1D7HA

Fkbp complexed with dmso
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7hA00
4MSPA 2OFNA 1NMWA 2F21A 3IHZA 4C02B 5HW6A 5D75A 2ITKA 2XP7A 4TW6A 1KT0A 3UQBA 4DT4A 4GGQA 4ODKA 2Y78A 3PA7A 1FKHA 3I6CA 3KAHA 4DRQA 2RQSA 4TW7A 3O5QA 4DZ3A 5I98A 1B6CA 2XP8A 3JYJA 2FAPA 2M08A 1T11A 4J4NA 1F40A 4DIPA 1BL4A 2RUQA 1ROTA 3JXVA 1HXVA 2LPVA 3EY6A 4ODOA 4TW8A 2XPAA 1QPLA 4N19A 1PINA 1J6YA 2LKNA 3KABA 1FKKA 1EYMA 1FKTA 2KI3A 3UI6A 2Q5AA 1FKBA 3O5RA 4LAYA 1YW5A 1JNTA 4IQ2A 2RSEA 3O5EA 3PRBA 4W9QA 3KAIA 2KR7A 2PPOA 4JFIA 3KAGA 1QPFA 1TCOC 5HT1A 4U84A 5HW7A 4DRJA 2KE0A 4JFJA 2N87A 1W26A 3IK8A 3TCZA 3KCEA 2PPPA 2MLZA 1J4HA 2PV2A 3O5IA 4JFMA 4TNSA 4W9OA 2JZVA 3PRDA 5DITA 3KAFA 3ODKA 1J4IA 4LAVA 2FKEA 2VCDA 2PBCA 2L2SA 3UQAA 4LAWA 1JVWA 2UZ5A 3NRKA 1Q6HA 5DIVA 2XP5A 4DRHA 1J4RA 2IF4A 3NI6A 2ZQSA 5GPGA 4DZ2A 4ODLA 2ZR5A 1FKSA 1M5YA 2MNTA 3O5JA 1FKGA 1R9HA 3B7XA 4ODQA 1FKJA 4G2PA 2K8IA 5HUAA 4TX0A 1FKLA 2F2DA 1D7HA 2MLYA 2PV3A 2XP9A 3O5MA 4W9PA 1FKIA 3RGCA 3VAWA 1FKFA 4DRPA 1PBKA 1EQ3A 3IKDA 2RUDA 4ODNA 4FAPA 4DRNA 3O5DA 3UQIA 5HW8A 4MGVA 1D7IA 4ODMA 4O2TA 2PPNA 1ZK6A 4U85A 5BXJA 2MPHA 2ZQTA 1F8AB 3RFWA 4DRKA 4BF8A 5HWBA 5HKGA 3O5GA 1Q1CA 2VN1A 2LJ4A 2D9FA 5HTGA 1D7JA 4TYOA 2ZR6A 3IKGA 1C9HA 4FN2A 1YATA 5DIUA 1D6OA 1BKFA 2MF9A 4ODRA 3KACA 4QT2A 2ZQUA 3H9RB 4GIVA 4ITZA 3NTPA 4ODPA 3CGMA 3WH0A 1ZCNA 1FAPA 1ROUA 4DH0A 4DRIA 1NSGA 5B8IC 3KADA 2RURA 2KFWA 2DG3A 2XP3A 3JYMA 2M1IA 2MLXA 4QIBA 4DROA 4JYSA 1FKRA 2LGOA 1N1AA 5HWCA 2M2AA 1FJDA 2F4EA 3LUOA 1FKDA 4G50A 1A7XA 3MDYB 2XPBA 3O5OA 4IPXA 3OOBA 4DRMA 2KGJA 3O5FA 3UI5A 3TC5A 2ZQVA 4IQCA 3CGNA 3KZ7A 1QZ2A 4U86A 3TDBA 4NNRA 4QT3A 2XP6A 1L1PA 4R0XA 1Y0OA 1KT1A 2XP4A 3O5LA 1U79A 1NMVA 3O5PA 5J6EA 3O5KA 1JNSA 1Q6IA 2DG4A 1FD9A 4LAXA 2PV1A 3GPKA 1P5QA 3UI4A 2KO7A 4J4OA 1Q6UA 3UF8A 2AWGA 2DG9A 4JFLA 4JFKA 2RUCA 3FAPA 2ZR4A
chains in the Genus database with same CATH superfamily
3ARZA 5HW6A 5D75A 1JCHB 3WD4A 1NWTA 3OA5A 4GGQA 4ODKA 3PA7A 1HKMA 4HBEA 1XHGA 2XP8A 2FAPA 4J4NA 1BL4A 1ZBCA 1VF8A 1SR0A 4TW8A 2XPAA 2LKNA 1EYMA 1FKTA 1EDQA 3UI6A 4MNMA 2QF8A 1W9VA 2RSEA 2PPOA 1TCOC 5HW7A 5HT1A 4DRJA 3TCZA 3KCEA 2DT3A 4TNSA 3WL0A 4LAWA 3ARQA 2UZ5A 4Z2HA 4R5EA 1Q6HA 1ZU8A 4DRHA 5DEZA 1NWUA 1M5YA 4Z2KA 3B7XA 1TFVA 1FKJA 4G2PA 2K8IA 1GOIA 2F2DA 3RGCA 3O5MA 3AS1A 2XP9A 1LG1A 1FFRA 4DRPA 4WKFA 1FKFA 4DWSA 1PBKA 1EQ3A 1LJYA 4W5UA 4FAPA 3O5DA 1E9LA 1GPFA 1JNEA 2PPNA 3W4RA 1E6RA 2MPHA 5HWBA 4LGXA 3GTYX 4DRKA 2B31A 2YBUA 1WNOA 2VN1A 3ARWA 1D7JA 1UR8A 4FN2A 1YATA 5DIUA 3H9RB 4DH0A 1W1YA 1XRVA 2XP3A 4DROA 1O6IA 4ZS6A 1FKDA 3O5OA 3WD0A 3UI5A 3TC5A 2PN0A 1HKIA 3G6MA 2XP6A 3AQUA 4Z2GA 4R0XA 2ETNA 1U79A 4KR0B 4MNLA 1Q6IA 2KO7A 2DSZA 4JFLA 1OGGA 1W1PA 4MSPA 2OFNA 2F21A 1E6PA 2XP7A 4TW6A 3UQBA 4UDMA 2EULA 2Y78A 4DRQA 1UR9A 4DZ3A 3JYJA 5DF0A 4DIPA 4WKAA 3EY6A 1PINA 3ARRA 1HJVA 2FDMA 2KI3A 3O5RA 4LAYA 1JNTA 1ITXA 3KAGA 4ZPTR 4JFJA 2N87A 1W26A 4JFMA 1FJDA 4WIWA 1E6NA 2PV2A 3O5IA 5DO2A 1F40A 4LAVA 2VCDA 1JVWA 3NRKA 1E44A 5DIVA 1J4RA 4DWSC 2IF4A 4DZ2A 1FKSA 4AY1A 1HKJA 4ODNA 1ZBVA 4IT6A 3ALFA 5BXJA 2G8ZA 3ARUA 3ARYA 4MAVA 2A3EA 2ZQTA 4L3NA 4BF8A 4P8UA 5HKGA 3O5GA 2D9FA 1C9HA 1NH6A 2IUZA 2MF9A 4ODRA 5JH8A 2ZQUA 3WH0A 4Z2LA 5B8IC 1LL6A 1FAPA 2MLXA 1FKRA 1WAWA 2M2AA 4G50A 3MDYB 2XPBA 3B9AA 4MPKA 1HJWA 2KGJA 1X6NA 4P8XA 4IQCA 4U86A 2DT1A 3WD1A 4P8VA 1NWRA 1EHNA 1Y0OA 4Q7NA 4PTMA 1NMVA 5J6EA 3O5KA 3CHCA 1JNSA 4QZVB 2B5UB 1P5QA 1NWSA 4J4OA 1Q6UA 3B8SA 3UF8A 2DG9A 2PI6A 2RUCA 1HKKA 3FAPA 4JFKA 2ZR4A 4MGVA 4C02B 4DWSD 2DPEA 2AOSA 1KT0A 3QOKA 3CHDA 5GPRA 1LL7A 1FKHA 3KAHA 2RQSA 1OWQA 1T11A 1CTNA 4L72B 1ROTA 1QPLA 4N19A 1J6YA 3B9EA 3KABA 1WB0A 1FKKA 4S3JA 1RD6A 3O5EA 4W9QA 3KAIA 4JFIA 1QPFA 1HXVA 3ARXA 4U84A 3ARSA 1LG2A 5DITA 2JZVA 3PRDA 3ODKA 1J4IA 3GU0A 1H0GA 2L2SA 3UQAA 3B9DA 4KQZA 1FFQA 5GPGA 3NI6A 4ODLA 2ZR5A 4WK9A 3O5JA 1R9HA 1E15A 3WD3A 4MTVA 2A3BA 1W9PA 3RMEA 2DSWA 2RUDA 4DRNA 3UQIA 1ZL1A 2DT0A 4ODMA 4O2TA 4ZPWR 1GUVA 2A3CA 4U85A 2DT2A 3RFWA 3CHEA 4XAKA 2O92A 3ALGA 5HTGA 3WL1A 1LL4A 3BMBA 1D6OA 3KACA 4QT2A 4Z2JA 3WQVA 2P4VA 3CHFA 4GIVA 3ARTA 3NTPA 4ITZA 3CGMA 1ZCNA 1ROUA 1IX5A 2WM0A 2KFWA 2O9OA 2M1IA 3EIPA 4QIBA 4JYSA 4ML4A 3PRAA 4IPXA 3OOBA 4DRMA 2ZQVA 3KZ7A 3TDBA 4NZCA 4NNRA 2WK2A 3O5LA 2YBTA 3O5PA 3WD2A 3ARPA 2F23A 3WIJA 4MNJA 3UI4A 1K9TA 2DSVA 4MNKA 1NMWA 4P8WA 3IHZA 2A3AA 4WJXA 2ITKA 4DT4A 3RM4A 3I6CA 4TW7A 3O5QA 2G41A 5I98A 1B6CA 2WLZA 2M08A 2RUQA 3JXVA 2LPVA 4ODOA 1ZBWA 3FY1A 3AROA 3AS3A 1JNDA 2Q5AA 1FKBA 4URIA 1YW5A 4IQ2A 3PRBA 3FXYA 2KR7A 2KE0A 3IK8A 4W9OA 2PPPA 2MLZA 1J4HA 3KAFA 2FKEA 2PBCA 2XP5A 1X6LA 4ZPVR 2ZQSA 3WQWA 2MNTA 1FKGA 1W9UA 4ODQA 5HUAA 4TX0A 1FKLA 2PV3A 1D7HA 2MLYA 4W9PA 3VAWA 1FKIA 4S3KA 3CZ8A 3IKDA 3CH9A 1OGBA 5HW8A 1D7IA 1ZK6A 1E6ZA 1F8AB 4HBOA 3AS0A 3AS2A 5HBFA 1Q1CA 3BXWA 2LJ4A 3WKZA 1EIBA 4TYOA 2ZR6A 3IKGA 3RM9A 1GRJA 4WKHA 1BKFA 1HJXA 1W1VA 2DSUA 4IT4A 4NSBA 4ODPA 4DRIA 1NSGA 4HARA 3KADA 2RURA 3JYMA 2DG3A 3RM8A 1N1AA 2LGOA 5HWCA 2F4EA 3LUOA 4DWSB 1A7XA 2ESCA 4Q22A 3O5FA 4Z2IA 3ARVA 2OLHA 1LQ0A 3CGNA 1W1TA 1QZ2A 3PR9A 4QT3A 1L1PA 3G6LA 1KT1A 2XP4A 1ZBKA 5GQBA 1FD9A 1D2KA 2DG4A 2PV1A 3GPKA 4LAXA 1H0IA 1ZB5A 2AWGA 2WLYA 1SYTA 1KFWA
chains in the Genus database with same CATH topology
3ARZA 5HW6A 5D75A 3WD4A 1NWTA 3OA5A 4GGQA 4ODKA 3PA7A 1HKMA 4HBEA 1XHGA 2XP8A 2FAPA 4J4NA 1BL4A 1ZBCA 1VF8A 1SR0A 4TW8A 2XPAA 2LKNA 1EYMA 1FKTA 1EDQA 3UI6A 4MNMA 2QF8A 1W9VA 2RSEA 2PPOA 1TCOC 5HW7A 5HT1A 4DRJA 3TCZA 3KCEA 2DT3A 4TNSA 3WL0A 4LAWA 3ARQA 2UZ5A 4Z2HA 4R5EA 1Q6HA 1ZU8A 4DRHA 5DEZA 1NWUA 1M5YA 4Z2KA 3B7XA 1TFVA 1FKJA 4G2PA 2K8IA 1GOIA 2F2DA 3RGCA 3O5MA 3AS1A 2XP9A 1LG1A 1FFRA 4DRPA 4WKFA 1FKFA 4DWSA 1PBKA 1EQ3A 1LJYA 4W5UA 4FAPA 3O5DA 1E9LA 1GPFA 1JNEA 2PPNA 3W4RA 1E6RA 2MPHA 5HWBA 4LGXA 4DRKA 2B31A 2YBUA 1WNOA 2VN1A 3ARWA 1D7JA 1UR8A 4FN2A 1YATA 5DIUA 3H9RB 4DH0A 1W1YA 1XRVA 2XP3A 4DROA 1O6IA 4ZS6A 1FKDA 3O5OA 3WD0A 3UI5A 3TC5A 1HKIA 3G6MA 2XP6A 3AQUA 4Z2GA 4R0XA 1U79A 4KR0B 4MNLA 1Q6IA 2KO7A 2DSZA 4JFLA 1OGGA 1W1PA 4MSPA 2OFNA 2F21A 1E6PA 2XP7A 4TW6A 3UQBA 2Y78A 4DRQA 1UR9A 4DZ3A 3JYJA 5DF0A 4DIPA 4WKAA 3EY6A 1PINA 3ARRA 1HJVA 2FDMA 2KI3A 3O5RA 4LAYA 1JNTA 1ITXA 3KAGA 4ZPTR 4JFJA 2N87A 1W26A 4JFMA 1FJDA 4WIWA 1E6NA 2PV2A 3O5IA 5DO2A 1F40A 4LAVA 2VCDA 1JVWA 3NRKA 5DIVA 1J4RA 4DWSC 2IF4A 4DZ2A 1FKSA 4AY1A 1HKJA 4ODNA 1ZBVA 4IT6A 3ALFA 5BXJA 2G8ZA 3ARUA 3ARYA 4MAVA 2A3EA 2ZQTA 4L3NA 4BF8A 4P8UA 5HKGA 3O5GA 2D9FA 1C9HA 1NH6A 2IUZA 2MF9A 4ODRA 5JH8A 2ZQUA 3WH0A 4Z2LA 5B8IC 1LL6A 1FAPA 2MLXA 1FKRA 1WAWA 2M2AA 4G50A 3MDYB 2XPBA 3B9AA 4MPKA 1HJWA 2KGJA 1X6NA 4P8XA 4IQCA 4U86A 2DT1A 3WD1A 4P8VA 1NWRA 1EHNA 1Y0OA 4Q7NA 4PTMA 1NMVA 5J6EA 3O5KA 3CHCA 1JNSA 4QZVB 1P5QA 1NWSA 4J4OA 1Q6UA 3B8SA 3UF8A 2DG9A 4JFKA 2RUCA 2PI6A 1HKKA 3FAPA 2ZR4A 4MGVA 4C02B 4DWSD 2DPEA 2AOSA 1KT0A 3QOKA 3CHDA 5GPRA 1LL7A 1FKHA 3KAHA 2RQSA 1OWQA 1T11A 1CTNA 4L72B 1ROTA 1QPLA 4N19A 1J6YA 3B9EA 3KABA 1WB0A 1FKKA 4S3JA 1RD6A 3O5EA 4W9QA 3KAIA 4JFIA 1QPFA 1HXVA 3ARXA 4U84A 3ARSA 1LG2A 5DITA 2JZVA 3PRDA 3ODKA 1J4IA 1H0GA 2L2SA 3UQAA 3B9DA 4KQZA 1FFQA 5GPGA 3NI6A 4ODLA 2ZR5A 4WK9A 3O5JA 1R9HA 1E15A 3WD3A 4MTVA 2A3BA 1W9PA 3RMEA 2DSWA 2RUDA 4DRNA 3UQIA 1ZL1A 2DT0A 4ODMA 4O2TA 4ZPWR 1GUVA 2A3CA 4U85A 2DT2A 3RFWA 3CHEA 4XAKA 2O92A 3ALGA 5HTGA 3WL1A 1LL4A 1D6OA 3KACA 4QT2A 4Z2JA 3WQVA 3CHFA 4GIVA 3ARTA 3NTPA 4ITZA 3CGMA 1ZCNA 1ROUA 1IX5A 2WM0A 2KFWA 2O9OA 2M1IA 4QIBA 4JYSA 4ML4A 3PRAA 4IPXA 3OOBA 4DRMA 2ZQVA 3KZ7A 3TDBA 4NZCA 4NNRA 2WK2A 3O5LA 2YBTA 3O5PA 3WD2A 3ARPA 3WIJA 4MNJA 3UI4A 1K9TA 2DSVA 4MNKA 1NMWA 4P8WA 3IHZA 2A3AA 4WJXA 2ITKA 4DT4A 3RM4A 3I6CA 4TW7A 3O5QA 2G41A 5I98A 1B6CA 2WLZA 2M08A 2RUQA 3JXVA 2LPVA 4ODOA 1ZBWA 3FY1A 3AROA 3AS3A 1JNDA 2Q5AA 1FKBA 4URIA 1YW5A 4IQ2A 3PRBA 3FXYA 2KR7A 2KE0A 3IK8A 4W9OA 2PPPA 2MLZA 1J4HA 3KAFA 2FKEA 2PBCA 2XP5A 1X6LA 4ZPVR 2ZQSA 3WQWA 2MNTA 1FKGA 1W9UA 4ODQA 5HUAA 4TX0A 1FKLA 2PV3A 1D7HA 2MLYA 4W9PA 3VAWA 1FKIA 4S3KA 3CZ8A 3IKDA 3CH9A 1OGBA 5HW8A 1D7IA 1ZK6A 1E6ZA 1F8AB 4HBOA 3AS0A 3AS2A 5HBFA 1Q1CA 3BXWA 2LJ4A 3WKZA 1EIBA 4TYOA 2ZR6A 3IKGA 3RM9A 4WKHA 1BKFA 1HJXA 1W1VA 2DSUA 4IT4A 4NSBA 4ODPA 4DRIA 1NSGA 4HARA 3KADA 2RURA 3JYMA 2DG3A 3RM8A 1N1AA 2LGOA 5HWCA 2F4EA 3LUOA 4DWSB 1A7XA 2ESCA 4Q22A 3O5FA 4Z2IA 3ARVA 2OLHA 1LQ0A 3CGNA 1W1TA 1QZ2A 3PR9A 4QT3A 1L1PA 3G6LA 1KT1A 2XP4A 1ZBKA 5GQBA 1FD9A 1D2KA 2DG4A 2PV1A 3GPKA 4LAXA 1H0IA 1ZB5A 2AWGA 2WLYA 1SYTA 1KFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSP A;  2OFN A;  1NMW A;  2F21 A;  3IHZ A;  4C02 B;  5HW6 A;  5D75 A;  2ITK A;  2XP7 A;  4TW6 A;  1KT0 A;  3UQB A;  4DT4 A;  4GGQ A;  4ODK A;  2Y78 A;  3PA7 A;  1FKH A;  3I6C A;  3KAH A;  4DRQ A;  2RQS A;  4TW7 A;  3O5Q A;  4DZ3 A;  5I98 A;  1B6C A;  2XP8 A;  3JYJ A;  2FAP A;  2M08 A;  1T11 A;  4J4N A;  1F40 A;  4DIP A;  1BL4 A;  2RUQ A;  1ROT A;  3JXV A;  1HXV A;  2LPV A;  3EY6 A;  4ODO A;  4TW8 A;  2XPA A;  1QPL A;  4N19 A;  1PIN A;  1J6Y A;  2LKN A;  3KAB A;  1FKK A;  1EYM A;  1FKT A;  2KI3 A;  3UI6 A;  2Q5A A;  1FKB A;  3O5R A;  4LAY A;  1YW5 A;  1JNT A;  4IQ2 A;  2RSE A;  3O5E A;  3PRB A;  4W9Q A;  3KAI A;  2KR7 A;  2PPO A;  4JFI A;  3KAG A;  1QPF A;  1TCO C;  5HT1 A;  4U84 A;  5HW7 A;  4DRJ A;  2KE0 A;  4JFJ A;  2N87 A;  1W26 A;  3IK8 A;  3TCZ A;  3KCE A;  2PPP A;  2MLZ A;  1J4H A;  2PV2 A;  3O5I A;  4JFM A;  4TNS A;  4W9O A;  2JZV A;  3PRD A;  5DIT A;  3KAF A;  3ODK A;  1J4I A;  4LAV A;  2FKE A;  2VCD A;  2PBC A;  2L2S A;  3UQA A;  4LAW A;  1JVW A;  2UZ5 A;  3NRK A;  1Q6H A;  5DIV A;  2XP5 A;  4DRH A;  1J4R A;  2IF4 A;  3NI6 A;  2ZQS A;  5GPG A;  4DZ2 A;  4ODL A;  2ZR5 A;  1FKS A;  1M5Y A;  2MNT A;  3O5J A;  1FKG A;  1R9H A;  3B7X A;  4ODQ A;  1FKJ A;  4G2P A;  2K8I A;  5HUA A;  4TX0 A;  1FKL A;  2F2D A;  1D7H A;  2MLY A;  2PV3 A;  2XP9 A;  3O5M A;  4W9P A;  1FKI A;  3RGC A;  3VAW A;  1FKF A;  4DRP A;  1PBK A;  1EQ3 A;  3IKD A;  2RUD A;  4ODN A;  4FAP A;  4DRN A;  3O5D A;  3UQI A;  5HW8 A;  4MGV A;  1D7I A;  4ODM A;  4O2T A;  2PPN A;  1ZK6 A;  4U85 A;  5BXJ A;  2MPH A;  2ZQT A;  1F8A B;  3RFW A;  4DRK A;  4BF8 A;  5HWB A;  5HKG A;  3O5G A;  1Q1C A;  2VN1 A;  2LJ4 A;  2D9F A;  5HTG A;  1D7J A;  4TYO A;  2ZR6 A;  3IKG A;  1C9H A;  4FN2 A;  1YAT A;  5DIU A;  1D6O A;  1BKF A;  2MF9 A;  4ODR A;  3KAC A;  4QT2 A;  2ZQU A;  3H9R B;  4GIV A;  4ITZ A;  3NTP A;  4ODP A;  3CGM A;  3WH0 A;  1ZCN A;  1FAP A;  1ROU A;  4DH0 A;  4DRI A;  1NSG A;  5B8I C;  3KAD A;  2RUR A;  2KFW A;  2DG3 A;  2XP3 A;  3JYM A;  2M1I A;  2MLX A;  4QIB A;  4DRO A;  4JYS A;  1FKR A;  2LGO A;  1N1A A;  5HWC A;  2M2A A;  1FJD A;  2F4E A;  3LUO A;  1FKD A;  4G50 A;  1A7X A;  3MDY B;  2XPB A;  3O5O A;  4IPX A;  3OOB A;  4DRM A;  2KGJ A;  3O5F A;  3UI5 A;  3TC5 A;  2ZQV A;  4IQC A;  3CGN A;  3KZ7 A;  1QZ2 A;  4U86 A;  3TDB A;  4NNR A;  4QT3 A;  2XP6 A;  1L1P A;  4R0X A;  1Y0O A;  1KT1 A;  2XP4 A;  3O5L A;  1U79 A;  1NMV A;  3O5P A;  5J6E A;  3O5K A;  1JNS A;  1Q6I A;  2DG4 A;  1FD9 A;  4LAX A;  2PV1 A;  3GPK A;  1P5Q A;  3UI4 A;  2KO7 A;  4J4O A;  1Q6U A;  3UF8 A;  2AWG A;  2DG9 A;  4JFL A;  4JFK A;  2RUC A;  3FAP A;  2ZR4 A; 
#chains in the Genus database with same CATH topology
 3ARZ A;  5HW6 A;  5D75 A;  1JCH B;  3WD4 A;  1NWT A;  3OA5 A;  4GGQ A;  4ODK A;  3PA7 A;  1HKM A;  4HBE A;  1XHG A;  2XP8 A;  2FAP A;  4J4N A;  1BL4 A;  1ZBC A;  1VF8 A;  1SR0 A;  4TW8 A;  2XPA A;  2LKN A;  1EYM A;  1FKT A;  1EDQ A;  3UI6 A;  4MNM A;  2QF8 A;  1W9V A;  2RSE A;  2PPO A;  1TCO C;  5HW7 A;  5HT1 A;  4DRJ A;  3TCZ A;  3KCE A;  2DT3 A;  4TNS A;  3WL0 A;  4LAW A;  3ARQ A;  2UZ5 A;  4Z2H A;  4R5E A;  1Q6H A;  1ZU8 A;  4DRH A;  5DEZ A;  1NWU A;  1M5Y A;  4Z2K A;  3B7X A;  1TFV A;  1FKJ A;  4G2P A;  2K8I A;  1GOI A;  2F2D A;  3RGC A;  3O5M A;  3AS1 A;  2XP9 A;  1LG1 A;  1FFR A;  4DRP A;  4WKF A;  1FKF A;  4DWS A;  1PBK A;  1EQ3 A;  1LJY A;  4W5U A;  4FAP A;  3O5D A;  1E9L A;  1GPF A;  1JNE A;  2PPN A;  3W4R A;  1E6R A;  2MPH A;  5HWB A;  4LGX A;  3GTY X;  4DRK A;  2B31 A;  2YBU A;  1WNO A;  2VN1 A;  3ARW A;  1D7J A;  1UR8 A;  4FN2 A;  1YAT A;  5DIU A;  3H9R B;  4DH0 A;  1W1Y A;  1XRV A;  2XP3 A;  4DRO A;  1O6I A;  4ZS6 A;  1FKD A;  3O5O A;  3WD0 A;  3UI5 A;  3TC5 A;  2PN0 A;  1HKI A;  3G6M A;  2XP6 A;  3AQU A;  4Z2G A;  4R0X A;  2ETN A;  1U79 A;  4KR0 B;  4MNL A;  1Q6I A;  2KO7 A;  2DSZ A;  4JFL A;  1OGG A;  1W1P A;  4MSP A;  2OFN A;  2F21 A;  1E6P A;  2XP7 A;  4TW6 A;  3UQB A;  4UDM A;  2EUL A;  2Y78 A;  4DRQ A;  1UR9 A;  4DZ3 A;  3JYJ A;  5DF0 A;  4DIP A;  4WKA A;  3EY6 A;  1PIN A;  3ARR A;  1HJV A;  2FDM A;  2KI3 A;  3O5R A;  4LAY A;  1JNT A;  1ITX A;  3KAG A;  4ZPT R;  4JFJ A;  2N87 A;  1W26 A;  4JFM A;  1FJD A;  4WIW A;  1E6N A;  2PV2 A;  3O5I A;  5DO2 A;  1F40 A;  4LAV A;  2VCD A;  1JVW A;  3NRK A;  1E44 A;  5DIV A;  1J4R A;  4DWS C;  2IF4 A;  4DZ2 A;  1FKS A;  4AY1 A;  1HKJ A;  4ODN A;  1ZBV A;  4IT6 A;  3ALF A;  5BXJ A;  2G8Z A;  3ARU A;  3ARY A;  4MAV A;  2A3E A;  2ZQT A;  4L3N A;  4BF8 A;  4P8U A;  5HKG A;  3O5G A;  2D9F A;  1C9H A;  1NH6 A;  2IUZ A;  2MF9 A;  4ODR A;  5JH8 A;  2ZQU A;  3WH0 A;  4Z2L A;  5B8I C;  1LL6 A;  1FAP A;  2MLX A;  1FKR A;  1WAW A;  2M2A A;  4G50 A;  3MDY B;  2XPB A;  3B9A A;  4MPK A;  1HJW A;  2KGJ A;  1X6N A;  4P8X A;  4IQC A;  4U86 A;  2DT1 A;  3WD1 A;  4P8V A;  1NWR A;  1EHN A;  1Y0O A;  4Q7N A;  4PTM A;  1NMV A;  5J6E A;  3O5K A;  3CHC A;  1JNS A;  4QZV B;  2B5U B;  1P5Q A;  1NWS A;  4J4O A;  1Q6U A;  3B8S A;  3UF8 A;  2DG9 A;  2PI6 A;  2RUC A;  1HKK A;  3FAP A;  4JFK A;  2ZR4 A;  4MGV A;  4C02 B;  4DWS D;  2DPE A;  2AOS A;  1KT0 A;  3QOK A;  3CHD A;  5GPR A;  1LL7 A;  1FKH A;  3KAH A;  2RQS A;  1OWQ A;  1T11 A;  1CTN A;  4L72 B;  1ROT A;  1QPL A;  4N19 A;  1J6Y A;  3B9E A;  3KAB A;  1WB0 A;  1FKK A;  4S3J A;  1RD6 A;  3O5E A;  4W9Q A;  3KAI A;  4JFI A;  1QPF A;  1HXV A;  3ARX A;  4U84 A;  3ARS A;  1LG2 A;  5DIT A;  2JZV A;  3PRD A;  3ODK A;  1J4I A;  3GU0 A;  1H0G A;  2L2S A;  3UQA A;  3B9D A;  4KQZ A;  1FFQ A;  5GPG A;  3NI6 A;  4ODL A;  2ZR5 A;  4WK9 A;  3O5J A;  1R9H A;  1E15 A;  3WD3 A;  4MTV A;  2A3B A;  1W9P A;  3RME A;  2DSW A;  2RUD A;  4DRN A;  3UQI A;  1ZL1 A;  2DT0 A;  4ODM A;  4O2T A;  4ZPW R;  1GUV A;  2A3C A;  4U85 A;  2DT2 A;  3RFW A;  3CHE A;  4XAK A;  2O92 A;  3ALG A;  5HTG A;  3WL1 A;  1LL4 A;  3BMB A;  1D6O A;  3KAC A;  4QT2 A;  4Z2J A;  3WQV A;  2P4V A;  3CHF A;  4GIV A;  3ART A;  3NTP A;  4ITZ A;  3CGM A;  1ZCN A;  1ROU A;  1IX5 A;  2WM0 A;  2KFW A;  2O9O A;  2M1I A;  3EIP A;  4QIB A;  4JYS A;  4ML4 A;  3PRA A;  4IPX A;  3OOB A;  4DRM A;  2ZQV A;  3KZ7 A;  3TDB A;  4NZC A;  4NNR A;  2WK2 A;  3O5L A;  2YBT A;  3O5P A;  3WD2 A;  3ARP A;  2F23 A;  3WIJ A;  4MNJ A;  3UI4 A;  1K9T A;  2DSV A;  4MNK A;  1NMW A;  4P8W A;  3IHZ A;  2A3A A;  4WJX A;  2ITK A;  4DT4 A;  3RM4 A;  3I6C A;  4TW7 A;  3O5Q A;  2G41 A;  5I98 A;  1B6C A;  2WLZ A;  2M08 A;  2RUQ A;  3JXV A;  2LPV A;  4ODO A;  1ZBW A;  3FY1 A;  3ARO A;  3AS3 A;  1JND A;  2Q5A A;  1FKB A;  4URI A;  1YW5 A;  4IQ2 A;  3PRB A;  3FXY A;  2KR7 A;  2KE0 A;  3IK8 A;  4W9O A;  2PPP A;  2MLZ A;  1J4H A;  3KAF A;  2FKE A;  2PBC A;  2XP5 A;  1X6L A;  4ZPV R;  2ZQS A;  3WQW A;  2MNT A;  1FKG A;  1W9U A;  4ODQ A;  5HUA A;  4TX0 A;  1FKL A;  2PV3 A;  1D7H A;  2MLY A;  4W9P A;  3VAW A;  1FKI A;  4S3K A;  3CZ8 A;  3IKD A;  3CH9 A;  1OGB A;  5HW8 A;  1D7I A;  1ZK6 A;  1E6Z A;  1F8A B;  4HBO A;  3AS0 A;  3AS2 A;  5HBF A;  1Q1C A;  3BXW A;  2LJ4 A;  3WKZ A;  1EIB A;  4TYO A;  2ZR6 A;  3IKG A;  3RM9 A;  1GRJ A;  4WKH A;  1BKF A;  1HJX A;  1W1V A;  2DSU A;  4IT4 A;  4NSB A;  4ODP A;  4DRI A;  1NSG A;  4HAR A;  3KAD A;  2RUR A;  3JYM A;  2DG3 A;  3RM8 A;  1N1A A;  2LGO A;  5HWC A;  2F4E A;  3LUO A;  4DWS B;  1A7X A;  2ESC A;  4Q22 A;  3O5F A;  4Z2I A;  3ARV A;  2OLH A;  1LQ0 A;  3CGN A;  1W1T A;  1QZ2 A;  3PR9 A;  4QT3 A;  1L1P A;  3G6L A;  1KT1 A;  2XP4 A;  1ZBK A;  5GQB A;  1FD9 A;  1D2K A;  2DG4 A;  2PV1 A;  3GPK A;  4LAX A;  1H0I A;  1ZB5 A;  2AWG A;  2WLY A;  1SYT A;  1KFW A; 
#chains in the Genus database with same CATH homology
 3ARZ A;  5HW6 A;  5D75 A;  3WD4 A;  1NWT A;  3OA5 A;  4GGQ A;  4ODK A;  3PA7 A;  1HKM A;  4HBE A;  1XHG A;  2XP8 A;  2FAP A;  4J4N A;  1BL4 A;  1ZBC A;  1VF8 A;  1SR0 A;  4TW8 A;  2XPA A;  2LKN A;  1EYM A;  1FKT A;  1EDQ A;  3UI6 A;  4MNM A;  2QF8 A;  1W9V A;  2RSE A;  2PPO A;  1TCO C;  5HW7 A;  5HT1 A;  4DRJ A;  3TCZ A;  3KCE A;  2DT3 A;  4TNS A;  3WL0 A;  4LAW A;  3ARQ A;  2UZ5 A;  4Z2H A;  4R5E A;  1Q6H A;  1ZU8 A;  4DRH A;  5DEZ A;  1NWU A;  1M5Y A;  4Z2K A;  3B7X A;  1TFV A;  1FKJ A;  4G2P A;  2K8I A;  1GOI A;  2F2D A;  3RGC A;  3O5M A;  3AS1 A;  2XP9 A;  1LG1 A;  1FFR A;  4DRP A;  4WKF A;  1FKF A;  4DWS A;  1PBK A;  1EQ3 A;  1LJY A;  4W5U A;  4FAP A;  3O5D A;  1E9L A;  1GPF A;  1JNE A;  2PPN A;  3W4R A;  1E6R A;  2MPH A;  5HWB A;  4LGX A;  4DRK A;  2B31 A;  2YBU A;  1WNO A;  2VN1 A;  3ARW A;  1D7J A;  1UR8 A;  4FN2 A;  1YAT A;  5DIU A;  3H9R B;  4DH0 A;  1W1Y A;  1XRV A;  2XP3 A;  4DRO A;  1O6I A;  4ZS6 A;  1FKD A;  3O5O A;  3WD0 A;  3UI5 A;  3TC5 A;  1HKI A;  3G6M A;  2XP6 A;  3AQU A;  4Z2G A;  4R0X A;  1U79 A;  4KR0 B;  4MNL A;  1Q6I A;  2KO7 A;  2DSZ A;  4JFL A;  1OGG A;  1W1P A;  4MSP A;  2OFN A;  2F21 A;  1E6P A;  2XP7 A;  4TW6 A;  3UQB A;  2Y78 A;  4DRQ A;  1UR9 A;  4DZ3 A;  3JYJ A;  5DF0 A;  4DIP A;  4WKA A;  3EY6 A;  1PIN A;  3ARR A;  1HJV A;  2FDM A;  2KI3 A;  3O5R A;  4LAY A;  1JNT A;  1ITX A;  3KAG A;  4ZPT R;  4JFJ A;  2N87 A;  1W26 A;  4JFM A;  1FJD A;  4WIW A;  1E6N A;  2PV2 A;  3O5I A;  5DO2 A;  1F40 A;  4LAV A;  2VCD A;  1JVW A;  3NRK A;  5DIV A;  1J4R A;  4DWS C;  2IF4 A;  4DZ2 A;  1FKS A;  4AY1 A;  1HKJ A;  4ODN A;  1ZBV A;  4IT6 A;  3ALF A;  5BXJ A;  2G8Z A;  3ARU A;  3ARY A;  4MAV A;  2A3E A;  2ZQT A;  4L3N A;  4BF8 A;  4P8U A;  5HKG A;  3O5G A;  2D9F A;  1C9H A;  1NH6 A;  2IUZ A;  2MF9 A;  4ODR A;  5JH8 A;  2ZQU A;  3WH0 A;  4Z2L A;  5B8I C;  1LL6 A;  1FAP A;  2MLX A;  1FKR A;  1WAW A;  2M2A A;  4G50 A;  3MDY B;  2XPB A;  3B9A A;  4MPK A;  1HJW A;  2KGJ A;  1X6N A;  4P8X A;  4IQC A;  4U86 A;  2DT1 A;  3WD1 A;  4P8V A;  1NWR A;  1EHN A;  1Y0O A;  4Q7N A;  4PTM A;  1NMV A;  5J6E A;  3O5K A;  3CHC A;  1JNS A;  4QZV B;  1P5Q A;  1NWS A;  4J4O A;  1Q6U A;  3B8S A;  3UF8 A;  2DG9 A;  4JFK A;  2RUC A;  2PI6 A;  1HKK A;  3FAP A;  2ZR4 A;  4MGV A;  4C02 B;  4DWS D;  2DPE A;  2AOS A;  1KT0 A;  3QOK A;  3CHD A;  5GPR A;  1LL7 A;  1FKH A;  3KAH A;  2RQS A;  1OWQ A;  1T11 A;  1CTN A;  4L72 B;  1ROT A;  1QPL A;  4N19 A;  1J6Y A;  3B9E A;  3KAB A;  1WB0 A;  1FKK A;  4S3J A;  1RD6 A;  3O5E A;  4W9Q A;  3KAI A;  4JFI A;  1QPF A;  1HXV A;  3ARX A;  4U84 A;  3ARS A;  1LG2 A;  5DIT A;  2JZV A;  3PRD A;  3ODK A;  1J4I A;  1H0G A;  2L2S A;  3UQA A;  3B9D A;  4KQZ A;  1FFQ A;  5GPG A;  3NI6 A;  4ODL A;  2ZR5 A;  4WK9 A;  3O5J A;  1R9H A;  1E15 A;  3WD3 A;  4MTV A;  2A3B A;  1W9P A;  3RME A;  2DSW A;  2RUD A;  4DRN A;  3UQI A;  1ZL1 A;  2DT0 A;  4ODM A;  4O2T A;  4ZPW R;  1GUV A;  2A3C A;  4U85 A;  2DT2 A;  3RFW A;  3CHE A;  4XAK A;  2O92 A;  3ALG A;  5HTG A;  3WL1 A;  1LL4 A;  1D6O A;  3KAC A;  4QT2 A;  4Z2J A;  3WQV A;  3CHF A;  4GIV A;  3ART A;  3NTP A;  4ITZ A;  3CGM A;  1ZCN A;  1ROU A;  1IX5 A;  2WM0 A;  2KFW A;  2O9O A;  2M1I A;  4QIB A;  4JYS A;  4ML4 A;  3PRA A;  4IPX A;  3OOB A;  4DRM A;  2ZQV A;  3KZ7 A;  3TDB A;  4NZC A;  4NNR A;  2WK2 A;  3O5L A;  2YBT A;  3O5P A;  3WD2 A;  3ARP A;  3WIJ A;  4MNJ A;  3UI4 A;  1K9T A;  2DSV A;  4MNK A;  1NMW A;  4P8W A;  3IHZ A;  2A3A A;  4WJX A;  2ITK A;  4DT4 A;  3RM4 A;  3I6C A;  4TW7 A;  3O5Q A;  2G41 A;  5I98 A;  1B6C A;  2WLZ A;  2M08 A;  2RUQ A;  3JXV A;  2LPV A;  4ODO A;  1ZBW A;  3FY1 A;  3ARO A;  3AS3 A;  1JND A;  2Q5A A;  1FKB A;  4URI A;  1YW5 A;  4IQ2 A;  3PRB A;  3FXY A;  2KR7 A;  2KE0 A;  3IK8 A;  4W9O A;  2PPP A;  2MLZ A;  1J4H A;  3KAF A;  2FKE A;  2PBC A;  2XP5 A;  1X6L A;  4ZPV R;  2ZQS A;  3WQW A;  2MNT A;  1FKG A;  1W9U A;  4ODQ A;  5HUA A;  4TX0 A;  1FKL A;  2PV3 A;  1D7H A;  2MLY A;  4W9P A;  3VAW A;  1FKI A;  4S3K A;  3CZ8 A;  3IKD A;  3CH9 A;  1OGB A;  5HW8 A;  1D7I A;  1ZK6 A;  1E6Z A;  1F8A B;  4HBO A;  3AS0 A;  3AS2 A;  5HBF A;  1Q1C A;  3BXW A;  2LJ4 A;  3WKZ A;  1EIB A;  4TYO A;  2ZR6 A;  3IKG A;  3RM9 A;  4WKH A;  1BKF A;  1HJX A;  1W1V A;  2DSU A;  4IT4 A;  4NSB A;  4ODP A;  4DRI A;  1NSG A;  4HAR A;  3KAD A;  2RUR A;  3JYM A;  2DG3 A;  3RM8 A;  1N1A A;  2LGO A;  5HWC A;  2F4E A;  3LUO A;  4DWS B;  1A7X A;  2ESC A;  4Q22 A;  3O5F A;  4Z2I A;  3ARV A;  2OLH A;  1LQ0 A;  3CGN A;  1W1T A;  1QZ2 A;  3PR9 A;  4QT3 A;  1L1P A;  3G6L A;  1KT1 A;  2XP4 A;  1ZBK A;  5GQB A;  1FD9 A;  1D2K A;  2DG4 A;  2PV1 A;  3GPK A;  4LAX A;  1H0I A;  1ZB5 A;  2AWG A;  2WLY A;  1SYT A;  1KFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...