1D7BA

Cytochrome domain of cellobiose dehydrogenase, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
b'ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7bA00
1D7CA 1D7DA 4QI3A 1D7BA 1PL3A
chains in the Genus database with same CATH superfamily
2EXTA 3BMWA 5JW5B 5TGBB 1DFXA 1RPKA 1FZMB 3F7YB 4M1CD 3EDKA 5D1QB 2AK4D 3V4VA 3K2UH 4ZSOE 5E8DH 3GBEA 5DQJB 2NOYA 4J7RA 1X9RA 1KACB 2FIKA 1PZBA 2OPCA 3BP4A 3DURB 4OAWB 3BKYH 5EZOH 4QHLA 3ARDA 3UERA 4HOWA 2NLJB 3JV6B 4WEUD 1AR1B 3VE0A 1BVKA 2CXKA 3KPTA 4A55A 4DKEL 3ZDZE 5KBMA 3BVWA 1CXKA 4TVPH 2EVJA 3MJGX 4QGYA 4TNFA 3VD3A 3QR0A 1A6AA 4CGUB 5I1AA 1E5ZA 2R0WL 5IVXA 4P46D 2DMBA 5DJ6B 3TO4B 4EN3C 1JZ3A 4JFYB 1Z5LB 1BJ1J 2I07B 1INEL 1E27A 1VEOA 3MV9B 3GSXB 5DD1H 1SHMA 4KK8C 4PWGA 3T08A 5D6CB 4X6DF 3C5ZD 2CO4A 1PEZA 2ZSWB 1INDL 2DIEA 4XMPH 4HCIA 3RWCA 4FQPA 1H6EA 2ZF8A 3C75A 4L8BA 3TA3C 1J7VR 4A68A 1UOKA 3UFIA 3EF7A 2AS5M 1RH8A 3P77B 1ZRUA 1BGXH 4G6FD 5B8CA 1YAIA 1RJZA 2P48B 3KPRA 2ATKA 1ZK5A 2WXJA 5HHVL 1VKXA 2VGLM 2JK5A 3LNHA 3BISA 5DUML 3LIZL 3GI9L 2VSMB 4CC4C 3QUYD 4HD5A 3K81A 2NUTA 1FFRA 2IDQA 3NA4A 4XO5A 1PKQB 2WYHA 3K8LA 2WBJB 3UIYA 1HHGA 3FFCA 3OB0K 3ULVC 1IBFA 1O9VA 5FUZL 1IC4H 3UAEA 4HD9A 2IGLA 3DIFA 4Z0BH 3KLLA 1OGSA 4ODVL 5ADPL 4JJ5A 2YAFA 5EO1B 2CCLA 3LXUX 1B0GA 1F56A 4GEJA 4N3TA 2XXMB 1FQ9C 5MP6H 4B97A 1BZQK 2PF6A 2MPVA 3KYOB 4FA8A 5J6HB 4HUWB 3WI9A 2VDRB 3UL4A 4KRPC 1UWYA 2ODHA 4N2CA 4R7NB 4E42A 4PG2A 1KBKA 2HP4A 3FQXA 3BYYA 2E8ZA 3Q5OA 4RGMC 2DQIL 5CLWA 1MWAL 1U95A 5BRQA 1LVEA 4BZ1L 1FP5A 3I9GL 4XE5B 3T09A 3TU6A 3WUWB 1HZHL 5HPMB 4V1DB 4MQXC 1DN2A 1FORH 2QHLA 1JWMB 2P8PA 2MTAA 1IEBA 2J1ZA 3B3BA 3SBRA 3DTDA 1R0AL 2RQEA 1C5BL 3GIVA 4NWUH 4HQQH 3S36L 3SKNB 5IHZB 3TJEL 5EO0A 5HDBB 3QJHB 4X6FB 1G87A 3FUJA 1JPST 3ILPA 4K7PL 3NK4A 1AGCB 1IM9A 1OPGL 4N1CA 3VFUB 4ALAC 1T80A 4Z7OF 5EFIA 5DWUL 3CIAA 4WCYL 4B9PA 1JPFB 1XSKA 2R7EA 4HS6B 1A02N 4CVZA 1RPQA 4QHPA 5JYMA 5JIDA 4RISL 2A77L 5KAQF 2EH8L 2DMKA 2LR4A 4B7LA 2FWSA 1FYHB 4OZHE 1ND0B 1Y1UA 5E08L 4GSUA 4K8RD 5EA0L 2W0FA 2DAVA 2IDTA 3M88A 1I1AA 4XP9L 3ATAA 1NJ9B 4AGNA 2RA1A 2YUXA 1JGUL 1JK8A 2DM7A 5I82A 4HSCX 3NCJH 4FN0A 3UJJH 4B27A 4NFDA 3WFCL 3GKZA 4ZXBB 5C0CA 3PQYE 1P4IL 3FOLB 4XN5A 4XMTA 3FFDA 1DUZA 4U05A 5JOFA 4JY6A 3IDXH 1CC3A 1AY1H 1J8HD 3P30L 3PAVA 3QUZB 2BVPA 3ZJAA 2HUHA 4Q6KA 5F7EH 4YWGH 1BFVH 4NRXA 3IFNH 4H0HB 4OF3A 5ICZA 1KZYA 3WO4C 1KXVA 4MKTA 1T5KA 2BNRD 2ZKWA 3VH8G 4UM8B 2YPLD 2JKLA 1FC1A 1LDPL 1FYTB 3GEFA 3U6XS 3CU1A 4O2CA 1TVHA 5AWNH 5HGHB 1RV6X 2FBOJ 5AOJA 1MHCB 5IKCA 1M7DB 4XVTH 4BHUA 3UP6A 3ME0A 5C0AD 1JF6A 3QAZC 5EUOB 3FT2B 2FH8A 2ZUQC 3BKCH 5BZZA 1UM6L 4X6CE 2C1PA 3NCEB 2AVGA 1WA2X 4F7MB 3WKYA 3AABA 1R4XA 1WZ1H 4L3CB 1UC6A 1OD9A 5IV2A 2FO4A 4Q9RH 4DZ8B 3PWPB 4MJIE 3GSUA 1Z0MA 1NCWL 3VYNA 5I8OL 1CE1H 2F74A 3Q3GA 4YHPA 4LPWA 4XCYB 5F89A 3QCUL 2DWSA 4MA8L 4XP5L 2Z8VC 1U93A 4PJFB 2WAHA 4FP8L 1YCSA 3IKKA 4MJJA 1NDMB 2GBTA 3LVTA 4JZNA 4UIKH 5IMMB 4XVSH 2BK8A 3CG8A 1GC1H 5ICUA 1UKQA 2A74A 4G8FB 4PJCF 4ELKA 3VCLB 5K9OB 4ENZA 1JGDB 3J07A 1RUQH 4KROB 5E9DB 3C2AL 3JV5A 2F7IA 4AX3A 2WJ7A 3GRWH 3MHZA 4LCUA 2GTWB 3V8CA 3SPJA 4UMSA 1OLZA 5JXAL 1UFUA 3ARRA 1TFPA 3CSPA 5DQ9A 1FZJA 1U8NB 2UYLA 4FHBD 2QZ5A 4L29A 5AQ0A 4Z3IA 1A4KB 2AZUA 1WT5C 5LBVA 2D3JA 3R0MA 2F8VA 3RAJL 2GFBB 1DBKL 4DN4H 3EGXA 1OP3K 2V33A 3S3JA 2AEQL 4RETB 4EI5C 4IBVA 1E6JL 2XFGB 5AB0A 2Y9RT 1XL4A 3HG0A 3LS5L 5AAWA 4POYA 4H40A 1MUJA 5I8CA 5LCVA 1DP0A 1XR9B 4JN1L 1N5AA 1P6AB 2B0SH 3PJSA 5KJ7E 2PETA 2DMCA 3OG6B 3ZQXA 2FDBP 5J1AA 3DETC 1ZHKA 5E8EA 4OSUL 1TDQA 4UOQA 3VSVA 1WWBX 1JWUB 3U1QA 2VJ8A 4LHUA 1K5NB 4YSDA 3WJMA 5BS0E 3D33A 4IGBB 2CHWA 1CYWA 3TJHC 4S0HA 4CUCA 1EGJA 4FXTA 2Q76B 4GXVH 4QRBA 2J88H 2D7NA 3B9KA 4G6JL 3TEYA 3GPEA 3OKOB 3H9SD 3SJVE 2ICWI 4H88L 3OGCA 2BDNL 1LDSA 2H6OA 2UZPA 3TZVD 5FCSH 3QDGD 4DP6X 4PJ9D 3SBWC 4QWWC 4XXWA 1H3XA 1RZQA 4PJ8B 5L2KD 4XODA 4FA6A 4YSAA 3PP3H 1EZVX 2QKIC 4YDMA 4E41B 1S5IL 4QTHB 3I75A 1XCWA 3M17B 1EJOH 4LDEB 5I5IA 2DQUL 2C34A 3CHSA 3T8MA 1J9SA 3PHOA 3FYEB 3RE0A 5DRWB 1I4FB 2DWYA 4JCMA 3UH8A 2J3SA 5EEVA 3CE1A 3TIDB 4IMKA 2OX5A 3Q6GH 2Z1KA 2YD8A 2XZQL 2P8MB 1OXYA 1XGPB 4XC3H 4R4FH 1T21A 1U6AL 1IBGH 5IWLC 4NAJA 4YIQA 3TYFA 4BZYA 1DVTA 1HHKA 2Y22A 3EFFA 3JWOC 3FN0L 1P4UA 2OJEB 1JHLH 3F12B 3MUHL 3IJ9A 1SEBA 3FQNA 1ZHLA 4JFPA 5LGHH 3VG9B 2R69L 5EMYA 3RZCA 4ZX3A 1ZVHA 2BP5M 4BH8B 3IN2A 5E99L 3S4SB 4I1RA 4QYOB 1C1EL 1DBJH 1FVDB 2VUKA 5FO9A 3M86A 4F7KA 3BEVB 4HIXH 5L0QB 1SY6L 2ZAIA 3OX8B 5DI8A 4WJ5A 1NMBL 4YHZH 1G5GA 4FADA 2V2XB 2QR0B 2RB8A 2PXYC 3DBSA 1FFPB 3ATEA 3JVFC 4N8CL 2Y2WA 1BMGA 1P4BL 1JGVH 4MD5A 1X7TA 5JLZA 4NUJB 1IGJB 2CK2A 5C3TA 4FDWA 3KD4A 4MS8C 4KH9A 2Y5TB 4OLZH 1MFAH 2X6BA 4RVBA 2ITDB 4JHWH 5EOTA 3BZ5A 1N9PA 4PWEA 4X4XA 3MLYH 4KZ0A 1GGUA 1MJJB 5SWSE 3L54A 1BHGA 4GMSL 3ARWA 3P2TA 4MBRA 2VZTA 1UM5L 4EUPA 5I9QB 2JH2A 5DFTA 2ZUVA 4D2NA 4JG0H 4PWKA 1RK7A 4F20A 4POZC 4IS6B 3UG3A 2PTTA 3X1FA 4PJ6A 4XAKD 2R0KL 4WU7A 3BSZA 4LL1A 1PD0A 4PB0H 5I1GL 4JFDD 4PB9H 1BM3L 1IGIL 4LLVB 1G84A 1B4TA 2XTJC 2WUBL 1CGSL 3IF1A 1PG7W 4JFQA 1TKWA 4G72B 1KIRA 3L6FB 2N0MA 3HZMA 3G5YB 3L48A 3HZYA 4XC1L 1BVOA 2I5YH 4WO0A 3I84A 5AYUL 3RURA 2FLBT 3L3GA 3D85A 1P7HL 1CZ8H 4HXAL 3IETA 3U46A 1XCQA 4K5PA 4JPKH 3KLHD 4Y1TA 3O3DB 1YC7A 4U6VL 3TBBA 2O93L 3HNTL 5KBKA 4NGHH 4WEBH 2R4RH 1A7PL 5EBWA 5HYIA 1MNUL 5FWRA 2XN9E 4YVUA 3NN8A 2XPZA 5DK2B 2GJ6A 4C47A 4PQXA 5KSUB 2OMXB 2VR3A 5ALCL 4DVRL 3MRGB 4L37B 3MUGA 2D7TL 2D7PA 2WAQA 3FB6B 2P47B 1PLAA 3ZHLA 4RA0C 1UXSA 1YNTA 4G1MB 4QAWA 5EZJB 4WF7A 3L16A 1WISA 5K9JL 2ZYRA 4I4WA 4Q2ZA 5MEQB 4MHHG 1SJHA 2JQAA 3GDBA 5C6PB 5I1DB 3GYRA 3CN4A 1T7ZA 4HUVA 1JAEA 4PJIF 4JREB 1EVTC 3O4LA 4M8RA 4NZUL 4Q74A 4Y19B 5LN8A 3CSYB 3IPFA 2AC0A 2DQ6A 2FTAA 2B2XH 1I75A 4GQ9H 3U2SA 3QS2A 2WP3O 1GSMA 4MXQC 3VWJD 1L0PA 3BO8B 3PDGA 1XFPA 2FX8L 1QSEE 3FCTB 2ZXQA 4Y7OC 4PJAB 3K1DA 1KTKE 5TH2A 5EN2B 3TF7C 1J5CA 1MJUH 1Z5YD 3AWFA 1HH6B 1S7UA 4W4OA 5DRXA 3RWDB 4AENB 1QBLH 1M3JA 4HT1L 1YEIH 2AF2A 1UWFA 3TIEA 2WLIA 2CM5A 4F93B 1I8LA 5EDXA 3WLWD 4HUMB 1PBYA 3T77A 4R0LB 4DETA 1JPEA 2BY2A 3KS0J 4KZDL 1IAII 1L7IH 2QSCH 5TDOB 5AW5B 4ZD3H 5IOKA 5GHWH 2VLKB 3F6JA 2YD5A 5JA9A 4LVOB 2XV6B 1W0VB 2G2RA 3S96A 3BVVA 1QWHA 3GSVB 3IJEA 2W9DH 4X6DA 5KN5A 1MIMH 3FPXA 2YGPA 5D4HA 1MW0A 2OTUB 2X1XR 4OD1H 4DP5X 2HRPL 3SO5A 1TT6A 3F5WA 2W07B 4O02B 3K6IA 4ZO6A 4N9GA 4AQ1A 4YSTA 2X41A 1D7DA 2FT6A 2WV3A 3PCYA 2A6KB 4HKXB 5LNGA 1RJYA 1SHSA 5FDYA 1AMXA 3BDYH 5KG9B 3S3SA 2Z7WA 2A9AA 3OAZH 4NQXB 2DTMH 3CVHB 4XWGL 2XOTA 5D7IE 3GJFA 2YC1B 3HPLA 5IQ9A 2OV0A 4HBQA 3WTTA 3P9LA 4AT6B 4DNLA 5IGXL 2I9LA 3I3DA 2I69A 4IJ3C 4KKLD 2VE6A 1LYQA 3UTZA 1F8TH 4WHYG 3K2MC 3VXRE 3W81A 1HEHC 3LZLA 4U6XA 4N0UA 4ZX5A 2YD7A 1OO2A 4OCYH 3GSRA 4X6BA 3WNKA 1LO2L 1N8OE 1M4KA 1G7PB 4I0PB 2HWZL 1DJYA 3KLSA 4KTDH 4MMYB 1SEQH 4QRQA 5KYUB 2QMKA 4NO0D 1IGML 2DEWX 2VXSH 2HPOA 3SGEH 1WC7B 3ROOA 4KITB 4HV8B 3QZBA 4A6YH 1EEYB 3RJQB 4OGXL 3FQTB 4EI0A 3Q8AA 4P59H 3ZE2B 1T03L 2WD0A 1MFCH 2P80A 4H5SB 4LSPL 5DFVD 3LNDA 4CVXB 2OR9H 4LASL 4YSUA 5DMIH 5GS0L 2GC4C 1GZPB 4JG1H 5CLTA 4OCXL 3B5TA 4GKSB 5EB9A 5LGJA 3DPBA 1QWNA 3NRFA 2B1AL 3LKOA 1OM9A 1KBGH 3IYLW 5CCKL 4QD2E 4M03A 3ARFB 2TSAA 2OSXA 1U3HA 3BZ4B 4L4TB 4WGVB 3EAKA 5HJBA 1F02I 4KTGA 3ZDYB 3ZKXC 4UU9A 5LQBL 1CD1B 4WWKB 2QV2A 4UT9H 2BOBA 3D9AH 2EE9A 5TD4A 3S2CA 3BXNA 5KVFH 5C92A 5L9DL 5CJ5A 3P4OA 2P7TA 4XXCA 2H2SC 5IF0A 2YAQA 4J5VA 4ZZKA 4LIQH 5E00B 1RZ8A 2D7MA 4PY8J 3ZZSA 1R9FA 1F58L 2I9TA 1UD8A 3QHZL 5I1EH 3BQUC 4F33A 1IT9L 1KJMA 4FEMA 4YEEA 3TOPA 4Q6YA 5DJYB 1KLFA 4FI8A 3EYUL 1CFQA 4UF7C 2YAEA 3THMH 1E4KA 5L8LB 4BCYA 4QRPD 3LAFA 5CWSA 2CUMA 2NY3D 4IBQA 2GPZA 2JB5L 2TAAA 1BFOB 1DJIA 4FABL 3ALWA 2WXQA 1A9BA 3C8DA 3N5AA 4U1IA 3D69B 1TU2A 3L9RA 2VL4A 1U8KB 1QRNA 5FGRA 1NLBL 1L9RA 3NJFA 2EDDA 4KPHH 3RDTB 3ERXA 1VFAB 2B4CH 2WWKT 1UOWA 3U48A 3BH9A 3D18A 4U1LA 1B4LA 5C0BD 1KWKA 1ONQA 4UNIA 1IFHL 4MFHA 4WO4B 4X5XA 4HEMA 2MCAA 4YQXL 4F9LC 3P9MB 3MUZ1 3DMMB 3G5VA 1QFUH 2ENSA 2Y24A 4O4YH 3LKNA 4Y16B 43C9B 2MRYA 4XP4H 4PGCB 3Q05A 1LILA 1IIKA 4DESA 3FBQA 3FU5A 1QFOA 1O5PA 2XWXA 1JXKA 5JHLA 4BQ6A 2XBTA 2BVOB 3PHAA 4HJ0C 1ZGLB 4YHIB 3PWNB 5EOCL 3ZQ9A 4R8WL 5MHSE 2IMMA 2AEPH 2D3NA 1D7BA 4KHTL 1UXWB 1IIIA 3QUML 1FFNB 3O3BA 3CFCH 3CHXA 4Z7NE 3TBSA 1Q9KB 3PHQA 3S3PA 1QEXA 4YDJB 1ZDSA 4FGMA 4DP0X 3NESA 2PCFB 1Q9LB 1XSOA 1J8KA 5DURD 1C5CL 2P5WD 2FSEA 4KI1A 4F27A 3MBEC 3O6FB 3MCLL 5E1AB 4GUCA 2BVEA 1SN5A 5D1ZD 5AAMA 5JPMB 3MLUH 3X1BA 1SFDA 2CLVA 1P7QD 2XVKA 2HLFD 2FT7A 4PJCA 4I3RL 4JO2L 1GGIL 4AE0A 4F24A 2BNQE 2P45B 4LBEA 1G9NL 1H3VA 2IDCA 3G6JF 3NZUA 4TQHA 3I6KB 5FO7A 5E6UB 1AAJA 1CF1A 4NP4L 1R46A 3LHPL 1YRKA 2G3ZA 2V8MA 3ARYA 2XA3A 3NSJA 5IBUG 1F4YL 2HTKD 3A6BL 3TCLA 1JRHL 1JTOA 5EC2A 3PU7A 3U1SH 2ROYA 5LNDA 2XQYA 3V0WH 5C0FB 3E2HC 4OQTL 3OZKA 2QQKH 5GISL 3VXSD 1OTUD 2ZSVB 4LLQA 3OSVA 2CUAA 2VRAA 1CGVA 2DIJA 3KWVA 3MCG1 3HI6H 1T83C 1G6RL 2Z35A 4RMRA 4OGAD 1D5RA 2PPCA 3QDME 2A83A 3VD9A 1TQBB 3HG2A 3RVUD 4TYUA 1GW0A 3T3MF 1E9PB 3DXAD 1AFVH 1KNOB 4TNWK 2QQLL 1KENH 3X13B 1QUPA 2X4RB 4UTCA 3FU3A 5C3IA 2CALA 3VRJB 3MRDA 5HHOA 1JYXA 3SOTA 5KJ4A 2ESVD 4UUJA 1X5MA 3FQUB 1UG9A 5FB8B 3LIUA 3SDXE 3RWIB 4EE2A 2H1LM 4JG5A 2IEPA 2BCKB 3U36B 2KPWA 2DKMA 4AIZB 4UNTA 3F7LA 2E4TA 4MAZA 2PYFB 3BE1L 3J8F7 2NXYC 2H9GA 5INCB 1UJ3C 3SQBA 4MJ4A 2VXVL 3VXUA 3SY6A 1G7MB 1OGPA 4WTXA 1JG9A 1W8OA 1F4XL 4OJYA 4P2CG 4XCCL 5JMOC 4WHYH 1NBYB 4W9DC 1J9RA 5CN1A 5J56B 1J8RA 1A14H 2W80C 5GGRA 4R7DB 5E6ZA 2DN7A 1VERA 1QSVA 4WWID 5D7JA 5H37G 5JQ6L 1JZ4A 4D9LH 3LTVA 3Q8EA 4NM4H 2NTFB 4LSUH 1KXQE 4X99A 5DQDH 4GG8B 1HIMH 5A2JH 1KB5L 5CJXA 3PGDB 1MLCA 4DVBB 1WFMA 4CRPA 1BXAA 3ABZA 3ZW3A 1W9XA 1KMGA 1RZGA 1L5GB 3X11B 1PZUB 2VDKH 3QXDB 5B39B 1AS6A 5I6XB 5E6SB 5EORL 1WEJL 5CO1A 2WJ5A 3MRRA 1S8DB 2WWNA 3NSCA 1UXLA 4XPHH 3CFQA 5GZNA 3ZOAA 5HHQB 2VDMH 3ZX1A 4GUPA 2NDGA 5I1IL 3HHRB 2Z6FA 2NXZC 3N85H 2CKBH 2HLAA 2V3DA 1O6TA 2CGRL 4QRFA 1GAFH 4BUQA 4WFHD 4Z3GA 4J6IA 4FZEL 1M1XA 1AKJA 2NNAA 4Y9FA 1PG7L 1RUMH 4JAMB 4LCWD 3QIBD 3MREA 1L9MA 1ZGLP 2GT9B 1D9KA 1A5FL 5F0PB 4LSVH 1IAKA 4I89A 3KE0A 1A6UH 2LU3A 2XFXA 2Y2TA 3MNVB 1J5IA 1N3NA 5F7UA 3KPSA 4KKPA 3ZIYA 4F1SA 2FT8A 1MNNA 4U1JB 2X4SB 3IXTB 2LAGB 3MNMA 3K2UL 1B9KA 4TV3A 1GW6A 2Z31A 4RGNB 3ESNA 1BFSA 2YFNA 1LP9F 3GLAA 4TNGA 4WY7H 5E8DL 3HS0A 3WS3B 3WNNA 3CFIC 4FC3E 1WWWX 3DX9B 4JRYA 1Z9LA 3DV4A 1J48A 3BKYL 3HE7B 3BUYB 4QOKE 5EZOL 1H8SA 4YLBA 3LNGA 3V9CA 1BZDA 1BA9A 1Z9OA 4XMVA 4PR5B 4LDLB 4RFNC 2DLIA 5AZUA 3ABMB 4WI9A 1WBYB 1T7VA 3TM6A 3MKKA 4RBPK 1BXVA 5ALBH 2YR3A 3SCMA 2YQBA 2K3HA 1CFSB 3ZLQC 1ETA1 3U7YH 2ITFA 1SYSA 1P5VA 1TTRA 4K8RH 4N8VB 4U31A 5CGYC 2ICWA 1FNFA 2Y25A 1WZKA 5T1LA 5CHNB 3FUIA 2VR7A 2XZCH 5DD1L 4PLKD 4AIXA 4Y4HC 1B2WL 2A4CA 4H1LB 3L4VA 2DTSA 4M8UA 5DZNA 1OGAA 2HA1A 3QHFL 4PRAA 2OTWA 3AACA 4NZTH 4X7TB 4Z7WB 2ETWA 4KK9C 1SUHA 3LPOA 2BM3A 2EIEA 4XPGH 4XBPB 1UYWH 1XGTA 3GSNA 3CHRA 1DSFH 4BZ2H 1D6EA 4LNRB 3BPNB 2BXZA 1G9EA 2DQCH 3EJSA 1HH9B 3ARGB 5HYSB 1SMAA 1X7QB 4I87A 4M4PA 4GAAA 1J88A 4LAJH 5J5EA 3AG4B 1EXUA 4ZMNA 2AQ1A 3GXUB 4AUYA 4A2DA 3LZPA 1M7IB 1AIZA 1CLYH 2FB4H 2VRKA 3DX7B 4YHKL 1G7HA 1UEMA 2HT3C 3PREA 4X5QA 1VDGA 4ONOA 4I2XB 1IC4L 2EUWA 4PYGA 3AS0A 1DVFA 4Z0BL 4PJIA 3S97C 1FO0B 1NL0L 1NANH 1T7XA 4BSJA 1FCCA 1AQKL 2WB7A 2WGNB 3QZWA 4RX4D 4Y88A 5CZKA 3CLEL 3N41F 3R1GL 5IVZB 2DH3A 5MP6L 1A3LH 2EDKA 2HRHA 2FNBA 5IB5A 1BJ1H 5F7LB 5GIRA 4KUCD 1U91B 3NFPB 2Q8BH 32C2A 4FFVD 4J3OD 2C9AA 5FECA 4D0BA 1Q1PA 3B83A 3N04A 1RK1B 3BVNB 4Q8BA 5F6HJ 2NY1C 4AMWA 1T1ZA 1MRFH 4PS4L 1F3JB 1D5IH 5DLML 1U3JA 3L3HB 3IS1X 3O9WA 2E74C 4D0DB 2EDBA 3PXLA 3SDYL 1UENA 3UZQB 4L4TE 4M48L 1FORL 2J44A 2EICA 4JO3H 4NKOB 1RUAL 1EAPB 2XXFA 4ODTH 3AXLA 4XNQB 4MQ7B 4F7TB 3T3PB 4YJZL 1HILA 3P54A 4JZOB 2WQVA 3KYMA 3AAZB 3GMNB 1D6VH 4KXBA 2XWBB 4NWUL 5DS2A 6CGTA 3BPCA 3IDUA 3ILQD 2NY5H 3C5SA 5F3BB 4KXZH 1AYRA 4RSYA 4JHBA 3K6SB 1E7VA 1QSFB 1QZNA 2AK4B 4LGSB 4TN9A 3WEMA 5GZOD 1B9ZA 1DQJB 1TZIB 4KY1H 3VXQB 1RCYA 2IXQB 1OW0C 3OB8A 1MH5B 2H7WA 4TUOA 5GS2D 5EF3A 2VB5A 1OB1B 2XWCA 3HZKA 4GKZA 5EPMA 4D0CA 3NP4A 1F3DJ 1UOLA 1XIWA 2FL5A 4NKDA 1RJLA 3FFCD 4ZMLA 3UPAA 1TQSA 3EO9H 1IILE 3WE6A 4LL9A 4PSPA 5I6OA 4OZFH 4L5FH 1EUTA 3ASWA 3X1GA 3E1ZA 1Y6NR 3JSSA 2X3CA 4E9WA 4MNGE 1E90A 2YD3A 3PYCA 4P2AA 4TLSA 4FMFA 3OKYA 4OIAA 4MDIB 3UJJL 4MXVF 3VI3B 2AJZB 1D5BB 3MOAH 4MD0A 4NN6B 4AKOA 3RUGE 2VKWA 4F2MB 3C5ZB 3BGMA 1JN6B 3IDXL 5H37H 4JGJA 4M6AA 4ZFZB 1AY1L 2CA4A 1OQOA 1AIFA 3FMGH 3KM2A 1JHTB 3EG9A 1HCZA 1BFVL 1EEUA 4YWGL 5HYJE 1OHZA 3IFNL 2ATPA 3LB6D 2WXMA 1FGNL 5D2NB 2NX5A 3EFOB 1EZSA 3HBZA 3QJFA 1QA9A 4N0YH 4XB7A 5I71C 5CLZA 4G6FB 5FYKU 3NYKA 1XGYL 1FJ1A 2CGYA 4FNSA 4OM0H 2ZKYA 5HTSA 5AW9B 3WAKA 2XIBA 3OLIA 3QFJA 4WFGE 3TA3A 2KZ1B 4GG6E 4I9WD 1WBZB 1YYLH 5AWNL 1EZUA 2V2WB 1O5DT 1SJEA 2HG5B 4UT6H 4XVTL 1H5BB 5IEHB 1MELA 2AXHA 4GSDH 1ZSDB 5K69A 3BKCL 1XAKA 1VADA 1ZANL 5M94B 5E5MB 4X98B 2GIYA 1CICD 4ELMF 5BRZB 4PBVC 1WZ1L 1ORSA 4Q6IC 4QRRD 4PWIA 3KJ4B 1LE9B 4Z23A 3MBXH 4G7RB 1K2DA 4YBQC 3HMXA 1ZLWH 4AJVA 1YEFH 4HF5H 4Q9RL 1OARH 3Q1EA 4CILA 1NGYB 2VDMB 3CMGA 4LARH 1CE1L 3WN5B 3PDDA 3IDJB 4Q9BA 4BUHA 3G04A 4LEOB 2BIOA 1I1AD 1I1FA 1JZ5A 3LEXA 3RGVC 4NNYA 4UWQB 3WDIA 4TNWF 4UIKL 4IOIB 4XVSL 1OPOA 3CHOA 5F6IC 1CS6A 1E3FA 4ZTEA 4UV4H 6TAAA 1CIDA 2WZ5A 2HJKB 2FQFA 2EEBA 1NINA 1T1XA 1WFJA 4F7CA 3OKNA 4I1PA 2Y36H 1I85A 3DGGB 4G6KL 4MCZB 4IYKA 4JJHA 4NSKA 1O7SA 2V4LA 3UTPE 5CEZD 3GRWL 5CIPA 5J9PA 3ASNB 3IFPA 2X4QB 1TO5A 3NCCB 3V6OE 1WYJA 3C6LA 3SY0B 3PV6A 4OQ1A 1MCPH 5CZXC 2LLGA 4FAAB 5KYWB 1S9VB 4B9GA 2V37A 2W65B 5DS1A 5HJDA 2RALA 1EO5A 4GO9A 1QEWB 4WSGA 4P2QA 4DN4L 2R2BA 5SX4H 3RX8A 1SHXA 3PE9A 4PMEA 3MLSH 5KSBF 1CVSC 2AJXH 1GL4B 5I8EB 3GZOA 2B0SL 4U2ZA 5E4EC 3BT2H 3FZUD 1DUYA 3HLAA 3U0WH 4H0LC 2GEEA 3N06B 3O8XA 5LJYH 5FA4A 1D5MA 4OF5A 2VIRB 3IJSA 5KYYA 2VRQA 2O6EA 3OKKA 1CLCA 3C9NB 5FKAB 2BVTA 1W8NA 1T6VN 3MOBH 5DD6A 1A1MB 3OAYH 4PJHE 2OJZH 4F15B 4OCLC 4PUBH 2WQ8A 3IDMB 4Z76B 2PPAA 2I24N 2FJGA 4GXVL 1UGKA 2J88L 1RSYA 1ED3A 2V6HA 1BOGB 4UQAA 4XTRD 2XA8H 5ADOH 1J8HB 5DRZA 4XVUC 1J5OH 1PL3A 5J3HC 4K71B 4ETYA 2X89A 1UQSB 4UZUA 1YO4A 1JHKH 4HUXB 3ISWA 2HUEA 4MWFB 2AV7A 3QPQC 3WY1A 3TWYA 2EDRA 2HAZA 4PVLA 1WFOA 4L8CA 1F4HA 5EF2A 1U4EA 2FUQA 2GC7C 3AFLA 5DHVB 3PWUB 2YPLB 1PCSA 2FWOB 2XV0A 3U2IA 4WENB 3G6JA 1F00I 1J0HA 3PL6D 4FFWD 3Q6GL 3P4MA 4G42B 4CVUA 1NAMA 4PMFA 4TQIA 2Z0UA 2W0LA 3WFHA 1IBGL 2XWTA 3VVVA 2R29A 3BZEB 4QCIA 2XJKA 4C83A 2PO6C 3GXFA 4R4BA 3CFJB 2CIIB 4M7ZB 4PG9A 4PJEE 1JHLL 3L4YA 3RWGA 4GLRI 2AXFB 5DEGB 4G82A 4KNUA 5LGHL 1P9MA 1G0YR 2R8SH 2FJSA 4JLRA 3D3VE 5BUPA 1TNMA 2F61A 1JGEB 1YEDA 4JE4B 4LHUD 3ZE1B 1TFHA 3BPLC 4L1LA 4NEHB 1U42A 4XGZB 4HK3N 5TE4H 4ZQTA 1VACB 3VU1A 4BEIA 2FJHA 4GBXD 1D7CA 2FECL 1DBJL 3BKMH 1KGCD 4FTVA 2VQ1B 3QJZA 1SQMA 4JR9H 1TMQA 3B9KD 3AB0B 3B1UA 1P5UB 2QQQA 1B6DA 1HDMB 1WA1X 3MLTB 1DBAH 4Y5XA 4UTAL 2DLEA 2C7UB 1ZPUA 1JGVL 4C4BA 5LN4A 5KVFE 4MYWB 2UWEF 2YXMA 1BF2A 1XH3A 3IU3B 3QQ3A 4MDJB 3TC9A 4OLZL 2YEZB 4JHWL 3GTNA 3IDYB 5D55A 4HAFA 4LIQE 4RMQA 2X1OA 4OY9A 2J8HA 1Q90A 3MLYL 3FSAA 3LQAH 2JKXA 2IGTA 5FUOH 3BSGA 5K1NA 3EYSH 4UYQA 1JL8A 2ARWA 2EYSA 3E1F1 4GS7C 1IVLA 4HIIB 4IU2A 1T89A 3HJEA 5E8PB 3N0PB 2YQGA 4MX7B 4HK0A 4HLZG 3RWEB 1WT5A 4FQQB 4GIOA 5CJ8A 4D9RD 5LBSH 3M6DA 4PB0L 4OZFB 3WN6A 1ACCA 1NCHA 4PB9L 4UDTB 4ZFQA 1V8HA 2WN2A 1MVUB 4MMZC 2PYEA 4QJ4B 5I75C 3NSYA 1CMOA 3GM8A 5JW4M 2J6EA 2EUZA 4G9FA 2IPKB 3L4WA 1NPJA 2V8LA 3HBGA 4YL9A 3RZCD 4YVNA 4Z7WE 1G0XA 3QQDB 5E6IA 3VSTA 4E5XG 3TEZA 1MFNA 1A47A 2I5YL 3D4YA 1XXFC 2R2HA 2EEDA 2GJJA 3BH8A 5D2LA 2BW4A 3H9SB 1CZ8L 4K3JL 1MREL 3UABA 4DT2A 3N55A 4JPKL 3TZVB 1YMHB 3CVIH 3QDGB 4JFSA 1MQ8A 4NGHL 4WEBL 1MXGA 2R4RL 4YUEL 2EDFA 3II3A 3MFFB 2BVUA 1R3KB 1WITA 3TEXA 2WQXA 3V9FA 1KG0B 3KPPA 3ARTA 3CZKA 5AW8B 1F11B 5BXFB 1NKGA 2AQNA 4L3EE 3AC0A 4Z7AA 4QRTA 4ABWA 4DGYH 2NW3A 4U33A 3QQ9D 2RFXA 1RZIA 3DK2A 3T1FA 4XO3A 2CBTA 1W80A 2WWKO 3QG6B 4FFZH 2DRUA 2GG1A 1MCBA 5F44A 4APQB 3K6OA 4XZUB 4B7IA 2C5DC 4HP5A 2GK2A 4NHCL 4WEEA 1LP9A 2B2XL 2AXGA 4GQ9L 2OMVA 2WANA 1V7MH 4JPSA 5ICXA 5AVRB 4YO0A 3JZ7A 1S9YB 4K23H 3CN2A 3UYRH 1IO4C 4XZ4A 5IWLA 1YEEH 3L2NA 4P99A 4YGVB 3V95A 3MPCA 2HFEA 2P49B 2V7NA 4D94A 2QTVA 1MJUL 3BP7B 1N4XH 2PPEA 1QBLL 1T04B 4HC1H 1MCJA 1ZT7A 1XGRB 4KJWD 1YEIL 4QHMA 4Y4KA 2PW1A 1FSKB 4ZQKA 3UBXI 2ZD0A 1XEUA 4ZMZA 3GZQA 3BUPA 1AGDA 3T3PE 1MFUA 2WTOA 1NQBA 3VMNA 1TETH 1I3GH 2QLVB 1AR2A 3BP6B 4HIPA 1L7IL 3EYOB 2FVNA 5A16B 1QTYT 4XXDA 4ZD3L 3KXFD 5GHWL 4A2EA 4N2AA 3MRHB 2YRPA 1KPRA 2EIBA 5JPNC 3RVXC 2AK4E 2W38A 2W9DL 1MIML 1I3UA 4TF4A 3V9EA 5C07A 4OD1L 4GRWE 1S78D 2PXYA 2OBGA 5DC4B 4BFEA 4RWYL 5KOVC 2H1PH 2CO6A 2VZ1A 5JXEC 4UQIM 1FLTX 3EZ8A 3QO0A 4JDEB 3S35H 3BDYL 4O51B 4PD4J 4R7VA 4IOFD 4XNAA 3ZL4L 2JE8A 3OKDB 2CJTA 3NIFF 2DQEH 3H53A 4YPGA 2COQA 3QXAB 5JW4Q 3EJTA 1OCWL 1VFMA 1PAZA 3Q5TA 4NQVA 4JFDB 3QEHB 4OVUA 1KIPB 3V55A 3WFBH 5IJVA 3VXMB 1F8TL 3VI3E 4ZNEA 1IBHA 4MTMA 1UT1A 3B34A 4AM0B 5FYKE 5L8KB 5EEWA 4QF1A 4HPHA 1PDKB 2NY0B 3QIWC 4FQ1H 3RY6C 3X12B 5I0XA 5C9KA 5I0ZA 4MMXC 1GGYA 3FH5A 4EBQH 5HBBA 4JM2C 1F1GA 1WTGT 2IDSA 5JW3H 3S34L 2O72A 1JYVA 4WI0B 4LCYA 5I1HL 3V4UL 1M71A 3MJ6A 5DT1H 3KS0H 5FKPB 3L3JA 3IJHA 3MGTA 1J1OH 5CJQL 2BWQA 3MRIA 2V5MA 1PVHA 4LF3A 4F8TA 5EU6A 4A6YL 2BMKA 3LQZB 5D5MF 1SOSA 5DHXB 4JM0A 3Q06A 3H1ZA 1OAYH 4P59L 1A7NH 1MFCL 5E8NB 2F54D 1PNDA 3GHPA 5ENWB 1NFDF 1DN0B 5GSVA 1OK0A 2OR9L 5DMIL 5BVPH 5IUCA 1QO3B 2H4EA 4KGLA 1G94A 4JG1L 5JDSB 3GSWB 1KBBA 2B08A 2FEEL 4GNKB 2ZOWA 3NBNA 1RK0A 2ZG1A 1BP3B 2E4FA 5BZDA 3GUTA 3HCVB 1NBQA 2BHFA 3AQXA 4XN8A 2GI7A 3KM1A 4J8RA 4TLTA 4BFIA 5CUSH 1VF5C 4RRPA 5JHDB 1WZMA 1FWXA 3UEQA 3V0EA 4KGJA 1CDUA 2WXPA 2J8UA 5KVFL 3EH4B 2UXGA 5EBGA 1CFTA 5FXCH 1MCNA 4I0KA 2J1YA 3VWJB 2HB0A 5J13B 2Y6SD 4M3HA 3GXMA 2NY4C 2R1WB 4WW2B 3OHXB 3E8UH 3QEQD 1R3JA 1PYWA 1P69B 3CH1B 3MRFA 3EOBB 3GBMH 3VFMB 1F1DA 5I1EL 1JZ2A 4G8GA 4WU5B 1VZGA 4HH9B 4DUXA 1ZPLA 4YDLC 5IB4A 3F3HA 3EH2A 2G2NA 2P44B 2F5AH 3FRUB 1J0IA 3THML 1I3RB 5M7QA 4WTQA 4Z3HA 3MV8A 1FG2B 4WI8A 3ZKNC 1TZGH 1IAIH 4WKZB 1SUJA 1R5VA 2BSTB 2PN5A 4NQEA 4PRIA 1NLDH 2ZKHH 1D5XA 4UNUA 3UACA 4X7SH 5GS0C 5HHNA 1EEZA 4W9FC 4HHGA 4PV8B 2QSTA 3AXHA 3DRQA 4GXUM 3ETTA 1AOHA 3QPKA 4JKKA 3CHPA 1EHAA 1Y6MR 4FQ2L 1QLFB 2K4AA 5AKTA 5TE7H 2GTZA 4FEIA 4KKBD 4L3FA 1IGYB 4FCAA 1QFUL 3SKOA 4JN2A 4O4YL 5HI3D 3LPGA 1U3HD 1UCBH 2BSSA 4HFWB 4K3HA 2WLMA 4XP4L 1BQ5A 1T0MA 3APMA 4P3WA 5DUBB 2MCMA 4D3CL 1QR4A 5ANHA 1P4LA 3ZY7A 3DVIA 3O3EB 1XO8A 2EDTA 1EUUA 1AD0A 4XBEH 5J4MA 4X5WA 4ZTPH 1JNHA 2AEPL 4P5KB 4W9EC 3IK2A 4DPRA 4ELMA 2ZXWB 2L7JA 3EOAB 5LUMA 5EBMB 2OR8A 4LCIH 4WI3A 2EXYD 4MZ3A 4NO0B 1JPSL 4G83A 2KH2B 2OSLA 4BKLA 2BNRE 1W72H 4C59B 3SD2A 5KVMC 3Q01A 2VZOA 3CZUB 3Q2LA 2SEBB 3TO4C 1XSIA 2HTLC 3MLUL 1KTDB 2L4OA 3HHSB 3DDGA 4MJ5B 1BVLA 1MJ7H 5ERWB 1HL5A 5C0AE 1FFOA 2VUOA 1QRND 5BQ7B 3QC5X 1EO7A 4OZ4A 1S9WB 4RCAA 1F5WA 5CNHA 1I7ZB 4MLIA 5FIEA 4UBDD 1QHPA 3NIGF 2WOBA 5F7MC 4CMHC 1A65A 4EIZC 5ID1A 4UILH 3U1SL 3UTTA 1BVNT 4Y9BA 1Z66A 1G7LA 3J27A 3UCRA 3EYQD 1XF4A 2FJUB 2MQCA 4JRLA 2HFGH 1A6TA 3AITA 3HI6L 4JDTH 4LVEA 4Q52A 5DZPA 3CH8A 5FYJD 4ODUB 1NC4A 2C7FA 2BVQA 5KSBA 2CDGA 3ZUNC 4Q14A 2WBJC 1AFVL 1KENL 3MRMB 1M6OB 5F7DA 4MJHA 2CBPA 2OMTA 4JFXB 3FHAA 4Y89A 4BA8A 5GGTH 5IZ7A 3RX9A 2J56A 2EKJA 3Q8BA 2AERT 4P06A 1C16A 4Y4FA 4PY7A 4D8OA 4QYAA 1KEGH 2NY3B 1NFIA 1JV2A 5F3FA 2P5EA 2YD9A 1XF2B 3AJ7A 2F7PA 4GRLA 3M7FB 2Y0SA 3SPVA 5FYKL 3FT4A 4NCDA 3STZB 1G9NC 2XY2A 3BVDB 5JUEL 4M5TA 2O61B 3JTTB 2UXVA 3UC0H 1E5CA 2BH0A 4KO7A 2LU5A 4WNQB 4N5UA 1JNNH 1NWOA 2CH8A 3ARUA 4GW1B 2F1AA 4KVCH 5C0BB 4KHXH 4DEWA 5J57B 3DBXB 5E1IA 1IMHC 4L5FE 1A14L 1I82A 1RZJC 2G9HA 3GXDA 5KYNA 1X6LA 3T0EE 1RFDH 4D9LL 2RAMA 4NM4L 1WAPA 4BELD 4P3DA 4OBRA 3NJKA 3KPMB 4LSUL 5DQDL 2YPVA 1XCTB 1HIML 3Q6FA 3AG3B 4M8QA 4NFCA 1FF5A 4YBHA 3U0PB 2BIIA 4GQPH 4ZMQA 2VDKL 1OAQH 3C60C 4JKLA 4FQLH 4OBSA 3H9SE 3F7KA 3VFNA 1WGVA 3IVKA 4DGIH 3AU1A 3QDGE 4HKZB 4ZW5A 3RQ3A 4XPHL 1BECA 3RFZB 4HPYH 3OPUA 1KPUA 2VDML 5EN3A 5L2KE 3OJMB 1OP4A 5I1LB 3OKLB 2YPKA 5DURB 2X6CA 2P5WB 4RZKA 4Q97A 2BOCA 3N85L 2CKBL 3T2PA 5D1ZB 3KNBB 3QWOA 4F1ZA 4ZXBC 4J3OH 1LO4H 4JO4H 2JJWA 3BUDA 3DO3A 1P7QB 5AZEH 4NBYB 3L1GA 5E56A 1BD2A 3MN8A 3GNMH 2ZX6A 1RUML 5H4ZA 1XZ0B 4G80B 3ZDZF 3QUZC 2R56L 3HAEA 3MBEA 3NCBB 1YLBB 1OTSD 2CLZA 1M1SA 1I1RA 4LSVL 4XPTH 3VXUD 3MBWA 2QHRL 4F58H 3WEAA 2UWEA 5L4JA 3L5WB 3FTZA 3FUEA 4OLVL 3B8YA 2DWEB 2OZ4H 4HJSA 4AWJC 1OAKH 2DD8H 4B9CA 4QMEA 2FZ3B 2X0UA 1YSOA 3K0YA 3VXSB 1YC8A 5D7JD 4M5YH 4WY7L 5IEKA 3P1VA 3DJSA 1Q94A 1YNKH 4AXWB 4H8WH 4KZCA 4IEFB 2XBDA 3GLEA 3U7WH 1HXYA 5GS2H 1KB9J 4LT7A 3DXAB 2X4OA 1LMKA 2BZ7A 4ZUTB 3SDAC 4WVRA 4NKMB 1DJXA 4ZPTB 1T83A 1F4WH 4HHAB 4ADGA 1KYOJ 2WXHA 2AQQA 2A6DA 3HE6B 3U7YL 3IGAB 1QI3A 4MVBC 4CBZA 3DROA 4K8RL 4XP6L 2BC4B 5DDHA 1I7UB 2WO2B 2X6UA 4JRXE 5AVZB 2XZCL 3QDJA 5GZND 4MBOA 4E9LA 4KO5A 1ZLVH 1LM8V 4DAGH 1T6WA 2ARJA 1AO7D 4PHXA 4QXWA 1LGVA 3G08B 4YZFE 2C9QA 1AGBB 1UVQA 5FYLD 1KCSH 4XN7A 5D1XD 2E7HA 4XPGL 5F7YC 2QQNH 1OE2A 1AKJD 4RIRA 4BZ2L 1NIFA 1MCEA 5LAXA 3FU9A 1E40A 2DDQL 4N5EC 4XAKE 2DQCL 3DUUA 4XRCA 5A7BA 1EZLA 1UJ3A 3V6BR 5J7CC 2FRGP 2NYKA 3Q8FA 4JFDE 4RNRB 1KCKA 1ZDQA 6PCYA 3SKUD 2J57A 3T8VA 1KCLA 2P26A 2VXTH 2C3VA 4K7FB 1OSPH 2FB4L 4XBGA 1SYVB 2W1NA 2VH5H 2ICEC 4R5XA 4G8EB 4MAYC 4XHJC 5AW0B 1CDGA 1HHIB 4HAGA 2YA1A 3FCSB 3P3TA 3FB7B 3NCXA 1TXKA 4JRYD 4IRSD 3HS9A 1ACYL 2OS7A 4IKNA 3VMPA 1JMXA 1IL1B 2AQ2A 1UZ8A 4GP5B 2J73A 3WEOA 3FU7B 1FPTH 3EZJB 2JB6A 4G3YH 1W72B 3SCMD 3DVGB 1IKOP 3DDFA 4MNHB 5A7EA 3ZHDA 3N40P 2LFEA 2Q8BL 1DO6A 1T0NB 1IVTA 4IGBC 4JDVB 2ADIB 5I74C 2WMPB 1DQMH 4BSVB 1MRFL 1X5ZA 3T0VA 3HUJF 1D5IL 3MRNB 3T4AB 1T2JA 1ODAA 4G8IB 3LOWA 1IZKA 1T1WA 4OZHF 3UDWC 1OGAD 2OMYA 3DC0A 4JO3L 4LCWB 4ODTL 4XBMA 2CJUL 2CMRH 4NZ8A 2VZUA 1GJUA 4JHAH 2IANE 2Z1PA 1KCUL 4KKAC 3VWKA 1K6QH 1IC5H 4FQXA 3SKMA 5CEZH 3WIHA 1D6VL 3LH9A 3QI9C 4PJ8C 5IJCC 1MFEL 4NIYE 2OXHA 2MOQA 4F3FA 1ZT4A 3IMVA 2X5PA 3OMIB 1UA6H 1TENA 2DYSB 3L3OB 3ZIMA 3AWGA 1S7TA 5FF6B 4C56D 4KY1L 5K39B 1AZCA 2UZIH 2DJMA 2Z7YA 2G0LA 1TR7A 1VB9A 1UB5A 5B1KA 3QWRA 4QHUA 1JI2A 5FK9B 2JKNA 2WB1A 4J3UA 4CMMA 5IB3B 3EGDA 1EFQA 4L5FL 3MRQB 5F97E 5HDRA 3WJJC 2IVFC 2W5PA 1K4CB 4QPEA 1YEJH 3BWAB 3RILA 2X6VA 3WIIH 3F7VA 3VG9C 1G4RA 4JPIA 1W6WA 1CL7H 2ORBH 1QMUA 1XQ4A 3Q48A 1OANA 5CS7A 3MOAL 1T20B 4X6CF 5E8OA 3B7SA 4PGBA 3SDCC 4ZS7L 4ZFOL 3OKMA 5A3ID 3WV0A 3V5HA 1IFGA 1NGQH 2PW2A 4X50A 3QQ4A 2UZYA 4L8DB 3O9WD 1MHEA 2WY3B 4FKEA 5HHMD 3EJYD 4YL4A 5D5MA 1NCDH 1WUZA 2E7CA 4H20L 3OL2A 2X4TB 4MNQB 4PBDA 2EKSB 1ZXQA 1JUFB 3EJZC 4OM0L 1NFDA 5C8JB 1U8LB 3KHOA 2AZAA 2EDHA 2ALAA 3EGSA 3PNWA 4MA7L 3KCWA 1C12A 1YYLL 2IALB 4UT6L 1DQDL 3SGJA 1OLLA 2AEIT 4GSDL 2QZQA 1E4XH 1KIUA 3FOMB 3NOIA 4AQ8A 4MXWH 4A2HA 1F3DH 3QORC 2H32A 5I9QC 1LE5A 3P40A 4JFWA 2FIKB 1XGUA 4TQEH 3BP4B 5D4QA 1UJTA 3L7EB 3KDPB 3RVWD 4KJQD 4QHLB 3L3KA 3EBIA 1YEFL 1XIWD 1BVKB 1H0DA 2XG4A 1OARL 3QJUB 4HF5L 1TEGA 3VE0B 4M8VA 3UBXA 1IAIM 3G5XA 1ACXA 2P24A 4Z7UE 2F7OA 3RNKA 1XZWA 2VDNH 2WVTA 3AUVA 1NOLA 1V3MA 1VFOA 2KERA 5D7EA 3ZDWA 2N59A 3VD7A 2NYYC 2VN5A 3RX5A 1J0ZA 3W0WA 1A6AB 4DQAA 2ZCHH 4RWHA 4Q9CA 5I1AB 2EC9T 5T5NF 2AQSA 2FLRT 4JKPH 5TQ2L 3QIUD 3GRBA 3ZSTA 4UV4L 5AYQA 5BOZG 1MFVA 1P1ZA 1E27B 3F64A 1KXTA 2F58H 2OCFD 2XX0A 3SE8L 5B4MC 1EGJH 3MI6A 2EVHA 3CHQA 4F91B 2Z64C 3VFRA 3RWCB 2XKSA 1G5AA 2N1KA 3STBA 1CO1A 2VJ0A 4L8BB 4KJPC 1I8MA 2VR6A 4F9PC 2X40A 4JW3A 3QZNA 1MCKA 3VG0H 1DVUA 4OIIH 2FATH 2E7LC 2C3WA 5B8CB 2Y7QA 5D96B 3B5HA 4AVHA 3KPRB 5DZLA 3QFJD 3Q2WA 4HUCA 3L3IA 1IGCH 4M6NH 5TK2A 1VKXB 2JK5B 1BZEA 5D4IA 3I6GA 3MLSL 4S1RH 5DJDA 2QMJA 2ENQA 2NUTB 4NLHA 3SE4C 4DPBX 4WNSA 1LQSR 3L2LA 3BT2L 3QUGA 1C08A 4WDIA 3U0WL 2EDJA 2FYYA 2VR9A 3LIZA 5ANME 1HHGB 3FFCB 5T3ZD 2YAPA 4QRPE 5DJ2A 3EKCA 3U9WA 1HCFX 4MLSA 4OTXH 3DIFB 1EO8H 3FTUA 4L2YA 3OAUH 2DJSA 1OAZH 4TTDD 1SXCA 5DMGD 2PR4H 4JJ5B 3WY4A 2I26N 1B0GB 1PY9A 2OJZL 1FVEA 1KJ2L 1Y0LA 3CZNA 4PUBL 5MEPA 1QATA 1EQWA 1IKFH 4R3SA 3KPQA 1GC1C 5IFJA 4ZMOA 5C7ZA 5C0BE 4E42B 3HPJA 1J5OL 3FQXB 3VFTA 4B41A 1KTBA 3C8HA 1C7TA 1S9KC 1U95B 4N86A 4KKCC 4KK5D 4Y7MA 4YHLH 4AZ8B 2QEJA 2GCYA 4IDLA 3N42B 1MWAA 2BFGA 2P8PB 4XX1G 3SSGA 4BZ1A 3C6LD 2YK1H 1ASOA 1ROCA 3G9AB 4JFVA 1LWHA 4UYPA 1Q8MA 2B77A 5ESQA 3UTQA 5LDSA 3GIVB 3FN3A 1B88A 1C9SA 1OHQA 3WFDH 3TN0C 5F8RC 4AV4A 3AS2A 5EO0B 4N1EA 5FAAA 5GGUA 3ILPB 4P2QD 3QH3A 3EHBC 1IM9B 3LDBB 4LLWA 3UAJA 1RL1A 1JXDA 2P9RA 2UZXA 3QJQB 1CE6A 4ZOAA 4P3CH 2QV4A 2NSMA 1IM3A 3A6CH 2Y1YA 4WK4B 1J8SA 4CVZB 1CD9B 1JRHI 3O8XD 4HCFA 2P5WE 1GCYA 4YHOH 2R8SL 2P52A 4Q6IA 2W0FB 5JIKA 3VGGA 2D2OA 1I1AB 5TE4L 5E4IA 4DPAX 2E3VA 3E3QC 2ZP8A 3LNFA 1JK8B 3BKML 5KW9H 2NNXA 3CDZA 4I0PC 4JR9L 4ECNA 4GRMA 2WLZA 3RVVC 5C0CB 2Q20A 4BXVA 4A2MA 1AXSA 4I88A 5EUKA 3VRLE 1DUZB 1VGKB 2DLTA 3TVMA 4S10A 4JY6B 1MW1A 1DBAL 5JOFB 1PTZA 4EN2A 2G9KA 2BVPB 2H6PA 4QXTB 4IIQA 4NRXB 3F6LA 3VXSE 3JTBA 5HY9A 5ICZB 4NB7A 1WAAE 1LO0L 1CXEA 3MRKB 3V52H 1WFNA 3VI4F 2X42A 3LQAL 4XH2A 5FUOL 2NR6C 2J1WA 4KXDA 3EYSL 4HIHA 3GMLA 4TUKH 3BAIA 5B8CC 4O2CB 2VO5A 1TVHB 3AUWB 3JYBA 5HJ3A 4LRIC 3T4YA 5IKCB 3FRPA 3ARPA 3ME0B 4ZMWA 4Y2OA 3ARFC 5AYTA 4DKFH 2ESVE 2HG0A 2X88A 3ULVE 5FR3A 2DH2A 5LBSL 5J6GA 4KMLB 4JDZA 3GRGA 1OB0A 2DPKA 4PV1C 2DYPA 2FO4B 3QRBA 4YOKA 5EU3A 2YBRA 4OCRL 1HWWA 2VLMD 4BYHA 2F74B 3Q3GB 5HD8C 1FNHA 4YHPB 5F89B 5EG6C 5JNYA 3LJ3A 4M5SA 4FOMA 1U93B 3Q7JA 4NAMA 3JWDH 4DP2X 4JZNB 3SGDI 4K3EL 4FTVD 5SWZD 1HS6A 4RAVA 3ZT5A 4ZSOA 4ZYKA 3HC0B 4GUOA 3LKSA 4ELKB 4W4NA 4XVOA 5ISZA 2AMUA 2APFA 4ANVA 1VESA 2N7SA 1U21A 1E28A 2OL3H 5A2IH 2W95A 4LCUB 2UXTA 3RG1C 3U4AA 5K9KA 1B0RA 5DGRA 1HXMB 5JORA 3W11D 4HDIA 1I9EA 3RDTC 3OMZA 4P2RA 1K5WA 5GSRA 4DGYL 4P5MA 5DQ9B 3U82B 1FZJB 2UYLB 3AMLA 4L29B 3LN4A 1U8MA 3AM8C 5AKRA 4RSVA 1F6LL 3DTUB 5AOKA 5ICYA 5JIMA 3ATBA 3D4GA 3EGXB 4WO4C 1HYSC 1A7OL 4U3CA 2K78A 4KQ4H 2W94A 4AMXA 1JFHA 2AJSL 4WK0B 3DMMC 1MUJB 4Q4IA 3T0DA 2HT2C 3PJSB 4ONFH 1V7ML 3FCBA 3GJFH 4LPTA 4K23L 5L8JB 4UB0H 3C2SA 5J1AB 4NQDE 1ZHKB 1YEEL 5E8EB 1MOEA 3PUUA 2PYED 5D1QD 1N4XL 3OD3A 2PO6A 1N18A 3RPIA 4HC1L 4LHUB 2OFQA 3WJMB 1RP8A 4G9FD 1PX4A 3W38A 1KN2H 4GBXB 5D7IF 2AQRA 4R83A 5E6ID 4M93B 3TBVA 4GFTB 2VLLA 1ZVSA 4Y1AA 1TETL 3B9KB 1I3GL 3VD2A 1SBBA 3UTSA 2CCVA 2JNZA 2QADC 4AYDC 3NP3A 4KMTH 4Z3EA 3T0BA 2H3XC 2HJLA 3OGCB 4OZGE 4HYTB 5EU5B 3BH4A 1KFGA 4BFRA 5B38G 3O6FC 1GY2A 3X3FH 1CFNA 4FYQA 3O2DL 1XF5A 1SN2A 5JPMC 4BA0A 4D8PA 4WGWB 3ZUCA 4WAFA 3MV9D 1F6FB 2F1EA 4JO1H 1OSZA 2EDWA 1MCSA 2LT9A 2R0LL 4FE9A 4RQQB 3S35L 3IWVA 3PHOB 5E24E 2MSPA 4PLJC 2IH9A 3REWA 4ATWA 4LQ1A 2P4AB 3ESMA 4X6EA 5IFHH 3EUUA 5C7XH 1LK2A 2DQEL 3F7RA 1WA0X 5DTFA 1R3HA 2XWDA 5AOLA 2CPCA 1T21B 3ZK0A 2DMHA 3V6OC 1F41A 3HHMA 3TYFB 5ESAA 1HHKB 2H6UA 3EFFB 3BIAX 3BZDA 3WFBL 4GQQA 1T3FA 3B2UC 1LK3L 5TF1L 3FUDA 4G6AC 1SEBB 2BY1A 3FQNB 1ZHLB 3I02A 4JFPB 5B7MA 1TQBC 4FZ8H 4FQ1L 3RZCB 3Q2NA 2WOYA 4I3GA 4YXLH 4MMZA 3CSBA 5JW3L 3WEXA 4Y4KD 2R69A 5DT1L 1YUKB 3ZYZA 2FHBA 2V17H 4PGEA 5FO9B 1J1OL 4NQQA 1G7JB 1LHZA 1UACL 3PP3K 5DI8B 4WJ5B 1DANT 1KT2A 2IPUG 3D05A 2FGWL 2YA2A 3V5DA 3RKDC 3OLGA 4KO6A 3D34A 4FERA 1ZHBA 2GAZA 4MD5B 5IMOA 5BVPL 2D31A 2GSMB 4KWUA 5JLZB 4Z1PA 3BAKA 5DJAA 4O2EA 5C07D 1AS7A 3N9GH 4OZHA 4CN1A 2WQWA 1KIQA 1NCJA 5FUCE 1HXKA 1X4XA 4RRPM 1B3JA 5LVEA 3LKQA 2ZCLH 1WRFA 4UT7H 2GUOB 3QS3A 4EUPB 3NCFB 5CMAA 3RWJA 3SO3B 4FTDA 3PQYA 2C4XA 5CFHA 3IMUA 1TYJA 1DYZA 3U9UB 4WU7B 4HEPA 4FYSA 3KVDD 5DJ8A 1VPOH 5FHBH 4AYBA 1UD5A 5FYJH 3E8UL 2XU9A 1QBBA 2ZCKH 2ZWSA 3GBML 4FG4A 5IOPA 2B9AA 3F8UB 3IF1B 4ZUVA 4JFQB 1TKWB 4HIQA 1KIRB 2F5AL 2R1XA 3HZMB 4H8UA 3F7QA 1DEDA 1UHVA 2AQPA 3AROA 2X28A 4WI6A 2APBA 2CRZA 2F5BH 3ULVL 3DTXA 1NPNA 4XMLL 3MV7E 1H6FA 3L3GB 1TJXA 3D85B 3NVQA 3IM1A 1IAIL 3EYFB 2VC2B 2NUPA 3IETB 3V4PL 4TLKA 1DDTA 4X6CA 5EU6D 5A2CA 2EABA 3EF4A 1F18A 2ZKHL 4KUZH 3NA9L 4W1TA 5EBWB 4DUWA 4X7SL 4NUGH 2WTPA 5J6SA 5CINH 4R4NC 5DRNA 2GJ6B 3FAXA 4Z7NF 2NZ9C 2XZAH 1L6XA 4IBLT 3LX9A 4MJIA 2WCGA 5E1QA 4TSAH 2XNAA 1ZJBA 3MUGB 4PJDE 4HU2A 2ZOTA 3QG7L 4LCCC 1S7QA 2YGNA 5TE7L 2RR3A 3FO1A 2WUCH 1UXSB 1YNTB 3OR7A 3QR2A 3ROLB 4I4WB 4Q2ZB 3WIFA 1GYCA 1SJHB 4RAUA 4HUVB 1ETJA 2QKSA 1DQKA 5AKVA 4O00A 2PMZA 3O4LB 4RGNC 1AE6L 1UWEL 4M62L 3RDJA 3UBGA 1A4AA 2E46A 4NI6A 4P05A 4ZTPL 1YMME 3U2SB 1FYTD 4XWOC 1BBDH 4IM8A 1KN4L 1G1CA 3F6IA 3ILEA 1GRWA 5TH2B 1HYRC 1S7UB 1G7QA 2FBJL 2H2PC 4G8GD 1HOCA 2Q10A 3UBFA 2D3VA 2MEJB 2RTTA 5ID0B 4NC2B 4PI0A 2WLIB 3TIEB 3G6AA 4GINA 2VDQB 3RY6A 3HNSH 1O9WA 1GKEA 3T77B 5IHLB 1U36A 1ET8A 2OL3B 1T4WA 2FEJA 2QGEA 4S1DD 4AQAB 3WJLC 4PJ5E 4PRID 3VM5A 2G2RB 3HZVA 3S96B 5I6MA 1P1VA 3WFEH 4X6DB 2B4CC 3BCFA 3JV0A 1OAJA 5KN5B 3CBKB 3ELQA 1JF5A 3PAYA 1F0LA 2LV4A 3F5WB 1QABA 5A43C 3BVTA 3SDXF 4N9GB 4AQ1B 4QRRE 3N43F 1RJYB 1HL9A 3BUBA 1J05A 4KROD 3H7LA 1P0SE 2H0EA 2BSEA 5AVQB 4GQRA 5G2NA 4AEFA 5I66B 4WJG3 1U2YA 3CZFB 1AQDA 1LQBC 4DJMA 4HG4K 3GJFB 3HPLB 1WBXA 5IQ9B 5INDA 1JSYA 4JDTL 2LGNA 3SJVA 2C9VA 3P9LB 2Y5QA 4N0CC 2I9LB 3G5ZA 4M1GL 4J4PC 4K94C 1JWSB 2VE6B 4OF6A 3UTZB 3ECBA 3QWQB 4Y2DA 2FE0A 1F97A 1MG2C 4GH7B 4GKOA 4U6XB 3Q2CA 4N0UB 5CKGA 5T5FH 4DGUA 5KSAA 3BKJH 4R9HA 4BFBD 3GSRB 3H54A 5CEZE 1AHWC 2EINB 2NQ3A 2OKMA 4QRQB 4M7LT 4ZT1A 4HSQA 3NUKA 1YQ2A 4YHNA 4NNXA 5IG7B 1XMWA 5DMKA 2QSQA 5F96H 3MYZA 3ROOB 4N1HB 3AQDA 2AV1A 3BZFA 2QGDA 3INUH 4RLDA 2IAMA 4DW2H 2HKHH 1KGJA 3M7OA 5HVGB 3UC0L 1L9NA 2G3MA 5FYLH 3OAZK 1JNNL 3NG5A 2CM6A 4KVCL 2DOCA 4KHXL 5KYXA 3DPBB 5FOBA 1RZKH 3LKOB 4HLEA 5DO2D 3RZWA 1JJUA 2AAVA 1RFDL 1U3HB 5EBLA 3BLBA 3UTTD 4DP8X 1BQHG 3F65A 4UU9B 4M1CC 2BOBB 4H7VA 5I0YA 3ULUF 3NQKA 3BXNB 3P4OB 2P7TB 1DFBH 3AGVA 4Z7OB 1CIUA 1OAQL 5IF0B 4BSWA 4FQLL 2YQ2A 4AK2A 1J9TA 4XNYH 1RZ8B 4A37A 4OFQA 1ZLDA 4FYTA 2I9TB 3HR5A 1A0QL 4WQOA 4GEIA 2DJUA 4U0RC 4YXKH 2JJSA 2EVFA 4F33B 4Z3JA 3F62A 4HPYL 1KJMB 1NMAH 3HZ3A 1A4JA 5SWSA 3ZPDA 5KBPA 5CXPA 1B4RA 1KLFB 5BO0D 1CFQB 1R17A 3PY9A 4PJGF 2EO9A 2VLJA 3NT0A 5I5JA 4P46C 4Y4FD 4G43A 1TOXA 2CO1A 4DERA 1BG9A 3K3QA 1WLHA 1LO4L 1GOGA 4IK6A 4NN6C 5J89A 5KEZA 1UWGH 1A9BB 2VABA 4U1IB 3C5ZC 1BQLL 1TU2B 1ETZA 3GNML 3L9RB 5AVVB 2CBQA 4GRLD 3Q13A 2IH3A 3WKPA 1QRNB 4K5OA 4CGTA 4YSSA 1G1YA 4OF0A 1BXXA 2VCOA 4GKNA 2ZXAA 2MOVA 4HJUA 4XPTL 2I07A 4F58L 4ZS6D 1NBZA 3ZQWA 5D2NC 4NQSA 4PJBE 5T1KA 3BH9B 3D18B 4U1LB 3ARQA 2ZSWA 2OZ4L 1ONQB 4X5XB 1OAKL 3LPFA 4POUB 4OLYH 2J5LB 5T1MA 3CXHK 3VFWA 5ABZA 1WP6A 2A4EA 3BJ91 3G5VB 4QHNA 2LQRA 3LKNB 4ATTA 4NKIH 1O7DE 5GRWA 1YNKL 3W3BA 4DGVH 5IM7A 2VQTA 4H8WL 4P07A 2B20A 3QUYC 5KSVA 4AUUA 1ZTXE 1XX9C 3U7WL 1KGCE 4OCSH 4DFHA 5C9JB 2YKKA 3N2JA 1KLGA 3UZVA 5JIIA 2XN9A 2GBUA 1FE8L 3KJ4C 1TQCB 1V3JA 2EZ0D 2CCWA 3O3BB 3DGCR 4ZW8A 1H9DA 3MRPA 1JGLH 3F00A 4NJAH 5B1JC 2WBJA 5I30H 1C5DA 4ZUWA 3TBSB 3WN5C 3OV6A 3QUMA 3QZPA 3ARXA 3C08H 3JWOL 3DO7A 3PHQB 4ACTA 1FNSH 4DAGL 3VQMA 2J21A 2Y06L 4N90D 4MCMA 2Q2EB 2FSEB 3DUHA 4WRLA 1O0VA 3X3GH 2VMCA 3KGSA 1ZLUH 1KCSL 1BEYH 2CLVB 3DX6A 2WKLA 1X7SA 1GJIA 2QQNL 4PJCB 3NQIA 1JPGA 3IAQA 4LBEB 3VW3L 2V7HA 2AI0H 1QSEA 5DC9B 3MVSA 4DP9X 4QNPF 1I8IA 3BIKA 5DSCB 2G3NA 3TCLB 4EKJA 2LW3A 5EC2B 1AXTH 1S46A 3APNA 3NK3A 5JR1H 3HRZA 4TTGA 3ULAB 4HULB 3X1EA 5I6LA 3FSZA 3NEXA 1JZ6A 4LLQB 2COVD 1MI5E 4O9HH 1UZ6E 3JBG7 4AEHH 1JERA 4OQTA 3RA7L 2Z35B 2APVA 4LLUA 3SKNA 4FXKC 2D4DA 1MZZA 2A83B 3ZGHA 5IJKC 2QGBA 1NA8A 2BIMA 1G6RA 2DQGL 3PABA 1FPTL 4G3YL 1RAMA 3LSOA 4K73A 2PWFA 3MRDB 5HHOB 4K8RC 4M6MH 4PBXA 1A2YA 4UUJB 3C60A 43CAA 9PCYA 2OQJA 1QQDA 1DVXA 4JANA 2EDLA 3HJ0A 4KKRA 4KXAA 1HEZA 5FM4A 3RRQA 4F15C 2VN4A 1UADC 3QDJD 1DQML 1ND0A 2ERJB 3GFUA 2DICA 4LPUA 5D7IA 3LRSA 4EOWH 1HESA 5C0EA 5DK0A 3A23A 3S37X 1HI6A 3KWWA 1D3CA 2XLLA 4I3SH 2H9GB 5CGTA 3SQBB 2CMRL 2EH7H 2J2ZA 2WLLA 3FT1A 1QBML 3VXUB 1IC5L 5CEZL 1HFUA 1I7TB 3DHPA 3VXRA 5JW4N 3WFZA 3CSFA 4QRUA 1RURH 1UA6L 1DQLH 5B1BB 1KELH 3O2VH 3RUGF 5GGRB 1YQVH 5D7JB 2KMWA 5C0RH 4P2YA 3D2TA 2UZIL 1USQA 3US0A 1BZOA 1RUKL 2BS9A 1CDJA 4JZJB 4YLQT 1ZA6A 2GIXA 4OUUA 1NC2A 5F9OH 5HI5D 3UAAA 5J0BA 1IE4A 4L05A 4NJ9H 5F0LB 1RZGB 2ARJQ 3IJ8A 2FO1A 1KB5A 3RKPA 3SOBH 4HH8A 2I32A 2HN7A 3NJMA 5T3ZH 1NMCB 3KXFE 4M7ZC 3FT2A 3TO2A 3MJ9L 4GG6F 5DJ0A 5D93B 1FBIH 1YEJL 3MLRL 4F5CE 2YD2A 3MRRB 3HMXH 4FQJH 4NENA 3WIIL 1EEQA 1CL7L 2OCJA 2ORBL 3SDAA 4BIKA 3V0JA 2FEDD 4UIMA 5I1CH 5IQ7H 3AZUA 4P8QA 3S5LG 1P84K 4DZ8A 1GGCH 2JI3A 1Q1JH 4Y9EA 3WMSA 2VZ3A 5IVXF 1NGQL 2HLAB 3APFA 4QO1A 2WZPA 3BW9A 3V0GA 1S7RB 4WV1C 4WGKA 3AB0C 4CSSA 2K7PA 1M1XB 1AKJB 2NNAB 1K4DA 4LRNL 3HI1A 1IC7H 3MREB 8FABB 1V7NH 1D9KB 3SGEI 1IAKB 2B16A 3VWKD 3MJ7A 1HK6A 2XFXB 2H8PA 3I6LD 4FQXD 4G8FA 2NY5C 1N3NB 2N0KA 2O6PA 4TM9A 4WUKL 4YC2B 5IROD 3KPSB 3IDYC 1JXFA 5CEXA 4PS8A 2N7AA 2C3XA 5EEUA 3SZKC 1E4XL 4AMKL 3HS0B 4L4JA 5JOPD 2ZP0T 3HBQA 3WAJA 1ET5A 1JVKA 2FEEI 2Y69B 4JRYB 3DV4B 3IAPA 5CP7A 1E2WA 3NGBB 1A4KA 4L4VE 3H8NA 5I6PA 4KXCA 1OP5K 1P7KB 4ZUUB 3UP1A 3FTVA 2ICEA 4MAYA 1TNNA 3KYNB 2VDNL 3PAZA 3SCMB 4WWKD 1HQ4A 3FSVA 1UB6A 2F54E 2KZWA 3QJTB 3QJVB 2J5WA 1SYSB 1P5VB 2ZCHL 3RGHA 3I9IA 4W9LC 1CLVA 5T1LB 4JKPL 2YQ3A 3NACL 2I7SA 5AW2B 3WUWG 1ZTXL 2BJMH 2F58L 3C87A 4PJ7E 4RMTA 1JWUA 1EGJL 2IF7A 4KNTA 1K5NA 4I8DA 1FA4A 3LZOA 1OGAB 4IGBA 4PRAB 4Z77A 2OTWB 3QXWA 3TZVC 2GJZB 2WNWA 4FXGC 3ETSA 4PJ9C 4E68A 1P6FA 1XGTB 4H8PA 2Q3ZA 4PJHF 2WHVA 3VG0L 4OIIL 2FATL 4OVVA 3QUXA 3KLQA 3NZ8A 4FL4B 4JVWA 4DHLA 2CBOA 4HCRH 4J3XA 1N6VA 4WHDA 4LHQB 1Z32X 1IGCL 3QEQE 4LVHB 3QI9A 1CTNA 2AJUH 3MA9H 4N0UE 4R7LA 4AQOA 4QTHA 4GSRA 1JZHA 1FL3A 3KCPA 1Z6JT 1ZKAA 2R0ZH 1G7HB 3US1A 5ACZA 2JKWA 3QWNA 3RLSA 1FH5H 1NAMH 1I4FA 4OTXL 1NGXA 3FQ4A 1EO8L 2A5UA 4PJIB 2R29H 2BNQA 1XAUA 1OAZL 2BSCA 3JVGA 3K72A 2PR4L 4BE6A 1WCBA 4Y16D 3QZWB 5DZJA 5C0ND 3TWCH 2BSRB 3UTOA 1YEGL 3WEBA 5E2TH 3OMNB 1IKFL 1B4JH 2DI9A 2QVTA 2CG9X 4UMGA 5GIRB 3F12A 32C2B 3L5HA 4IBYA 5FECB 1FSKC 1NZRA 4D0BB 4DO4A 1TVDA 2G60H 1DQTA 4M1DL 1DZ0A 4PJEF 5HDLA 3MNZB 3O9WB 4FJYA 4I18A 5HHMB 4YHLL 1RIHH 2BPBA 3SDCA 3HB3D 4ZX6A 3FDWA 3QDMA 4GSXA 1NCBH 3AXLB 3QJRB 2YK1L 1KCVH 3KYMB 2Z7UA 5CFAA 3BPCB 4MHHI 3C5SB 2RD0A 2IQ9H 3WELA 3OJDB 3SDXA 1H19A 5F93C 5HHPA 4YGAB 2A9BA 3FQWA 4AG4H 1ZLEA 2Y5TA 4P3CL 5E23A 3N1FC 3OXSA 4TUOB 3HZKB 5EPMB 4GKZB 3A6CL 1K9TA 4HETA 4H26A 4X42A 3S5YA 1XIWB 3IGFA 3QGVA 3FQ1A 4UM9A 2FL5B 1RJLB 3DSNA 1AQ8A 3QORA 4YHOL 4URTB 2CR6A 4Q56A 2OSWA 3WE6B 1N6QH 1OT2A 1KGXA 1E7UA 1MN4A 3WKMH 5CP3A 1WFUA 2D0GA 1WAEA 5C09E 1YUHB 4NXSA 5H94A 3WL9A 5KW9L 3DSFH 1P2CB 5GS1C 2J6EH 4OZIE 2ZXGA 3UBHA 1LNUA 1NKRA 1SLUA 2RIKA 4LE8A 3A22A 4P0DA 4MD0B 1M56B 5E9NA 3IRPX 2SODB 3FB5A 3K2IA 3BGMB 4QTIH 5J11C 1G6VK 5EZLA 1KXQA 4J3SA 4X5PA 5K1JA 1AIFB 1N19A 4DQOH 3KLHC 3EG9B 3WS6C 1ZXKA 3G5YA 4HGMA 2ATPB 1VRSA 1Y6KR 2MHAA 4K2UH 1RU9H 3QJFB 3V52L 1QA9B 1HHHA 5CR1A 1M3IA 1FJ1B 2M1KA 5FYJE 4FG6D 5CD3A 3KGUA 4QHKI 3H6JA 3KG5A 1O9ZA 2XRAH 3QFJB 4GAGL 4GIPD 4TUKL 3MMEA 3TA3B 3VFVA 1Q0XH 5A2AA 1NUNB 1O6SB 1Y18A 2E7LA 4NPKA 4DKFL 4LSRH 3SHSA 1BVZA 2G2PA 1S9XA 3ATFA 3UAJD 1VADB 3VGAB 3P73B 5E03A 1AP2A 4AJYV 5FGBA 3TEWA 1ORSB 1IM3D 2OXGB 5C71A 4N2MA 1K2DB 1MF2H 3OG4B 3VWJC 5J13C 3NPSB 4KVNH 1S3KH 3RTQA 3KPOA 4WW2C 4MRBA 3OHXC 3G04B 3NIDE 3NSXA 5HPOA 1ZE3H 4OGYH 5KVEH 1I1FB 1U33A 1KBWA 4NNYB 4QXUH 4PRPE 1U3ZA 3FCTA 2JCCF 1Q9OB 4JGMA 1SN0A 3WLWC 4BFGA 4OR1A 3HEIB 3WXVH 4YN3A 4PEEA 1HH6A 4PWFA 3OKNB 4F7CB 1KC5H 3TVMD 2J4WH 4NSKB 4L0YA 4QOKA 2OL3L 5CIPB 2IDUA 3IFPB 5J9PB 4EZJA 3C6LB 2HMID 1OAUH 3SD5A 2XTSA 4ZMXA 3GRWA 1GYUA 5TDOA 4LCVA 3TT3L 1E9OA 3HTLX 2VDRH 4M7LH 4XT1C 3RB7A 2DLFL 4P2QB 3QEGH 5K1VA 2R2BB 5TQ0H 3SGKA 3K74B 3O11A 3UG5A 5FGCB 5GGSA 1HNGA 3DYMA 3TN0A 4BK8A 4QR7A 3WMQA 1DUYB 3HLAB 3CD4A 4GRWF 3KBFA 4HKXA 4ONFL 5A2KH 3L81A 2O6DA 3O8XB 5J8OA 4F8NA 3WTVA 4UB0L 4PTUA 1D5MB 3RNQB 3S4SG 2RGSA 1DVQA 3IJSB 3WY3A 1RZJH 3CDYA 4KKLC 5ITBL 3OKKB 4P48A 4YDVA 1E2VA 4Y8AA 1ROWA 2DYPD 5C6TH 1G1KA 5DD6B 2V5TA 1RQ5A 4RFOH 1KN2L 1XH0A 2ZX9A 2LABA 1CT8A 5FV1L 1NCAL 4O58H 3VJ6A 3HE7D 1A66A 5BVJA 3D2UA 2X44D 3VXUE 8PAZA 1ED3B 3D06A 4FI7A 1TIUA 2Z8WC 4KMTL 4FNQA 4JRFA 4ONHA 1EBAA 4NDMA 3VO0A 3P3UA 5K59E 3TFKD 2WZ6A 3X3FL 5ISZD 4KTEL 4PJXE 4B5EA 2AV7B 5DFVC 2EDQA 4L8CB 2QDVA 2XN0A 4JO1L 4U4IA 4E9VA 4UQBA 1NCIA 2EYTA 4B9KC 1EEYA 1BSIA 4G7VH 4B60A 3G6JB 4P2RD 4Y9GA 3WO4B 2WN3A 2DMGA 4F7EA 5G55A 5KVGH 3KL5A 3QPQD 4OI7A 5AOMA 3ZHFA 5IFHL 3GS0A 2IBBA 1JNLH 3IT8D 3P4MB 4A38A 3I9PA 1NAMB 5GGQL 3E7JA 4JFFE 2KKQA 3WFHB 2XWTB 1YECH 4AW7A 2X05A 5FA3A 3EIFA 5B1AB 4QCIB 3ARGD 1SJVA 3OAYK 3P02A 4C83B 1L0QA 4R4BB 2J55A 5HVWA 5BRPA 3M45A 3QAZB 4PG9B 1NIDA 4L4TA 1QAWA 3BZ4A 1U2CA 4NRYA 3RWGB 5LAPA 3TV3H 1AO7E 1CD1A 1AC0A 4JLRB 2X1WL 1M2OA 1XV8A 5FYLE 3B4NA 3NFNA 3O4OB 2ZQKA 5D1XE 2HVKA 4YXLL 5ES4B 3T3MB 5B3JE 2ZWKA 2FJHB 4CSTA 3AMKA 2XDHA 4LAQL 4FTVB 5D7LD 2V17L 5SWZB 3RPKA 3SYAA 1URLA 4Y1AD 1NANI 1IBBA 1TTUA 1CTMA 1BQRA 3LV3A 4B95C 3UTSD 2NY3C 4AEIL 3T6XA 3CFUA 2YBGA 3CC5A 4Y5XB 4L48A 3KHQA 5CEYA 4BCXA 3AREA 4OU3A 2BP0B 4NO2A 1XH3B 3QQ3B 3PFQA 4UTAA 1TITA 2ZPKH 3G7TA 1E0OB 3N9GL 4R6UA 1QNZL 4NWTH 4ICWA 4LOUD 1EBPA 2XVBA 2ZCLL 5E2VH 4UT7L 2UV3A 2KC0A 4MNGA 3BRFA 4G7YH 2CSPA 5C0DA 2EYSB 1U0QA 1M7XA 4NIKB 3RDTA 1IGTA 4IU2B 3IS0X 4DK3A 2GQHA 3OXRB 3RUGA 4K3GA 3WNMA 3C09B 3A21A 3B5GA 4IKKA 1I8KA 1QTPA 3APCA 2CRYA 5HYJA 4KXZI 3K8MA 4CN4A 1VPOL 5FYJL 3R8QA 5A6MA 4URKA 5HXMA 2PYEB 1QSFD 2ZCKL 3GZPA 4CU6A 4AGLA 1TSRA 5L88L 3OLDA 2O5ZL 1HKLH 2KHAA 4G9FB 4M5ZH 4NT6A 1GTNA 1U8QB 2JIXA 3MFGB 5E51A 1VFBA 3ZKQD 3AT0A 1L0XA 5E6IB 4GG6A 1I53A 2WLKA 5C08E 2VZSA 2KYIA 1DSYA 1A6WH 2PCYA 2F5BL 4YHIA 2R2HB 3SE3A 4EXKA 3RFZC 2I60H 5J12B 2YWYA 1CTOA 1OK8A 3U25A 1BF5A 2L7QA 4AL8H 2DW5A 1ZK9A 3VH8A 4FQIH 1GKOA 2MPAH 1UGNA 2ZJSL 3MA7A 5I76A 3IE4A 1KUMA 4KUZL 4KK6D 4KI5F 3WTYA 5D1ZC 4C56E 3ULSA 4NUGL 1Q9KA 5CINL 1AC6A 4K5MA 2HLFC 1E9QA 1H9VA 3AG1B 2ISDA 1Q9LA 4CC0A 1PG7X 5K9QG 2XZAL 3KPPB 3CFBB 3BAJA 5E4AA 3QARA 4TSAL 3O6LH 4F8PA 1UUSA 3GMOA 4PLNC 3V5KA 2WUCL 3E6FA 4GO6B 2NW3B 5E70A 2GI0A 2HTKC 2RFXB 3V2AR 3S5LB 1RZIB 4W6XB 3WIAA 4CW1A 2OP4L 4MSWA 3T1FB 1MCLA 1P53A 3NH7H 5IBLD 3PQYD 1OTUC 1VCAA 2QLYA 4LU5H 2EDYA 1GSKA 4ODSH 3SE9H 1LP9B 3VA6A 2VM4A 2AXGB 2GSIA 5ICXB 2RACA 2EO1A 5DHDA 2E7DA 3DOSB 1BBDL 2CDEA 4YO0B 4OGAC 3GXPA 3V6OA 2DQFA 2Z8RA 3RVUC 2HFEB 2V7NB 3PWLA 2V5YA 4M4RA 1EFXA 1ZT7B 4Y4KB 2IBGA 3MGOA 1W0WA 5BRZD 1N67A 4DTGL 3LH8A 2WBKA 1AGDB 2YAOA 4G5ZH 3HNSL 3T9WA 1DVYA 1RLBA 4P23A 4DOHE 1I31A 4XXDB 7PAZA 3KMDA 1WWAX 3O81A 3LD8B 3MUY1 1WK0A 5FB8A 1YYMH 1SLXA 3WFEL 3CIQA 4G1EA 5C07B 5EULV 1W91A 4OJFL 2YN5A 3T65A 1RIUH 2PXYB 5DVPA 5I8KH 4ZFFA 4JQXA 4K9EC 3MXVH 2CO6B 3H9HA 1E3ZA 2W60A 4PJHA 3QO0B 4QJ5B 3QO1B 1J11A 3DOIA 2Y7MA 3RU8H 2NY7H 35C8H 3U30B 1U8PA 4W6WB 4DKAA 1QI5A 4YPGB 5IW6A 2C3HA 3ZTCC 1PU0A 4NQVB 2MCG1 5G5DA 3BAXA 5T33L 3GLZA 4L8SA 4UAHA 5IJVB 3DNKA 4R7DA 2YPVH 4LKXA 2HX9A 5SX4I 4PGZA 2O1AA 4WHCA 5FDWA 1RSFA 5T5FL 2ZAHA 4QF1B 5CSGA 4ETQA 2EO7A 1E5BA 1YVLA 1S6NA 1R5IA 2VXQH 1N26A 4OJDH 1FNEA 2Q7AA 3FCGA 4KVPA 4S1SH 2OYPA 1ID5I 1M71B 1QUNA 2IJ0C 3N41B 1IE5A 3IJHB 4HMEA 3WXWH 3DX3A 1FGVH 5TFSL 3GHBH 4UQCA 4XI5D 3MGTB 5F96L 3MRIB 4LF3B 4P4KA 3FB8B 4ILDA 5EU6B 2BMKB 3DO4A 3QFJE 4S2SA 3BWSA 3INUL 2QSVA 5CCJA 2E27H 5KUKA 2GSGA 1JZGA 1KJVA 2B59A 3P2BA 2P8LA 5DS8A 3T4AC 4A6YA 2CZNA 5GSVB 4PJEA 5FYLL 3VDCA 4HIEA 3H3PH 3S7GA 4LEXH 4L1BA 3QIBC 3CFDA 4RBPH 2YFOA 3MXWH 2WKOF 1WS8A 1UT2A 4H44C 4XCNA 4PLOB 3D3VA 2GW5A 1U8JA 1X5IA 5ILTL 5T3ZE 5I16B 1RK0B 5C2BH 1SZNA 1ETB1 3K1KC 5BZDB 3LPPA 3RWFA 3GUTB 3O2WH 3CFEA 5LXGH 4JAMA 3SDDA 3PP4H 4OM1H 4J8RB 4BFIB 1AG6A 2VDPL 3TEUA 4LCCA 3L3OC 5F7BA 2JQZA 4OT1H 5I0VA 3ARZA 4A1RA 3LS4H 1EVUA 1CFTB 3QCVH 3UROR 1RMFH 4ODXA 4TRPH 3MODH 4X80L 3MGAA 4XNYL 1QR1A 5CN2A 4Y2DD 3RI5K 1R3JB 1PYWB 4JHVA 2OYLA 3MRFB 4B50A 4TQPA 4YXKL 4G8GB 4OB5H 3KWXA 4E2OA 2R2EA 5KSAD 1DVZA 1Q72H 1ITBB 5IB4B 1CG9B 1NMAL 4X0KA 5IW3A 1AKPA 4CAGA 1A7BA 5HI4D 4LNVA 1N70A 3MV8B 2ZUYA 3CUPA 1JD7A 1OTTD 3KYKH 4H2CA 1R5VB 4PLKC 4Z0XA 2VDLL 1WUNT 1UWGL 1GR7A 1ADQH 4NQEB 4PRIB 4WWPA 3ML9A 1D5XB 2IGFL 3L95B 2IAMD 3VA2C 5MI0B 1PGRB 3GDCA 4WTWA 2V3EA 1EEZB 1NCUA 5HHNB 1SJMA 1RUPL 3DRQB 3AT8A 3U6RA 5IT2H 4FFYL 5EOQH 4HXBH 5SV3A 1BDYA 4WTZG 1GYAA 4OLYL 2GTZB 1AZUA 1FG9C 3DWTA 3PUCA 2AJYH 2W88A 4WUUA 4XBPA 4JN2B 3SKOB 1VENA 4YZFF 2Q7YA 2BSSB 4NKIL 1KLUA 4YX2H 3CN1A 4X9FA 1T0MB 1K3IA 4ZG1A 1RPUA 1KV7A 1K85A 3GT6A 3JQOB 3FTWA 4KJYB 4CSZA 4YHMH 3FTSA 4DO6A 1P4LB 5HGD<