1D7HA

Fkbp complexed with dmso
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7hA00
4GIVA 3KAIA 4IQCA 2K8IA 1NSGA 1J4IA 1FKIA 3UF8A 3O5DA 4C02B 3TC5A 4DIPA 3NI6A 1Q6HA 1ZCNA 1D7HA 4JFIA 2XP4A 5HT1A 4TW8A 4U86A 4DROA 1YW5A 1ZK6A 3IKDA 1FKGA 4G50A 3MDYB 2M2AA 4O2TA 5HW8A 4DRHA 4MSPA 3NRKA 4GGQA 4ODMA 3IHZA 3WH0A 4DH0A 5HW7A 3CGNA 3IK8A 2KGJA 1QPFA 4U84A 3RFWA 1M5YA 2PV2A 2RQSA 3KAGA 4U85A 1PBKA 5D75A 3JYJA 4ODOA 4DRQA 4J4OA 1J4RA 3PRDA 5HKGA 4DRIA 2KI3A 3KAHA 1JNSA 1ROUA 2PBCA 5HTGA 2F2DA 1EYMA 1R9HA 3PA7A 1FKBA 4QT3A 3UQAA 3TDBA 1QPLA 4DRJA 3TCZA 3PRBA 2ITKA 3KCEA 2FKEA 4G2PA 4R0XA 2XP8A 2KE0A 1YATA 4TYOA 2RUQA 2LJ4A 1L1PA 2VCDA 3UQBA 3UI4A 2XPAA 4TNSA 2LPVA 2ZQTA 4W9PA 1TCOC 4NNRA 1W26A 1BL4A 1FKTA 1A7XA 2VN1A 4IQ2A 2ZR5A 3O5MA 1FKLA 1Q6IA 2XP5A 2PV3A 3FAPA 2RUDA 1FAPA 2D9FA 1C9HA 2Q5AA 1FKRA 2ZQUA 2MF9A 4BF8A 4LAXA 3VAWA 2LKNA 5DIVA 1FJDA 1FKKA 5HUAA 1J6YA 1NMVA 4QT2A 2MPHA 3O5QA 3KACA 2XP7A 2MLYA 2XPBA 1D7JA 2ZR4A 2ZR6A 3IKGA 1Q1CA 3O5GA 3OOBA 1FKHA 3JXVA 2RSEA 2DG9A 3B7XA 1FKJA 3O5KA 1FKFA 2LGOA 2RURA 3KABA 3O5LA 3I6CA 3CGMA 3O5RA 5HWCA 4ODRA 4JYSA 2Y78A 3H9RB 4W9QA 3UI5A 1EQ3A 2OFNA 1P5QA 2IF4A 3NTPA 3O5PA 3UQIA 1FKSA 4JFLA 1Y0OA 2N87A 2PPPA 2KO7A 2UZ5A 4DT4A 1F40A 1D6OA 1N1AA 1NMWA 2M08A 3JYMA 1HXVA 2MLXA 4MGVA 2XP9A 5DIUA 4ITZA 2ZQSA 2F4EA 5HW6A 1BKFA 2XP6A 1U79A 2JZVA 3KADA 3O5FA 1ROTA 1JNTA 4JFMA 4QIBA 5I98A 5B8IC 2PPOA 2PPNA 3KAFA 4TX0A 4DZ3A 2DG4A 4ODQA 2L2SA 4N19A 4W9OA 3RGCA 4JFJA 3KZ7A 5HWBA 2AWGA 2FAPA 2PV1A 3LUOA 4DRMA 4ODKA 1JVWA 2MNTA 3EY6A 4ODPA 4DRKA 1D7IA 2KFWA 3O5IA 5BXJA 1B6CA 1FKDA 2KR7A 4DZ2A 5J6EA 1KT1A 1J4HA 4FN2A 2DG3A 3GPKA 4IPXA 2ZQVA 4J4NA 4LAYA 1PINA 4ODLA 3ODKA 5DITA 3UI6A 1F8AB 2M1IA 1T11A 4FAPA 1FD9A 1QZ2A 3O5JA 2F21A 4TW7A 2MLZA 4LAVA 4TW6A 5GPGA 1KT0A 4DRNA 1Q6UA 3O5OA 3O5EA 2XP3A 4ODNA 4JFKA 2RUCA 4DRPA 4LAWA
chains in the Genus database with same CATH superfamily
3UF8A 1NSGA 3TC5A 1UR8A 1ZCNA 2XP4A 4MNKA 4ZS6A 3MDYB 3NRKA 3WD4A 4ODMA 3B9EA 3WQWA 1OWQA 5D75A 4ODOA 4QT3A 1EDQA 1E6NA 3TDBA 3W4RA 1CTNA 1YATA 3OA5A 2RUQA 3GTYX 2VCDA 3UQBA 3UI4A 2XPAA 4R5EA 1HKMA 1BL4A 1FKTA 4Z2LA 4P8XA 1XHGA 1FKLA 1Q6IA 2XP5A 2DSWA 3ARWA 1C9HA 2Q5AA 2ESCA 2PN0A 2MF9A 4HARA 2A3EA 4LAXA 4BF8A 1FKKA 4QT2A 3KACA 2ZR6A 2XPBA 1E9LA 1E44A 4DWSC 3O5KA 2WLZA 1W9PA 2DT2A 2OLHA 3O5LA 3I6CA 3CGMA 3O5RA 4W5UA 4DWSB 4W9QA 3UQIA 4ML4A 1FKSA 2UZ5A 2DSVA 3RMEA 1O6IA 3ALFA 5DIUA 3G6MA 5HW6A 3WL1A 1U79A 2JZVA 4TX0A 3WL0A 2A3AA 3AQUA 3KZ7A 4MPKA 1ZBKA 5HWBA 4PTMA 2PV1A 1ZB5A 2O9OA 4DRMA 2MNTA 4QZVB 3B9DA 3ARRA 2ZQVA 2WK2A 2G8ZA 4ODLA 3ODKA 5DITA 4URIA 5DEZA 2M1IA 4FAPA 1FD9A 2QF8A 2MLZA 3ARZA 5HBFA 2YBTA 3O5EA 4ODNA 4JFKA 1ZBVA 4DRPA 1GPFA 4IQCA 2K8IA 1FKIA 4L3NA 1LL4A 4DIPA 1Q6HA 1D7HA 4NZCA 1GRJA 3IKDA 1FKGA 1LJYA 4O2TA 2M2AA 3WKZA 2WLYA 4MSPA 3CHCA 3WH0A 3ARTA 3IK8A 1LL7A 1QPFA 4U84A 2P4VA 4DRQA 1E6PA 4L72B 1J4RA 3QOKA 5HKGA 2WM0A 2KI3A 1HKJA 5HTGA 2F2DA 1EYMA 1W1VA 4DRJA 2ITKA 4KR0B 2KE0A 3ARPA 1NWRA 1W9VA 3WQVA 2ZQTA 1K9TA 1TCOC 1JNEA 1ZL1A 2VN1A 2DT3A 3CZ8A 1E15A 2RUDA 1FKRA 4ZPWR 1X6NA 1JCHB 4P8UA 2LKNA 4DWSA 3ARQA 4NSBA 1NMVA 3O5QA 1D7JA 2DT1A 1Q1CA 3OOBA 1FFQA 3B7XA 1FKJA 2LGOA 4ODRA 4KQZA 3WIJA 1EQ3A 1WB0A 1P5QA 2N87A 1F40A 2DPEA 2M08A 2MLXA 3ARVA 2XP9A 2ZQSA 2F4EA 3KADA 3ARSA 4JFMA 5I98A 4DZ3A 4ODQA 2L2SA 4WKAA 1H0IA 4JFJA 1LG2A 2AWGA 1JVWA 1E6ZA 1FKDA 1HKIA 4LGXA 5J6EA 4DWSD 1KT1A 4FN2A 2DG3A 1D2KA 4J4NA 4Z2HA 3B8SA 3AS2A 1T11A 1QZ2A 1ZU8A 2F21A 4TW6A 1KT0A 4ZPTR 2XP3A 2IUZA 4LAWA 3FY1A 2DSUA 1XRVA 1GOIA 3NI6A 5HT1A 4JFIA 4DROA 1ZK6A 4IT6A 5HW8A 4WKFA 3IHZA 1WAWA 2KGJA 1LL6A 4S3KA 4ZPVR 3RFWA 2PV2A 2RQSA 2FDMA 3ARUA 4WK9A 3WD1A 3AS0A 3PRDA 4DRIA 3KAHA 2PBCA 3WD0A 3EIPA 1FKBA 1W1PA 4P8WA 3UQAA 1QPLA 3GU0A 4G2PA 2XP8A 2LJ4A 1L1PA 4NNRA 4Z2JA 1W26A 1JNDA 4MNLA 4MAVA 3B9AA 2PV3A 2B31A 2D9FA 2ZQUA 1LG1A 2PI6A 3VAWA 4IT4A 5DIVA 1NWTA 5HUAA 2DT0A 1J6YA 2MPHA 2XP7A 2MLYA 2ZR4A 1TFVA 1FKHA 2RSEA 1FKFA 2RURA 3KABA 5HWCA 3CH9A 3H9RB 1VF8A 2OFNA 2IF4A 3NTPA 3O5PA 1HXVA 4DT4A 2PPPA 2AOSA 1NH6A 1D6OA 1WNOA 4MGVA 4ITZA 3ARYA 3FXYA 2XP6A 4WJXA 3O5FA 1ROTA 2YBUA 2PPOA 2PPNA 3KAFA 1ITXA 1H0GA 2G41A 3BXWA 3RGCA 2FAPA 3WD3A 4ODPA 4HBEA 5BXJA 3O5IA 1NWSA 1B6CA 3GPKA 1X6LA 4LAYA 3CHDA 3UI6A 1F8AB 2ETNA 4LAVA 5GPGA 5DF0A 1EHNA 3O5OA 1KFWA 2RUCA 4P8VA 4GIVA 4WKHA 3KAIA 1J4IA 3O5DA 4C02B 3RM8A 4Z2IA 4TW8A 4U86A 1YW5A 4G50A 4DRHA 4GGQA 5HW7A 4DH0A 3CGNA 1M5YA 3KAGA 3PRAA 4U85A 3ARXA 4MNJA 3RM9A 1PBKA 4MNMA 3JYJA 1HJVA 2EULA 4J4OA 3RM4A 1JNSA 1ROUA 4WIWA 4MTVA 1R9HA 3PA7A 2F23A 1W1YA 3TCZA 3PRBA 3KCEA 2FKEA 4R0XA 4TYOA 1SR0A 2A3BA 3WD2A 2B5UB 1GUVA 4Z2KA 4TNSA 2LPVA 4W9PA 1IX5A 1A7XA 4IQ2A 2ZR5A 3O5MA 1E6RA 5JH8A 3FAPA 1FAPA 1LQ0A 1RD6A 2A3CA 1FJDA 2DSZA 3IKGA 1HJXA 3O5GA 3CHFA 1ZBCA 4Q22A 3JXVA 2DG9A 1W9UA 4Q7NA 4JYSA 2Y78A 3G6LA 3UI5A 4JFLA 1Y0OA 2KO7A 3AS3A 4XAKA 3JYMA 1N1AA 1NMWA 1W1TA 1BKFA 1OGBA 1JNTA 4QIBA 5B8IC 1ZBWA 1EIBA 2DG4A 1SYTA 4N19A 3CHEA 4W9OA 5GQBA 1OGGA 3LUOA 4ODKA 3EY6A 3BMBA 4DRKA 1D7IA 2KFWA 3AS1A 4HBOA 2KR7A 4DZ2A 3AROA 1J4HA 4IPXA 1HKKA 4S3JA 1FFRA 5DO2A 3ALGA 4AY1A 1PINA 4Z2GA 3O5JA 5GPRA 3PR9A 1NWUA 4TW7A 2O92A 1HJWA 4DRNA 1Q6UA 1UR9A 4UDMA
chains in the Genus database with same CATH topology
3UF8A 1NSGA 3TC5A 1UR8A 1ZCNA 2XP4A 4MNKA 4ZS6A 3MDYB 3NRKA 3WD4A 4ODMA 3B9EA 3WQWA 1OWQA 5D75A 4ODOA 4QT3A 1EDQA 1E6NA 3TDBA 3W4RA 1CTNA 1YATA 3OA5A 2RUQA 2VCDA 3UQBA 3UI4A 2XPAA 4R5EA 1HKMA 1BL4A 1FKTA 4Z2LA 4P8XA 1XHGA 1FKLA 1Q6IA 2XP5A 2DSWA 3ARWA 1C9HA 2Q5AA 2ESCA 2MF9A 4HARA 2A3EA 4LAXA 4BF8A 1FKKA 4QT2A 3KACA 2ZR6A 2XPBA 1E9LA 4DWSC 3O5KA 2WLZA 1W9PA 2DT2A 2OLHA 3O5LA 3I6CA 3CGMA 3O5RA 4W5UA 4DWSB 4W9QA 3UQIA 4ML4A 1FKSA 2UZ5A 2DSVA 3RMEA 1O6IA 3ALFA 5DIUA 3G6MA 5HW6A 3WL1A 1U79A 2JZVA 4TX0A 3WL0A 2A3AA 3AQUA 3KZ7A 4MPKA 1ZBKA 5HWBA 4PTMA 2PV1A 1ZB5A 2O9OA 4DRMA 2MNTA 4QZVB 3B9DA 3ARRA 2ZQVA 2WK2A 2G8ZA 4ODLA 3ODKA 5DITA 4URIA 5DEZA 2M1IA 4FAPA 1FD9A 2QF8A 2MLZA 3ARZA 5HBFA 2YBTA 3O5EA 4ODNA 4JFKA 1ZBVA 4DRPA 1GPFA 4IQCA 2K8IA 1FKIA 4L3NA 1LL4A 4DIPA 1Q6HA 1D7HA 4NZCA 3IKDA 1FKGA 1LJYA 4O2TA 2M2AA 3WKZA 2WLYA 4MSPA 3CHCA 3WH0A 3ARTA 3IK8A 1LL7A 1QPFA 4U84A 4DRQA 1E6PA 4L72B 1J4RA 3QOKA 5HKGA 2WM0A 2KI3A 1HKJA 5HTGA 2F2DA 1EYMA 1W1VA 4DRJA 2ITKA 4KR0B 2KE0A 3ARPA 1NWRA 1W9VA 3WQVA 2ZQTA 1K9TA 1TCOC 1JNEA 1ZL1A 2VN1A 2DT3A 3CZ8A 1E15A 2RUDA 1FKRA 4ZPWR 1X6NA 4P8UA 2LKNA 4DWSA 3ARQA 4NSBA 1NMVA 3O5QA 1D7JA 2DT1A 1Q1CA 3OOBA 1FFQA 3B7XA 1FKJA 2LGOA 4ODRA 4KQZA 3WIJA 1EQ3A 1WB0A 1P5QA 2N87A 1F40A 2DPEA 2M08A 2MLXA 3ARVA 2XP9A 2ZQSA 2F4EA 3KADA 3ARSA 4JFMA 5I98A 4DZ3A 4ODQA 2L2SA 4WKAA 1H0IA 4JFJA 1LG2A 2AWGA 1JVWA 1E6ZA 1FKDA 1HKIA 4LGXA 5J6EA 4DWSD 1KT1A 4FN2A 2DG3A 1D2KA 4J4NA 4Z2HA 3B8SA 3AS2A 1T11A 1QZ2A 1ZU8A 2F21A 4TW6A 1KT0A 4ZPTR 2XP3A 2IUZA 4LAWA 3FY1A 2DSUA 1XRVA 1GOIA 3NI6A 5HT1A 4JFIA 4DROA 1ZK6A 4IT6A 5HW8A 4WKFA 3IHZA 1WAWA 2KGJA 1LL6A 4S3KA 4ZPVR 3RFWA 2PV2A 2RQSA 2FDMA 3ARUA 4WK9A 3WD1A 3AS0A 3PRDA 4DRIA 3KAHA 2PBCA 3WD0A 1FKBA 1W1PA 4P8WA 3UQAA 1QPLA 4G2PA 2XP8A 2LJ4A 1L1PA 4NNRA 4Z2JA 1W26A 1JNDA 4MNLA 4MAVA 3B9AA 2PV3A 2B31A 2D9FA 2ZQUA 1LG1A 2PI6A 3VAWA 4IT4A 5DIVA 1NWTA 5HUAA 2DT0A 1J6YA 2MPHA 2XP7A 2MLYA 2ZR4A 1TFVA 1FKHA 2RSEA 1FKFA 2RURA 3KABA 5HWCA 3CH9A 3H9RB 1VF8A 2OFNA 2IF4A 3NTPA 3O5PA 1HXVA 4DT4A 2PPPA 2AOSA 1NH6A 1D6OA 1WNOA 4MGVA 4ITZA 3ARYA 3FXYA 2XP6A 4WJXA 3O5FA 1ROTA 2YBUA 2PPOA 2PPNA 3KAFA 1ITXA 1H0GA 2G41A 3BXWA 3RGCA 2FAPA 3WD3A 4ODPA 4HBEA 5BXJA 3O5IA 1NWSA 1B6CA 3GPKA 1X6LA 4LAYA 3CHDA 3UI6A 1F8AB 4LAVA 5GPGA 5DF0A 1EHNA 3O5OA 1KFWA 2RUCA 4P8VA 4GIVA 4WKHA 3KAIA 1J4IA 3O5DA 4C02B 3RM8A 4Z2IA 4TW8A 4U86A 1YW5A 4G50A 4DRHA 4GGQA 5HW7A 4DH0A 3CGNA 1M5YA 3KAGA 3PRAA 4U85A 3ARXA 4MNJA 3RM9A 1PBKA 4MNMA 3JYJA 1HJVA 4J4OA 3RM4A 1JNSA 1ROUA 4WIWA 4MTVA 1R9HA 3PA7A 1W1YA 3TCZA 3PRBA 3KCEA 2FKEA 4R0XA 4TYOA 1SR0A 2A3BA 3WD2A 1GUVA 4Z2KA 4TNSA 2LPVA 4W9PA 1IX5A 1A7XA 4IQ2A 2ZR5A 3O5MA 1E6RA 5JH8A 3FAPA 1FAPA 1LQ0A 1RD6A 2A3CA 1FJDA 2DSZA 3IKGA 1HJXA 3O5GA 3CHFA 1ZBCA 4Q22A 3JXVA 2DG9A 1W9UA 4Q7NA 4JYSA 2Y78A 3G6LA 3UI5A 4JFLA 1Y0OA 2KO7A 3AS3A 4XAKA 3JYMA 1N1AA 1NMWA 1W1TA 1BKFA 1OGBA 1JNTA 4QIBA 5B8IC 1ZBWA 1EIBA 2DG4A 1SYTA 4N19A 3CHEA 4W9OA 5GQBA 1OGGA 3LUOA 4ODKA 3EY6A 4DRKA 1D7IA 2KFWA 3AS1A 4HBOA 2KR7A 4DZ2A 3AROA 1J4HA 4IPXA 1HKKA 4S3JA 1FFRA 5DO2A 3ALGA 4AY1A 1PINA 4Z2GA 3O5JA 5GPRA 3PR9A 1NWUA 4TW7A 2O92A 1HJWA 4DRNA 1Q6UA 1UR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIV A;  3KAI A;  4IQC A;  2K8I A;  1NSG A;  1J4I A;  1FKI A;  3UF8 A;  3O5D A;  4C02 B;  3TC5 A;  4DIP A;  3NI6 A;  1Q6H A;  1ZCN A;  1D7H A;  4JFI A;  2XP4 A;  5HT1 A;  4TW8 A;  4U86 A;  4DRO A;  1YW5 A;  1ZK6 A;  3IKD A;  1FKG A;  4G50 A;  3MDY B;  2M2A A;  4O2T A;  5HW8 A;  4DRH A;  4MSP A;  3NRK A;  4GGQ A;  4ODM A;  3IHZ A;  3WH0 A;  4DH0 A;  5HW7 A;  3CGN A;  3IK8 A;  2KGJ A;  1QPF A;  4U84 A;  3RFW A;  1M5Y A;  2PV2 A;  2RQS A;  3KAG A;  4U85 A;  1PBK A;  5D75 A;  3JYJ A;  4ODO A;  4DRQ A;  4J4O A;  1J4R A;  3PRD A;  5HKG A;  4DRI A;  2KI3 A;  3KAH A;  1JNS A;  1ROU A;  2PBC A;  5HTG A;  2F2D A;  1EYM A;  1R9H A;  3PA7 A;  1FKB A;  4QT3 A;  3UQA A;  3TDB A;  1QPL A;  4DRJ A;  3TCZ A;  3PRB A;  2ITK A;  3KCE A;  2FKE A;  4G2P A;  4R0X A;  2XP8 A;  2KE0 A;  1YAT A;  4TYO A;  2RUQ A;  2LJ4 A;  1L1P A;  2VCD A;  3UQB A;  3UI4 A;  2XPA A;  4TNS A;  2LPV A;  2ZQT A;  4W9P A;  1TCO C;  4NNR A;  1W26 A;  1BL4 A;  1FKT A;  1A7X A;  2VN1 A;  4IQ2 A;  2ZR5 A;  3O5M A;  1FKL A;  1Q6I A;  2XP5 A;  2PV3 A;  3FAP A;  2RUD A;  1FAP A;  2D9F A;  1C9H A;  2Q5A A;  1FKR A;  2ZQU A;  2MF9 A;  4BF8 A;  4LAX A;  3VAW A;  2LKN A;  5DIV A;  1FJD A;  1FKK A;  5HUA A;  1J6Y A;  1NMV A;  4QT2 A;  2MPH A;  3O5Q A;  3KAC A;  2XP7 A;  2MLY A;  2XPB A;  1D7J A;  2ZR4 A;  2ZR6 A;  3IKG A;  1Q1C A;  3O5G A;  3OOB A;  1FKH A;  3JXV A;  2RSE A;  2DG9 A;  3B7X A;  1FKJ A;  3O5K A;  1FKF A;  2LGO A;  2RUR A;  3KAB A;  3O5L A;  3I6C A;  3CGM A;  3O5R A;  5HWC A;  4ODR A;  4JYS A;  2Y78 A;  3H9R B;  4W9Q A;  3UI5 A;  1EQ3 A;  2OFN A;  1P5Q A;  2IF4 A;  3NTP A;  3O5P A;  3UQI A;  1FKS A;  4JFL A;  1Y0O A;  2N87 A;  2PPP A;  2KO7 A;  2UZ5 A;  4DT4 A;  1F40 A;  1D6O A;  1N1A A;  1NMW A;  2M08 A;  3JYM A;  1HXV A;  2MLX A;  4MGV A;  2XP9 A;  5DIU A;  4ITZ A;  2ZQS A;  2F4E A;  5HW6 A;  1BKF A;  2XP6 A;  1U79 A;  2JZV A;  3KAD A;  3O5F A;  1ROT A;  1JNT A;  4JFM A;  4QIB A;  5I98 A;  5B8I C;  2PPO A;  2PPN A;  3KAF A;  4TX0 A;  4DZ3 A;  2DG4 A;  4ODQ A;  2L2S A;  4N19 A;  4W9O A;  3RGC A;  4JFJ A;  3KZ7 A;  5HWB A;  2AWG A;  2FAP A;  2PV1 A;  3LUO A;  4DRM A;  4ODK A;  1JVW A;  2MNT A;  3EY6 A;  4ODP A;  4DRK A;  1D7I A;  2KFW A;  3O5I A;  5BXJ A;  1B6C A;  1FKD A;  2KR7 A;  4DZ2 A;  5J6E A;  1KT1 A;  1J4H A;  4FN2 A;  2DG3 A;  3GPK A;  4IPX A;  2ZQV A;  4J4N A;  4LAY A;  1PIN A;  4ODL A;  3ODK A;  5DIT A;  3UI6 A;  1F8A B;  2M1I A;  1T11 A;  4FAP A;  1FD9 A;  1QZ2 A;  3O5J A;  2F21 A;  4TW7 A;  2MLZ A;  4LAV A;  4TW6 A;  5GPG A;  1KT0 A;  4DRN A;  1Q6U A;  3O5O A;  3O5E A;  2XP3 A;  4ODN A;  4JFK A;  2RUC A;  4DRP A;  4LAW A; 
#chains in the Genus database with same CATH topology
 3UF8 A;  1NSG A;  3TC5 A;  1UR8 A;  1ZCN A;  2XP4 A;  4MNK A;  4ZS6 A;  3MDY B;  3NRK A;  3WD4 A;  4ODM A;  3B9E A;  3WQW A;  1OWQ A;  5D75 A;  4ODO A;  4QT3 A;  1EDQ A;  1E6N A;  3TDB A;  3W4R A;  1CTN A;  1YAT A;  3OA5 A;  2RUQ A;  3GTY X;  2VCD A;  3UQB A;  3UI4 A;  2XPA A;  4R5E A;  1HKM A;  1BL4 A;  1FKT A;  4Z2L A;  4P8X A;  1XHG A;  1FKL A;  1Q6I A;  2XP5 A;  2DSW A;  3ARW A;  1C9H A;  2Q5A A;  2ESC A;  2PN0 A;  2MF9 A;  4HAR A;  2A3E A;  4LAX A;  4BF8 A;  1FKK A;  4QT2 A;  3KAC A;  2ZR6 A;  2XPB A;  1E9L A;  1E44 A;  4DWS C;  3O5K A;  2WLZ A;  1W9P A;  2DT2 A;  2OLH A;  3O5L A;  3I6C A;  3CGM A;  3O5R A;  4W5U A;  4DWS B;  4W9Q A;  3UQI A;  4ML4 A;  1FKS A;  2UZ5 A;  2DSV A;  3RME A;  1O6I A;  3ALF A;  5DIU A;  3G6M A;  5HW6 A;  3WL1 A;  1U79 A;  2JZV A;  4TX0 A;  3WL0 A;  2A3A A;  3AQU A;  3KZ7 A;  4MPK A;  1ZBK A;  5HWB A;  4PTM A;  2PV1 A;  1ZB5 A;  2O9O A;  4DRM A;  2MNT A;  4QZV B;  3B9D A;  3ARR A;  2ZQV A;  2WK2 A;  2G8Z A;  4ODL A;  3ODK A;  5DIT A;  4URI A;  5DEZ A;  2M1I A;  4FAP A;  1FD9 A;  2QF8 A;  2MLZ A;  3ARZ A;  5HBF A;  2YBT A;  3O5E A;  4ODN A;  4JFK A;  1ZBV A;  4DRP A;  1GPF A;  4IQC A;  2K8I A;  1FKI A;  4L3N A;  1LL4 A;  4DIP A;  1Q6H A;  1D7H A;  4NZC A;  1GRJ A;  3IKD A;  1FKG A;  1LJY A;  4O2T A;  2M2A A;  3WKZ A;  2WLY A;  4MSP A;  3CHC A;  3WH0 A;  3ART A;  3IK8 A;  1LL7 A;  1QPF A;  4U84 A;  2P4V A;  4DRQ A;  1E6P A;  4L72 B;  1J4R A;  3QOK A;  5HKG A;  2WM0 A;  2KI3 A;  1HKJ A;  5HTG A;  2F2D A;  1EYM A;  1W1V A;  4DRJ A;  2ITK A;  4KR0 B;  2KE0 A;  3ARP A;  1NWR A;  1W9V A;  3WQV A;  2ZQT A;  1K9T A;  1TCO C;  1JNE A;  1ZL1 A;  2VN1 A;  2DT3 A;  3CZ8 A;  1E15 A;  2RUD A;  1FKR A;  4ZPW R;  1X6N A;  1JCH B;  4P8U A;  2LKN A;  4DWS A;  3ARQ A;  4NSB A;  1NMV A;  3O5Q A;  1D7J A;  2DT1 A;  1Q1C A;  3OOB A;  1FFQ A;  3B7X A;  1FKJ A;  2LGO A;  4ODR A;  4KQZ A;  3WIJ A;  1EQ3 A;  1WB0 A;  1P5Q A;  2N87 A;  1F40 A;  2DPE A;  2M08 A;  2MLX A;  3ARV A;  2XP9 A;  2ZQS A;  2F4E A;  3KAD A;  3ARS A;  4JFM A;  5I98 A;  4DZ3 A;  4ODQ A;  2L2S A;  4WKA A;  1H0I A;  4JFJ A;  1LG2 A;  2AWG A;  1JVW A;  1E6Z A;  1FKD A;  1HKI A;  4LGX A;  5J6E A;  4DWS D;  1KT1 A;  4FN2 A;  2DG3 A;  1D2K A;  4J4N A;  4Z2H A;  3B8S A;  3AS2 A;  1T11 A;  1QZ2 A;  1ZU8 A;  2F21 A;  4TW6 A;  1KT0 A;  4ZPT R;  2XP3 A;  2IUZ A;  4LAW A;  3FY1 A;  2DSU A;  1XRV A;  1GOI A;  3NI6 A;  5HT1 A;  4JFI A;  4DRO A;  1ZK6 A;  4IT6 A;  5HW8 A;  4WKF A;  3IHZ A;  1WAW A;  2KGJ A;  1LL6 A;  4S3K A;  4ZPV R;  3RFW A;  2PV2 A;  2RQS A;  2FDM A;  3ARU A;  4WK9 A;  3WD1 A;  3AS0 A;  3PRD A;  4DRI A;  3KAH A;  2PBC A;  3WD0 A;  3EIP A;  1FKB A;  1W1P A;  4P8W A;  3UQA A;  1QPL A;  3GU0 A;  4G2P A;  2XP8 A;  2LJ4 A;  1L1P A;  4NNR A;  4Z2J A;  1W26 A;  1JND A;  4MNL A;  4MAV A;  3B9A A;  2PV3 A;  2B31 A;  2D9F A;  2ZQU A;  1LG1 A;  2PI6 A;  3VAW A;  4IT4 A;  5DIV A;  1NWT A;  5HUA A;  2DT0 A;  1J6Y A;  2MPH A;  2XP7 A;  2MLY A;  2ZR4 A;  1TFV A;  1FKH A;  2RSE A;  1FKF A;  2RUR A;  3KAB A;  5HWC A;  3CH9 A;  3H9R B;  1VF8 A;  2OFN A;  2IF4 A;  3NTP A;  3O5P A;  1HXV A;  4DT4 A;  2PPP A;  2AOS A;  1NH6 A;  1D6O A;  1WNO A;  4MGV A;  4ITZ A;  3ARY A;  3FXY A;  2XP6 A;  4WJX A;  3O5F A;  1ROT A;  2YBU A;  2PPO A;  2PPN A;  3KAF A;  1ITX A;  1H0G A;  2G41 A;  3BXW A;  3RGC A;  2FAP A;  3WD3 A;  4ODP A;  4HBE A;  5BXJ A;  3O5I A;  1NWS A;  1B6C A;  3GPK A;  1X6L A;  4LAY A;  3CHD A;  3UI6 A;  1F8A B;  2ETN A;  4LAV A;  5GPG A;  5DF0 A;  1EHN A;  3O5O A;  1KFW A;  2RUC A;  4P8V A;  4GIV A;  4WKH A;  3KAI A;  1J4I A;  3O5D A;  4C02 B;  3RM8 A;  4Z2I A;  4TW8 A;  4U86 A;  1YW5 A;  4G50 A;  4DRH A;  4GGQ A;  5HW7 A;  4DH0 A;  3CGN A;  1M5Y A;  3KAG A;  3PRA A;  4U85 A;  3ARX A;  4MNJ A;  3RM9 A;  1PBK A;  4MNM A;  3JYJ A;  1HJV A;  2EUL A;  4J4O A;  3RM4 A;  1JNS A;  1ROU A;  4WIW A;  4MTV A;  1R9H A;  3PA7 A;  2F23 A;  1W1Y A;  3TCZ A;  3PRB A;  3KCE A;  2FKE A;  4R0X A;  4TYO A;  1SR0 A;  2A3B A;  3WD2 A;  2B5U B;  1GUV A;  4Z2K A;  4TNS A;  2LPV A;  4W9P A;  1IX5 A;  1A7X A;  4IQ2 A;  2ZR5 A;  3O5M A;  1E6R A;  5JH8 A;  3FAP A;  1FAP A;  1LQ0 A;  1RD6 A;  2A3C A;  1FJD A;  2DSZ A;  3IKG A;  1HJX A;  3O5G A;  3CHF A;  1ZBC A;  4Q22 A;  3JXV A;  2DG9 A;  1W9U A;  4Q7N A;  4JYS A;  2Y78 A;  3G6L A;  3UI5 A;  4JFL A;  1Y0O A;  2KO7 A;  3AS3 A;  4XAK A;  3JYM A;  1N1A A;  1NMW A;  1W1T A;  1BKF A;  1OGB A;  1JNT A;  4QIB A;  5B8I C;  1ZBW A;  1EIB A;  2DG4 A;  1SYT A;  4N19 A;  3CHE A;  4W9O A;  5GQB A;  1OGG A;  3LUO A;  4ODK A;  3EY6 A;  3BMB A;  4DRK A;  1D7I A;  2KFW A;  3AS1 A;  4HBO A;  2KR7 A;  4DZ2 A;  3ARO A;  1J4H A;  4IPX A;  1HKK A;  4S3J A;  1FFR A;  5DO2 A;  3ALG A;  4AY1 A;  1PIN A;  4Z2G A;  3O5J A;  5GPR A;  3PR9 A;  1NWU A;  4TW7 A;  2O92 A;  1HJW A;  4DRN A;  1Q6U A;  1UR9 A;  4UDM A; 
#chains in the Genus database with same CATH homology
 3UF8 A;  1NSG A;  3TC5 A;  1UR8 A;  1ZCN A;  2XP4 A;  4MNK A;  4ZS6 A;  3MDY B;  3NRK A;  3WD4 A;  4ODM A;  3B9E A;  3WQW A;  1OWQ A;  5D75 A;  4ODO A;  4QT3 A;  1EDQ A;  1E6N A;  3TDB A;  3W4R A;  1CTN A;  1YAT A;  3OA5 A;  2RUQ A;  2VCD A;  3UQB A;  3UI4 A;  2XPA A;  4R5E A;  1HKM A;  1BL4 A;  1FKT A;  4Z2L A;  4P8X A;  1XHG A;  1FKL A;  1Q6I A;  2XP5 A;  2DSW A;  3ARW A;  1C9H A;  2Q5A A;  2ESC A;  2MF9 A;  4HAR A;  2A3E A;  4LAX A;  4BF8 A;  1FKK A;  4QT2 A;  3KAC A;  2ZR6 A;  2XPB A;  1E9L A;  4DWS C;  3O5K A;  2WLZ A;  1W9P A;  2DT2 A;  2OLH A;  3O5L A;  3I6C A;  3CGM A;  3O5R A;  4W5U A;  4DWS B;  4W9Q A;  3UQI A;  4ML4 A;  1FKS A;  2UZ5 A;  2DSV A;  3RME A;  1O6I A;  3ALF A;  5DIU A;  3G6M A;  5HW6 A;  3WL1 A;  1U79 A;  2JZV A;  4TX0 A;  3WL0 A;  2A3A A;  3AQU A;  3KZ7 A;  4MPK A;  1ZBK A;  5HWB A;  4PTM A;  2PV1 A;  1ZB5 A;  2O9O A;  4DRM A;  2MNT A;  4QZV B;  3B9D A;  3ARR A;  2ZQV A;  2WK2 A;  2G8Z A;  4ODL A;  3ODK A;  5DIT A;  4URI A;  5DEZ A;  2M1I A;  4FAP A;  1FD9 A;  2QF8 A;  2MLZ A;  3ARZ A;  5HBF A;  2YBT A;  3O5E A;  4ODN A;  4JFK A;  1ZBV A;  4DRP A;  1GPF A;  4IQC A;  2K8I A;  1FKI A;  4L3N A;  1LL4 A;  4DIP A;  1Q6H A;  1D7H A;  4NZC A;  3IKD A;  1FKG A;  1LJY A;  4O2T A;  2M2A A;  3WKZ A;  2WLY A;  4MSP A;  3CHC A;  3WH0 A;  3ART A;  3IK8 A;  1LL7 A;  1QPF A;  4U84 A;  4DRQ A;  1E6P A;  4L72 B;  1J4R A;  3QOK A;  5HKG A;  2WM0 A;  2KI3 A;  1HKJ A;  5HTG A;  2F2D A;  1EYM A;  1W1V A;  4DRJ A;  2ITK A;  4KR0 B;  2KE0 A;  3ARP A;  1NWR A;  1W9V A;  3WQV A;  2ZQT A;  1K9T A;  1TCO C;  1JNE A;  1ZL1 A;  2VN1 A;  2DT3 A;  3CZ8 A;  1E15 A;  2RUD A;  1FKR A;  4ZPW R;  1X6N A;  4P8U A;  2LKN A;  4DWS A;  3ARQ A;  4NSB A;  1NMV A;  3O5Q A;  1D7J A;  2DT1 A;  1Q1C A;  3OOB A;  1FFQ A;  3B7X A;  1FKJ A;  2LGO A;  4ODR A;  4KQZ A;  3WIJ A;  1EQ3 A;  1WB0 A;  1P5Q A;  2N87 A;  1F40 A;  2DPE A;  2M08 A;  2MLX A;  3ARV A;  2XP9 A;  2ZQS A;  2F4E A;  3KAD A;  3ARS A;  4JFM A;  5I98 A;  4DZ3 A;  4ODQ A;  2L2S A;  4WKA A;  1H0I A;  4JFJ A;  1LG2 A;  2AWG A;  1JVW A;  1E6Z A;  1FKD A;  1HKI A;  4LGX A;  5J6E A;  4DWS D;  1KT1 A;  4FN2 A;  2DG3 A;  1D2K A;  4J4N A;  4Z2H A;  3B8S A;  3AS2 A;  1T11 A;  1QZ2 A;  1ZU8 A;  2F21 A;  4TW6 A;  1KT0 A;  4ZPT R;  2XP3 A;  2IUZ A;  4LAW A;  3FY1 A;  2DSU A;  1XRV A;  1GOI A;  3NI6 A;  5HT1 A;  4JFI A;  4DRO A;  1ZK6 A;  4IT6 A;  5HW8 A;  4WKF A;  3IHZ A;  1WAW A;  2KGJ A;  1LL6 A;  4S3K A;  4ZPV R;  3RFW A;  2PV2 A;  2RQS A;  2FDM A;  3ARU A;  4WK9 A;  3WD1 A;  3AS0 A;  3PRD A;  4DRI A;  3KAH A;  2PBC A;  3WD0 A;  1FKB A;  1W1P A;  4P8W A;  3UQA A;  1QPL A;  4G2P A;  2XP8 A;  2LJ4 A;  1L1P A;  4NNR A;  4Z2J A;  1W26 A;  1JND A;  4MNL A;  4MAV A;  3B9A A;  2PV3 A;  2B31 A;  2D9F A;  2ZQU A;  1LG1 A;  2PI6 A;  3VAW A;  4IT4 A;  5DIV A;  1NWT A;  5HUA A;  2DT0 A;  1J6Y A;  2MPH A;  2XP7 A;  2MLY A;  2ZR4 A;  1TFV A;  1FKH A;  2RSE A;  1FKF A;  2RUR A;  3KAB A;  5HWC A;  3CH9 A;  3H9R B;  1VF8 A;  2OFN A;  2IF4 A;  3NTP A;  3O5P A;  1HXV A;  4DT4 A;  2PPP A;  2AOS A;  1NH6 A;  1D6O A;  1WNO A;  4MGV A;  4ITZ A;  3ARY A;  3FXY A;  2XP6 A;  4WJX A;  3O5F A;  1ROT A;  2YBU A;  2PPO A;  2PPN A;  3KAF A;  1ITX A;  1H0G A;  2G41 A;  3BXW A;  3RGC A;  2FAP A;  3WD3 A;  4ODP A;  4HBE A;  5BXJ A;  3O5I A;  1NWS A;  1B6C A;  3GPK A;  1X6L A;  4LAY A;  3CHD A;  3UI6 A;  1F8A B;  4LAV A;  5GPG A;  5DF0 A;  1EHN A;  3O5O A;  1KFW A;  2RUC A;  4P8V A;  4GIV A;  4WKH A;  3KAI A;  1J4I A;  3O5D A;  4C02 B;  3RM8 A;  4Z2I A;  4TW8 A;  4U86 A;  1YW5 A;  4G50 A;  4DRH A;  4GGQ A;  5HW7 A;  4DH0 A;  3CGN A;  1M5Y A;  3KAG A;  3PRA A;  4U85 A;  3ARX A;  4MNJ A;  3RM9 A;  1PBK A;  4MNM A;  3JYJ A;  1HJV A;  4J4O A;  3RM4 A;  1JNS A;  1ROU A;  4WIW A;  4MTV A;  1R9H A;  3PA7 A;  1W1Y A;  3TCZ A;  3PRB A;  3KCE A;  2FKE A;  4R0X A;  4TYO A;  1SR0 A;  2A3B A;  3WD2 A;  1GUV A;  4Z2K A;  4TNS A;  2LPV A;  4W9P A;  1IX5 A;  1A7X A;  4IQ2 A;  2ZR5 A;  3O5M A;  1E6R A;  5JH8 A;  3FAP A;  1FAP A;  1LQ0 A;  1RD6 A;  2A3C A;  1FJD A;  2DSZ A;  3IKG A;  1HJX A;  3O5G A;  3CHF A;  1ZBC A;  4Q22 A;  3JXV A;  2DG9 A;  1W9U A;  4Q7N A;  4JYS A;  2Y78 A;  3G6L A;  3UI5 A;  4JFL A;  1Y0O A;  2KO7 A;  3AS3 A;  4XAK A;  3JYM A;  1N1A A;  1NMW A;  1W1T A;  1BKF A;  1OGB A;  1JNT A;  4QIB A;  5B8I C;  1ZBW A;  1EIB A;  2DG4 A;  1SYT A;  4N19 A;  3CHE A;  4W9O A;  5GQB A;  1OGG A;  3LUO A;  4ODK A;  3EY6 A;  4DRK A;  1D7I A;  2KFW A;  3AS1 A;  4HBO A;  2KR7 A;  4DZ2 A;  3ARO A;  1J4H A;  4IPX A;  1HKK A;  4S3J A;  1FFR A;  5DO2 A;  3ALG A;  4AY1 A;  1PIN A;  4Z2G A;  3O5J A;  5GPR A;  3PR9 A;  1NWU A;  4TW7 A;  2O92 A;  1HJW A;  4DRN A;  1Q6U A;  1UR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...