4G9DB 5A2FA 3CHQA 3GHEL 2NMSA 5IHUH 5I73C 2PP7A 4LFHG 3CN0A 2JXMB 5JUEL 2O26U 1KELL 3SDCD 3TN0C 4ZUSA 3DIDA 1BW8A 1I9JL 4OKVA 4HISA 1KPUA 1EHAA 3GO1L 4NYLA 3PABA 4Z7WE 1XBRA 3QIBD 2YUXA 3EFDH 4A2EA 3SKMA 1VHPA 3NRQA 4JM2D 5DVNA 3Q8AA 4XP6H 3DPDA 4CSTA 4WKZB 1JPFA 4RGOH 2XPZA 1RAMA 3UJTL 3QRLA 1QEWB 4PY7A 5IEHA 2BWDA 3C8DA 3VE0B 5EF1A 1K8IB 1RP9A 3O3UN 3HAEA 4HD9A 5GZOC 3WTWA 3HA0A 5AYTA 1HINH 2VM9A 1OAKH 3RWCB 3TT3L 1RFDH 3TBYA 3PV6A 1S9KC 5KS9A 2MQCA 1OM3L 3MLTB 4HOWA 1UM4L 5EO9A 2PO6B 4YJZL 3K6FA 1IGMH 4RDQG 2AQRA 3EUDA 1Q0YL 1WV7T 3BLKA 1ASPA 4NO5B 5FO9A 3SKUD 4YS4A 1MHCA 2YPVH 1BAWA 3VNYA 1CI5A 3G5VB 1QBML 1CLZH 3L3JA 3L5IA 2Q3AA 1UOKA 4PCSA 5ISZB 2ZSVB 3EYQC 2E74C 2J1YA 3ZKXC 5G5DB 4CC0A 1G6RL 1NCCL 4OD2A 2PPEA 3IFLL 3QDGD 1J18A 4W9LC 4X9FA 3T4YB 3F85A 4C83A 3DYPA 4KO5A 5F7DA 1PLGH 3G6AB 4IEFA 1JCVA 1A6VH 5CJQH 1M7UA 3KDMB 3RLSA 3HZYB 2ITDB 1W9XA 5ESQB 5I71B 5D7IB 1DBJH 4U6VL 4JB9H 3ILQD 4LCYB 4IDLA 3UYRL 4DO5A 5CMAA 5AW0B 1NBVL 5F7HA 3GM0A 1F8TH 1B0IA 3ISYA 5CLZA 5FM5O 4M1CC 1I1CA 4N8VB 1TTGA 3RA7H 3MODH 5I5JA 4MD5B 4ODUA 1AACA 3AQDA 1QPKA 2FWUA 3PQYD 1E9QB 2R1WA 1OTUC 1P4IH 4N2MA 3FC8A 1EIBA 4P23B 1JWMB 1NBYB 2A6DB 1XR8A 2X5PA 4OV6F 4BYHA 4PV8A 1JNNH 1INEH 4KNTA 4W6WB 1IO4C 4JLRB 5I18H 5D1XD 4J3OC 3FT0A 1CLOH 3QQ9C 4M8QB 1WICA 2DH2A 1PZ5A 5AL8A 4Z7NE 2YBRB 4YSTA 1V3MA 4NKQB 1SYSB 3T4AC 3V8CA 2N0MA 5AYUH 5J7CC 4NHCH 1VF5C 4LCIL 2AABL 4B27A 4UOZA 1UD6A 4D94A 4HUUA 2VDKH 3FSOA 5BS0B 4PJAE 1A14H 3P4OA 2YQGA 3S2CA 5EFIB 1RIHH 1XZWA 1GOHA 3U2SA 2E9JA 1J1XL 2NSMA 1WWBX 3Q5OA 3VI4A 3PE9A 5F1OB 3GXDA 5HGHB 2PPDA 2OMYB 5I6LA 4QRQA 4XP1H 4AEEA 3QFJA 2EYSA 3FO2B 4DH2A 2E27L 4F2ME 1ZA6B 4NZFA 4Z77B 2WVVA 3VGEA 4OI7A 1HCFX 2EVGA 2VXTH 2XXGA 3P0VH 4QD2E 3U48A 2A6DA 4GKSA 4EKJA 1UA6H 2OCJA 3NZ8A 5F71A 3KE0A 1WVZA 2WAHA 2NDFA 5D7LE 1UWEL 1U42A 2WUBH 3QDMA 4W9IC 5ITFB 3P3UA 4EN2A 4GXVH 3KLHD 1QLFA 1T03H 4CKQA 1X5FA 3QUZB 1C7SA 4XCCL 3MV8A 5D4QA 2CO7A 4ZW5A 3E1ZA 2L04A 3MX0A 1NOFA 1U8PB 4HPOL 4ISVB 4F7CB 3L3KA 1R3IL 2ZCLL 2DD8L 3AS2A 3B2UC 1FZJA 3GMPA 2Q3ZA 4XNQB 1N8ZA 2H4EA 1T7XA 1A2YA 2EDQA 4AUJA 4HIEA 3QXDB 3FN0H 2XN1A 3S5LG 5C08D 4EAEA 2E7LC 4Q9RH 4YAQB 2VAAA 1HHHA 1INQB 4KOCA 4I8DA 4DPCX 4P59H 3L3OB 1QBLL 4U1IA 3BE1L 2WJ7A 1ZE3H 1BVLA 2YXVA 2R2HB 4HFWB 2NY6C 1QFHA 3A23A 1NUNB 4MLSA 5FF6A 4YOKA 2XPGA 1A1OB 5BMFH 3X1EA 1NMAL 2Z4QB 1OCZB 3DV6A 2VM3A 2ZXCA 4XVUC 4LSPH 1MCQA 3TVMA 1IZKA 5E2WH 4Y9BA 2E9WA 4X6DA 4E5XG 4WFHE 1F3DH 4XCEA 4NFCA 4Y7MA 3SDAD 3FO2A 2XQBL 1A5FH 1DVQA 4EIUA 1V3JA 1OGAA 2VLRA 2VDOB 1QBAA 3FZUD 2MPAH 3TBSB 1DQVA 2A4ZA 3OLIA 1NGQH 3GKWH 1G7MB 3GBDA 3NIDB 1B4LA 3MRQA 3TGXA 3P4OB 2XUWA 4M7KL 4XMKL 1FE8H 4IGBD 3VGFA 5TFSH 4FQIL 3KLKA 1BBJA 2LU7A 3IDYC 5GGQL 5K1NA 1N18A 1XB6A 1OXYA 1N64H 4XXWA 4N0UE 4OTXH 4AQ1A 4BZ1L 3MO1A 3TA3A 2YMOA 3VG9B 4UOW1 2OYPA 3B2DC 1OAUL 3A6CH 2BP0B 5HJGA 3MUJA 4GKZA 4TVUA 1A6ZA 2CR6A 4JZJC 2QDWA 2R1XA 4NCC2 4EXKA 1BHGA 1EFXA 2XFGB 1IBDA 4IGBB 3W38A 2HFEA 1AFVL 1YEJH 1WG3A 3B83A 5BVPH 4G7YH 2IOOA 1SRDA 2EO9A 4JG9A 2VMFA 3KJ4B 4H7VA 3O3BA 1I1FB 2PWGA 4UANA 2B16A 2WXLA 1IKNC 3BVTA 4CSPA 2FL5B 3JTBA 2HPTA 3SOTA 3I74A 2NR6A 4OU3A 1HNYA 3X12A 3EFDL 4ABVA 2ZCKL 4WEBL 4XP6L 4MD0B 5E8NB 3AG1B 3KGTA 2CNYA 1BIIB 2AERT 4U1SB 3TJEH 4AGPA 4BQ9A 5IV2A 2NLJA 3HMXA 1NCAH 4DGWC 3HRZC 4I1PA 1OCCB 4N90E 1Z2KA 3P9MA 2ZE0A 1MFEH 3GS4A 4XRCB 3UTTA 2EXTA 3U1SH 4N2AA 3SD2A 4N86A 3CFKB 3LZQA 3TT3H 1RFDL 2RALA 5DD0L 2Y2WA 1JFQH 1OF2A 2QBWA 1ND0A 3FU8A 4LEXL 4GBXB 4EQ3A 3FHEA 4Q97A 1XH3B 4WWID 2ED8A 1CFBA 3MRPA 5HGHA 1GL4B 3K8KA 3ARFC 1IKFH 2DQJL 5HJ3B 1OPGH 4ZUVB 3MRBA 3V5HA 1SJEA 1X7QB 4NKIL 2WTPA 4XMLL 3RPIA 3TO4A 1CT8B 1SHSA 3ULVH 1JJUA 4PGBB 4ODHH 2UY7A 1NCCH 3WFHB 1B2WH 4Q52A 4DEWA 3G6DL 1FYHB 4UTBA 2O5XL 3T6WA 1F3JB 4U3HA 2OI9C 1T5XB 4G8FB 5AKRA 5INCB 1T0NA 4HIXL 3M1OA 3ILDA 3QZWB 1U6AH 1H3XA 1G1OA 4UQ3A 4XPBH 1A6TA 5TH2B 1KC5L 3RDTA 3I02B 1QX1A 4P06A 3P4LA 4Y88A 3BGFC 2WYZA 4I3SL 4Z1PA 5DFTA 5IB2A 1B0WA 1AP2B 4PI2A 4ORZC 3GSUB 3F5WA 2HKAA 1FLTX 4M1GL 4GLRH 3MLPA 1ZV9A 2XWZA 1A8JH 2X2HA 5DUPH 1P7BA 4YBHA 3VH8B 2YSTA 3FZUC 1DVFD 3OLDA 1MCSA 3R7RA 2VQ1B 4I9WE 1HL9A 1XXDC 3HB3C 4KDWA 4JFQB 4BFIA 1PJWA 1HEHC 2J88H 4YUEH 5AZEL 4PJGB 3CDGA 3HLKA 5AAWC 1X5GA 4FMKA 2UZXB 1A66A 3H4FA 3BHBB 3PWNA 4IRSB 1A1MB 1SLVA 2AABH 5IIEA 2C7UB 5FC9A 4NHUB 1CXFA 2XG4A 2WLZA 5FM4A 3SPHA 3K71B 4PUBL 1D5XB 4C56D 2H9GB 2X4SA 2O5ZH 2VDPB 1WCBA 2IDQA 3V5DA 3BJ91 3QJHB 4FG6D 4XOCA 2BSCA 5H35A 1HXKA 1C08A 3MFFA 1DO5A 2E27H 3MGOB 4JFDD 2WXPA 3HNSH 5SWQA 3W81A 3ZR6A 5GS0H 2RB8A 1YPZB 4F7KA 5EC1A 4L29A 4NXSA 1W72A 5AVXB 3NJXA 1U93A 2ZX8A 1THAA 3MGAA 4G11A 4UINH 3UAAA 5A6LA 5CU9A 4O51A 3CVBA 4LSDA 2XWJB 3ZSSA 3BWUC 5AG8A 1A64A 2FIKA 4E42A 1MPAH 1KY6A 2FT6A 4YE0A 5JXED 3IK2A 3MDJA 1CGSH 1ID5I 1LGVA 4HPOH 1PKQB 3EG9B 2X1PA 3G08B 4QRTA 1S9WB 1YO4A 4PJ8D 4G8FA 2XETA 3AW5A 3MLWL 4GIPD 1PKQA 5DK2B 4D0DA 1UXWB 4AEIH 1PMYA 1GXEA 5D9SB 4LASL 3WE6A 4HBCH 5IBTH 2IWGA 3WFDL 1UVQA 5IROA 2J4WH 1UUNA 4P9HH 1RD6A 3RTQA 3D0LB 3KJ4C 2BIMA 1MF2L 2FIKB 1TEYA 4KX8A 4B97A 3T1WA 4IK6A 1GKOA 3WE1A 1M1SA 4U6HB 3BQVA 5T1KA 2IPUG 2X6VA 3KYNB 4L9LB 2G9HA 2P24B 2VRKA 3B2VH 1PQZB 2PTUA 1Z7JA 1HHJB 1WS7A 4OLWH 1NGZA 3WN6A 5T33H 3PU7A 3JWNC 1XMEB 3PABB 2AI0H 5J13C 3EG9A 4LVOC 1ROCA 4UT6A 5KVGL 5HJDA 2NY4C 1RPUA 2JIXB 3GKWL 1IM3D 1SMOA 1UGNA 2C7UA 4DK5A 4J3OF 4BRJA 1OW0A 2CK0L 1G9MH 5C0IB 5GGQH 3MV7B 2NY2C 4K5PA 5IMKA 4XXDB 4NKOB 3UBXG 1J1PH 2AK1L 1ZHKB 4JO2L 3X13A 3L5XL 3ZKQD 1CBVL 1R75A 5F7KC 3E6HB 2DIEA 5DMIL 3NFSH 4M4PA 5D7IA 3ZN6A 5CN3A 1U36A 5IQ9B 1MCIA 1KCRH 3U2JA 3U36A 2OK0H 2CU9A 3EOTH 4PB0H 1HH6A 3EZJB 3EJSA 4U4BA 5DZVA 3VGHA 1L6ZA 2Z9TA 3TXAA 4HUWA 5EF0A 4XT1C 3QG7L 3TJPA 4YHZH 3BP5A 2HVBA 1UCTA 5EF2A 4RZKA 4BM7A 3UOAB 3AT9A 2QTVA 3EJQA 4FQ2L 3CCHB 3QUYD 5KSBF 3SQOL 3GZQA 2C1OB 5FA4A 3RBSA 5IHLB 1A4BA 4QTFA 1XGZA 2I07A 1R9FA 2ZCKH 2P24A 3KCPA 5D2NA 5HGAB 2J2ZB 3VGAB 3ZRSA 5HHMB 3ZQWA 2ADGB 4DOHB 5MEPB 4LAQL 3O9WB 3FTGA 1J9RA 5F88B 4PW4A 1IGTA 5C8JA 3R19A 1NDMA 3QPQD 3MLXH 4O2FA 3UBXI 2PYED 5HDWA 1SJEB 1AP2A 2RQ8A 1G9NL 3RPIB 4FYRA 5BQ7B 1LO3H 1AZNA 4NKDA 5DD0H 4LLMB 1A6WH 4A2GA 4WU5B 1F11A 3S4SB 3EYUL 5E99L 1B4JL 1WFOA 1W0VA 3RDTC 3T0AA 1QNZL 4FQQB 3OHXC 4NC2B 3KNBA 2I07B 3PXLA 4OD1L 4OZGB 2F7PA 1SOSA 1WUNT 5FGCE 2JJUA 1ZVYA 3ATBA 5I17A 2DQJH 5FF6B 2ZT9C 1F0LA 3VFVA 3US0A 2QELA 3FCGA 1O5DT 3KWXA 3LQAL 1Z3RA 4H0HB 4KKPA 3MKGA 4NQXA 5DQDL 2XSKA 1EGJH 2A9AA 3D9AL 4UOJA 4O5LL 2CCWA 2O6DA 3OAUL 4ODXB 4KKCC 5DZAA 3GXMA 1B2WL 4GP8B 3SGDH 1A7RL 4F2EA 3K6NA 1VADB 3HG5A 3MXVH 1KNOA 2D2CC 2MSPA 1CGTA 3MQIA 4FD0A 2WYHA 1UXSB 5EUOA 4D7PA 2DLGA 4J3OG 4XPBL 2CIKB 3CN3A 4DGVH 1VEOA 3MRMB 4Z95L 5KUMA 3H7BB 1U3ZA 1FFPA 4JFPA 5K9JL 5C0DB 3WXWL 3GSNH 2XWBA 3QI9A 2FWOA 2ZOUA 4JGJA 2ZUQB 4F8TA 1CMOA 4Z3FA 3CUPB 2IO5A 2JJSA 5C08A 4ANUA 5KBDA 3MV9E 4NM4H 1SFHA 2XY2A 3QIUB 1KIUA 4PRPA 1QLEH 1BLNA 2DPKA 3FT3B 3SE8H 3GXPA 2BP0A 4QRUB 1WEJH 4YDIL 4HIPA 3V52H 3DROA 1YYMH 4U3SB 5AKSA 2JI1A 1ZHLA 3KG5A 2M1KA 4XAWH 4H25B 5I71C 1QR1A 2RR3A 4OQTA 2ZG2A 4QHMB 4QXWA 4B3EA 2ATKB 3FCTB 2QPEB 3MRLB 3L7FA 1IGYA 3ARGD 5T1JA 3HG2A 1UT1A 1JXFA 1G7MA 4GG6E 3GM8A 4M6AA 4Z7VB 5JPNA 5MHSD 2CBMA 3QIWB 3T8XB 5J57B 1NCWL 1DANU 4ZFZB 1BREA 2Q20A 5ICUA 3RZCB 1DN0A 4OZ4A 4WFFE 4AOFA 3DPBA 2K9FB 4MB5A 4F8PA 1B3IA 2DM4A 5I66B 3MV7E 4OLYH 2AANA 1JVKA 2X1WL 4RFNB 1DTUA 1IEAA 3DPBB 1QSZA 2EO7A 2ITCB 4FGMA 5ADPL 2LAAA 2Y07L 4IOSA 3B9EA 3B3IA 2EH8H 3FYIB 3FSAA 1KYDA 1D6EA 2HAZA 4PJDB 2YLKA 1S5IL 3VYNA 2X4PB 5HHPA 4YSEA 1ZT7A 2ZIDA 2UVEA 3QEUB 4UT9L 4X7FC 5DRNA 2VO8A 4ZTPL 5MERB 4IMLA 3U83A 1ZGLB 1F3RB 3T0WA 1E4JA 1Z9PA 4N24A 3KS0H 5DVLA 2JIXD 3L13A 3RWEB 5L8KB 4L4VA 4OJCA 4KPHL 5D5MB 4AQ8A 1PW3A 4FXLA 3WNNA 5DYOB 1VFUA 5KTEH 3LB6C 1KENH 2OMVA 1JWSB 5I75B 3DROB 4P5TC 3SJVB 4MDJB 3VDCA 4RZCA 2HX9A 3QZOA 2XIDA 4EBQH 1IQDA 3KPOB 4FQXD 2XA8L 1SOXA 3VFTA 1A22B 4R90L 1WZLA 3X11A 5I73B 2W94A 2EKSA 1TQWA 2KT6A 1CLVA 4QJ3B 2MCG1 2PCXA 4JN1H 2BZ7A 3Q2LA 3IMRA 1XX9C 3FULA 3L1FA 1E8ZA 2WXMA 4WI0A 4A1RA 2AEQL 1F3DJ 2BJMH 3QJZA 4FLHA 1NIFA 3UAJA 2NR6C 2XJLA 1JPSH 1JWSA 3HZVB 4JY4B 1FNSL 1S3KH 1G7JA 5E5RB 3ZHDA 1M9SA 4KITB 5DHDA 1FFQA 4C56B 1DBMH 1IVLA 4ISVA 4Z3EA 1JYWA 3QFDB 3CTTA 2VXQL 1MWAH 1C7TA 4KZEH 1IE4A 3CZJA 1CD1B 1UB5B 4FXGC 4XCNA 1FP5A 5F9WC 5AQ0A 5KYWA 1EBAA 3M17B 3RDTB 3U7WH 4OLUH 5DLLA 4LQ1A 3AY2A 5CLTA 1VZGA 3Q2NA 4TUOA 5CXPA 3OR7A 3AADB 3QUXD 4ZUTA 3GMNB 1RHHB 5I1CL 3EXJA 4I13B 5C6TL 4JO2H 4Q9CA 4G7VL 3W9EB 3SZKC 2LU3A 4X99A 2HB0A 2QV2A 3PHOA 2B1HH 3TYGH 3RVTC 5I0VA 1SEQH 5CCKH 4I48A 1JTTA 2EEXA 2HJLA 5D7JA 2DJMA 1UYWL 5DD6A 3LIZH 4ODBD 3FTGB 3QG7H 5E70A 4OGZA 2YAFA 1TQVA 4LGSB 2OP4H 1EEZA 4HDIB 4MZRA 4XN8A 3KYOB 2B14A 2W65A 1ZLSH 2QR0B 4X50A 4L37A 1UD5A 2XVGA 2ZKHH 3LOWA 3IF1A 2OV0A 3ARDD 5C0ND 4Z7OF 4LO9A 3KJ6H 4BZ2L 1TDQA 2QMJA 3TNMB 3OB8A 3RWIA 1UA7A 4YE4H 3O3EB 2Y22A 4TQHA 2FX7L 3POCA 1DCEA 4Y4KC 1ITBB 2LAGB 1GIGL 5ETUB 5H94B 1G9NH 3FQUB 4JBSA 5FHBL 2YC1A 2SODB 4KJWC 4PLJC 1L9PA 3EYUH 1FYTE 3DVGA 4XOEA 3EGXB 3QNZA 4OD1H 4JFHE 4IU3A 1T6WA 2OZ4H 2Y25A 4JDVB 1B6UA 4DO4A 3TCTA 3ZDYE 3LJ3A 4KKBD 5IW1A 4U6YA 1S9VA 4KXZH 3O9WC 1Y1DA 4OBSA 3QUZA 2DLFL 2FVNA 1V55B 2FO4A 3LQAH 4IBQA 3HBGA 3T4YA 1WBZA 4QRRD 4C83B 4O5LH 3U4BH 2BOBA 1CWVA 5HYQA 1H8OA 1H8LA 3O2DA 1D6VL 1KG0A 4KHTH 5I8KH 1CFMA 3BWUF 5E8PB 5H37G 5HHVH 1D5RA 2OMTA 3CV5A 1WIUA 4KTDL 2LOEA 3EYFB 5AOLA 3P2BA 3OJMB 4HT1L 1NPUA 1BZEA 4N9GB 3K6IA 3AXHA 4XNYH 3MOQA 5HDBF 3BAKA 1QAWA 2XC8A 4ERSL 3OZKA 1JERA 1QLEB 4BXVA 1AE6H 3DX6B 4KMLB 3VGGA 5J9PB 2N4IA 1AHMA 1ANUA 5EFIA 3U2SB 4XI5C 1KTRL 3D18A 4BFEA 5FUOH 5DC2A 4YHPB 5FGCB 3GSNL 4IS6A 1BJ1H 1UWXH 1DSYA 3TBYB 3VRJA 5AKTA 3I6GB 3BFWA 1OCRB 2LU4A 4LOFA 3IE9A 4NRZB 1A6AA 3HB3D 4QNPE 3CDCA 5I6MA 3ES6A 1D7CA 1YEFH 2YEVB 1TJHL 2C8NA 3FQ2A 4KY1H 4JE0A 4EIBA 3BUPA 2VL5B 4HVBA 3KBPA 1ZHNA 2I85A 2FEDC 3CLFL 3UO1H 1E9QA 4JO5A 4NRXA 4L4VB 1AGCB 3L1GA 4QI3A 5JYLA 1QKZH 1C8QA 2OMUA 2K70A 1CLCA 1QOKA 4R7XA 2X3BA 1OSPH 1LEIB 2K7PA 1NCWH 3WY2A 3GNMH 4A66A 4UQCA 2PMZA 2QHLA 3S8WA 4UUJA 25C8H 3OC5A 3VX0A 4JPKL 2BCKA 3X13B 3KDMA 4Y9CA 4TSAL 1AKPA 4NJAH 2DQGL 4PJBF 3ULVF 1NMBL 4HQQH 4I85A 1HDMA 4PJ8C 5D4IA 4WW1A 1F4WL 3NACH 1MFNA 4N2CA 5BZDA 1DQQB 1UOVA 3O4OC 1S5IH 4JKPH 3MROB 4J6IA 4JUTA 3WOVA 4HKXA 2XKUA 2OTUB 4KJQC 1JGLH 5J0BA 4X7SH 4APXA 1FL5B 4PJFE 4XC1L 1ZSHA 5LDUA 5B4MC 3VO0A 1ZA3B 3L95B 1I1YA 4PV9A 4FA7B 3NN8A 2EYSB 3BO8A 3KPLB 2HT2D 1TTBA 4HH9B 1BEYL 5EU5B 4EEEA 4UQ2A 2Z91B 3BO8B 1L3WA 2OA9A 3NPZB 3QI9D 1YMMA 2NUPA 2WZPD 3KPQB 1X5HA 3KLAB 2WHVA 1KTCA 2OTUA 1JRHH 3LDBB 4P2RA 2YJLA 3FONA 3NSCA 4GAYB 1FIGH 2AEQH 4WW2C 5F7UA 4MA7H 4NP9A 2K6ZA 4K15A 4P9ML 5CSZB 3ASOB 1JPSL 2F61A 5IT2H 4LIQL 3FSWA 1EZVY 4WHTB 2VJ8A 5EEVA 4WCYH 4HKBA 4PLKC 4QR7A 1PG7X 4OJAA 2NQDA 1ODUA 4YSPA 3OHMB 2IPTH 3I9PA 2QVIA 5KG9B 3IJ8A 3H9YA 3N42B 3UJJL 2A9MH 1CICB 1PIGA 1QLRA 1TCMA 4YIQB 5CD5C 4N4YB 5D72H 3K8MA 4Y2DA 2NPLX 1KYOJ 1YEDB 4DFIA 4P05A 3CFUA 3V10A 5IQOA 2GY5A 4GQQA 3GUTA 3QG6B 4KJWD 3U6XA 1JZIA 3UFIA 3O0RH 3PRZA 3NCYP 4JW3A 2DM2A 3EYSH 1KJMA 2MTPA 1E40A 2ADFL 1GGYA 2E7MA 1PG7L 3HRZB 1SEQL 5CCKL 5A40E 3K2MC 1EVTC 3NCBB 4I0PD 3FB5A 4L4VE 5HSFA 1I3VA 4OQ1A 1MCEA 1FYTB 1NAKH 1LJMA 1JHKH 3OJVC 2FEJA 5C0BD 3FQRB 5I30L 4PJGA 1L7TH 3O9WA 4XVUD 3ARSA 4YC2C 1VIWA 1BCIA 4ZMNA 2WINA 2ZKHL 4YXKL 3QUMH 3NZUA 2Z7WA 3ZDWA 2NY0C 3MLTA 4F57L 2FD6L 1BJ1J 5IOKA 5D1ZD 1Z0MA 3ETSA 2DI9A 2OMTB 1P0SE 5I8OL 2FX8L 3VFRB 1TZHA 1FJ1A 3HC0B 1TT6A 3QNXB 3FRUA 2JKLA 2UVFA 2CUAA 5D5ME 3APMA 1TZHB 5FHBH 4IBTA 2F8OA 1JK8A 2AF2A 3PNRB 4HJTA 3FO9A 4UQ3B 1U8NB 4DEPB 3NJGA 2ENJA 2IC2A 3NSFA 4AITA 4H1LG 1JMXA 1B0RB 1NBZA 2OSXA 4FQHB 2WN2A 3JUYA 4NC1E 4Y1AD 9PCYA 3IGKA 1XIWC 3C9NB 2QPUA 1BZ9A 4R83A 3WFHA 1MRCL 3MV7A 3MRQB 3NCWA 4G9DA 2XLLA 5LXVA 2VLKA 3AJ7A 4U7MA 1CIDA 1EXUB 5F7FA 1GGBH 3ILEA 2X89A 3REWB 4KKZA 3IDJB 2Q10A 2FSDA 3ZIYA 3VTTA 4TV3A 4GAJL 2VZVA 2HH0L 4HJGA 5ENWB 4DFHA 4HJJH 3SODB 3SN6N 4OQTL 2GBTA 3WNPA 1U3NA 3NIDF 3UYPA 4Z0XA 3HMWH 5CGYC 1A7BA 2Y23A 4Y4FD 4WEMB 35C8H 4YLCA 5IFHH 2UYLA 3UZVA 1T2XA 3TEUA 3DECA 1E42A 2WLHA 3Q3GB 3MOBL 5D1QA 5HD8D 2NXYB 3LKRB 5ICYB 3N1MC 5ALCL 5HHOD 2QPFA 5C0EA 5K9QI 4I48B 4K3EH 1Q94B 4LEOA 3P02A 3T77A 4YDKH 4YDJA 2DWEB 2YAQA 2YOAA 4L1BA 3BAEL 4ZUWB 1X5JA 5CSBA 1FHNA 1GGTA 1F4YH 1L9TA 3QDGE 4DJMA 5BZWA 4M62L 5CSZA 1LMKA 4DP9X 3QUMA 3LNHA 5TD4A 3ZE2F 3VACA 3FQWA 5ABZA 1AGFA 1P5VA 2EIMB 4Y4KB 4GFXA 3G5XB 3ILQC 3PWPB 4AEFA 4BK5C 4ZOAA 5PAZA 3KLAA 2Y5EA 3CAFA 1KXTB 1OSPL 4HV8B 4HWBL 4M29A 4NGHH 1U8CB 4Q4EA 4JFTA 4P9HC 1C16B 2YQBA 2YS4A 4XPHH 4DKFH 1IL1B 4KV5F 3UTZB 2YK1L 3OQ3B 3V0HA 4TVPH 5A16B 1R3HB 2VT0A 4QTHA 1D9KC 4G2AA 3QNFA 3RKDC 3LN4B 3B5HA 4ALAL 1BQSA 4Z76B 2WINB 3K0WA 5KSAC 4GMTH 3NN8B 2KPWA 3T4AB 3IAGC 2AJ3A 1MHHB 2XV2A 1XF5A 5DEZA 1EMTL 3MN8A 4ES8A 4YDVA 4BCYA 5A43C 1RMFL 1T1ZA 2WZAA 3FT9A 4HHAA 3B7TA 5GRWA 1UWFA 3RVWD 4H8UA 1RZJL 2JH2A 1SLWA 5JW4Q 4H4NA 1J5CA 2R8SH 4TXVB 4CAGA 5IB3A 2PXYD 3UYOD 5EIIG 4FXKA 4JLRA 4PN6A 2WMPB 5EWIH 3GLDA 4NLAA 5CGTA 1Q1PA 5BJTA 3BSZL 1OIOA 4B9JA 1FVCA 1JZJA 2WTOA 5FK9B 4AENB 4Z6AT 4QKTA 4G5ZH 2R2EA 4G42A 4P46D 3WJLA 4URTB 2I9LA 4JREC 2WKOA 4NJ9H 4U6TA 1GYCA 2LW3A 4MSWB 1HL5A 1NCHA 4KUCD 4B53A 2DYSB 3H9HB 1QLRB 4P3DA 5CUSL 1XF3A 3IPBA 5EC2A 3ZTDC 5J6SA 1ADQH 4PMEA 2BNQE 3II1A 1R3HA 1GW6A 3PS6A 5HYSA 2BSTA 1U8NA 5DJZA 3P3SA 5C0JB 1H6UA 4MCZA 1VPOL 3FQ1A 3RIKA 4S11A 4MXVE 5SX4I 5JIIA 3O81A 4ZFZA 3SKJH 1KOAA 4B95C 1OVZA 3VFRA 4QOKA 2ZSVA 4W68A 3BEVA 5HDLA 3CN1A 1XVSA 2F54A 4WTWA 5IHZB 1KBWA 3D1MC 2BS9A 1CDIA 1T3FB 4P23C 4JPWH 2K7QA 4H8WC 5BOJA 3FDWA 3L5JA 3EH3B 2X70A 1BFVH 4XN1A 5AOIA 3UTTE 3WNMA 2VLMD 1GOGA 4KKNA 4DN3H 5AZUA 4Z76A 1X4YA 1MJUH 5FUZL 2ADFH 4Z5RA 2Z65C 3BKML 4BFKA 5GGRA 4RWYL 1D5BB 4NZ8A 1WD8A 1MFAL 3F00A 1Y6NR 2FLBT 2AV1B 1KGXA 1HXMA 2VLLA 3VE0A 1GS6X 3DUHA 5F6HJ 3LZLA 3SDDA 1FZMA 1I7TA 3E2HB 3OPZL 4CC1A 2QGCA 4Q0XL 4JZJA 5I30H 4CVXB 2MFNA 3P4MB 3SDAC 4HX1B 5EBMB 3BAJA 5IQ9A 5CCGE 2IVFC 5ESAA 2CIKA 1ERNA 1N0XL 4K8RD 1BG1A 3FJTA 3NA9H 1ROWA 3WXVH 2FD6H 3RVVD 3IDGA 3Q06A 2X87A 1W6LA 2V17H 3QDJE 4GW5A 1OV8A 1BQHB 3EJPA 4FAAB 1VADA 3CFIC 4JO3L 3C60B 3VMOA 2FX9H 1U41A 2VERA 3WIIL 2VR4A 2IANA 3VGDA 1BZ9B 4PWKA 5HHXL 1WT5A 2FEEL 4LEBA 2YD8A 4R4FH 3N42F 3BD5A 1UH4A 3H0TA 1N6QL 1X5MA 4PRIA 5FO7A 5IW6B 2BRQA 3BT2L 4DPBX 4ONGH 4IYKA 2ZWNA 3LAFA 4PJ7F 1NUFA 3DBSA 2WSPA 4I18B 2COQA 1D5ZA 2ED9A 3IMBA 2DJ4A 1PVHA 3SZ6A 1FDLL 1M6UA 1SPDA 3NZHL 3FONB 5T3XH 3HZKB 5DQ9B 3BAYA 2R29L 1JNHB 1ADWA 2OXHA 5CIPH 3S4SA 1EAPA 1H3WM 1W16A 4DVBA 2XACC 5EZOL 1HNFA 2F6AA 4DKAA 2B9BA 4AM0A 4LOEA 1YEWA 1P2CA 4AX3A 4NQTA 1FFOB 1P6AB 4O2EA 1JZ8A 3V4VL 2HH0H 2FYYB 4UAOC 5ABAA 2KMWA 3FTYA 3QDJD 3V9CA 4E9XA 3NIGE 4M43L 4TL5A 2A6IA 2ZWZA 5DD3H 3T6VA 1HNGA 5CP7B 3ULUL 2HP4A 3VXUD 1G4MA 3LHPH 3D2TA 2OCCB 5FYKD 4RGND 4N2DA 2NXYC 35C8L 1GGCL 3HNTH 4QYOA 2Z6FA 3DMMA 4YVNA 3S35H 1YY8A 3O2WH 5F7BA 5JW3L 5DHVA 3IRPX 1LE5A 5J1SC 2HVKB 4BKSC 2J44A 5ANMB 1QVOB 1I7ZB 4NWUL 2ZTBA 4KVCL 4MNHB 4U1JA 2JQAA 1P7QA 4PS4H 3DVNA 4K3EL 4TLUA 4PW9A 1A2YB 3LD8C 2GPZA 3BVWA 3L3HA 1JZ4A 2AJUL 2KC0A 3OHXB 4QHKI 2NOYA 1WFJA 4HOZA 3EGXA 4M62H 4DKTA 4PGCB 3U6XS 1GPOL 2HLFD 4UT7H 2Z7ZA 2AJYH 3FHQA 2BOLA 3H9SA 4I3RH 4DGIL 3TBVB 4PP2A 5DVKA 2WLIA 4NQEA 4JDZB 2W9LA 4LOVA 4HWBH 1TVHB 1QPXA 3QS3A 4NUGL 4DKFL 1P5UB 4JJ5B 3FB5B 1S7RB 2EAEA 2ZXDA 4OJFH 2DMCA 4PJIB 1IQDB 3KPOA 3FU9A 4NWTL 5DD5H 1WTGT 1A0QL 3ZT5A 1JMZA 3INUH 3V7MA 1DO6A 3L4YA 4PJIA 3UXFA 3TWYA 5IHWA 1TZOA 2QQKH 2WXOA 3MRKA 3EXLA 1NIEA 2NY4B 5C0FB 1L3NA 4I77L 2I7OA 3QHFL 4DEPC 4DZ8A 2WCGA 5CJ8A 4HDIA 4S0SD 3IJYA 4K8RH 2P46B 4FG0A 5GGSY 5SWSA 4OIAA 1RZJH 4MNQB 3VXTA 1U2HA 1CFQA 3BH9A 3EGDA 1M3IA 4FQXB 4G8IB 5I74C 1GCYA 4QCIB 1CICA 4YIQA 3WIFB 5C9JB 4YHMH 4XCYA 2K78A 3CZFA 5FPIA 4P2AA 2VR9A 3A6OA 2V9RA 3CC5B 1LDSA 5EWIL 2JE8A 4EI6B 4ZG1A 1T2QL 2BVOA 4LP8A 2OR8A 4YC2B 1NFDE 3C12A 4IK7A 2X10A 2DDQH 1HIMH 3UTQA 1U8KB 2JB5L 3FBQA 4TUOB 5GSVB 3Q2VA 1NCTA 2FBOJ 4Q4IA 5LNDA 1DLFL 4ZW8A 1G0DA 1TO5A 1JGEB 1JZ2A 3L3IB 4AMKL 5I1JH 1HC1A 2DBLH 3MRHA 1MVFA 4RSYA 5IROC 1FFTB 3VD2A 5D7EA 1DUZA 4H8PA 1O9WA 4U6YB 1XMWA 1BVKA 5DUBA 2MOVA 2HRLA 2WSDA 4X9YA 2H26B 1G1KA 4HLZH 3D85B 5J56B 3N40P 4CRPA 2K45A 1XV8A 1F5WA 4G8EA 4G9FD 5I8CA 5DK3A 4LZKA 1S5HA 5E6IA 3KPMB 3DURB 4HS8H 5DC9B 4IIQB 4IJ3C 2GJ6D 3SOBL 1VCAA 2VDKB 5ETUA 5K9QG 4TM9A 3UP1A 3BN9C 3SHSA 5DZPA 4QY8A 1HEZB 4FP8H 5CEZE 3QUZD 5FYJU 4NM8L 1KULA 1CICC 3K4DA 2NXZC 4QXTA 5IK3B 1FNGB 3AUVA 4OCRH 3J27A 4HULB 2TSBA 1UADC 4PGJA 3MR9B 2GT9A 1DSWA 3FTWA 4L3EE 1TPXB 5B21<