1D7HA

Fkbp complexed with dmso
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7hA00
4IPXA 5DIVA 1L1PA 2ITKA 2KR7A 2F4EA 2PV3A 2KGJA 2RURA 2XP3A 2XPAA 2ZR6A 3KADA 3NTPA 3O5LA 3CGNA 4W9PA 5HW7A 1FD9A 3WH0A 2MF9A 2FAPA 3UF8A 1FAPA 2RUCA 2XP6A 3JXVA 4G2PA 4R0XA 1NSGA 4ODMA 1FKFA 1FKGA 2PV1A 1P5QA 3JYJA 2VCDA 3UQIA 1F40A 1JNTA 4DRNA 3IKGA 4TW8A 1D7JA 4U84A 2KO7A 4DRPA 1NMVA 5BXJA 1N1AA 1FKBA 3KAGA 1ZK6A 4GGQA 1FKIA 1T11A 1ZCNA 2AWGA 3KABA 3O5RA 4ODRA 4DIPA 3UQBA 2XP9A 2RUDA 4LAWA 4JFIA 1YW5A 4DROA 4DRJA 3CGMA 3KACA 4ODNA 4DRHA 5B8IC 3O5QA 1FKHA 2KE0A 2M1IA 4FN2A 4DT4A 1PBKA 3NI6A 2JZVA 2UZ5A 4QT2A 2LGOA 3JYMA 3RGCA 4JFLA 4IQCA 1F8AB 4QIBA 3O5FA 3PRBA 3UI4A 4ODLA 1YATA 2MNTA 5DITA 2F21A 2ZQTA 3O5GA 4IQ2A 4JFMA 2D9FA 4FAPA 1ROUA 4TNSA 1TCOC 2FKEA 2ZQVA 1EQ3A 4N19A 5HW6A 4DRMA 1J4HA 1D7IA 1Y0OA 2LPVA 5D75A 1JVWA 1PINA 2XP5A 1FKLA 4TW6A 3I6CA 3O5KA 4O2TA 2XP8A 2DG9A 3EY6A 1JNSA 4QT3A 3GPKA 2M2AA 4TW7A 5GPGA 3IKDA 2KI3A 2XP4A 1KT0A 1R9HA 4JYSA 1BKFA 4DRQA 4MGVA 1U79A 1ROTA 2OFNA 1FKDA 2LJ4A 2MPHA 3O5JA 2IF4A 4ODKA 1FKRA 2MLXA 4MSPA 2XPBA 2VN1A 3H9RB 4LAXA 3UI5A 4DRIA 2RQSA 4ITZA 4ODQA 5HT1A 2DG4A 2PBCA 2ZR5A 3TDBA 2M08A 4C02B 5I98A 2ZQUA 4U86A 3B7XA 3RFWA 3OOBA 5HW8A 3KAHA 4DRKA 2F2DA 2RSEA 1B6CA 3PA7A 1Q6UA 1FKSA 4DZ3A 1QPFA 4ODPA 4DH0A 2PPOA 3KZ7A 2MLYA 4J4NA 3O5PA 3NRKA 5DIUA 1Q6IA 3UQAA 2K8IA 4W9QA 3TC5A 2KFWA 3VAWA 4W9OA 1Q1CA 2PPNA 3ODKA 3TCZA 1KT1A 4NNRA 5HTGA 3MDYB 4TYOA 1J4RA 1M5YA 1W26A 1A7XA 2PPPA 2DG3A 2ZR4A 3O5MA 3O5DA 4GIVA 2PV2A 3LUOA 1C9HA 1FKTA 2N87A 1BL4A 2ZQSA 1FKJA 4LAYA 1D6OA 4JFJA 5J6EA 3FAPA 3O5EA 4ODOA 4U85A 1J6YA 2Y78A 1QPLA 1EYMA 4LAVA 1FJDA 3IK8A 3KAIA 3KAFA 4TX0A 2Q5AA 3IHZA 1J4IA 4DZ2A 3UI6A 1FKKA 5HWCA 2LKNA 1Q6HA 3KCEA 4J4OA 2XP7A 5HUAA 1QZ2A 4BF8A 4JFKA 4G50A 5HWBA 2MLZA 2RUQA 1D7HA 3O5OA 5HKGA 2L2SA 3PRDA 1NMWA 3O5IA 1HXVA
chains in the Genus database with same CATH superfamily
5DIVA 2ITKA 2KR7A 2PV3A 3KADA 2XPAA 2RURA 1OGBA 2A3CA 3AS0A 1E6ZA 4ZPWR 4G2PA 1NSGA 4ODMA 1FKGA 1H0GA 1GUVA 4TW8A 3CHDA 4HBEA 4DRPA 5BXJA 4MSPA 4WIWA 1FKIA 1T11A 4ODRA 2RUDA 3AROA 4DROA 3KACA 1FKHA 2KE0A 2M1IA 4FN2A 3NI6A 5DEZA 3RGCA 4IQCA 1CTNA 3WIJA 3UI4A 4ODLA 2QF8A 1H0IA 4XAKA 2F21A 2ZQTA 3G6MA 1LQ0A 1HKJA 1LG2A 1TCOC 2FKEA 2B31A 4N19A 5HW6A 1UR9A 1IX5A 4L72B 3WQVA 4Q22A 2XP5A 2DG9A 3AQUA 3GPKA 2M2AA 4NZCA 1KT0A 2OFNA 2LJ4A 2MPHA 2DT2A 3W4RA 2RQSA 3TDBA 3CH9A 4Z2HA 1E6PA 1TFVA 2AOSA 1JNDA 4DZ3A 1EDQA 4ODPA 4DH0A 3ARVA 4J4NA 3NRKA 5DIUA 2YBUA 4MNKA 1Q1CA 4R5EA 5HTGA 3MDYB 4TYOA 1W9VA 1J4RA 1M5YA 2G41A 2IUZA 2PPPA 2DG3A 2A3EA 1XHGA 2N87A 1FKJA 5J6EA 3FAPA 2WLZA 1NWUA 4LAVA 1WAWA 2FDMA 3KAFA 1ZB5A 2Q5AA 1FKKA 2LKNA 1ZBCA 2G8ZA 2P4VA 3O5OA 1J6YA 1HXVA 4IPXA 4WJXA 1W1PA 4HARA 2F4EA 1LL6A 4S3KA 3CGNA 4P8VA 4W9PA 1FD9A 3QOKA 1FAPA 2RUCA 4R0XA 2B5UB 4Z2IA 1P5QA 3JYJA 1F40A 1JNTA 4DRNA 2AWGA 4L3NA 3KABA 4DIPA 2XP9A 1UR8A 1X6NA 4LGXA 4LAWA 1W1YA 1ZBWA 5B8IC 4HBOA 4DT4A 1LL4A 3AS2A 4WKFA 2DSWA 4MNMA 3ARZA 5DITA 3O5GA 4JFMA 2D9FA 4DWSC 3AS1A 1NWTA 4Z2JA 1EQ3A 1SR0A 1D7IA 4WKHA 1JVWA 4TW6A 1JNEA 4KQZA 4TW7A 3ARUA 1R9HA 4JYSA 4PTMA 4DRQA 3WL0A 4MNJA 1GOIA 2IF4A 1LJYA 4ITZA 2PN0A 4ODQA 2PBCA 2M08A 2ZQUA 3AS3A 5JH8A 3RFWA 3OOBA 1FKSA 5GQBA 1QPFA 3CHEA 3ARSA 3KZ7A 2K8IA 1NH6A 2DPEA 2PPNA 3TCZA 3RM9A 1KT1A 1HKMA 3RM8A 3O5MA 4KR0B 4GIVA 3O5DA 1FKTA 4LAYA 1LL7A 1D6OA 1E9LA 4ODOA 4U85A 3FXYA 1JCHB 3WQWA 1FJDA 3IK8A 4TX0A 1HKIA 4DZ2A 3UI6A 3BMBA 3KCEA 3CHFA 4J4OA 1QZ2A 4BF8A 2RUQA 1D7HA 5HKGA 2L2SA 3PRDA 3ALGA 2KGJA 5HW7A 1ZL1A 2MF9A 2FAPA 3UF8A 1HJWA 3WD3A 2XP6A 1FKFA 2PI6A 2PV1A 4IT6A 3FY1A 4UDMA 3ARTA 3CZ8A 1ZK6A 3RMEA 2OLHA 3UQBA 4MAVA 2ETNA 4JFIA 1YW5A 4P8UA 4W5UA 4DRHA 1PBKA 3ARXA 1WB0A 2YBTA 4QT2A 3JYMA 1LG1A 4JFLA 3PR9A 1E15A 4ZPVR 1F8AB 4QIBA 3PRBA 1YATA 4TNSA 3ALFA 4DRMA 1Y0OA 2LPVA 5D75A 1ZBKA 3I6CA 3O5KA 4O2TA 2XP8A 1VF8A 1JNSA 1SYTA 4QT3A 5GPGA 3IKDA 1NWSA 1U79A 1ROTA 1FKDA 3O5JA 1HKKA 4Z2LA 2VN1A 3B8SA 3H9RB 4LAXA 4DRIA 1W1TA 2ZR5A 5DO2A 4C02B 4DRKA 2F2DA 1Q6UA 4Z2KA 2F23A 3WD2A 2PPOA 1KFWA 1OGGA 3O5PA 1Q6IA 4Q7NA 2KFWA 1ZU8A 4W9OA 3ODKA 1FFQA 4NNRA 1A7XA 2ZR4A 2PV2A 3ARRA 1GRJA 2ZQSA 2EULA 3BXWA 1NWRA 1O6IA 1EHNA 3O5EA 1E44A 2Y78A 1QPLA 3ARWA 4QZVB 1HJXA 4P8WA 3IHZA 3WD0A 5HWCA 3CHCA 1OWQA 4JFKA 5HWBA 3WKZA 3B9DA 2DT1A 5HBFA 1X6LA 1W9PA 1NMWA 4IT4A 3OA5A 1L1PA 2XP3A 2ZR6A 4DWSD 3NTPA 3O5LA 5GPRA 3WH0A 4ZPTR 1D2KA 2O9OA 3JXVA 2VCDA 3UQIA 3IKGA 1D7JA 1E6RA 2KO7A 4U84A 3B9AA 1NMVA 1N1AA 1FKBA 3KAGA 4GGQA 1ZCNA 3O5RA 4MPKA 4ML4A 2A3AA 2WK2A 3B9EA 2A3BA 4DRJA 3ARPA 3CGMA 4ODNA 3EIPA 3O5QA 4Z2GA 3WL1A 3G6LA 2JZVA 2UZ5A 2LGOA 4URIA 2DT0A 3O5FA 1EIBA 2MNTA 3WD1A 4WK9A 4IQ2A 4FAPA 1ROUA 4MNLA 2ZQVA 4DWSA 1J4HA 1FFRA 2DSUA 2WM0A 1E6NA 1PINA 1W1VA 3GU0A 4ZS6A 1FKLA 3EY6A 2DT3A 2KI3A 2XP4A 1BKFA 4MGVA 1K9TA 4ODKA 1FKRA 2MLXA 1ZBVA 2XPBA 1ITXA 1GPFA 4DWSB 3UI5A 1RD6A 1HJVA 1XRVA 1W9UA 2ESCA 2DG4A 5HT1A 5I98A 4U86A 3B7XA 5HW8A 3KAHA 2RSEA 1B6CA 3PA7A 4S3JA 4NSBA 2MLYA 4P8XA 3UQAA 4W9QA 2DSVA 3TC5A 3VAWA 1W26A 4MTVA 3LUOA 1C9HA 1BL4A 2DSZA 3PRAA 4JFJA 3ARQA 3GTYX 5DF0A 1EYMA 2WLYA 3ARYA 3KAIA 1J4IA 1Q6HA 1WNOA 4WKAA 2XP7A 5HUAA 4G50A 2MLZA 3RM4A 3WD4A 3O5IA 2O92A 4AY1A
chains in the Genus database with same CATH topology
5DIVA 2ITKA 2KR7A 2PV3A 3KADA 2XPAA 2RURA 1OGBA 2A3CA 3AS0A 1E6ZA 4ZPWR 4G2PA 1NSGA 4ODMA 1FKGA 1H0GA 1GUVA 4TW8A 3CHDA 4HBEA 4DRPA 5BXJA 4MSPA 4WIWA 1FKIA 1T11A 4ODRA 2RUDA 3AROA 4DROA 3KACA 1FKHA 2KE0A 2M1IA 4FN2A 3NI6A 5DEZA 3RGCA 4IQCA 1CTNA 3WIJA 3UI4A 4ODLA 2QF8A 1H0IA 4XAKA 2F21A 2ZQTA 3G6MA 1LQ0A 1HKJA 1LG2A 1TCOC 2FKEA 2B31A 4N19A 5HW6A 1UR9A 1IX5A 4L72B 3WQVA 4Q22A 2XP5A 2DG9A 3AQUA 3GPKA 2M2AA 4NZCA 1KT0A 2OFNA 2LJ4A 2MPHA 2DT2A 3W4RA 2RQSA 3TDBA 3CH9A 4Z2HA 1E6PA 1TFVA 2AOSA 1JNDA 4DZ3A 1EDQA 4ODPA 4DH0A 3ARVA 4J4NA 3NRKA 5DIUA 2YBUA 4MNKA 1Q1CA 4R5EA 5HTGA 3MDYB 4TYOA 1W9VA 1J4RA 1M5YA 2G41A 2IUZA 2PPPA 2DG3A 2A3EA 1XHGA 2N87A 1FKJA 5J6EA 3FAPA 2WLZA 1NWUA 4LAVA 1WAWA 2FDMA 3KAFA 1ZB5A 2Q5AA 1FKKA 2LKNA 1ZBCA 2G8ZA 3O5OA 1J6YA 1HXVA 4IPXA 4WJXA 1W1PA 4HARA 2F4EA 1LL6A 4S3KA 3CGNA 4P8VA 4W9PA 1FD9A 3QOKA 1FAPA 2RUCA 4R0XA 4Z2IA 1P5QA 3JYJA 1F40A 1JNTA 4DRNA 2AWGA 4L3NA 3KABA 4DIPA 2XP9A 1UR8A 1X6NA 4LGXA 4LAWA 1W1YA 1ZBWA 5B8IC 4HBOA 4DT4A 1LL4A 3AS2A 4WKFA 2DSWA 4MNMA 3ARZA 5DITA 3O5GA 4JFMA 2D9FA 4DWSC 3AS1A 1NWTA 4Z2JA 1EQ3A 1SR0A 1D7IA 4WKHA 1JVWA 4TW6A 1JNEA 4KQZA 4TW7A 3ARUA 1R9HA 4JYSA 4PTMA 4DRQA 3WL0A 4MNJA 1GOIA 2IF4A 1LJYA 4ITZA 4ODQA 2PBCA 2M08A 2ZQUA 3AS3A 5JH8A 3RFWA 3OOBA 1FKSA 5GQBA 1QPFA 3CHEA 3ARSA 3KZ7A 2K8IA 1NH6A 2DPEA 2PPNA 3TCZA 3RM9A 1KT1A 1HKMA 3RM8A 3O5MA 4KR0B 4GIVA 3O5DA 1FKTA 4LAYA 1LL7A 1D6OA 1E9LA 4ODOA 4U85A 3FXYA 3WQWA 1FJDA 3IK8A 4TX0A 1HKIA 4DZ2A 3UI6A 3KCEA 3CHFA 4J4OA 1QZ2A 4BF8A 2RUQA 1D7HA 5HKGA 2L2SA 3PRDA 3ALGA 2KGJA 5HW7A 1ZL1A 2MF9A 2FAPA 3UF8A 1HJWA 3WD3A 2XP6A 1FKFA 2PI6A 2PV1A 4IT6A 3FY1A 3ARTA 3CZ8A 1ZK6A 3RMEA 2OLHA 3UQBA 4MAVA 4JFIA 1YW5A 4P8UA 4W5UA 4DRHA 1PBKA 3ARXA 1WB0A 2YBTA 4QT2A 3JYMA 1LG1A 4JFLA 3PR9A 1E15A 4ZPVR 1F8AB 4QIBA 3PRBA 1YATA 4TNSA 3ALFA 4DRMA 1Y0OA 2LPVA 5D75A 1ZBKA 3I6CA 3O5KA 4O2TA 2XP8A 1VF8A 1JNSA 1SYTA 4QT3A 5GPGA 3IKDA 1NWSA 1U79A 1ROTA 1FKDA 3O5JA 1HKKA 4Z2LA 2VN1A 3B8SA 3H9RB 4LAXA 4DRIA 1W1TA 2ZR5A 5DO2A 4C02B 4DRKA 2F2DA 1Q6UA 4Z2KA 3WD2A 2PPOA 1KFWA 1OGGA 3O5PA 1Q6IA 4Q7NA 2KFWA 1ZU8A 4W9OA 3ODKA 1FFQA 4NNRA 1A7XA 2ZR4A 2PV2A 3ARRA 3BXWA 1NWRA 1O6IA 2ZQSA 1EHNA 3O5EA 2Y78A 1QPLA 3ARWA 4QZVB 1HJXA 4P8WA 3IHZA 3WD0A 5HWCA 3CHCA 1OWQA 4JFKA 5HWBA 3WKZA 3B9DA 2DT1A 5HBFA 1X6LA 1W9PA 1NMWA 4IT4A 3OA5A 1L1PA 2XP3A 2ZR6A 4DWSD 3NTPA 3O5LA 5GPRA 3WH0A 4ZPTR 1D2KA 2O9OA 3JXVA 2VCDA 3UQIA 3IKGA 1D7JA 1E6RA 2KO7A 4U84A 3B9AA 1NMVA 1N1AA 1FKBA 3KAGA 4GGQA 1ZCNA 3O5RA 4MPKA 4ML4A 2A3AA 2WK2A 3B9EA 2A3BA 4DRJA 3ARPA 3CGMA 4ODNA 3O5QA 4Z2GA 3WL1A 3G6LA 2JZVA 2UZ5A 2LGOA 4URIA 2DT0A 3O5FA 1EIBA 2MNTA 3WD1A 4WK9A 4IQ2A 4FAPA 1ROUA 4MNLA 2ZQVA 4DWSA 1J4HA 1FFRA 2DSUA 2WM0A 1E6NA 1PINA 1W1VA 4ZS6A 1FKLA 3EY6A 2DT3A 2KI3A 2XP4A 1BKFA 4MGVA 1K9TA 4ODKA 1FKRA 2MLXA 1ZBVA 2XPBA 1ITXA 1GPFA 4DWSB 3UI5A 1RD6A 1HJVA 1XRVA 1W9UA 2ESCA 2DG4A 5HT1A 5I98A 4U86A 3B7XA 5HW8A 3KAHA 2RSEA 1B6CA 3PA7A 4S3JA 4NSBA 2MLYA 4P8XA 3UQAA 4W9QA 2DSVA 3TC5A 3VAWA 1W26A 4MTVA 3LUOA 1C9HA 1BL4A 2DSZA 3PRAA 4JFJA 3ARQA 5DF0A 1EYMA 2WLYA 3ARYA 3KAIA 1J4IA 1Q6HA 1WNOA 4WKAA 2XP7A 5HUAA 4G50A 2MLZA 3RM4A 3WD4A 3O5IA 2O92A 4AY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPX A;  5DIV A;  1L1P A;  2ITK A;  2KR7 A;  2F4E A;  2PV3 A;  2KGJ A;  2RUR A;  2XP3 A;  2XPA A;  2ZR6 A;  3KAD A;  3NTP A;  3O5L A;  3CGN A;  4W9P A;  5HW7 A;  1FD9 A;  3WH0 A;  2MF9 A;  2FAP A;  3UF8 A;  1FAP A;  2RUC A;  2XP6 A;  3JXV A;  4G2P A;  4R0X A;  1NSG A;  4ODM A;  1FKF A;  1FKG A;  2PV1 A;  1P5Q A;  3JYJ A;  2VCD A;  3UQI A;  1F40 A;  1JNT A;  4DRN A;  3IKG A;  4TW8 A;  1D7J A;  4U84 A;  2KO7 A;  4DRP A;  1NMV A;  5BXJ A;  1N1A A;  1FKB A;  3KAG A;  1ZK6 A;  4GGQ A;  1FKI A;  1T11 A;  1ZCN A;  2AWG A;  3KAB A;  3O5R A;  4ODR A;  4DIP A;  3UQB A;  2XP9 A;  2RUD A;  4LAW A;  4JFI A;  1YW5 A;  4DRO A;  4DRJ A;  3CGM A;  3KAC A;  4ODN A;  4DRH A;  5B8I C;  3O5Q A;  1FKH A;  2KE0 A;  2M1I A;  4FN2 A;  4DT4 A;  1PBK A;  3NI6 A;  2JZV A;  2UZ5 A;  4QT2 A;  2LGO A;  3JYM A;  3RGC A;  4JFL A;  4IQC A;  1F8A B;  4QIB A;  3O5F A;  3PRB A;  3UI4 A;  4ODL A;  1YAT A;  2MNT A;  5DIT A;  2F21 A;  2ZQT A;  3O5G A;  4IQ2 A;  4JFM A;  2D9F A;  4FAP A;  1ROU A;  4TNS A;  1TCO C;  2FKE A;  2ZQV A;  1EQ3 A;  4N19 A;  5HW6 A;  4DRM A;  1J4H A;  1D7I A;  1Y0O A;  2LPV A;  5D75 A;  1JVW A;  1PIN A;  2XP5 A;  1FKL A;  4TW6 A;  3I6C A;  3O5K A;  4O2T A;  2XP8 A;  2DG9 A;  3EY6 A;  1JNS A;  4QT3 A;  3GPK A;  2M2A A;  4TW7 A;  5GPG A;  3IKD A;  2KI3 A;  2XP4 A;  1KT0 A;  1R9H A;  4JYS A;  1BKF A;  4DRQ A;  4MGV A;  1U79 A;  1ROT A;  2OFN A;  1FKD A;  2LJ4 A;  2MPH A;  3O5J A;  2IF4 A;  4ODK A;  1FKR A;  2MLX A;  4MSP A;  2XPB A;  2VN1 A;  3H9R B;  4LAX A;  3UI5 A;  4DRI A;  2RQS A;  4ITZ A;  4ODQ A;  5HT1 A;  2DG4 A;  2PBC A;  2ZR5 A;  3TDB A;  2M08 A;  4C02 B;  5I98 A;  2ZQU A;  4U86 A;  3B7X A;  3RFW A;  3OOB A;  5HW8 A;  3KAH A;  4DRK A;  2F2D A;  2RSE A;  1B6C A;  3PA7 A;  1Q6U A;  1FKS A;  4DZ3 A;  1QPF A;  4ODP A;  4DH0 A;  2PPO A;  3KZ7 A;  2MLY A;  4J4N A;  3O5P A;  3NRK A;  5DIU A;  1Q6I A;  3UQA A;  2K8I A;  4W9Q A;  3TC5 A;  2KFW A;  3VAW A;  4W9O A;  1Q1C A;  2PPN A;  3ODK A;  3TCZ A;  1KT1 A;  4NNR A;  5HTG A;  3MDY B;  4TYO A;  1J4R A;  1M5Y A;  1W26 A;  1A7X A;  2PPP A;  2DG3 A;  2ZR4 A;  3O5M A;  3O5D A;  4GIV A;  2PV2 A;  3LUO A;  1C9H A;  1FKT A;  2N87 A;  1BL4 A;  2ZQS A;  1FKJ A;  4LAY A;  1D6O A;  4JFJ A;  5J6E A;  3FAP A;  3O5E A;  4ODO A;  4U85 A;  1J6Y A;  2Y78 A;  1QPL A;  1EYM A;  4LAV A;  1FJD A;  3IK8 A;  3KAI A;  3KAF A;  4TX0 A;  2Q5A A;  3IHZ A;  1J4I A;  4DZ2 A;  3UI6 A;  1FKK A;  5HWC A;  2LKN A;  1Q6H A;  3KCE A;  4J4O A;  2XP7 A;  5HUA A;  1QZ2 A;  4BF8 A;  4JFK A;  4G50 A;  5HWB A;  2MLZ A;  2RUQ A;  1D7H A;  3O5O A;  5HKG A;  2L2S A;  3PRD A;  1NMW A;  3O5I A;  1HXV A; 
#chains in the Genus database with same CATH topology
 5DIV A;  2ITK A;  2KR7 A;  2PV3 A;  3KAD A;  2XPA A;  2RUR A;  1OGB A;  2A3C A;  3AS0 A;  1E6Z A;  4ZPW R;  4G2P A;  1NSG A;  4ODM A;  1FKG A;  1H0G A;  1GUV A;  4TW8 A;  3CHD A;  4HBE A;  4DRP A;  5BXJ A;  4MSP A;  4WIW A;  1FKI A;  1T11 A;  4ODR A;  2RUD A;  3ARO A;  4DRO A;  3KAC A;  1FKH A;  2KE0 A;  2M1I A;  4FN2 A;  3NI6 A;  5DEZ A;  3RGC A;  4IQC A;  1CTN A;  3WIJ A;  3UI4 A;  4ODL A;  2QF8 A;  1H0I A;  4XAK A;  2F21 A;  2ZQT A;  3G6M A;  1LQ0 A;  1HKJ A;  1LG2 A;  1TCO C;  2FKE A;  2B31 A;  4N19 A;  5HW6 A;  1UR9 A;  1IX5 A;  4L72 B;  3WQV A;  4Q22 A;  2XP5 A;  2DG9 A;  3AQU A;  3GPK A;  2M2A A;  4NZC A;  1KT0 A;  2OFN A;  2LJ4 A;  2MPH A;  2DT2 A;  3W4R A;  2RQS A;  3TDB A;  3CH9 A;  4Z2H A;  1E6P A;  1TFV A;  2AOS A;  1JND A;  4DZ3 A;  1EDQ A;  4ODP A;  4DH0 A;  3ARV A;  4J4N A;  3NRK A;  5DIU A;  2YBU A;  4MNK A;  1Q1C A;  4R5E A;  5HTG A;  3MDY B;  4TYO A;  1W9V A;  1J4R A;  1M5Y A;  2G41 A;  2IUZ A;  2PPP A;  2DG3 A;  2A3E A;  1XHG A;  2N87 A;  1FKJ A;  5J6E A;  3FAP A;  2WLZ A;  1NWU A;  4LAV A;  1WAW A;  2FDM A;  3KAF A;  1ZB5 A;  2Q5A A;  1FKK A;  2LKN A;  1ZBC A;  2G8Z A;  2P4V A;  3O5O A;  1J6Y A;  1HXV A;  4IPX A;  4WJX A;  1W1P A;  4HAR A;  2F4E A;  1LL6 A;  4S3K A;  3CGN A;  4P8V A;  4W9P A;  1FD9 A;  3QOK A;  1FAP A;  2RUC A;  4R0X A;  2B5U B;  4Z2I A;  1P5Q A;  3JYJ A;  1F40 A;  1JNT A;  4DRN A;  2AWG A;  4L3N A;  3KAB A;  4DIP A;  2XP9 A;  1UR8 A;  1X6N A;  4LGX A;  4LAW A;  1W1Y A;  1ZBW A;  5B8I C;  4HBO A;  4DT4 A;  1LL4 A;  3AS2 A;  4WKF A;  2DSW A;  4MNM A;  3ARZ A;  5DIT A;  3O5G A;  4JFM A;  2D9F A;  4DWS C;  3AS1 A;  1NWT A;  4Z2J A;  1EQ3 A;  1SR0 A;  1D7I A;  4WKH A;  1JVW A;  4TW6 A;  1JNE A;  4KQZ A;  4TW7 A;  3ARU A;  1R9H A;  4JYS A;  4PTM A;  4DRQ A;  3WL0 A;  4MNJ A;  1GOI A;  2IF4 A;  1LJY A;  4ITZ A;  2PN0 A;  4ODQ A;  2PBC A;  2M08 A;  2ZQU A;  3AS3 A;  5JH8 A;  3RFW A;  3OOB A;  1FKS A;  5GQB A;  1QPF A;  3CHE A;  3ARS A;  3KZ7 A;  2K8I A;  1NH6 A;  2DPE A;  2PPN A;  3TCZ A;  3RM9 A;  1KT1 A;  1HKM A;  3RM8 A;  3O5M A;  4KR0 B;  4GIV A;  3O5D A;  1FKT A;  4LAY A;  1LL7 A;  1D6O A;  1E9L A;  4ODO A;  4U85 A;  3FXY A;  1JCH B;  3WQW A;  1FJD A;  3IK8 A;  4TX0 A;  1HKI A;  4DZ2 A;  3UI6 A;  3BMB A;  3KCE A;  3CHF A;  4J4O A;  1QZ2 A;  4BF8 A;  2RUQ A;  1D7H A;  5HKG A;  2L2S A;  3PRD A;  3ALG A;  2KGJ A;  5HW7 A;  1ZL1 A;  2MF9 A;  2FAP A;  3UF8 A;  1HJW A;  3WD3 A;  2XP6 A;  1FKF A;  2PI6 A;  2PV1 A;  4IT6 A;  3FY1 A;  4UDM A;  3ART A;  3CZ8 A;  1ZK6 A;  3RME A;  2OLH A;  3UQB A;  4MAV A;  2ETN A;  4JFI A;  1YW5 A;  4P8U A;  4W5U A;  4DRH A;  1PBK A;  3ARX A;  1WB0 A;  2YBT A;  4QT2 A;  3JYM A;  1LG1 A;  4JFL A;  3PR9 A;  1E15 A;  4ZPV R;  1F8A B;  4QIB A;  3PRB A;  1YAT A;  4TNS A;  3ALF A;  4DRM A;  1Y0O A;  2LPV A;  5D75 A;  1ZBK A;  3I6C A;  3O5K A;  4O2T A;  2XP8 A;  1VF8 A;  1JNS A;  1SYT A;  4QT3 A;  5GPG A;  3IKD A;  1NWS A;  1U79 A;  1ROT A;  1FKD A;  3O5J A;  1HKK A;  4Z2L A;  2VN1 A;  3B8S A;  3H9R B;  4LAX A;  4DRI A;  1W1T A;  2ZR5 A;  5DO2 A;  4C02 B;  4DRK A;  2F2D A;  1Q6U A;  4Z2K A;  2F23 A;  3WD2 A;  2PPO A;  1KFW A;  1OGG A;  3O5P A;  1Q6I A;  4Q7N A;  2KFW A;  1ZU8 A;  4W9O A;  3ODK A;  1FFQ A;  4NNR A;  1A7X A;  2ZR4 A;  2PV2 A;  3ARR A;  1GRJ A;  2ZQS A;  2EUL A;  3BXW A;  1NWR A;  1O6I A;  1EHN A;  3O5E A;  1E44 A;  2Y78 A;  1QPL A;  3ARW A;  4QZV B;  1HJX A;  4P8W A;  3IHZ A;  3WD0 A;  5HWC A;  3CHC A;  1OWQ A;  4JFK A;  5HWB A;  3WKZ A;  3B9D A;  2DT1 A;  5HBF A;  1X6L A;  1W9P A;  1NMW A;  4IT4 A;  3OA5 A;  1L1P A;  2XP3 A;  2ZR6 A;  4DWS D;  3NTP A;  3O5L A;  5GPR A;  3WH0 A;  4ZPT R;  1D2K A;  2O9O A;  3JXV A;  2VCD A;  3UQI A;  3IKG A;  1D7J A;  1E6R A;  2KO7 A;  4U84 A;  3B9A A;  1NMV A;  1N1A A;  1FKB A;  3KAG A;  4GGQ A;  1ZCN A;  3O5R A;  4MPK A;  4ML4 A;  2A3A A;  2WK2 A;  3B9E A;  2A3B A;  4DRJ A;  3ARP A;  3CGM A;  4ODN A;  3EIP A;  3O5Q A;  4Z2G A;  3WL1 A;  3G6L A;  2JZV A;  2UZ5 A;  2LGO A;  4URI A;  2DT0 A;  3O5F A;  1EIB A;  2MNT A;  3WD1 A;  4WK9 A;  4IQ2 A;  4FAP A;  1ROU A;  4MNL A;  2ZQV A;  4DWS A;  1J4H A;  1FFR A;  2DSU A;  2WM0 A;  1E6N A;  1PIN A;  1W1V A;  3GU0 A;  4ZS6 A;  1FKL A;  3EY6 A;  2DT3 A;  2KI3 A;  2XP4 A;  1BKF A;  4MGV A;  1K9T A;  4ODK A;  1FKR A;  2MLX A;  1ZBV A;  2XPB A;  1ITX A;  1GPF A;  4DWS B;  3UI5 A;  1RD6 A;  1HJV A;  1XRV A;  1W9U A;  2ESC A;  2DG4 A;  5HT1 A;  5I98 A;  4U86 A;  3B7X A;  5HW8 A;  3KAH A;  2RSE A;  1B6C A;  3PA7 A;  4S3J A;  4NSB A;  2MLY A;  4P8X A;  3UQA A;  4W9Q A;  2DSV A;  3TC5 A;  3VAW A;  1W26 A;  4MTV A;  3LUO A;  1C9H A;  1BL4 A;  2DSZ A;  3PRA A;  4JFJ A;  3ARQ A;  3GTY X;  5DF0 A;  1EYM A;  2WLY A;  3ARY A;  3KAI A;  1J4I A;  1Q6H A;  1WNO A;  4WKA A;  2XP7 A;  5HUA A;  4G50 A;  2MLZ A;  3RM4 A;  3WD4 A;  3O5I A;  2O92 A;  4AY1 A; 
#chains in the Genus database with same CATH homology
 5DIV A;  2ITK A;  2KR7 A;  2PV3 A;  3KAD A;  2XPA A;  2RUR A;  1OGB A;  2A3C A;  3AS0 A;  1E6Z A;  4ZPW R;  4G2P A;  1NSG A;  4ODM A;  1FKG A;  1H0G A;  1GUV A;  4TW8 A;  3CHD A;  4HBE A;  4DRP A;  5BXJ A;  4MSP A;  4WIW A;  1FKI A;  1T11 A;  4ODR A;  2RUD A;  3ARO A;  4DRO A;  3KAC A;  1FKH A;  2KE0 A;  2M1I A;  4FN2 A;  3NI6 A;  5DEZ A;  3RGC A;  4IQC A;  1CTN A;  3WIJ A;  3UI4 A;  4ODL A;  2QF8 A;  1H0I A;  4XAK A;  2F21 A;  2ZQT A;  3G6M A;  1LQ0 A;  1HKJ A;  1LG2 A;  1TCO C;  2FKE A;  2B31 A;  4N19 A;  5HW6 A;  1UR9 A;  1IX5 A;  4L72 B;  3WQV A;  4Q22 A;  2XP5 A;  2DG9 A;  3AQU A;  3GPK A;  2M2A A;  4NZC A;  1KT0 A;  2OFN A;  2LJ4 A;  2MPH A;  2DT2 A;  3W4R A;  2RQS A;  3TDB A;  3CH9 A;  4Z2H A;  1E6P A;  1TFV A;  2AOS A;  1JND A;  4DZ3 A;  1EDQ A;  4ODP A;  4DH0 A;  3ARV A;  4J4N A;  3NRK A;  5DIU A;  2YBU A;  4MNK A;  1Q1C A;  4R5E A;  5HTG A;  3MDY B;  4TYO A;  1W9V A;  1J4R A;  1M5Y A;  2G41 A;  2IUZ A;  2PPP A;  2DG3 A;  2A3E A;  1XHG A;  2N87 A;  1FKJ A;  5J6E A;  3FAP A;  2WLZ A;  1NWU A;  4LAV A;  1WAW A;  2FDM A;  3KAF A;  1ZB5 A;  2Q5A A;  1FKK A;  2LKN A;  1ZBC A;  2G8Z A;  3O5O A;  1J6Y A;  1HXV A;  4IPX A;  4WJX A;  1W1P A;  4HAR A;  2F4E A;  1LL6 A;  4S3K A;  3CGN A;  4P8V A;  4W9P A;  1FD9 A;  3QOK A;  1FAP A;  2RUC A;  4R0X A;  4Z2I A;  1P5Q A;  3JYJ A;  1F40 A;  1JNT A;  4DRN A;  2AWG A;  4L3N A;  3KAB A;  4DIP A;  2XP9 A;  1UR8 A;  1X6N A;  4LGX A;  4LAW A;  1W1Y A;  1ZBW A;  5B8I C;  4HBO A;  4DT4 A;  1LL4 A;  3AS2 A;  4WKF A;  2DSW A;  4MNM A;  3ARZ A;  5DIT A;  3O5G A;  4JFM A;  2D9F A;  4DWS C;  3AS1 A;  1NWT A;  4Z2J A;  1EQ3 A;  1SR0 A;  1D7I A;  4WKH A;  1JVW A;  4TW6 A;  1JNE A;  4KQZ A;  4TW7 A;  3ARU A;  1R9H A;  4JYS A;  4PTM A;  4DRQ A;  3WL0 A;  4MNJ A;  1GOI A;  2IF4 A;  1LJY A;  4ITZ A;  4ODQ A;  2PBC A;  2M08 A;  2ZQU A;  3AS3 A;  5JH8 A;  3RFW A;  3OOB A;  1FKS A;  5GQB A;  1QPF A;  3CHE A;  3ARS A;  3KZ7 A;  2K8I A;  1NH6 A;  2DPE A;  2PPN A;  3TCZ A;  3RM9 A;  1KT1 A;  1HKM A;  3RM8 A;  3O5M A;  4KR0 B;  4GIV A;  3O5D A;  1FKT A;  4LAY A;  1LL7 A;  1D6O A;  1E9L A;  4ODO A;  4U85 A;  3FXY A;  3WQW A;  1FJD A;  3IK8 A;  4TX0 A;  1HKI A;  4DZ2 A;  3UI6 A;  3KCE A;  3CHF A;  4J4O A;  1QZ2 A;  4BF8 A;  2RUQ A;  1D7H A;  5HKG A;  2L2S A;  3PRD A;  3ALG A;  2KGJ A;  5HW7 A;  1ZL1 A;  2MF9 A;  2FAP A;  3UF8 A;  1HJW A;  3WD3 A;  2XP6 A;  1FKF A;  2PI6 A;  2PV1 A;  4IT6 A;  3FY1 A;  3ART A;  3CZ8 A;  1ZK6 A;  3RME A;  2OLH A;  3UQB A;  4MAV A;  4JFI A;  1YW5 A;  4P8U A;  4W5U A;  4DRH A;  1PBK A;  3ARX A;  1WB0 A;  2YBT A;  4QT2 A;  3JYM A;  1LG1 A;  4JFL A;  3PR9 A;  1E15 A;  4ZPV R;  1F8A B;  4QIB A;  3PRB A;  1YAT A;  4TNS A;  3ALF A;  4DRM A;  1Y0O A;  2LPV A;  5D75 A;  1ZBK A;  3I6C A;  3O5K A;  4O2T A;  2XP8 A;  1VF8 A;  1JNS A;  1SYT A;  4QT3 A;  5GPG A;  3IKD A;  1NWS A;  1U79 A;  1ROT A;  1FKD A;  3O5J A;  1HKK A;  4Z2L A;  2VN1 A;  3B8S A;  3H9R B;  4LAX A;  4DRI A;  1W1T A;  2ZR5 A;  5DO2 A;  4C02 B;  4DRK A;  2F2D A;  1Q6U A;  4Z2K A;  3WD2 A;  2PPO A;  1KFW A;  1OGG A;  3O5P A;  1Q6I A;  4Q7N A;  2KFW A;  1ZU8 A;  4W9O A;  3ODK A;  1FFQ A;  4NNR A;  1A7X A;  2ZR4 A;  2PV2 A;  3ARR A;  3BXW A;  1NWR A;  1O6I A;  2ZQS A;  1EHN A;  3O5E A;  2Y78 A;  1QPL A;  3ARW A;  4QZV B;  1HJX A;  4P8W A;  3IHZ A;  3WD0 A;  5HWC A;  3CHC A;  1OWQ A;  4JFK A;  5HWB A;  3WKZ A;  3B9D A;  2DT1 A;  5HBF A;  1X6L A;  1W9P A;  1NMW A;  4IT4 A;  3OA5 A;  1L1P A;  2XP3 A;  2ZR6 A;  4DWS D;  3NTP A;  3O5L A;  5GPR A;  3WH0 A;  4ZPT R;  1D2K A;  2O9O A;  3JXV A;  2VCD A;  3UQI A;  3IKG A;  1D7J A;  1E6R A;  2KO7 A;  4U84 A;  3B9A A;  1NMV A;  1N1A A;  1FKB A;  3KAG A;  4GGQ A;  1ZCN A;  3O5R A;  4MPK A;  4ML4 A;  2A3A A;  2WK2 A;  3B9E A;  2A3B A;  4DRJ A;  3ARP A;  3CGM A;  4ODN A;  3O5Q A;  4Z2G A;  3WL1 A;  3G6L A;  2JZV A;  2UZ5 A;  2LGO A;  4URI A;  2DT0 A;  3O5F A;  1EIB A;  2MNT A;  3WD1 A;  4WK9 A;  4IQ2 A;  4FAP A;  1ROU A;  4MNL A;  2ZQV A;  4DWS A;  1J4H A;  1FFR A;  2DSU A;  2WM0 A;  1E6N A;  1PIN A;  1W1V A;  4ZS6 A;  1FKL A;  3EY6 A;  2DT3 A;  2KI3 A;  2XP4 A;  1BKF A;  4MGV A;  1K9T A;  4ODK A;  1FKR A;  2MLX A;  1ZBV A;  2XPB A;  1ITX A;  1GPF A;  4DWS B;  3UI5 A;  1RD6 A;  1HJV A;  1XRV A;  1W9U A;  2ESC A;  2DG4 A;  5HT1 A;  5I98 A;  4U86 A;  3B7X A;  5HW8 A;  3KAH A;  2RSE A;  1B6C A;  3PA7 A;  4S3J A;  4NSB A;  2MLY A;  4P8X A;  3UQA A;  4W9Q A;  2DSV A;  3TC5 A;  3VAW A;  1W26 A;  4MTV A;  3LUO A;  1C9H A;  1BL4 A;  2DSZ A;  3PRA A;  4JFJ A;  3ARQ A;  5DF0 A;  1EYM A;  2WLY A;  3ARY A;  3KAI A;  1J4I A;  1Q6H A;  1WNO A;  4WKA A;  2XP7 A;  5HUA A;  4G50 A;  2MLZ A;  3RM4 A;  3WD4 A;  3O5I A;  2O92 A;  4AY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...