1D7BA

Cytochrome domain of cellobiose dehydrogenase, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7bA00
4QI3A 1D7CA 1PL3A 1D7BA 1D7DA
chains in the Genus database with same CATH superfamily
4JFPB 1KOAA 5EIVA 1E4KC 1GC1H 3EJSA 1OAKL 1JDCA 4X98A 4P2OC 1A14L 3C60C 5BVJA 1I7RA 2AK4E 2HT3C 1CIDA 5HHPA 1U9KA 3ZTJH 4AGPA 1TYEB 3LRMA 5LXGH 3K71B 2JFCA 2R23B 5DO8A 1QO3A 4HKBA 2VH5H 3V2AR 3AB0B 2HKHL 3RWGA 3QBTB 4CL7A 4EDWL 1I75A 4ZPTA 5HHXH 2X4PA 3RA7H 4MJJA 2CAKA 2R8SL 1J05A 2LW3A 2G4EA 1ZLDA 5IV2B 5F9WC 1XCXA 3BHBA 2J57A 1JAEA 1PAZA 3VFOA 2P5EB 4PJ7B 4TQEH 4PD4K 1OAUL 4HHWA 4FQIL 2WUCL 3MROA 5F7EH 4BUHA 1N12A 3IJHB 4TM9A 3SE8L 4WSJA 1UJ3C 3B56A 3W57A 1A6PA 4N1EA 1A7OL 5EMYA 5I8KH 4UT6H 4M6ML 4OTXH 2HUEA 3IAGC 3MJ8B 1O75A 2BVQB 1NMCB 3GD1C 4U6HA 4X6DF 4E9YA 3FN3A 3RVUC 3WSQL 4DW2L 2OQJB 2OMNA 1SXNA 2FE0A 3C6SB 4H25B 4TLTA 2J3SA 1S6NA 3OLIA 5EU3A 3A6BL 3KH3A 3N1GC 3OKLB 3QCUH 2BS9A 4Y4HA 3VFSA 1EEQA 3U1QA 2N0MA 3CSPA 4QHMB 2ZSWA 4K3GA 3ZTJG 4KO6A 4L29B 1KCWA 5CF3A 4WTZA 4G7VL 3OXRA 3UTTA 1CS6A 1NBVL 2NCEA 2JKRM 2R51A 3APDA 4OZHB 5FYLL 3KDPB 3SBRA 3WXWL 1MCKA 4H1LB 1J1OH 3ZMRA 2F18A 2QVMA 4RA0C 4U1LB 3B7UX 4N90E 5FCUH 2PUQT 4X6DA 1MIMH 5IQMA 3CFEA 4WUUD 2H6PA 2Q86A 4PLJC 4DAGL 4XN4A 4JCMA 3WTUA 1E9OA 5D7HA 5F9OH 1KUMA 3ZKNC 1KYFA 2AQ3A 3HCVB 1U58A 5D9SB 3AGWA 2I9LB 1JIBA 2VDRB 3ARVA 5EU7E 3BEWA 4H1LH 4PJAF 4HD5A 3LQAL 4MKTA 4A7UA 3OV6A 2HYMA 1K3ZA 5GS0D 5DA4A 5FFOA 5AFAA 1DEEA 2CGRL 1P4BL 3C5ZC 5L9DL 5AZUA 1PDKA 1X5GA 3IDMA 2X87A 3AROA 2VDRH 1NUDA 3HE7C 1XSJA 2JJSA 2EO1A 3DVGA 4IS6B 2C3HA 5D96C 4F93B 1ADQA 4YBQC 3RWFB 3FCSA 1R24A 1P6WA 1TTFA 1OF0A 1ZK5A 3HNTH 1OK8A 4MD5A 3WE6A 2AK1H 5DLLA 2WVTA 3CHPA 1ZXKA 4KK8D 5HDRA 4EI5D 3AT8A 4PJAA 5E23A 4AOFA 5A7BA 1JYWA 3CNKA 1NICA 1TVDA 2J1ZA 1J5IA 5GZOD 3U0WL 4XPFH 1UD3A 4UBDD 1OP3K 2UY6B 3K4ZA 1TTRA 4BFIA 4HUUB 1Z32X 4NM4H 4V2CB 4MMZB 3B2UD 3MKGA 1HWHB 4M02A 4S11A 4TUKL 2EVJA 5JNYA 2B39A 2DAVA 2DEWX 2ROXA 1G0XA 3PGDA 4I0PA 3H9SE 1F6LL 1DN2A 2I26N 5E1IA 5FKAB 4WJ5B 3BPLC 3DO7A 2YGNA 4YNYA 3RWHB 1UZ6E 4JM2D 2WBJC 5D5MB 1CN4A 2EE0A 3MRHA 1NKRA 4UOW1 4DP4X 5I6OA 1FRGL 2LFGA 4PJDF 3FYEB 3L5WB 1RV6X 2WLZA 1N0XH 1YJDH 2HWZH 3CDZB 4YLCA 5EIIA 1S7SB 1UD5A 2AK4D 4FTVB 1OGTA 2BO0A 3T08A 4IBUA 2IXQA 4TNFA 4FXGC 1LEIB 5ESQB 2ZOWA 3R19A 2O5ZH 1TTUA 1TFHA 4MJIB 4I48A 1XGRB 2L7EA 2ZF9A 12E8L 2FCBA 1Z5LB 5FPIA 1S7WB 4J1UA 2WTRB 5BO0D 2IFFL 2XWJA 1HQRA 5DJDB 5H94A 3FBKA 1MWAA 3VXSE 4DTGH 2XFXA 2VMDA 4PJHB 4XP4L 1GAFL 4GS7B 3VRLF 5DD5L 2W60B 2XG4A 2YAMA 4OZ4A 2YGQA 2JH2A 1EO5A 3P73A 4PJDA 4LFHG 1II4E 3VFPB 1OSPL 1O5DT 4K94L 5B3JE 2CO4A 1U3ZA 2QGEA 3EZ8A 5IJBC 2YPKB 5AOLA 1H19A 3LEXB 4ERSL 4LOUC 4Y4FD 5HYEA 3TBVA 3CMGA 3NSJA 4UTAA 3UJTH 4AH2A 1KEGL 3ZUNC 5CS7A 2XQYK 3QQDA 4A7TA 4OF7A 1L9NA 3NSCA 2GIMA 1OT1A 2NY0B 2Z4TA 3MRRB 4HWZA 4TQIA 1HWWA 1UQSB 2BCMA 4QF1B 4I1NB 3VRJA 5KS9E 2OXGB 3UPAA 2YUXA 4W9KC 4FQLL 1LLAA 5E8EA 1GSKA 4JO2H 1HHGB 3ABLB 1VENA 3MRNB 5D1ZB 4CW1B 4F9PC 3IJEA 4GW5A 3S96A 4NUQA 3CUPA 1HH6B 2IPUK 3O6MH 4J23A 4MA8L 2EH7H 3WEBA 1VEMA 2DWDB 1LMKA 5LBGA 4L4TE 4PSPA 1JTPA 4L2YA 4FJ6A 3FCTB 2ZWSA 3E2HC 3IFOB 4J8QA 4WSKA 5DC4B 1OGSA 4CN4A 1XFPA 3II1A 3ZE2E 4DHLA 1FG2B 3BQUB 3W9EA 4BUQA 1ACYH 4Y4KA 4JPSA 1I8UA 4XCFL 1DTUA 2E27L 4X5XA 1JGEB 1KGUA 3GHBL 1HK6A 2AQTA 3H6JA 4FL4B 4Q8BA 4F2ME 4LLQB 1YUKB 2EXWC 4WIQA 1NBCA 3WJLC 4PJCE 4MAYA 1UACL 4LOEA 2LVCA 5I6NA 1XV8A 5F6IC 5D71L 4E42B 5DVOA 3SN6N 1PKQA 4GRWE 2HVKA 4NKDA 1FO0B 3MBEB 2D31B 3ROOB 3FTYA 4ZMYA 5HYQA 4ZOCA 4N0UA 5SWZA 2OK0H 2P52A 3ZIYA 2QSTA 2B5IC 2J5LC 5EZJB 2ESVA 3L7FB 5I1EH 1YY8B 5JOEA 4F7EB 4M8RA 5HDWA 2Z3FA 3VSUA 2XT1B 3FQNB 5BRZE 4KAQH 3T8VA 1SYVA 3ZZLA 4XHJC 4K3HA 2MQCA 3OMIB 1Y0LB 3WIFB 3QRLA 3OKMA 4HKXB 2VDPB 4JJ5A 5G4NA 1LNUB 4KRMB 1FO0H 3QUZB 4NP4L 4GY4A 4TOYL 4MQ7A 1I85C 2GJ6D 4Z7AA 1YECL 3QIWA 3NCFB 5TDOA 4PRDA 2W65A 2ERJC 4N3TA 4ICXA 1XGQB 1U36A 2Z35B 4L8DB 4PW9A 1BG1A 4PJIA 3WNPA 1UYWL 3C09C 3P9WB 1JXJA 4ABWA 3AMKA 3H9SD 3ECBA 3P11H 4NJ9H 3O9WD 2VDPH 3I6KB 2NY3D 1QBLH 4OJDH 1BM7A 4PRPA 1PGRB 5EO0B 2NNAA 1BXAA 5I74B 1DQTA 2R39A 5C2BH 3B7SA 3RVXD 4TQPA 1QWNA 3KHOA 5EO1A 3RBGA 4OLZH 2NY4D 5DTFB 3K6OA 3QUML 1M3IA 3AXLA 1CFBA 1JOIA 2C1OA 3PL6B 4YOKA 1BBDL 5JLZA 5CNHA 3K8KA 4G8GB 4EPSA 1L3NA 2XXCB 5DHEA 1JZ2A 4BWTA 1UWYA 5IR1A 2NY7L 1M7XA 2OI9B 4WV1A 1QFOA 2E7BA 4HOZA 4TVPL 4QTFA 3KGSA 4U4IA 4Z5RB 3U79A 1J1XL 2CCLA 1CXFA 1PEWA 1XCQA 2E7CA 5CZRA 4P5MA 4Q7DA 2ICCA 4FQ2H 3P0YL 3VXSD 3B3IB 4J28A 4OV5A 5FV2A 1QR1B 1VFMA 3MTXA 3PDOA 4MD4A 1HSBA 4Y1AA 3WY4A 1Z0MA 1QI3A 1PG7X 3FSOA 1Q9WB 4YLBA 5HYJE 4DEPC 4RDBA 3MOBH 3TO4A 4BFNA 5IHLB 2CUMA 1KPVB 2HX9A 4URTB 2A77H 2R29L 2NT0A 1YZZA 3QWOB 4LCWD 3FONB 4MCZA 1YEEH 1CI3M 1SMOA 3GS4A 4UT7L 4FHJA 3UTZA 4CRPA 5GIRB 3OHMB 1HINH 1KN4H 3QDHA 4DGVH 1IAIL 1UXSB 2BS71 3PXHA 4R4BB 4ZXBD 2HRPH 4Z77A 2RGSA 4NDMB 4JDTL 2B14A 2LLGA 3TA3A 5J1SC 3ZTDC 2R1XB 2AV7A 4IKKA 1BX2B 3LTVA 3EJRA 3LKRA 2WKLA 3MXWL 4FZEL 3RWDA 1BV8A 4Y16D 3NPSB 4AZ8A 4WUUA 1A1NA 4Z7VB 3ENEA 4WO4D 1W15A 3JV0A 5T1KA 2J12B 3EKCA 1T6BX 4L4TD 3RAJH 4HBCH 5DO2D 1HDMA 1WFMA 2ZYHA 1Y6KR 4HPYL 1NEPA 4S1SL 5F0JB 3VMPA 1T22B 4P2CG 1RVFL 2WHVA 2FWLB 3MCYA 5L7XH 2ZUXA 1J8RA 2FJHB 4X0KB 1CI5A 2VN6A 3VXNB 2D3VA 1IKFL 1LK2A 4BD4A 3DSNA 5DF0A 3ARBC 4URKA 3IU4H 5TE6L 1RK1A 2VMFA 3F7RA 4FQJL 4HZLB 1MCNA 5E9DB 3V0WL 2DTSA 3DX4A 4KTEH 1H3TA 2VN4A 3T0EE 5M95B 1QHOA 3EO9L 1ERNA 4L3EA 3HUJF 3QQ4A 3DTDA 4KHTH 1CLOH 3DO4A 3VDBA 2N0KA 2APTA 1KCRH 4PRIB 43CAA 1FH5H 3EDKA 1N70A 2PCYA 4G8EB 5F3FA 2CUAA 3GMMA 4JM2F 3AREC 4NI6A 1MW1A 3HG3A 1H3VA 3UJJL 2OMVA 4LLMB 4AVJA 2DYPD 2HFEB 2ZX6A 4HXAL 4OH2A 1E7UA 4EIUA 2V7HA 5I8CA 2LE9A 4RESB 5ICZA 4OF8A 5JIIA 2PCPA 4OY9A 1YLBB 1KXVA 4PJ9D 4HF5L 3DARA 2F1EA 1RZKH 1FPTH 4K23L 5BRZD 1D2PA 3FB8A 4OKVA 1RJYA 2UZIH 1GKOA 3HUJA 4XXWC 3SGDI 4BH8A 2FO8A 1YY9D 3QJHB 2R0WH 1NFIB 4AWJC 1E4XH 4S1QH 4Z95L 3TN0C 4ZTOH 3B2XA 4KUCD 3MMEB 5LKNA 3SKOA 1CE1L 3O0LA 2CLZB 4G82A 2CGZA 5E2WH 2FWOB 2BY1A 4ADGA 3P9MB 3RIAK 15C8H 5ADPL 2ZCZA 3AS0A 5DR5H 3RTLA 2AK4A 1F4WL 1KYOJ 3B7RL 5JHDA 1JWUB 3FT3A 5CD5D 3P0VH 2HTLC 4MBRA 2V2XA 3ULSA 4AQ8A 3OJ2C 3ZOAA 4Q14A 4HLEA 4G83A 3VM5A 1FL6A 3ESUF 4KQ4H 5DJCB 4L05A 2PTTB 4IDJH 4KHXH 2UWEE 4N22A 4WGKA 1HAUA 4NQSB 5CZVH 4KKBD 5ALCL 3HB3B 3VSTA 1AXTL 4GQQA 2G9HB 2AEPH 1FFQA 3CVHA 5LDUA 1JNNH 3CZFB 1J9SA 4X4ME 1FNEA 4W9EC 1QZNA 2AAAA 5L6YH 4Q52A 4G70B 2ZNXA 3PXLA 1QFPA 2UZPA 1E8ZA 3U0PA 5IB3B 3DOHA 2FBJL 3WL9B 4KOBA 3HZYB 4DFIA 2OZ4L 2Z9TA 3FU0A 4Y4FA 3F7VB 1OLLA 4IMLB 3BUYA 3S4SG 1PX3A 1JWMB 1BAGA 1SDDB 2AJ3A 4Y8AA 4JRXB 3JQOB 2EXYD 1TJXA 5CJOH 1F00I 4G59C 2X4NB 2D3LA 1HU8A 4J4PC 2VXVH 1NCJA 1PY0A 2W0FA 2GBVA 1E3ZA 4GAFB 5HYJD 3EH1A 3SE3C 2YFNA 4DGYL 3JV4A 3KYMB 4JR9L 2WXHA 5AD0B 4K5OA 3HRZC 2GQHA 1DJGA 1HHJA 3SYQA 3EGDB 2QELA 5A43C 1JPTH 4BE6A 2L4OA 2P47B 4FQXA 3W0WB 3O3AA 5H4YA 3W39B 3VFMA 3VXQA 2OMWB 4JHAH 2VLJD 3QUKB 4UMGA 4L5FH 3D09A 1Z3RA 2FBOJ 5KN5B 4JZOB 4PG2C 3ZDXB 5I82A 2ZXEB 4HCRL 4UZSA 1W6WA 2PW2B 4JKPL 3SKJH 4JRWA 4YGVB 4DP6X 2H3XC 1URZA 2RTTA 3B83A 3L3KB 3Q5OA 4IRJC 4OZGB 5JPNC 3O45A 5D2NB 2EE3A 2ZP9A 2WAHA 1L3WA 4Y2DD 4Y7MA 1WA2X 1KBPA 1A2YB 2HZHA 3UERA 2HVJB 5TFSH 3BXNB 2R27A 3UYPA 5JW3H 4CVUA 1OAJA 4RNRB 4AI7A 1RURH 1WWBX 4R84A 2R2HA 4LSDA 4WJG3 3ESPA 3FTVA 4YBHA 4MDRA 1T5XB 1AZVA 3RB7A 3X3FL 5KYYB 3FTUA 4JM0A 3VG9C 2HLAB 2IH1B 3FTXA 5HBBA 2WXFA 2M83A 3NA9H 4DVRL 1RD6A 5HY9B 1MDAA 4K5MA 3HHRB 5AVSB 2LU5A 4XNQB 3T0ED 1PZCA 1GCFA 3SBWA 2F15A 1TEGA 1UWXH 3O8XA 4H4NA 4RIRB 2CPCA 4KGLA 2CUHA 4QY8B 5ID0B 4OKDA 4P8QA 4I77L 3T4AB 5CZKA 4J6RH 5EORH 1UZ6F 4P5SA 2HX7A 4UB0H 2YD7A 3WFDH 2GC4C 2K7QA 3FU8A 4QYOB 5BPPA 4F7CA 4DQOL 4PWEA 4JANA 4JO1L 2DBJA 2QQNL 4HCGA 5DRWA 4PP1D 5LGJA 3D39B 1X4YA 4JX0A 4AV4A 1F4YH 1DLFL 1G7LB 1H9DA 1HHKA 5DWUL 3TBSB 4EQ3A 5DC0A 3EGXA 4IK7A 5A7EA 2BSTA 2DMHA 5KJRH 3LQZB 5D7LE 3WTWA 2I07B 3OWEA 3QXAA 4NERA 1Z9PA 3VXMA 1ZOXA 2WINB 3S88L 2YBRA 5C07B 1T7WA 4UQ9A 4P4KB 5DHVB 2A9CA 4AV0A 4GRLA 4EDXB 3U4EA 2FL5A 1RFDL 3B6SB 2VERN 4R0LC 4QRSB 1E6JL 1ZD6A 4PS7A 4OQ1A 3SJVE 1XBRA 3VXTB 3I9GH 1RL1A 5BZZA 4ZAKB 5B3JF 4Y7OC 3ZKMD 4H8PA 1WGVA 1RLBA 1XR9B 5DK0A 5KVFH 1F4HA 1QNZH 4HBQA 1WV7T 1VFOA 3DTUB 5DHVH 5ICYB 1MZYA 3BN9C 1E5BA 2IH9A 5ECJE 5JDJA 1FBIL 2XRAH 1IFGA 2ZCKL 4HKJA 4XGZA 1MFNA 3L8QA 4NQCE 1FFPA 5I19L 1WA0X 3VXSA 1PSKH 1S7RB 1IL1B 5B22A 2CM5A 2K8QA 4MZ3A 1NAML 3CIAA 5KS9F 3KYOB 3SE9L 4UT9H 2Q76B 3OJDA 3ABMB 3SDXB 5I73B 1S7QA 4IRZA 5JUEH 4FQHB 3QPQD 4HXBL 3B37A 5HJGA 1JK8A 4NKOA 3MV8E 3ZQWA 4QRRA 2VDOB 3B5TA 3VFTB 3RWJB 1IKNA 5IIEB 1T66C 2BSRA 2DIEA 4Z3EA 1SJMA 4OI7A 1TJMA 2XYBA 1THCA 3LKOA 1J9TA 1T04A 2BZDA 5HJBA 5JQHC 5DZNA 1AZCA 4HQQH 5DD0H 4QJ4B 4GW4A 5GRUH 1KPRB 3FSWA 3ZE2F 3SQRA 3LDBC 3A22A 4AEEA 3V7MA 2Y2WA 4EIZC 5DQDH 3TS8A 2FWSA 3THML 4HLZG 4KPHL 4MS6A 3KJ4C 4AG4H 1U3NA 1QSEE 1BIHA 4JCLA 2VDOH 4L18A 4OCWH 3KG5A 4KTGA 4AQEA 4OZHE 1WSST 5DQJA 4IJ3C 3VX1A 5C0EB 4OT1H 4LSSL 4LHUB 4PJCF 3RX9A 3FQ2A 4L4TA 1KTCA 1KGXA 4FYQA 3G3LA 4GMSL 4CBZA 2QHRH 1J5OL 4XNMA 4GRWF 3JV6B 2AS5M 1T1YB 2ZZUT 4ZX3A 5TE4H 2Y6SD 4HV8A 2B16A 3RY6C 4XMKL 3BESR 2UYLA 2JKWA 1CGSL 1YEIH 3CAFA 3QR1A 5F3HA 3WMPA 1AO7E 4PB0H 3PQYB 3L4XA 2CDFA 2AVGA 2CU9A 1HIMH 3K0YA 3SEPA 2ATPB 4ZSOA 1NEZA 5AW2B 4F2MA 4JG9A 2WVSA 3IDXH 4HH9A 1HQ4A 2DM2A 1DCLA 4PJCA 2EYTB 5B8CC 2OXHB 4KUCF 3WTVA 1SVZA 1VGEL 1TZIB 2NXYB 3VAEA 5IMKA 4GSRA 4FQ1H 2I7OA 3P69A 2DYPA 3TNMB 1IMHC 4W81A 1R3LB 3EFOB 4NX0A 3UBXA 4XCYA 2F74B 5BW7C 5FECA 1EFXD 1DQJB 3HPJB 1E4KA 5DSCA 4YDVA 3MV7E 5DLML 2A83A 2XFGB 4P2OA 5L88L 4PJGA 2QPUA 1LP9A 3IFLH 3K2UH 1FHNA 3HS0A 5FKPB 2FSEB 4PHZA 5HGHB 1LE9B 1GSMA 4TUOA 1ORSB 1T0NA 5IB5B 2HTKD 1C7TA 4JNXA 1P2CA 5F7LB 2EE6A 2AQ2A 5A6LA 2ZYIA 2VL4A 3FFDB 4XN2A 4ORGA 3FTGA 5FF6B 5IVXB 3NTCH 4KO9A 1UWGH 1MNUH 4X8GA 1B4RA 1EX0A 1BQHG 4ZDHB 3O2DH 2FNBA 3MJ9L 3N44B 3HLAA 3EAKA 3D6GA 3J2PA 4UNTA 5K39B 2JJVA 3TV3H 3U1PA 2A74C 3JWDC 2J71A 2YRZA 1I9JL 2WOBA 4ZUVB 3ZU8A 1G7HB 4LL9A 4FMFA 2OSYA 4Y19E 1I1RA 4WTXA 3F65A 1UJ3A 3PWJB 2VR7A 1L9PA 4HWEH 4LLYA 1NGPL 5J12C 2G30A 3L54A 3QO0B 4UNIA 1MJ8H 3SJVD 3UYRH 4HUNB 3WKQA 4PJ5B 5E7FA 2YGOA 1BQKA 4M7KH 3L9RA 1T89C 3WIHA 2H0JA 4KKCC 2AXHA 2AJZA 5E2VL 1DVSA 2EKSA 1NLDH 2A6KA 4O2CB 4ODTL 3U2IA 4DK5A 1QFWH 2E0PA 4GSQA 3V52H 1YDPB 2PXYB 3L9YA 3WDIA 1AQDB 2BFVL 2DQDH 1HI6B 2IQ9H 3T6WA 4XO9A 4QLWA 5JXEC 4NQCD 4WUKL 2QVFB 4X6CE 5BV7L 2IAMD 4AVHA 1R46A 5T1MB 5E2TH 1JF1B 1GIGL 4I9WE 3T65B 3DRQB 2BVTA 2IV9A 3PP3H 4L1TA 4WGWB 4DO4A 4YS4A 1E4WL 1ITCA 1TJGH 3ZHNA 4O51B 4FS0A 4JFFA 1AGDB 3F6IA 1IVLA 3GFUA 5HYJA 1P4LA 3Q48A 4NGHL 2P80D 4GBXC 3ZHDA 1Z9NA 4WZ9A 5KVMC 1HHHA 2LTQB 3NEXA 1QTPA 5AB0A 3K46A 1DSWA 4J3UA 1KIRA 4D9LH 4UV4H 1BIIB 5DMIL 4JMXA 4DGIL 3R0MA 2I5YL 4XZUB 4ENEC 1J9CT 4LPCA 2YEZB 2MPVA 4OIFA 4JK0D 1OTSC 2VSMB 4XX5A 2Z8SA 4IIZA 1K8DB 3SO3C 3DXAB 1AGCB 1MELA 1QSED 1BVLB 2QGCA 4W9FC 4HK3J 2WQWA 5ALBL 3C5ZA 1UB6B 5BS0A 1NCIA 1S8DA 4UU9A 3TASA 4TSAL 4Y5XB 3VGAB 5BUGA 2EZ0D 1A9EA 4PB9H 4U1IB 3RIKA 4BSJA 1RZJC 3DK2A 1BD2B 4UNUA 3TT3L 3UBHA 5CUSL 3HE7A 4N1CA 4X7SL 4B6ZA 3DIVA 4GMTH 2B1AL 2CHXA 4GUCA 4TQHA 4UIMA 2MOGA 1T7ZA 1EAPA 2G60H 3JT0A 4NQXB 4RMBA 1BMWA 3GLDA 2VZOA 1JV5A 4HX1B 1DBJH 4L1SA 5AENA 4YE4H 3TU6A 2BH0A 3U9WA 1V8HA 2YSSB 3MGTA 1ETZA 4ZFOL 1H6UA 1I8MA 1YNLH 4G6AD 1AO7D 3TCLA 2WTOA 4UINL 2DJ4A 4XBGB 2ARWA 1T5WA 5F71A 3T0EA 1AE6L 2R29A 2O26U 4J3TA 2GEQA 3C6EA 1A7PH 2VDML 3KPPB 3F7KA 4F2FA 4YDMA 3QZWG 1CR9H 5HYIA 3H85A 1PAMA 3QXUA 1TU2B 1AD0A 4WU5B 3U36A 4DKEL 4LFHD 3SY0A 3FT9A 2OMZB 4HEPG 2JK5B 4UUJA 1NDTA 4XVTH 1HL4A 4NQVA 4HWUA 2AJXL 5L8KB 5E8DL 1JNHA 4G6ML 2Y4SA 2VZUA 1TQCB 4X7TA 3GKWL 5ANHA 3EHBD 2O6EA 4FG6D 1AZUA 3F5WB 1Z66A 3HZVB 1BGXL 4ZNEA 1F56A 1PLGH 3GJFB 3MV7D 1FORL 4NQQA 3CXHJ 4FXGA 1V27A 4PY8J 3QJSB 2OS7A 3O4LA 3OZ9H 2OMBA 5SWSA 1UA6L 3UZEC 2D7TL 1RIUL 3FTSA 3LZFL 2UWEF 3ZW3A 3HVNA 5IK3A 1AQHA 1U8MB 1WAAE 4J3OC 2E7LC 3RVWD 3TL5A 4YL4A 2E6PA 1U4EA 3GJFH 4IK6A 1KBBA 2YD0A 4TVUA 4A7GF 1I3RA 1QSVA 3Q6GH 1H3GA 3N85L 5BMFL 2BMKB 1DE4B 1NL0H 2Q7YA 1ZVSA 1MOEA 1X5XA 4QHLA 5EBMA 1TQBC 5I0ZA 2OTWB 4RFEB 1IZKA 3C5XA 3N06B 3QEGL 4MXQC 3M1CA 4Y19D 4N2KA 3GMOB 3BMWA 3QJTB 2DIJA 3KPOB 3SOTA 3IDGA 2ORBH 2YXVA 1QYGL 1KLFB 3P1VA 2VCOA 2TSAA 4MJID 3G5YA 4RETB 4KH9A 1CT8A 1EIBA 1IEBB 3MN8A 4LL1A 3CWGA 4RFOH 4ZYKA 1UJTA 2P48B 4JRYE 4OLXL 4Y2OA 4A7GA 3NDZE 5HJ3B 5I6KA 3B9KB 1BBJB 4FLQA 5DZVA 4PS4H 3ECVA 4G6FB 4NZFA 1GZPA 3VTTA 4ZMQA 5B1CA 2KQNA 3HZMB 2COVD 4ELKB 5J06A 3QC6X 4UTBL 5DRZB 3L3HB 4I9WD 3CH8A 2LU7A 2J2ZB 4PP2B 3CSTA 3BLBA 4A2FA 1OTTD 2X1WL 4KC3B 4NHCL 3NABL 3PHOB 3KWXA 4DESA 3UAFA 4HLJA 1KLUA 4XNXH 2X41A 4XWGL 1AACA 8PAZA 4QRUA 1TOXA 5HDQL 3UBGA 4O2EA 3QZOA 2YD1A 3BKMH 3MUZ1 2WCGA 3VFRB 2H2PD 3QIBC 2NX5A 4PJEB 3KVPA 5J3HD 4C59B 4L9LA 4IBQA 4ELMB 1A3RH 2XA8H 3MLTA 5T33L 2XWBA 2L3BA 4UQ2B 3SDDC 3WJLA 3FB5A 4Q56A 3SPHA 2WBKA 3BD5A 3CQQA 5DUMH 1O6SA 4A67A 5B38G 4V2BA 5DZOA 5JHLL 5K9JL 2WWKO 4FFZH 3DV4B 4XO4A 3K2IA 3NJNA 4TULH 5D6CA 3U6RA 3GSNL 3ILPA 1IGFL 4Q9RH 4CSPA 5B39G 3N41B 5AWNL 3DECA 3X11B 5DEGA 1K6QH 3FOLB 4PRBA 2P46B 1CU4H 1EVTC 1X5AA 1FNGB 4PCYA 3QQ9C 1VERA 4G7YH 4OB5H 4LIQL 2WUBH 3W1ZA 2V2TB 4XPGH 1MXDA 1NKOA 1T0PB 4ZMOA 5GS0L 5DD6A 3CVBA 1E3XA 5DK2B 2EO7A 2J6EL 3OKNB 4WFGD 3BAXA 4YXKH 3HHSB 4F27A 1BWMA 3BP6A 4CMHC 1ZSHA 5IMLA 5F88A 4F9LC 1AGFA 2GTZB 4I1PA 1L6XA 3GTVA 1MAJA 3FOMA 1JZJA 4EIGB 5HPOA 3AG3B 5CIPA 5I76A 3TO2B 3POCA 4YUEH 3MNVA 4Y8DC 2BWIA 3BLKA 2VE6A 1EEYA 2WWMD 3OMZA 1R75A 4M6OL 4P3DB 3IMUA 5KYUB 5CLYA 4W9LC 3VXPA 5AKTA 4XAWL 1AFVH 2H32A 3TTYA 5D7IE 5JO5A 1EHXA 2X6CA 2JWYA 2NSQA 4JO3H 3FC8A 2CH8A 3WTXA 3H9HA 1JD9A 1QLEL 1AYRA 3CFBA 2F58H 1BLNB 4ONGL 1U92B 3PGFH 2BDNH 1IM9B 3TWCL 2OJ1A 2PF6A 1B88A 5D7LA 1WC7B 3IXTB 3PHAA 3QXDB 2HN7A 1HZLA 3H3PH 4X9GA 5F7YC 3WUWG 4AK2A 3DX7B 2JLPA 2V9RA 2Y5EA 4XO8A 2BNUB 3P9LA 5KBNC 1DVFC 4MX7B 1RIVL 1UM5H 1QI4A 1NC2A 3NIDB 4XMTA 2E9WA 5GS1A 4WW2B 5TH2B 4AE1A 4JN1L 4TTDC 1WZAA 3BVWA 3MX0A 4R83A 4Y9BA 3VACA 4AVIA 1DQLH 1ZHLA 5C6PB 3FFCB 2CBPA 4WFHD 5D7JB 4CNIA 2PCXA 4F3FB 4QGYA 2VN3A 3NFPB 2WLIA 2FH6A 4OIAA 4NO3B 5AW6B 4PGDA 3Q2NA 4UT6A 2UVEA 3VNYA 2X70B 4PGZA 5C0DA 3S8FB 2WCSA 3O3EB 4IBWA 3KPMA 4PV9B 5JZ7C 5CJQL 3GMRB 2D7NA 1DFBL 4HA1A 1MCOH 1SUJA 2EIZB 3D3VE 4NZDA 5KZCB 4N85A 1N9PA 4Y9CA 1I82A 2JF1A 1F3RB 5EO9B 4JRYD 5CLXA 1KEMH 1MHPH 2BOLA 3ARTA 3LPFA 4NRXA 5F6HJ 4C4KT 4GUQA 2Z0UA 2F8VA 2EDXA 2PTVA 3QDGB 4L5FE 4ZTPH 4BZ1A 2VW6A 1RZFL 3MV8A 4E2OA 1CK0L 5EEZA 3UG4A 4JE4B 3NRQA 2YD6A 1MFEH 2YUWA 1G7IB 1HHIB 3IWUA 1MCJA 2VABA 2YPLB 2YPVA 4HJJH 4U6YB 4R7VA 5E5MA 5E51A 4XWOD 2HX8A 3B2VL 2XY1A 3GEWB 1ZWIB 1ZRUA 5FYKU 3O3UN 3VD0A 5AW1B 3FZUC 4APXA 4XMPH 3FSZA 1QPXA 3CU1A 5DMKA 3M46A 3W9DA 1N6VA 1O9VA 1OARH 1PS3A 3ARBA 5DEFB 3HJEA 4CADB 3WD5L 3ZZ1A 4CSZA 1Q72H 2CK0H 2FGZA 4S10A 5AZEH 5IBLD 1XGYH 2WD0A 1NOFA 3WKML 3VD2A 2H1LM 4KRPD 1MJ7L 3MZTA 1PVHA 4XP5H 5INCB 1TPXC 3BE1L 3CC5B 4KZCA 5KSBA 2LT9A 2UZYB 3UCQA 1NEUA 1WG3A 1LL1A 3QEHB 3AREA 3NQKA 4RMWA 1RQ5A 1LE5B 3FU7A 3MRMA 1YEHL 2FJFA 1FIEA 2VLLB 1OCWL 1R4XA 2AGJH 3VGEA 1H6FA 2NSXA 1VJSA 2WLLA 3FQUA 4K55A 4RVBA 3Q8BA 3MNZB 3SCMB 1BREA 5DA0B 1SN0A 4BRJA 5HI4C 1G7PA 4PAZA 4PH8A 4XC3H 3C5SB 2Y2TA 3S8GB 4UDUB 4F91B 4MVBD 4P2QB 3NGBB 1NJ9A 3EUDA 5I16B 5CINL 3BEVB 4OGYH 2IQAA 2J43A 4XXWA 4GKOA 1BEYL 3MRPA 1S5HA 1CFTA 1C5DA 1VDGA 4HEME 4N5ED 3OZLA 3DOIA 5I0WA 1MEXL 3TN0A 1QATA 4YDIL 4DP9X 1MPAH 3VWJB 1F4AA 3GT6A 4Q9RL 5T3XE 1JG9A 3BO8A 1RULH 4NZTH 4ZMVA 1NLBH 3NCJH 4P5RA 5EN3A 2V33A 1ODAA 2J1YA 4XODA 3HI1A 4EKJA 3W82A 4GQZA 2VWEE 1OL0A 1ULVA 3MV7A 3X1NA 1O5PA 4HC1L 4XVUD 3SKMB 2B0SH 4DOHE 3IU3B 2WQVA 3KLAA 5HGAA 5T5FL 2QR0B 2GSIB 3R06B 2JJTA 5DI8A 2EXTA 3OJMB 5IHBA 3IAPA 4WY7L 3ETSA 3MUGB 2O5YL 2CRZA 1NBQA 5FUCC 4OUUA 1KCUL 5CD3B 3FH7A 5KVFE 4D8PA 3IB4A 5TF1H 3UIZA 1BJ1H 2HKAA 2NTFB 3SPVB 4QHUA 3TVMC 4RBPK 2UV3A 1KNOA 2FATL 1TJIL 1MF2L 3RGBA 3BKCL 3UO1L 1X5JA 4JAMB 5B4MD 2Y22A 4W4OC 1Y18B 4XBMA 1XF2A 2ICWA 4X6CF 1PZ5A 1CF8L 4ODWB 1A7RH 3QR0A 1RKRA 4LVOB 4YSCA 2MHAA 2A9MH 4NN6C 4HDIB 1JWSB 2QADC 2ZTBA 1E9QA 4M29A 4N1HB 5F1IB 2F5BL 4J4PA 3G6JB 3HC0B 3PF2A 1XH2A 4FQQA 1ASPA 2A0LC 4K3DH 1NC4D 4JGJA 4W1TA 3JTSA 5D1XB 4BGLA 5C0NC 3ATFA 3SDYL 5C3LD 1IM3D 3D4GA 3HRZA 2QVIA 3HB3D 4U3CA 3Q0HA 1WQVT 1J8HB 4WHCA 4M3KB 5FOJA 3Q1SH 3BVNB 1JHKL 3W38A 1IBHA 4JQVC 2VW7A 5GHWH 1Q0XH 4X6CA 3NVQA 5CEYB 4KK5D 3D3VD 4WWKD 3FB6A 4KJWD 4ANUA 2YQ3A 3L3IA 4NYLB 2XKSA 4BKLB 4GSDH 4LP8A 3PWNB 2ZPKL 2WK2A 4IRJA 2ZOLA 3CZEA 5HYSB 1DDHA 5DZJA 4OCRL 5E4OA 3L9BA 5JPNA 2ODIA 1ZE3H 4IOFC 4YHKL 3WAKA 2OL3H 3QXVA 4QRQA 4UV7H 4ZUUA 4CMMA 3BT2H 2ZCLH 4ZQKB 1A6UL 3HKFA 3LHPH 1F2QA 3HG1B 3Q7JA 3W0WD 5EBGA 3LZOA 3OAUH 4NN5B 4KNQA 5IW1A 1BVNT 4YO0A 5IHZB 2OPCA 1SNRA 1KTDB 3W11D 1QPKA 3TIDA 4KZEL 4Y5VB 2ADJB 2VC2B 3L4UA 4YXHL 1A7NL 1GGYA 5D1QE 3RKDD 3UGUA 4B95C 3SQBA 3S37H 1I7UA 3EYVB 3OAYK 1VFBB 2ZYRA 4LNVA 4LNRA 1CG9B 4X4XB 1ZY9A 3B3BA 1OZUA 1S7VB 1ZTMA 3ZK0A 1UATA 3PS6A 3RFZA 4OCYH 1C9SA 5GGRB 3IDIA 3GMQB 4UQEA 4H8HA 3ZYJA 3K6SA 3COOA 5LBSL 4M7ZC 1N4XH 1A3LL 3QHTC 3BUQA 4GFTB 3MUJA 5ITBL 2VC2H 4PV8B 2QMKA 4OCSL 1XF3B 1D5IL 5DFTA 1WTLA 4G11A 5EZPA 3NAAH 5E08H 3BW9A 2IFGA 1V7ML 2VSDA 2Z92B 4LEXH 4YAQA 3V4VL 3JVFC 2MMXA 3F7YA 4KMTL 4LRNH 1DUYB 4LEEA 4MA7L 3IT8D 4ZPVA 4DVBA 1CWVA 2CJUL 4FNPA 4Z7WB 2CIIA 3EO0B 4E41B 1HCYA 4XAKE 1ZK9A 4KXAA 4JPVH 3NJHA 3Q8EA 1WAAF 3DROA 3MV11 3S34H 1PNDA 2ZUTA 4ZODA 4TRPL 5BZDA 1V3JA 1D5BA 4F80A 2C9PA 4R0LA 5PAZA 5FOBB 1X3DA 1DQIA 2ADYA 2X4OA 1Z3GH 3RPIA 1G4RA 3KWWB 2O72A 2WXRA 4YPGA 5IWLC 1LO0H 2GAZB 3D07A 2BZ7A 3VWKB 4NBYB 1E90A 1QA9B 2C1PA 5MERB 1MFCH 3EYOA 2AQ1A 1PNCA 1VF5C 3DDGA 3BAYA 1LJMA 4XPTH 3P3UA 1BJ1J 3JWNH 1R33A 2A73A 2NLJA 1FFNA 3EOYG 1WAAA 2X2HA 4KROC 3L3JA 1KJ2B 1WYJA 3V0HA 1W72H 2XETA 2ITDA 3DETD 3ZXAC 4DZBA 5IOPB 4OF5A 2A1WH 3SYCA 3ILQC 4TPRH 2JIXA 1EEZB 1RUQH 3ALWA 5B7EA 1OP3H 1FAIL 4FXKB 1M6UA 5ABAA 1R5IA 5HDOA 1WFJA 1RK7A 2APWA 4CBPA 2Q10A 4J2XA 3QJUB 3C08L 3IKKA 3LV3B 1S9XA 4OD1H 1BOGA 1N8OE 2DTMH 2ZXBA 5E4EC 3QI9C 5CWSB 4DSYA 1KJ2H 3A4EA 2H3KA 3HNSL 1BZ7B 4TUJA 4DF9A 5EFIA 4MSWB 1M9WA 1KLGA 3IXAA 2VDLL 5T1DH 4NP9A 5DQ9B 2MTPA 3UFIA 1L6PA 5ESAB 1AZBA 4X5WB 1TETL 1A25A 1N3NB 1XTLA 2E4TA 4JRYA 1GPOL 2X44D 3Q5YA 5IVZA 3RL2B 3FQWA 4KJYA 1N8ZA 3BSZH 1TZAA 1A6ZA 3IDYC 2IG2H 3ULVC 2EADA 4LBAA 1YSOA 2XVGA 5KYNA 3C6LC 1AZRA 1YYCA 2ITCA 2X40A 4CN6A 1EGJL 1MCIA 4KY1H 5KVDL 1A1MB 3QDJB 1B0RB 1SLUA 4GLRH 4R9HA 1TSHA 2BY0A 3EBAA 3JWNG 3I75A 2C3VB 1TVBB 2G5BB 5CAYB 5IHWA 4L0PB 4L8BA 5F1NA 3ARZA 1KN2H 3FMGH 2X9YA 4NBXB 4PD4J 1OE2A 2Z0BA 2EDKA 1IV8A 5MP6L 1NCAL 4LEOB 4CGUB 4H88L 3DIFA 4CILA 1EHLL 3L3GB 5CEZE 5KYXA 1SBBA 3QR2A 4MMYA 4RCAA 4U0QB 1Q4NX 1MUJB 2MCG1 3TYFA 2ICES 3U2SA 4U49A 2F54E 5B1KA 3WY3A 1HYRC 3G5VB 3EYUH 2OLDA 3CCHB 4LHUD 2ZUQB 2CLVB 4LPTA 2BJMH 2N4IA 4EI6A 2DOCA 1KF9B 2CA4A 1JL8A 1N68A 5IROD 3F3HA 1S9VB 3V4PB 2VQ1B 3SDCC 1G9NH 3LH2L 1S9KC 5D1QD 3HI6H 1JTOA 2G2NA 2FLRT 1MWOA 5I1DB 2BSSB 4A2LA 1OCRB 2IDUA 5KTEH 2ENSA 2ZXCA 3K1DA 5E99L 3LKNA 3IMWA 4EN3D 5IHUL 2AFNA 1Z9LA 4AQAB 3ABKB 4ODVH 1TCMA 5D7IF 4EZKA 4X9BA 1QABA 4KVCL 5DFVC 3K1KC 4CKQA 4KKLD 1YEDB 3AB0C 3MZGB 2VR9A 2BY2A 1S78D 4XOEA 5FGBA 3EH4B 5I18L 1P84J 2J1WA 1CDIA 5CBAB 4NPYA 1T2JA 4X8JB 3GGWA 1KG0B 1ZEAL 1A22B 1S4IA 4BKTC 2NXZD 2IDFA 1KXTA 1Z9SA 2BCKA 1ET8A 4XP9H 3S4SA 4RGMB 3BKYL 1MI5B 4XAKD 1SN2A 3U0TB 4MFHA 2BW5A 2A74A 3EJUA 3PWUA 1F90H 3AFLA 1AR1B 2JKLA 2X6BA 3VRIA 4AYBA 3LEYH 4YHPA 4NSKB 2DQCH 1NTDA 4NKIH 3DMMB 2WO4A 4ZFZA 1H0DB 3TIEA 1NFAA 5FA3A 4ABQA 2AQSA 3Q6FB 2XQYG 5D7IA 3VM7A 3MGAA 2XACC 1NMCC 2Z1KA 4HWBL 4WWID 5KUMA 1BXVA 4KQ0A 2IBBA 3UPCA 3G5XB 4ZMZA 1T89A 3C8KA 2QV2A 1ZT1B 5FYJH 1CQYA 2HXAA 2J7LA 2K6ZA 3EFDL 1ICTA 1AP2A 3Q44A 2R1WB 4PGJA 5GGRY 3QFDB 2WLYA 5KSAB 3AACA 3N1MC 2QLVB 2X7LB 2B1OA 5KBDA 3P54A 4J3XA 5EU4B 3D51A 4PRNA 3MRFB 1X6LA 4KKNA 5IQ9B 2RALA 4G1EB 1KIUA 1KFGA 2BIQA 1PLBA 4L3FA 4MJ6A 8FABB 2HFGH 1CFQA 3T2OA 3TOPA 1K2DA 5DU7A 1ED3B 4X9HA 2MCPL 4L8CA 1RP9A 1MCPH 1WWWX 1E50A 3L5JA 1NC4A 2AJYL 4JFTA 3T8XA 3O41A 4F7TA 1RZ8B 4GBXA 1ODUA 1U3HC 1QRNE 3MV9B 1IM3A 1R3HA 1CXLA 1IBGL 2W8CA 4P59L 3GDBA 4E5XG 4AUUA 2H47C 2GFBA 3FB7A 2Q8AL 2AV1B 3KPQA 3SPGA 4DN3L 4WJKB 2YLHA 5ISZB 3NP4A 4F58L 3GSQA 2PXYD 3P2BA 4ZFGH 1I7TA 4NO2B 5E6IB 4NN7B 5ANMB 3FYIB 1GGBL 1HXMA 2NY2B 4HH8A 1MHCA 3LNIA 4KJQC 2YKLL 1D2OA 4YEFA 4IHOA 1NFDB 4PRHE 1A3QA 3F58L 3F8UB 2IH3B 3R18A 4O9HH 3ZL1A 4HU8A 2B59B 1FUNA 1P1ZA 1MRDL 1LEGA 2OA9A 4O02B 4YHNB 2GB2A 4P5TB 3X13A 1VFUA 3Q5TA 5EEWA 2ETWA 3N9GH 1ZXQA 1OWRM 4FE9A 2GJZB 2E4FA 3QAQA 5D4IA 2XNAB 2VLRA 5FC9A 3S36H 3V9FA 4ELME 5LXVA 1I9RL 3ZL4H 1YC8A 1ZHBA 3MBWB 4WI3A 2IANB 4M62L 4PM1A 2AW2A 5EZLB 3EYSL 4FLSA 2X1OA 1Z6JT 4DQAA 1W80A 1ZA3B 2XN9E 4O02H 2UZXA 2PR4H 4P99A 4WFFE 5E95B 3GK8L 2RQ8A 1CDJA 4MMZC 2R2CA 3QEQB 4XMXA 3ULUC 3UYOD 1TEFA 2DH2A 2WSKA 2F54D 4MNQB 3P4OA 1Q0EA 5BJTA 4NQEB 4AKOA 4JHZA 4TL5A 2YKKA 4UM9A 3LB6D 4Q0XL 2EUVA 3PP4H 1ZHNA 3Q2WA 1PD1A 1SQ2N 2B9BA 4J3SA 5IFAL 4JO5A 3O11B 5CBEB 2L0DA 4PY8I 2OTUB 1JXFA 1M05B 1W0WA 4XNBA 4NXKA 1YEJH 5GGVH 4BXVA 2QDVA 3EYFA 1EO8L 1XBDA 2BIHA 2CLRB 2H45A 3INOA 2W9EH 3NP3A 1ZLEA 4LPWA 3UZEA 3BZ4B 4HEMA 3U1SH 5K5YA 3ELAT 2EDJA 3BPOB 4AE0A 4JPIB 2Y1YA 3PHQA 3MKKA 2V5SA 1AQKH 1F58H 2AEWA 3KJ6H 3F6LA 3ZT6A 3K7UA 3KS0J 4BCXA 4H5SB 4AMKL 3TBYA 3FCUB 3IGLA 1UKTA 2FEDC 3GIVB 4NI3A 4NRZA 3BP4A 1NCBL 2OP4L 3KL5A 4PJBB 1G6VK 4KNUA 2IF7A 4XC1L 4XPBL 4CVZA 2PO6B 2XZQL 2A9NL 2EIEA 4HS6B 4I2XB 3MNWB 1GJUA 1JV2B 4JFXA 5AKRA 3X14B 1CDCA 1J5DA 5C6TH 5IESH 1GC1L 1WWAX 4JPKL 5FO8A 1QFWI 2OYPA 3VGFA 4ALAH 3DYMA 4JQIA 2XXMB 4LLAA 4X80L 5EOTA 4FEMA 2NY0C 1S7XB 3GLEA 5LXGL 1EAJA 3GS7A 2XZCH 3IKCB 3WNMA 3AWEA 4GIPD 4LCVA 3STZA 1XZ0B 4GUPB 5I66A 4JG0L 5D1ZC 2LLLA 5FA4B 5HHXL 5DGRA 3GUTB 2AJVH 5DS2A 1AXIB 2X4SA 3NJMA 5EG6C 3DDFA 5CJXC 3V9CA 3JTTA 3BYTA 2X4QB 4R96B 3U6XA 3S35L 2VUYA 5AVRB 4TQEL 1KB5B 5I9QB 5F7EL 2YIHA 3MLRL 2FB4H 4UANA 5FCSH 3BQUC 1QRND 1YUHA 5IBTH 2COQA 4OTXL 2WCPA 4DH2A 1Y6NR 5C2UB 1D7BA 1RPUA 3D25A 1VCBC 4IU2B 3ZO9A 1Q9OA 4FL4C 1MKFA 2VR3A 3B9KD 5I71B 1JS4A 4NQTA 5C0RH 1KB5H 4X5RA 3SDDA 4GKNB 3QO1B 1FG9C 3ARQA 1MAML 1TFPA 4MAUH 3QCUL 1XF4B 3KWVA 3GSVB 4QHNB 3CC1A 3MBEC 1JK9A 4JZNB 2NSMA 4PRHD 2XKNA 5KSUA 2KPWA 4G8IA 7PCYA 2KERA 2GEEA 3DUUA 4B9YA 3CMOL 5TD4A 4IRSB 2P28B 1DUZA 1JPSH 1JI2A 3DJRA 3QRGL 4KK6D 1C5CH 4PIRF 4MASA 4GKLA 4Q6IA 1LQSR 3DRTA 3JUYA 4YR6B 4FFVC 4RQQB 1AC0A 2EDRA 4YVUA 5FCUL 1EZUA 1F2XK 2DQUH 4I3GA 1KIQB 1MIML 4IDLA 4YHIB 5JA8B 4S1DD 1G7JA 4M8VA 2P8MB 4N2MA 4U6VH 5DS8B 3QUZC 4DZ8A 3QSKB 3E6FB 1FLRH 4LCCB 3UZQA 3QWQB 4D3CL 1VZIA 2XN9D 1PQZA 3MJ6A 4UILL 4PR5B 4F9LA 4LAQH 5D1QA 3RPBA 3SGKC 3ZHFA 1INQA 1P7KA 2ITEA 4P05A 1SDAB 5KVEH 4XMUA 1ZA6A 1BVKA 1NCDH 1INEH 1QFWM 1T7YA 3FO1A 4A66A 3NPZB 2VOTA 1SYSB 3PFQA 5DVKA 5I2IA 4EN3A 4X6EB 2HT4C 1ETA1 1NPUA 1SXBA 5F9JB 3GSRA 5TGBA 2HH0L 3QH3A 2XVLA 2VDRL 2VDNB 4OBRA 3PL6C 4N26A 4UZGA 3KPRA 1L0QA 2DLTA 2ENYA 2RBLA 3NIFB 5CMAB 5A3IC 4UQ3B 4K9EH 4NO5B 2KH2B 1T1XB 2AK1L 3DV6A 5EOCH 1CF1A 2OI9C 4HJGA 1IX2A 3BGMA 1IE5A 3T77A 4XPFL 2P1YA 5D93B 4MAZA 4X99A 1Y6MR 4X98B 5CJ5A 3QP3A 1EMTH 2JI1A 1I7RB 2X12A 1B3JA 3LKPA 3OVUB 4NM4L 5I1AA 4Q9CA 5L4MA 1DVFA 3DUHA 1D7DA 2B2XH 2P5PA 5HHPB 3GZKA 2FRGP 2RCSH 3DSFH 2RD0A 1H9VA 3WKNA 1QO3B 3S2AA 4UM8A 3PUUA 5F21B 4PLNC 3RWGB 1JZGA 2Z6FA 2WMPB 3RGHA 3MLUL 4ZPTB 5F70A 2X4PB 2QVKA 5FYJU 1WK0A 3RJQB 2OMTA 3I6LE 5DJ8B 1TNNA 3TEZA 3MXVL 1KPUA 3BHBB 1HH9A 1PJ9A 3O6KH 1KBVA 1N0XL 2HWZL 3VFOB 3U4AA 2VMEA 4QOKA 2RHEA 2QZQA 3QUXD 4L3CA 4NO0B 3RWIB 3TT1H 3MROB 2CBOA 2W9DL 1QI5A 3DBXA 3H0TA 2W07B 3D0LA 3TH4T 3O3DA 4J3VA 3I02B 1NCUA 5DURB 3N6YA 4YXLL 5GISH 1NGXA 4N8VG 1U2HA 4U6HB 3VW3H 1ZIAA 3BAKA 4Z3HA 1A5FH 1J7VR 3G6JE 3FUIA 3QDME 1KCVH 4I88A 3AWGA 2WXMA 4AM0A 4BM7A 1SXZA 3FFCD 1IILE 5HHNA 1GA2A 3TBBA 4N2OA 3CSYA 1DVXA 4WQOA 4JFEB 4J39A 1XF1A 4JCWA 4UIKL 3FH5A 4Y4HB 5IHHA 3VFSB 5FGCB 2CRMA 1R1CA 4G5ZH 3KCPB 2ZSWB 3IFPA 3RJDA 5EUKB 1U8JB 3UJTL 3OXRB 2WQUA 3UTTB 1URLA 5DEJA 1U91A 4C56E 1ZJAA 4AC4A 3MRKA 2XLLA 1JGDA 4WO0A 1GZQA 1G4MA 3B4NA 4ABVA 4GW1A 4X6DB 1D5MA 1RZKC 4HHAA 2H6PB 2Q86B 2OSLB 3QNYA 3TH3T 5B1BB 1KIPB 4LQFH 5FK9A 1E9OB 3HS9A 4MB4A 4DK6A 4JO2L 1U58B 5MENA 5F96H 4HIIA 3O6ML 4L8SA 3BEWB 2EACA 3Q05A 1K4CA 4K8RD 1P5UB 4C83A 1GJIA 1V5JA 4AGQA 3TJHD 3QEUB 1G5GA 2F7RA 5C0CE 3OLGA 2CQVA 1PDKB 1ZSDA 4Q2ZA 3V0FA 3WO4B 5LQBH 3OGOE 1JGIA 1YNTF 3IDMB 5HHVH 2Z31B 3RX8A 5JXAH 3EOBA 3WMQA 4YL9A 2F54A 3DVGB 4I0CC 2CBTA 1DQDH 3FCSB 1R24B 4ZRGA 1M1XA 2OAAA 5KG9A 4MD5B 3WE6B 3S2CA 3WE1A 4ZMPA 1DHKA 4GAJH 4PJAB 4LSVH 4PTUA 2RA1A 4OLVH 1KTBA 1E9PA 1RY7B 3K8MA 3KYKL 3N1FC 4HPOH 3VFGH 1TJHH 3NJGA 1NDGA 1ZPUA 1UKSA 1KYOK 1JHTA 4BFIB 3VYNA 1JRHH 4YSRA 1ADQH 3KE0A 4YK4C 4MXVE 4P2QD 2OK0L 1RH8A 4M5ZL 3U9PH 1I8KA 3EJYC 1G94A 1YNTA 2DH3A 2XOTA 3MRBA 1DJZA 3PGDB 4I0PB 4XP1H 1YYMH 2I32A 4OLWH 4F15B 5I1EL 3QG6B 1E5AA 1UXMA 2QVTA 2PWHA 3ECUA 2JXMA 3SY6A 3DO7B 4KAQL 4YNYB 2DWYA 3TVMA 3KDMA 1CFMA 4LB8A 2ZXQA 3P4MA 3MRHB 1MJUH 5CILH 1FO0L 1SLVA 4OAWB 2ZG2A 4J7RA 4KZ0A 4ODXA 3JWNE 4W4OA 3GQFA 1XGTA 3VGBA 4NC0B 3AW5A 5EBLA 5EIIB 3WFCH 2A9DA 3PABB 1JGVH 2IXQB 4QRPE 5DVPA 3SD2A 4ZMAT 5DHYA 5BO1H 4PPTA 3ZDWA 2ARJA 4ECNA 4I48B 2GIYA 3OB0K 3P11L 4IOSD 4NJ9L 4XR8C 5F7DB 2VDPL 3MSPA 4WU7A 1QBLL 4J1UB 5BZWA 2XWJB 1WDAA 5H94B 5C2BL 5JORB 1XXFC 1MWAB 3E3QC 1HOEA 2XFXB 4AITA 2GYSA 2Z8WC 1FH2A 4N8UA 3ARPA 4LDLB 2HLFD 2XG4B 2MSPA 4HIXL 3QPXH 4OZ4B 2CXKA 4PWGA 3OLDA 3P73B 4PJDB 3SKNA 5EUOE 1JPFA 3EBIA 5FGSA 3WHXA 2OMYA 3CFIC 3G04A 2X1PA 3T0AA 4JQVA 4BA0A 2GUOA 2AXGA 2W88A 3ARGC 5H4ZA 5HHME 3ZQXA 5DMYA 4JKMA 1MWAH 3TBVB 3KLQA 4AH2B 2P5WA 2XZZA 3MC0A 4PGEA 2C3WA 2YUZA 4HFUL 2QTEA 4NEHB 4RISH 2BSEA 1C8QA 3QG7L 4FQ2L 2FIKA 3G6DH 3GPSA 4W9IC 3QDMD 1QRNA 4HWZB 4YSOA 5AKVA 4N2LA 3VRJB 4XX1G 3IMBA 5E8EB 5LLIC 1N0LA 2ZWZA 5I30L 2QZ5A 4UTAH 1J8HD 1GYCA 3IJEB 4ELMF 1L7TH 4GW5B 2XU9A 1QNIA 2GJJA 4RRPG 3CUPB 3S96B 2A77L 4FNTA 2O6CA 3UTPE 3B43A 2EXSA 2D9QB 4GRMA 4FN0A 4LPXA 1EBAA 4W93A 5C0BE 4C56D 1R34A 4F20A 4DGVL 1HINL 1KN4L 3FO2A 2JV6A 1T03H 4YHOH 4ZMXA 3X3GH 1OSZA 3FO0H 2NW2A 1CD1A 3L3OA 5D7KE 2DWEA 4N3UA 3T4AC 4Y4KB 2FX9H 1KJVA 1NA8A 3OC5A 4JFDA 2V7NA 3LRSA 4B9IA 4YDLB 4LSPH 2XTLA 3OHXC 7TAAA 1INDH 1QEWA 5J57B 1WRFA 2XV0A 3HG1D 4I9XA 1FYTB 2DM7A 3PWPE 4R7NA 1YMHA 1IRAY 3RAJL 4HBCL 2R7EA 3HMXL 3WUWA 2CXGA 4OSUL 3VO0A 4HAGA 3G7TA 2XN9A 4G6JH 1TQTA 5C0CD 1PKQB 2VZVA 2HVKB 4K71B 4P2RE 4NKDB 4DPCX 5HYQB 4W68A 3T3ME 3GXFA 3QC5X 3G5ZA 1T83C 1NGQL 1X5IA 3IU4L 4B0MM 2P9RA 4WW1B 3GMNA 2ESVB 4S0HA 5F3BA 2R0KH 4EI0A 3T0WA 4JZJA 4KQ3H 1BYPA 5AVYB 1XL6A 4AVKA 1GZHC 4KHTL 1EDQA 2LU4A 1PG7H 1SYVB 3RHWF 2EECA 3AS2A 4R2GC 1KCRL 4JJ5B 1M7DA 4ZAKC 3QZMA 1RZIB 3TFKC 5IWLA 1MCLA 1SJXA 3QIWB 4JJOA 4OI9A 3V55A 3X17A 4PRDB 4A37A 3G08A 4C54A 1A6VL 1KZYA 5LQBL 3BPCA 4YIQA 1NUGA 3ECBB 1RZKL 4QHKJ 4PRPB 4CC4C 5G2NA 4R4NC 4YHLH 1S9YA 4KK9C 1MFAL 2UZIL 3ROLB 5EO1B 3WJMA 2R0WL 3HAEG 4I3SL 1E4XL 4S1QL 4DP8X 4ZTOL 2YD5A 3ULVF 3AXLB 2HFFA 2C1OB 3RU8H 3WG7B 2X4RB 5JLZB 3PY9A 1PX8A 5AW7B 2FGWH 1FGVH 4HUVA 2ADIA 1K72A 2BRRH 2VGLM 3B5HA 3CHRA 4QRPD 1P5VA 5IR1B 2XTJE 4WV1B 2XBTA 1EZLA 2IAAC 3G9VA 3QI9A 3VWKD 1G9MC 3MUY1 2SEBA 3CN1A 1E27A 3NACH 2Q2LA 5DR5L 3QUXA 1W0VA 1ITBB 1XCQB 1OSYA 3P0VL 3V6BR 3MREA 3WN5A 2VZTA 3ZTNH 4WEBH 3RGVD 2EYRB 2LHAA 4OV5B 4BHUI 2WXIA 2PPFA 4KQ4L 1XAKA 3Q8AA 4MD4B 4Y1AB 3QCVL 4IDJL 1KXHA 3LZRA 4KHXL 1ETJA 5CZVL 1RU9H 4ONHB 4AL8H 4X5QA 3WAJA 1UH4A 4FCHA 3PYCA 3FN0H 3OKKA 2AEPL 4J5VA 2K70A 1S5IH 2AJUH 3C6LA 4QEGA 3RYMA 3ZR6A 1JNNL 3CLFH 5DD1L 5L6YL 1RUKH 4MCZB 4U1SA 3U30B 4YHMH 5T3ZH 5AOZA 4XOAA 4J3BA 3UJIH 1JMZA 1EERB 1UA7A 4O4YH 4OQTL 4K07A 2G3XA 3FS9A 3A67L 1SJVA 1L6ZA 3VI3E 4Z77B 4XNZB 3IDJA 3NN8A 3FQTA 3QYCA 3VXRE 1QW9A 4HHGA 5CJOL 1T20B 4NJAL 2EUZA 3RWCA 1R3IH 2VXVL 4KBPA 4A1RA 3QA3A 3LKRB 3OWRA 4EXPX 4KFMA 2CIKA 5BRQA 5SV3A 4DP0X 4AZ8B 5BNXD 1SPDA 4WUUB 2X2UA 1JPTL 1U41A 1V7NH 5T1KB 5J9PA 1J87A 2NXYC 2W95A 1HDMB 3BWUC 2CHDA 4JHAL 5IW3A 4KTDH 3SDCA 4QUOA 4AXWA 4MNGA 4XCCL 1NMBH 2O5XH 1ZTXL 4XNUH 5IJDC 3T3PE 5IKCA 3WDHA 2GY7B 3UAJD 3HG5A 1LK2B 3NDYE 5E1HB 5HHOE 1MREH 4YX2L 3DSNB 3SKJL 5D2LA 5T1LD 5D7KD 5IBUG 3E8UL 2K45A 2XA3A 4NAQA 1I8AA 3DK0A 2Y0SA 1TMCB 2APSA 2J72A 2R23A 2F6AA 3QEQE 2IDCA 1DJIA 1IC5H 1B2YA 3PWPD 4OFYA 1PLAA 1TNMA 2Y36H 2R9HD 1MQKH 1RURL 3GMMB 4G8AC 1VACA 4UWQB 2OMVB 4XMZA 4NWUL 3Q8CA 4OLUL 4P2RD 1JNLL 2G3MA 2V7HB 4EI5B 1IO4C 1QRKA 2P5EA 2DLHA 1F11A 5ICZB 2PCPB 3NA9L 5K9OA 4I4WA 4NNPH 4X9YA 3MOQA 1QLEB 3R8BB 1RJCA 2M8XA 3H4FA 5HVWA 2NZ9C 4GG6E 3KL0A 3EADA 1WIOA 3MI6A 2BVPA 1AGEA 3GM0A 4HSQA 1HJCA 3FB8B 4JKWA 4MXWH 1RJYB 3HUJB 4OKVB 3O0RH 4Z7UE 3ARFC 4BFEA 1NIBA 1FN4A 2BVQA 2MQ3A 3P3RA 4J6RL 5EORL 4NNYA 4UB0L 3VJ6A 3WIAA 3WFDL 2J8UE 3PFUA 2FX8H 2IWGA 2KL6A 2O4EA 3WN6A 1RUMH 4O58H 4JM2B 5TTRA 1BXUA 3EJZD 3CXDH 4FHKA 3H42L 3KPSE 4H25A 1FZJA 1OPOA 4IEFA 4LHQB 3SKOB 3DUSA 5AG9A 3KNBA 3OKLA 1OK0A 3V0VA 2OMUA 1F4YL 2ARJQ 3DNKA 5GGTA 3ZDZE 1CGVA 3RVVC 2DQ6A 1JTTA 1MHEA 2Q3XA 2AK4B 1GHFH 3FT3B 4AZUA 2UXFA 1DZ0A 3AG2B 3A4AA 2V2XB 4GQRA 1TUPA 3ULSB 1QBMH 3BH8B 1MCCA 3NCXA 4I2XE 5K93A 1FL6B 4C47A 5KJ4A 5EN2A 4U1LA 2Y25A 2MEJB 4E9SA 5C7XL 1TCRB 1SMDA 3G6JF 1MVUB 4N2FA 4RGNE 3DURA 1U3HA 3SDAD 1SXCA 2AAVA 1HNGA 2BHFA 3CVHB 2XTJD 4BFBD 3E6HA 1FNEB 1Z9MA 4IIQA 1HAWA 4OU3A 1MJJB 4XI5C 3V8CA 3K4AA 1SLWA 1O7VA 3U0PB 3S35X 1IAMA 4DUWA 1JZ3A 1L9QA 4FFWC 1P7QA 1JYXA 4R5VA 4Y4FB 3T6QC 3NSXA 1XIWC 3GI9H 1KACB 4ES8A 2AJ3B 2YGPA 2EVHA 3VGAC 3CTTA 2YAFA 3CVHH 4GLRI 2ADGA 4Y5XC 3MLYH 3ULUF 4X9FA 3WNLA 4BE5A 2NY1D 2W0FB 1QTYT 4BQ9A 1J8SA 1DQML 2VJ8A 4F24A 4BHUA 3JV4B 4N2DA 4UT9L 2J4WL 1OY3B 1BFVL 2J21A 3QFJE 4MZ2A 4JVUA 4M1GL 4X0NA 5JUEL 3RWFA 3WO3B 4R97C 3OKDA 3WLWD 1TVHA 2HG0A 3O3AB 4GB9A 5JOPD 1U8CA 1ZS2A 5CJ8A 5AUMA 2EEAA 1KSRA 2OL3A 5HD8D 4FF9A 3L4YA 4XRCA 4NLAA 1X4ZA 3FK3A 4I18B 5E6ID 2XG5A 4G42A 3VXRD 4HQQL 5DD0L 1WVZA 3G5WA 1R6VA 2NY2D 1JPEA 5GRUL 4C56A 5F0LB 1WEJH 1CTNA 1AHKA 1X5YA 2DZEA 1BZDA 3HE6C 4NNXB 4MMZA 5DQDL 3O45B 1IJNA 4AG4L 3VFNA 1N10A 2VDOL 2ZYSA 3NZ8A 5G4OA 5J13C 4L9DA 4XXCC 1E5CA 1T4KA 4FX5A 3UYPB 3TF7C 1NGZA 2DQFB 1G9ML 2R2HB 4OT1L 3P30H 4WFEE 5D5MA 3ZX1A 1XH3B 1TQCC 4NOFA 2F53E 5KVEE 1M2VA 2JCCE 2F8IA 2DD8H 5HHOD 2QHRL 4K2UL 4BSVA 2D7QA 1S7SA 1OAUH 1YPZE 4FTVA 3DX9A 5TE4L 5CSZB 5J56B 2FSDA 3IDNB 2IDQA 4MXVF 4QRTA 5ESQA 1QLRA 2AJSL 1YEIL 3GXUB 2RJMA 2HFTA 3O8XB 5FHAL 3QJFA 2PP7A 4ABUA 5ES4B 2ZOKB 1Z5LA 1CGUA 3QEQD 4PB0L 4GUOA 1S7WA 1NGWA 2WTRA 4KVNH 4ODHH 1HIML 4TF4A 4L1DA 1WTGT 5DJDA 2C26A 1I3GL 3WEMA 1FNFA 5D4JA 1E8YA 4F7CB 1OCCB 1G0YR 3IPBA 4DW2H 4JANB 4TNWF 1GL4B 3IPFA 1R17A 3IRCA 1PZDA 5DRWB 5GRYA 1D7CA 5LGJB 2JI2A 3IMTA 5KJ7E 5IJVB 4FQ1L 4TMPA 2BP3A 3NT0A 4S0SD 3IGAA 2PR9A 2GHWB 1L9OA 3EGXB 4G7VH 5T1JA 2YO3A 3QXAB 4NQUA 1LMIA 1SZNA 1KJ3H 1WWCA 3WXWH 3MLWH 4Z7IA 2YBRB 2CSPA 3O9WB 1DBBH 1E3FA 2NY3B 3IFLL 3K2UL 1ZLUK 4G7RB 4GRLB 3U4EB 2FL5B 3BUDA 1IT9H 3KPSD 3BP5A 2VXUH 4YH6A 1D6VH 2NY4B 3D48R 3KVDD 7CGTA 4MNHA 5D1ZA 5EUOF 4CW1A 2NY6D 3GHPA 1IGJA 1HH6A 4YZFE 4HSAC 1FWXA 5DK0B 4TKWA 3NTCL 1W72A 5F97E 1UWGL 1MNUL 3HBGA 4POZD 4QRPA 2V5TA 3PAVA 4HWNA 3O2DL 2PO6D 3VA6A 3SGDH 2QV4A 3TV3L 3QUYD 4XNAA 2XWEA 2VITB 3IFOA 5L9DH 1H15A 1Q9KA 4NCC2 3UPRA 2VIRB 4J8RA 5DC2A 1NANH 4G1MA 4XGZB 3UDWC 5GZND 1GH7A 4FP8H 2Q7AA 1I31A 3CDGA 4JFOA 2RAMA 3L2NA 3VXSB 1RJLA 4RGND 3BQUA 3KH4A 4OF6A 3RGVA 1BYOA 2EDBA 4RX4A 4WKZA 1A6WH 3A23A 4QO1A 3CIQA 3OJDB 4RMVA 1S7QB 3FTZA 4ZX6A 4LLQA 5EUOA 1JK8B 1X9LA 4M7KL 1X4XA 2EEBA 1KCBA 2DI7A 5J11B 1NLDL 2BSRB 5JW4M 1I4FB 1QFWL 1GY2A 3V52L 2HJLB 3V4UH 4FYTA 2R4RL 2VZSA 3LKOB 5EH1A 1T04B 3KHQA 2DQDL 3GPEA 2IQ9L 2AVFA 4GW4B 1A1OB 2X9ZA 3BCDA 3ROOA 6PCYA 4KXDA 1A4CA 2DQIL 5F8QC 2HB0A 2MKWA 2RR3A 4TUKH 5FGCE 1NIFA 1Z5HA 5EZJA 3QFJD 5TPWL 1TJGL 1UCBL 2F8OA 3CLWA 3RVTC 3PREA 4F7EA 2LU3A 2G0LA 1J12A 3FQNA 2F9BT 3VTAA 4HGKC 4N9OB 3K5SA 5DQJB 1ML0A 3BD3A 4HKXA 4P23C 4B7IA 1OIOA 1LNUA 4H8WC 4Q4EA 3QUZA 1FRGH 4WO4B 5DJ0A 5IGXL 4D9LL 3LSOA 4L4TB 3WFZA 5D72H 4JY5L 4XCEB 4XNMB 2B8OT 5C0BA 1ES0A 4PVNA 3T3MF 3SGKA 2K3HA 4HV8B 3D06A 5DMGC 5FYKL 3KLHC 3CFJA 4IBVA 1IEAA 3ZE2B 3NJXA 2UYLB 3UAJA 1HEHC 5FO9A 5CHNA 12E8H 2D73A 2EJ1A 2NYYD 3QORD 4IRSD 5LNEA 4G3YH 2CDFB 2IFFH 3IE4A 3HTLX 1LYQA 5K1VA 1MCBA 4MB5A 3E1ZA 4RZKA 2DQGH 4F2MB 2Y06H 4WFED 1MCEA 5E8OB 2F53D 2DQMA 1MNNA 5DTFA 4GMTL 3E1F1 3PWPA 2EC8A 5DD5H 1HQ4B 1GRWA 4PJCB 3A4DA 2APFA 4I5BA 3BRGC 1NKGA 1YN6A 4ZMNA 2G60L 2VUKA 1OSPH 1AHWC 2M2DA 4K94H 1DBJL 4XT1C 4GRWB 1OP5K 2DYPB 5FV1L 4P2RA 4YE4L 3UBXB 5IUCA 4XCYB 4L1HA 3KL3A 1MLBA 2XV6B 1OXYA 3OL2A 1IU1A 3O6FC 5JQ6L 1YNLL 5A2KH 1X5LA 4QKXB 5DSCB 4YDVB 3ES6B 2A83B 4IU3A 2WN2A 5AZ2H 1A7PL 1JHLH 5BVPL 3HS0B 4FXLA 4IGBD 3ESOA 5BRZB 1CR9L 4TUOB 2J8HA 1TTGA 1QR1A 5DC9B 1HNYA 4E5XA 1CFVH 4GRWH 4XX1E 4R90H 2NW3A 3OR6B 3PG2A 3V6FB 2HKFH 1GXEA 1P2CB 3ZRCC 3O3BB 2XZAH 3OSVA 2OW6A 3OAYH 4KV5E 3L1GA 4ORGB 1KPVA 5F9WB 3REWA 5C9KA 3ARDD 3NCBB 1KGWA 1R3JB 4PCSA 2BPBA 3AMLA 1JVKA 1PLGL 1FYHB 2IBGA 3HLAB 1B6DA 3QPKA 3U7WH 3H9ZA 2X89D 3AABA 4Y89A 3M7OA 5I1CH 1BAWA 4KXCA 3HMXA 4F7MB 2C3XA 1H5BC 2H2SC 3PDGA 4UAOB 5C8JB 4LLYB 2R1XA 3CDYA 2FJGA 2TRYA 3K5RA 3DLQR 3P4NA 4QPEA 4UQCA 2YARA 3GHBH 3EGSA 4O2FA 2QQQA 3WFHA 4NFCA 3L9RB 4Z7VA 4N0CC 5BOJA 3SDAA 3Q6GL 2DKSA 2JQMA 5E2UH 2AJZB 3FJTA 1RERA 3SGJC 1NEZG 1NL0L 2A6KB 2EKSB 2OYLA 1SXSA 1KYUA 4CDHA 4OM1H 2ZONA 2BVUA 1T22A 3OKOA 3FT1A 1WFOA 4IJTA 1UOKA 4GSUA 3INUL 1JJUA 3VXNA 2N59A 3VI3F 3B5GA 3FF7A 3W2DH 2AXWA 4NCDA 4QTHA 1FFOA 2ORBL 1DO6A 2NR6D 1J5CA 3W5NA 2ZOOA 2Y7OA 2YK1L 4B53A 4PBWD 1LO3L 3LMJH 5TDPB 5ACZA 2GSGA 3WTSA 1B0GA 1NDMA 5EDSA 5HYJB 1CE6A 5DURD 1P4LB 3MRGA 5TDNA 2NNFA 4RFOL 3ZTEA 3D18A 4FLRA 4HUKB 4XB7A 3F00A 3BZFA 5LJYH 1KIRB 5CGYD 2HT2C 4TOYH 1A8JH 4PS4L 4LLMA 1YECH 4FCAA 5C0FA 1CGWA 3T3PF 3GWJA 2HFEA 5EOQH 3RNQA 3DX8A 4DJMA 1HN1A 4BFJA 2ICEA 3SCMC 4X6FA 1PYWA 1CDYA 3VI3A 1QSFE 4KXBA 4B3EA 2JKSA 1BQLH 5GQBA 5F89A 1FDLH 3WXVH 3NGBC 3C5ZB 3UTTD 2GPZA 1S8DB 4UU9B 4XNXL 1O0VA 1H8NA 1A9EB 4N2GA 3QJHA 3I50L 2EDTA 4Y2DB 2XV3A 2PYFA 1U8KA 1QQDA 5D96B 3VWJC 4HMEA 4P3WA 5ICUA 1BBDH 4UIMB 3QARA 2XA8L 2Y3NA 2GT9B 1JV5B 3FO9A 5F7HA 5A6IA 3BZEA 2KYIA 2NY7H 5ELIA 2X53A 4Y0GA 1L5GA 3MGTB 1V3KA 2WYHA 3A4FA 5HHOA 2X05A 4GG6F 5DGQA 4FFZL 3TCLB 1J1XH 1I7ZA 1UEYA 1HCZA 1T5WB 4PCKA 3ZKQD 3S97C 1B90A 3T0EB 3P0YH 2BM3A 1X5HA 5IB3A 4E0RB 2I60H 4Z7UF 5A2BA 1B2WH 4GAGH 3UP1A 1X7SA 2JE8A 4N0UE 1K6QL 5SWZE 2PTTA 1AD0B 1CGYA 1CU4L 2E56A 2J8UF 2FQEA 3OPZH 4OQTA 4WENB 2ZKMX 3U36B 3SY0B 4UUJB 3U46A 2OKMA 5CP7A 4CVWA 4NQVB 2WUBL 3N5AA 2R1YA 4JY6B 4XPGL 3RTQC 1SBSL 4HIHA 2ZSVA 3IK2A 3RHWK 3ZIMA 5MI0C 2R29H 4GG8B 3ZDZF 4YXKL 4XVSH 4JEGB 4LPUA 4GT0A 1XGUB 2Y9RT 3RQ3A 3RDJA 4UT7H 4QR7A 5JIMA 5EPMA 4LVOC 4FXGB 2WZPD 1BZ8A 3FT4A 3BAIA 3V6OC 4JDTH 5SWSB 2B08A 1XWVA 4PJIE 1U8QA 4Z7UA 2IOOA 4MD0A 4UYQA 5DJ2A 4EUPA 3L5HA 2FEEI 3AT9A 3HVDA 3VFVA 5IK3B 2BVYA 3ATBA 4O5LL 2J8UA 1S9WB 4LGRB 2AP2A 4FZEH 1YMME 3FSVA 5D1XC 5INDA 3TCTA 3DPBB 3DX1A 1BCIA 3KPSA 3F85A 4PY7A 1JZ6A 3KLSA 4JO3L 2O5NA 2Q7YB 4HPYH 3W39A 2F58L 1ZVSB 2P7TB 3S7GA 3M7FB 5EBMB 1NM9A 1RVFH 1T1WB 1N6UA 4HIJB 4IKNA 2BDNL 5IEKA 1CUOA 3RIAF 2HJKB 3U48A 4JUSA 4JDEA 1XAUA 3ARGA 1BPLB 2Q5BA 3EJTA 2WBXA 1L9MA 2PW2A 3H3PL 3CBRA 1CGTA 3FULA 2HLEB 3L3KA 3IDGB 4FQJH 5AVTB 4M1CC 3ELQA 5GZNA 3G5YB 1D7FA 2UWEB 2X6MA 4KKAD 4XHQA 1CT8B 3LQAC 3SO5A 4KNTA 4Z3JA 2R2BA 2IBZY 2E8YA 4UF7C 2YAPA 5IMOA 3BXNA 4ZYKB 4GXUN 4PYHA 5CKGA 5ADOH 5E1GA 4RNRA 4WDIB 2F2HA 5T3ZE 5I8OH 3MJGX 4PJ8C 2B15A 1KXQE 1GZPB 4NN5C 4PWFA 5K1JA 3O2WH 3M07A 4MA3A 2YOAA 2HLAA 2WNGA 2VLKE 3KPLA 4NC1E 5IQOA 3DI2B 1R9FA 4Y5VC 3IAQA 3KM1A 4XNQA 5F72S 1D9KC 1UM4H 1BQSA 3R4DA 3GC3A 1KLUB 2YBGA 3D4CA 2WC7A 3ML9A 4NM8H 3DGDA 2V37A 4Q6YA 4QRUB 4QY8A 2N01B 4O2EB 1MHPL 4MCYA 2FQDA 3MLSL 4FG2A 2XN2A 4ZTPL 3DGCR 5GSRB 1TENA 2XWRA 3H2PA 3OHXA 2C9SA 4L9LB 1UOWA 1USQA 4KZDL 4Y5YB 3MLTB 2JCCF 2XWBB 2EH8H 1SF5A 3FB5B 4HJJL 1YPZF 5E2JA 1QSFD 1QVOA 1SLXA 2H0FA 3OC8A 3APFA 5GS2D 1A9BA 3WELA 3U6RB 5D6CB 4HZ1A 5E6UB 2I07A 3ILPB 4XMPL 2WLJA 1T83A 2B5IB 2J5LB 1UT9A 2R56H 4BRVA 4BQ6A 3VD7A 2FO4A 1GS6X 2CK0L 5AZEL 4B3VA 1W16A 1XGYL 3NRFA 1ILSA 5DK3A 1U3YA 2FEJA 4KJPC 1LO4L 4XP5L 1GZHA 2H5UA 4N0RA 1J5HA 1JRHI 1JXKA 2F53A 1U8IA 4ZTEA 4L3EE 2VYRE 4P9MH 2Z8RA 3VXTA 5F0PB 2EYSA 1MFDL 2JCCA 4ZAKA 2E7HA 5ABDE 5IM7A 3MYJA 2OTPA 4GEIA 2AGJL 2BIMA 2LABA 3BP6B 4MAYD 5IMLB 4ZOEA 5KWYC 1AGFB 2ERJB 1P9MA 5ICYA 3ETBJ 2E7DA 3FOMB 3MRLA 4KKRA 4XC3L 5CIPB 5I76B 4PLKD 2VE6B 5SWZD 4N8VA 3CVIH 3GBEA 3D9AL 3MA7A 4CC4A 4EEEA 1S7RA 1QTSA 3MRCA 3KYOA 1OD9A 5AL8A 3ARRA 1F1GA 4C4KO 1DVTA 1HYSD 4B7LA 3VXPB 4CC0A 2H32B 3CQPA 3LNDA 1NWOA 5JO5B 5HPMA 2O30A 3GO1L 2E86A 2ENQA 3AXIA 1YYLH 1MPAL 3K72A 4E9LA 5GRZA 3H9HB 5IB1A 4YZFF 4LOVA 2P8PA 4MDIA 2DBLL 2ZUUA 1NLBL 3NCJL 5CIPH 3CN2A 3EJQA 3OSKA 4KRNA 4Y1SA 4YDNA 3ARDA 4AQZA 1UB5A 5D7LB 3KWUA 3C9NA 4FG0A 2HN7B 3L2LA 3EIFA 3L1OH 1IC1A 2X89A 4QMEA 4GXVH 1PG7W 3DVNA 3P9LB 1N6QL 4PRPD 1NC2B 5JHDE 3HG2A 5JW5A 1B9KA 3FUMA 5GS1B 1UUSA 4YZWA 3GXMA 3BUPA 2YLKA 2Z4QA 4TS6A 3MX0B 3SJVB 4NQDE 4EN2A 2V4LA 5TF1L 2RACA 1ZHLB 5GGSB 2F8XC 2Y69B 2B3IA 4CNIB 2YQGA 3ABZA 2BLFA 3K4DA 2WLIB 3CQFA 4PGDB 4FADA 2BSCA 3PXJA 1NOAA 4S1RH 5C0DB 4BA8A 3VI4E 4JVPA 3NFSL 4DVRH 1XD0A 1ZLWK 3KPMB 5JW4R 5GRWA 2Y5TA 5F7UA 3B2MA 2CRIA 4NQCB 1A7RL 1AY1L 4LVHB 4AYID 2IAMB 2A9ML 3EO1A 4QIRA 5DZ9A 2HUHA 3PQYA 4BK5C 2NR6A 3BGFC 3WS6A 4LVNB 2OMXA 3CHQA 3N55A 4GOSA 4D0CB 5CN3A 5T3ZD 2KLSA 4Y1AD 3MV8B 4DQOH 4LLWA 4RSYA 4P23D 2QQNH 4BGDA 2D2OA 2EYTA 2OXHA 4XN5A 4AENA 3MCKA 3MVSA 3TO4D 1TZIA 1FL5A 2VLKD 2C9RA 3CFCH 3SZ6A 1SJHB 4P46C 1DLFH 3CX2A 1R3LA 3EFOA 5FUOH 3STBA 2GBTA 4KGJA 5GHWL 4GNKB 3C87A 3LYRA 2DQJL 1DQJA 4BZ1H 2FZ3A 3W9DB 3S88H 1QSEB 4GSDL 2X3BA 4P0DA 1NQBA 4R6UA 4MCMA 3ATEA 5CZXD 1CLCA 3ZSTA 2DS4A 2IMMA 5D6DC 1KBWA 3AQYA 2JTYA 2YPVH 3TA3D 1ORSA 4OLEA 1RFDH 4RRPM 4NZUH 4UV7L 1E6JH 1XSIA 5F7KC 1JGUH 1X5KA 2XWTB 3PJLA 4M3HA 4OJCA 3LHPL 5AYQA 3RKPA 1P84K 2WAQA 3FFDA 1UGNA 3AREB 5T1KD 3FU7B 3MRMB 3D05A 5FF6A 1XT5A 4UI2A 2VSKB 2WLLB 4S2SB 3FQUB 5E6SB 1Q9LA 1AYOA 4LDOB 1ZDQA 1HNFA 4RGMC 4ZS6C 5GGUB 1FV1A 2H4EA 2NDFA 1MRFH 1FBIH 1AO7B 1G7PB 3L48A 1AR1C 1KCLA 2EDNA 1GGCH 4QYAA 3US0A 5I19H 1NJ9B 1TZHB 3DMMC 1K85A 3S37L 1WLHA 1KY7A 1BWWA 1GS7A 2IQAB 3CFDA 3O6LL 1S5HB 1CFTB 4L3ED 5ESVB 5FB8B 1C5DB 3ARFA 2IWFA 5C97A 2WJ7A 1YEFL 4BV1A 4LLUA 3TN0B 4PJ5A 2A4EA 4KV5F 1EJOH 1IAOB 4F8PA 4HJ0D 3AT0A 2A5UA 3BO8B 1O6TA 3CFNA 3PNWA 2DWTA 4ELDA 1C8PA 2VC2L 1OAQL 4O2CA 2CKBA 4TNWK 1E5YA 4YFLI 4Q6KA 3EHBB 1SM3H 3T1FA 4HJIA 5KSAC 4LEXL 2XWXA 4YE0A 4EIBA 1A47A 3VE0A 1HI6A 3MV7B 1H3PH 1J48A 3FH8A 4LRNL 3QFGA 1M3JA 3RZCC 1LTXA 1I1CA 2PWGA 3KLAB 5HGAB 2WZPA 4HCIA 5AALA 4HK0A 1AKJA 4WWPA 3U9UA 3VXUA 2DJMA 2ZX9A 1A6AA 4CU6A 1EDHA 3M45A 2FECI 1KENH 4KXZH 4OUUB 3S34L 3VXME 1HE7A 2DICA 3LX9A 4K4KA 2E9GA 2VXSH 4D8PB 2BFGA 4RRPA 3Q01A 1A4BA 1CD8A 1KFAH 5TQ0H 4QHUB 4MB1A 2JJUA 1KNOB 1CFSB 1Y7VA 1MG3C 2DV6A 4GMSH 4LSTH 3PHSA 3ME0A 1Z2KA 3FHQA 2QSCH 1XF2B 3M17A 3CHXA 1PZ5B 2ZP8A 4NN7C 4XMKH 2IOMA 1I1AC 1AGCA 4Y19B 1ZCRA 5TK4A 1JFQL 3BT0A 1RIHL 3ZUCA 2MHAB 5JHDD 1MAKA 1XIWA 4RMTA 4XPTL 5IG7B 1CICD 1E9QB 2WYZA 5AAMC 4NQDD 2Q1EA 1U95B 1S2EA 3ZE0E 2ADFH 5C0JA 1BD2A 4FQQB 3KBEA 1MH5A 3JTSB 4TLKA 2M26A 5TK2A 3T8MA 4MHHG 2A1WL 3HRZB 4P5TC 1I1FA 1RUQL 1WS8A 4MMXA 1VGEH 1BPVA 4X7FC 4M8QA 4OGAC 4H0HB 2YD2A 1IBYA 1T3FB 4N2IA 4X6CB 4X7DC 4OD1L 2DTML 2DY2A 4QRRE 1KJ2L 3FB6B 1G7MA 3VA2C 4W70A 3L3IB 5DLMH 4WK2B 3BAJA 2B7DT 4IOIA 1HEJC 2DIAA 3KPPA 2ZOLB 3HE6A 1DDHB 3APNA 4HJEA 1HZHL 5T1DL 5JPNB 2WWOA 5HDBE 2HRGA 5ERWA 1FA4A 4ENZA 1FF5A 3OQ3B 2BS8A 3TJEH 5FLUA 1U30A 4ZUUB 1V54B 1UWEH 4CMMB 3OZKA 3DPDA 4DWHA 2OMZA 5E0FA 3BIKA 3BSZL 1IBDA 4Z18A 4QWWC 4MS8D 2PW1A 4FQXD 4JFUA 2UXTA 3K2MC 1CLVA 5IW1B 4YO0B 1BOYA 3LRHA 1QSFA 4Q58C 3VG9B 5GGSY 1P6FA 2WNWA 3TIDB 4GKSA 3IJYA 1G6RA 1HSAA 1KN2L 1UH2A 5I1LB 3SQBB 1I7UB 4WI4A 1PEZA 2VKWA 4FI8A 4XCNB 2H26B 2DKMA 3HAEA 3ZDYF 4HOWA 4N90D 3EJJX 1MQ8A 4TSCH 4HAFA 1S46A 3T2PA 4IKLA 3BPOC 1SQMA 1JD7A 1U8MA 2OFQA 3V4LA 4MQXD 3N40F 5LG6A 3RFZB 1ECZA 5J5EA 2D7OA 2P24A 1U8HA 3IDIB 4BYHA 4RAVA 1VLXA 2H3NA 4OD3H 3K6SB 4ZSOE 1CXHA 2GK2A 3TXAA 5E2VH 2BMKA 3EYUL