1D7PM

Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
LNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNCLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C2 domain of human factor VIII at 1.5 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords COAGULATION FACTOR VIII PRECURSOR
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1d7pM00
3SKVA 1K42A 3C7HA 2W47A 1UY4A 4M4RA 4D0QA 3GGLA 2W3JA 3GXUA 2ORZA 2W1QA 4YPJA 2EIDA 3K75B 4XUOA 3NJVA 1UY2A 1NUKA 5B4XA 2YG0A 5IFTA 4LKSA 2YC4A 1R64A 1GU3A 1JYXA 3T0DA 1T2XA 4LPLA 4DUWA 4DEVA 3ACIA 3HN3A 5A1AA 1H6YA 5EIYB 3HEIA 1F4AA 3NQHA 2OKXA 2BGPA 1JZ2A 3A23A 2Y6JA 1UXZA 2EICA 2W91A 1SG3A 4XZUG 2VMCA 5EJZB 2WZEA 3VDAA 3EYPA 5LA0A 2W1WA 3OBAA 4XUNA 5LA2A 2QQOA 3DYMA 1UYXA 2WABA 3ACGA 2W1SA 2WDBA 3I3DA 3HNYM 1CIYA 2WO3A 3I2FA 2BERA 2Y64A 2EIBA 2JE8A 4OMDA 4QPWA 5I0DA 2WUHA 3VD5A 3K46A 3WNPA 2JKXA 2KD7A 1UXXX 5CZKA 3VD3A 4HG6B 5JR2A 4M4PA 1OF3A 4MGSA 1J84A 4DUXA 2ZEXA 2WBKA 2WQ8A 4DXRA 3IIIA 1XPWA 4GWIA 2RVAA 3C7FA 3ABZA 1WKYA 2E33A 4CU8A 4XUTA 1W9WA 4MGQA 4ARYA 2ZEYA 5JXIA 2X05A 2W87A 2J1SA 1UY0A 2XHNA 3ECQA 1H6XA 1WCQA 2JD9A 4A6OA 4TXWA 1K45A 3OEAA 4P5YA 2VZTA 4ARXA 1J83A 3FL7A 3GM8A 4IUGA 4BK5A 1JU4A 5IHRA 2YFZA 3IB3A 4CUCA 2QQLA 2JDAA 1F4HA 2W94A 3MV11 1XC6A 5JUVA 2VO5A 5JXJA 2LW8A 1KEXA 1TG7A 1ULPA 3CDZB 5J1XA 1JZ8A 3SEEA 2Y6HA 2J7MA 3LQCA 4CU6A 2VTFA 2CDPA 1UYZA 3ACHA 2QBXA 3ZM8A 1D7PM 2BGOA 3DECA 1CZVA 4P00B 4ET7A 3A21A 3I2GA 3WSOA 1PMJX 2WO2A 1GOHA 2Z4FA 2W5FA 2ORXA 3C7OA 2VZVA 1UZ0A 5DN2A 2V72A 3P1IA 2ZXQA 4ZY9A 3WNNA 1O8PA 4QB6A 1JU3A 1O8SA 1UYYA 3CZJA 1JZ6A 1GQPA 4QX0A 2VMDA 3K4DA 3MO4A 5C71A 3VD9A 3A7QA 3MUY1 2BBAA 3ETPA 3P6BA 1IQDC 4A41A 2DCKA 4DEQA 4A42A 2VM9A 3HOBA 2V5DA 4AAXA 2W92A 4QX2A 4CU7A 2J1UA 4QB1A 2PQSA 3WNKA 4OZOA 2QQMA 1US2A 3LE0A 3PUHA 3K4ZA 2VZPA 5JMOA 2WAOA 2ID4A 1W0NA 2B9VA 4A4AA 3WNOA 4JKMA 5G04L 4ZZ8A 2QQIA 3WEZA 5HPOA 1UY3A 3I3BA 3WF3A 5LCWL 2WO1A 5DPNA 1GMMA 2QQNA 4ZZ5A 3LEIA 4CVUA 5LA1A 2VJXA 2HLEA 4XVHA 2LS6A 4CUBA 2RV9A 5FUIA 1K3IA 2XOMA 1UY1A 3CKHA 1DYOA 1W8NA 1W9TA 1P8JA 4W50A 3T0BA 3LPFA 2WAAA 3I2IA 4CU9A 2J1AA 3OGRA 1GNYA 1CZTA 1W99A 3WF1A 3PUIA 1OF4A 1NX9A 4PT6A 3FHQA 1ULOA 2VOTA 1DP0A 2VQTA 3IAPA 3FN9A 2W46A 1JYWA 3MV01 2DDUA 5IFPA 3EB7A 2Y6GA 2VZSA 3WF4A 1US3A 3AC0A 4KI5M 2VZUA 2E26A 2W1UA 3VDCA 1JZ7A 3DYPA 3THCA 4RN5A 1RYYA 3HPNA 3LEKA 1PMHX 4XUQA 1JZ3A 2R7EB 2DCJA 4L0PA 1KGYA 3D3AA 3HNBM 2ZEWA 3VDBA 1NAEA 3T08A 3I2KA 5JXGA 3LPGA 3C7GA 1JZ5A 1JI6A 2VR4A 1DLCA 4W4ZA 3CQOA 3I97A 4GWJA 3CZUA 2VZOA 1GOFA 1OT5A 3BN6A 3T2QA 3WNMA 3UNPA 4DUVA 3IDAA 3UETA 2J1TA 2Y6KA 1TVGA 1UX7A 4AG4A 2RJ2A 2VMFA 3OG2A 2X10A 4MOAA 4E8DA 5DMYA 4QX1A 2HYXA 3T2PA 4QB2A 1UWWA 3JXSA 3VD7A 3WQBA 1EUTA 2C26A 3NRUA 3IAQA 1W9SA 1SDDB 2VC9A 3GDBA 1JYNA 1K12A 4PF1A 3J7HA 1HN1A 5G05L 4JHZA 4KMQA 4DXSA 4A44A 5B4NA 4A3ZA 2VCAA 3SKJE 2E32A 3CMGA 4D8MA 2WZ8A 3K77A 3I2JA 3WF2A 2VZRA 3HJRA 4ZXEA 5IJRA 2Y8KA 4QAWA 4UAPA 5CYYA 3BGAA 3SEPA 4QDQA 1JYVA 1XNAA 3F2ZA 3THDA 2E31A 1OD3A 5C70A 5IYYA 4P02B 1I5PA 5DQ0A 4Z2AA 2VCCA 4LHSA 3W5NA 3OGSA 4E8CA 1BHGA 4RYDA 5C7GA 4KWUA 2BZDA 3FHAA 4P08A 1PX3A 1L7RA 4XURA 2CDOA 1UMHA 4LQRA 1CZSA 4UOJA 1YQ2A 2VCBA 4XUPA 3WF0A 1L7QA 4GZ9A 4MO3M 2QQKA 1SHWB 5EJ1B 1EUUA 3T0AA 4PQQA 2C9KA 4JKKA 3HNMA 3UESA 4BJ0A 1JZ4A 3DYOA 1GOGA 4UI9L 4BK4A 2Y6LA 2B4KA 1O59A 3MBWA 2V4VA 1NKGA 2VL4A 4A45A 1GUIA 2VMEA 2WN3A 5HXMA 2VZQA 1JHJA 3C7EA 4OUEA 3T2OA 2YC2A 4CUAA 4BXSV 1LNSA 2YFUA 3I3EA 1OH4A 4TTGA 2W9XA 2WYSA 3C8XA 4QDRA 3U37A 1MPXA 4OYUA 4MADA 3W5MA 3OB8A 2J22A 3CIHA 1UMIA 3LEGA 2C4XA 3OEBA 3A22A 2EIEA 4QX3A 4BDVB 3OGVA 3E1F1 2ZEZA 4JKLA 4FI9A 2VQUA 2L9LA 2X09A 5JXHA 1XNTA 3VD4A 4QDSA 2J1VA 2YB7A 5F7UA 2VZ3A 3MUZ1 4DXTA 4JX0A 2VZ1A 1CX1A 2XQXA 3K4AA 4W8JA 2J1RA 2WN2A 2XONA 3T09A 3WNLA 3ACFA 2W95A 4OMCA 1W8OA 3NJXA 2QQJA 2J1EA 3NNGA 1PX4A 3I2HA
chains in the Genus database with same CATH superfamily
2X5IA 4NIDA 4IGPA 3ASIA 4HKOA 4XCAA 3C7HA 1K42A 2HBTA 1H8VA 1Z7S3 3CNAA 5EFUA 4IE0A 2A5ZA 3AYDA 3LWCA 3RJ2X 5FO8B 3POFA 1WMEA 3J4UH 4XIOA 2CAUA 3H7JA 3AKRA 1UNBA 2GNBA 4NHYA 3ZSMA 1RUJ3 4XUOA 4OULA 1W06A 3P5BA 4LE4A 5KHKA 2WR9A 3LOIA 5B4XA 5FZ6A 1G9BA 1GZTA 1N1SA 3THPA 5BNPA 2H6BA 1A8MA 5T54A 4DINB 2CU5A 2ZAHA 3BPZA 4XBNA 4YZ3A 4A6SA 3VZJA 3T0DA 5FMOS 1DDLA 3SCHA 1DZQA 4DUWA 4DEVA 1SFYA 4H7LA 2ZX2A 1WW4A 1BEV2 1YI7A 2XH6A 1YFXA 2VMIA 1E5HA 1W3XA 1ZBE1 4EROA 5EIYB 1OKOA 3HQRA 2E7AA 3PJQA 1JZ2A 2WC2A 1QQP3 4AI1A 3A23A 5JZGB 1OVSA 3ILNA 1RUD1 2NPIA 2W91A 4NRMA 4FFHA 4XZUG 3ZFEC 5LA0A 2WZEA 3VZNA 3NSTA 3SCGA 3KF3A 2PAEA 2DU1A 5AC93 1UYXA 4BH9A 4IV3A 1ZA7A 3OD4A 3MF6A 3GNEA 4QQ2A 4JTOA 1W6OA 2W1SA 4NE9A 2CY6A 4UT5A 4D6SA 4C90A 1Z78A 5IVJA 1TNRA 3OOXA 2IVJA 1E5RA 2PXJA 1CIYA 3I2FA 1Q8PA 1WLDA 4OHWA 1G9DA 1AZDA 3SLIA 1H8TA 1QOOA 1BLZA 2RMU2 5JR7B 4HT1T 4DY5A 1JS9A 5I0DA 1HB4A 3K46A 3PUQA 4CEYC 4EN0A 5BNOC 2HWC3 3PIGA 1FOD3 3KF5A 3BKZA 2OUHA 4QXHA 1H2LA 3KT4A 4AQTA 5L19A 3VLBB 2PHFA 5FPAA 3B7MA 4XTMA 1AYN3 1OF3A 4CCLA 3HWJA 3MLJA 3POYA 1XYOA 2WBKA 4P14A 4I2OA 1OLRA 1MACA 3C7FA 3MEPA 4CDQB 1HV0A 1WKYA 4RGKA 1OBNA 1RJ8A 4ARYA 5A1LA 5FCCA 1QOSA 3ZSLA 2WLPA 1OPMA 5BV6A 2RS51 4NPLA 4IEWA 1H6XA 1WCQA 1ZBA3 2ZHLA 5FJKA 4A6OA 1K45A 1RUD3 5IW0A 5KXCA 1Q8SA 2ARAA 1W04A 4Q4X3 3FMGA 1PGW1 3JD71 5FR3A 3C2UA 3FL7A 1WA6X 1JU4A 2OIIA 3VBUC 5LBEA 2X29A 5H9QA 2MPFA 4AK3A 1DU3D 1CWPA 3MHZA 4AFMA 2RE9A 4GB33 4CUCA 1CAUB 3WW1A 2VNOA 2QQLA 3LB9A 2W94A 4PCRA 5JUVA 5KXBA 4YVWA 2NMNA 2NZ9A 4QXCA 1H4GA 3BB6A 1LCLA 2WNEA 4YZ2A 2XLAA 2PYTA 4IE5A 3MIFA 1CAXA 1YHFA 5FKCA 4CE8A 1STMA 5J1XA 4LUKA 2IZWA 5DXDA 1XE7A 4LLOA 3SEEA 4JGYB 1RINA 3E6CC 1R1ZA 2VTFA 3NO8A 3I49A 3O7OA 3LD8A 3SH5A 3MLKA 1HRI1 1C8M3 4WM7A 4P9YA 1YFUA 1D7PM 4BWOA 4JV4A 3KS7A 5T5LA 4DXZA 4CEYA 4AQ6A 2D3PA 4A7KA 2VE1A 1OA2A 1U5IA 5FMOL 1QJX2 4XFGA 5D8AC 5CFDC 3TEZA 2JENA 3AMNA 2W5FA 3HT2A 2ORXA 4PDWB 5CB7A 4AAPA 2ZGTA 2OVUA 1BMV2 2FD8A 2C9AA 4IV3B 4FPEA 4KBZA 3E97A 3LDKA 1WLCA 2HWE3 3B3QE 4OUSA 1Q8OA 1YUDA 1FT9A 4QGNA 2V72A 4R9AA 2ZXQA 4AFAA 4ZY9A 3BU7A 3ZN6B 4I0BA 4JDMA 4FPKA 4P9GA 1RUF1 1O8SA 5DDJ2 3M70A 3WG2A 1JZ6A 5CG9A 5L73A 3MO4A 1O5LA 2PELA 4NAMA 4NOTA 5FZ8A 1CX4A 2TEPA 3A7QA 3S7IA 4QKBA 4A41A 2DCKA 1AL0G 2RDNA 4XHXA 5D1IA 5KXDA 1HKDA 4YZ1A 1SFNA 4W6WA 4XDPA 3POSA 2BNOA 4P9XA 2V5DA 1CPNA 1XNDA 1EP0A 2R072 3ENRA 4MHUA 1MQTB 2B39A 2PQSA 3J26N 3LFMA 3N9PA 2B7YA 2B5HA 1N1YA 2O0OA 4A3XA 2R1BA 2QQMA 1QKQA 2YPDA 2DF7A 3V0BA 3LE0A 3AFKA 3DKWA 3K4ZA 3PUHA 5JMOA 1H1MA 5T5PA 5J37A 5H9RA 1FYUA 4XF1A 5FYYA 1J59A 1Y7BA 4NRQA 3RZMA 5A3PA 1GSLA 3OPTA 1ND3C 1ODNA 3JBG3 3A4UA 4JKMA 1OOPA 4RR3A 5G04L 4OI4A 2YBPA 4GKYA 4XJWA 3WLUA 4D69A 3CJIB 4M0HA 2VAUA 1WMFA 1UY3A 2VUDA 1DF0A 3WF3A 4AI2A 3FLPA 3EXUA 2WO1A 2CGNA 3FC0A 1WLTA 1ZZBA 2FDHA 5F8PA 2GNDA 2DYCA 4WZCA 1RUG2 1GMMA 3FLTA 3RMXA 3ZXGA 4AQ2A 2OX0A 3WG4A 5I0SA 1RMU2 5HI0A 3LA7A 2WNOA 3WW3A 5LA1A 4PQ9A 5A7QA 1SBEA 3AZWA 3H3LA 2A71A 2X5IC 3JD72 2WFF2 1XOYA 4IV3C 4Q4V3 4CUBA 2CWSA 4LK7A 4AEDA 5L7OA 1VAMA 3K48A 5C4WC 4YSFA 1C3HA 4E4SA 5I91A 2Q0AA 4SBVA 5T52A 3SQOA 4JDOA 3BU0A 4YGDA 4FPLA 3PVNA 4QPIA 1GNYA 4WM7B 4WM8B 1LHWA 4QPYA 4Q1PA 1NX9A 4PT6A 1RUNA 4YVSB 1IGOA 2RS31 4IGQA 4RFT0 1ULOA 3ZFFB 1LOFA 4YM0A 1J3QA 3OYWA 1RXGA 3MW3A 4GIQA 4O61A 2DCYA 2EXHA 2W46A 1UIKA 2HWE1 1JYWA 3MIEA 1UOFA 1QJZA 5JOXA 1LULA 5FZ9A 2C1FA 1AR61 3PNAA 2NP0A 3VBRA 4E9KA 1W6QA 3H9AA 4DB5A 2VECA 1B09A 1JBCA 2VBDA 2A6ZA 1PM4A 3FFQA 1SEFA 4XJ9A 3VBOC 1US3A 4KI5M 4TLFA 5A7OA 4P9LA 2E26A 3IT8A 3N36A 4FPGA 3VDCA 1JZ7A 3RZLA 5HV4A 1CIWA 4RN5A 3TAYA 3AMHA 3V64A 1C4RA 2EF6A 2IXCA 1PMHX 1BZWA 2Q30A 4GD4A 1SPPB 1JZ3A 3BOPA 4DIQA 2DVBA 1KGYA 5A3OA 3X29B 2WS91 3VDBA 1ULDA 3KCYA 3UT0A 2R062 5FZ1A 1QXRA 5FPBA 1TME2 4PLMA 3WDXA 3N35A 2QDRA 4IE4A 3C7GA 5CAZA 5I0RA 4EWDA 1L7LA 5FZ3A 4HLTA 5FPZA 4FOQA 1LHUA 3QCWA 4CEWA 4Z92B 4Q5OA 3T30A 1GP6A 4DPNA 1ULGA 1GOFA 3BN6A 2J42A 3H1WA 2UWCA 2ADDA 1C5HA 2AGSA 2D98A 3HQUA 4M01A 2AR6A 3IDAA 3KD4A 4YFZA 3OBRA 4DOUA 1UX7A 1UW8A 2XR4A 3RSJA 3OBZA 2XHKA 4Q4X1 1HB1A 3HR9A 1RC6A 4QX1A 2HYXA 5E89A 3MDPA 3S7EA 3M4FA 4UFJA 3ZYPA 1RUC2 4B4QA 2ZZQA 3MF9A 5F6LB 1K5JA 1IQAA 1EUTA 1FATA 4GJZA 5JCTA 1W9SA 2G9ZA 3ELNA 4UW6A 4S2FA 2H0BA 4Q4V2 1RUG1 2FZ1A 2GC3A 3AZVA 3AXEA 1W03A 2PHTA 4PJYA 2WZR3 5A6YA 2D6OX 2YV8A 5FP8A 1BXHA 1W2TA 3WHUA 3ZN6A 4JHZA 2R0FA 2RS12 4KMQA 5D2AA 2BEOA 1PVC1 4JGYA 4UFLA 2NQYA 3ES1A 3RZJA 4IXLA 3ZMNA 1OLMA 4KWLA 4XACA 2VCAA 2XBO1 1RUH3 2P3KA 3AP4A 1D0GA 3WP5A 2WZ8A 3DXUA 5DAWA 2NYYA 4PIXA 3RYKA 3KHCA 3WNXA 4TYSA 3ZFFC 5JOWA 1ZZ8A 4IEOA 1QJFA 3WF2A 5L36A 4W6XA 2WFPA 5JOZA 3HJRA 3J7LA 2Y8KA 3POIA 1AR83 2YHJA 5FY1A 1K5MB 5FZMA 4QU1A 1ZRCA 5CYYA 4BLIA 1VRH2 5IATA 5CA6A 1QJU2 5FYBA 3THDA 1CVNA 1NE4A 2E31A 2K46A 3VBRB 4JRAA 5IVVA 4NUBA 1ST8A 4FPYA 3OGJA 2WA3A 1WD4A 4YGBA 2E51A 3E5UA 3OSDA 4Z2AA 1GZWB 1IS5A 2DUOA 4LHSA 3SITA 1LOEA 5BNQA 4CP0A 4IESA 3SNMA 1BVVA 3CJXA 4RYDA 1ZRIA 4FPHA 4XE9A 1PHMA 1WGPA 2DV9A 3L2YA 4FP3A 3I54A 2IC1A 2Y33A 4XURA 1JUHA 5FBJA 1UU6A 1S0FA 1Y9QA 3AK0A 4LQRA 1YQ2A 2VCBA 4XUPA 3WF0A 1PZ8A 1DYKA 5GLUA 4C0BA 3TEWA 2EALA 2MNGA 2JDPA 2BFUL 2QQKA 2JG8A 3NAPC 4Q4Y1 1VBE1 3GBWA 2XLFA 5BNPB 4XHBA 3ZYHA 3KLSA 4XJZA 4PQQA 4Y5SA 2C9KA 3Q9OA 4JKKA 4NIAA 1NZIA 1XU2A 4Y1UA 4LMFA 4AHXA 1GOGA 3OCPA 2A70A 4BMEA 1XJAA 4X6RB 3DUIA 1UF2C 2ZGMA 4F3JA 2B4KA 1O3RA 3O0WA 3M1HA 2D6LX 5JZGA 4MGIE 2VL4A 2VMEA 1LR5A 2EXKA 2XUMA 1VBA3 4Z07A 1BBT3 1VMFA 1XXNA 1ZBE2 3N9MA 3WDWA 4AEJA 3WUDA 2WZR2 1W6NB 4RS5C 4OUEA 1CESA 3O5SA 3PJYA 5FZOB 4Q0SA 5C3PA 1CR7A 3WG3A 1ZBA2 3B9CA 1U12A 4BM8A 3R4DB 4Q4W3 5L7OB 1NCRC 5LBBA 1OH3A 1DQ5A 4XJ8A 5AVAA 1LNSA 2Y38A 2ZMKA 4E2QA 1EAH1 3Q8FA 5B2GB 2A75A 4D7YA 4TTGA 1VP6A 4X6QB 4LBMA 3RYPA 2JIGA 1V6IA 3UKTA 3N7JA 3T1MA 4IEPA 4GA9A 2XJUA 2PHWA 2GMPA 3CIHA 3I3MA 2HWF1 5D8AB 4MHRA 3LFIA 3OEBA 5C8CB 1RHI3 2ES3A 1PVC2 1GANA 1EYBA 2ARCA 2YMZA 5D21A 5EV7A 4EWAA 1MEC1 4Q8KA 4FFFA 1GYKA 2ZEZA 2HWB1 2BQPA 3DV8A 3TBDA 4FI9A 4Q4Y3 2VQUA 3JZVA 4KL1A 5JVVA 5ISLA 1DQ2A 1M4WA 1GKBA 1GP4A 1Y9GA 4QDSA 1HB2A 1PNGA 3WQ0A 4CTEA 2BOIA 2FDKA 5FO9B 1QNWA 2PTMA 4XC9A 3U4XA 2GMMA 1MS4A 2VZ3A 4CDWB 2BP6A 3LF7A 4A7YA 1DQ6A 1XNBA 1X50A 2UYAA 5FJHA 2Q8DA 4JX0A 1Q3EA 1IPSA 4HXCA 5F1RA 1LRHA 4ASMB 4ZU4A 4XBLA 3LIHA 1ZX5A 2XQXA 1SPPA 3K4AA 2W68A 5EJ3A 3FBYA 1PGW2 2DCTA 4LBJA 4ORFA 5JMCA 1Y3TA 4CDUC 2AACA 4K9SA 4R8HA 5FYMA 2O8QA 2PQQA 4GAZA 5LK7B 1EAH3 1POV3 1QEXA 2QQJA 4Q0PA 5FXWA 4AEKA 1PX4A 5DDJ3 3I2HA 3ILRA 3WHTA 3VN4A 4AVBA 4AYUA 5I8YA 3VL8A 4M3CE 2RS53 3UK9A 5FMCA 1RUG3 4BQWA 4D0QA 4Q1RA 4NWWA 2Y0IA 2VVDA 5JPNB 3VKFC 1TQ5A 2ORZA 4YPJA 2EIDA 4XF0A 4XTPA 4IV1B 4LO7A 3IPVA 4FO9A 4RGAA 4HPKB 1I6XA 1OFNA 3AYCA 5T55A 5FY7A 1NUKA 1UY2A 1FNZA 4JQTA 5ANNA 3U07A 3VBSC 2ET1A 1YIFA 4LO5B 1ENQA 3TRSB 4BQ2A 5BNOB 4IDZA 5FLIA 2Q8EA 4QGMA 4UW4A 4CDXB 1R64A 5A3LA 4CXWA 2A3YA 1QWRA 3IDBB 4KU7A 1DCSA 3WW4A 5IK7A 5GLWA 4IEUA 3IDCB 4AI3A 2GC2A 3UV9A 1J1TA 4Q4W2 1WA4A 1JN2P 3HEIA 3NNJA 5LZ6A 5EPAA 1F4AA 3NQHA 2WZR1 2OKXA 3FUQA 2BGPA 4QX7A 2ZX0A 5T3NA 4QQPA 1ZRDA 3LDBA 2WNVB 4TSVA 5LBCA 1VBD3 1UZVA 4YZ4A 5DG1A 1VR3A 2EICA 4YW3A 4COZA 5FV3A 4ZU5A 4YW1A 4JC1A 1SG3A 4Q8LA 1IG3A 3DF0A 4R4XA 3JUUA 1EAH2 3EYPA 3WD5A 3Q8EA 5DDJ1 4XUNA 1SCRA 2ZA9A 4CXYA 1NA1A 1W39A 3T2TA 4D94A 3O1VA 4AR2A 5JZGC 2ARXA 2DVFA 2RS52 3GCWA 3ON7A 3RQ0A 3BODA 3WZ1A 4BIFA 4OQ8A 4OHXA 3I3DA 3HNYM 3GJAA 4Y24A 1PMIA 2JE7A 1T6GC 3RPQA 1T6BX 2Y64A 3W20A 2EIBA 1PO13 4NIHA 3ZSJA 3PUSA 4LBNA 4Z2WA 2HWB2 4NR1A 1HRI3 1QGLA 3VD5A 4EZ4A 5DG2A 3EBRA 4K1ZA 2YU1A 4AQSA 2KD7A 3OTFA 4NPMA 3VD3A 3POJA 1W8TA 3N9LA 1GZWA 3RFRA 3AJYA 4AGGA 4P9IA 4M4PA 4MGSA 4UXAA 1AR71 4CCOA 2CHHA 4XF4A 2WQ8A 1AVBA 2VTXJ 2Z69A 2P5BA 4GWIA 4AEMA 2XVGA 2RVAA 3NNLA 4IE6A 3ILFA 4XUTA 1W6NA 2ZEYA 5FZOA 2W87A 2J1SA 1UY0A 1SDWA 5FAXA 1DGWX 1F5JA 2AREA 4N53B 4KG0A 1RMU1 1R1A1 2UURA 3AB0A 1F2NA 3Q8AA 1XQNA 4NRPA 3W58A 5IK5A 4YFWA 4QPGB 5CU1A 1JYTA 2E7QA 2JG9B 3FLRA 2BOJA 1LGNA 4H3WA 2JB4A 2YBSA 4IUGA 2LM3A 2MHFA 4HL0A 3RWNA 3VHNA 4BK5A 4C1WA 5FPVA 5IHRA 3VBSB 1S4CA 1QJEA 2WT0A 4WBBA 2EAAA 4XABA 4WM8A 5C5UA 2YFZA 3R05A 4HONA 4IV1C 4CYDA 1I9RA 1LAJA 1TME3 4HPKA 3BTYA 4XJAA 3AKPA 4XMAA 5JXJA 3CLPA 4COUA 3ZSKA 1YQCA 1N1TA 1KEXA 1S55A 1TG7A 2ARBA 2B46X 1JOBA 4FT8A 5CG8A 5FK7A 4P5HA 1FMD3 4BQ5A 2OS2A 2RS13 4YGEA 1FOD1 2Y6HA 1SMVA 1VBB1 5IAVA 3ZXDA 1OQEA 3R4UA 1SLAA 2QBXA 1HRV3 5C3OA 2HWE2 5ERLA 3UYJA 4META 2GP3A 3GJBA 3DECA 5F3GA 1D4VB 4ET7A 1URXA 3O1OA 2R071 3VHOA 4AZZA 5FYSA 1ZRRA 1HQLA 1PMJX 4MZUA 5EZWA 3S0MA 3E5XA 5FXXA 1NXMA 2Z4FA 4LORA 2O8OA 2LRPA 2Y34A 4DFSA 4Q27A 2WO7A 4RD7A 5DAQA 4R52A 3ROUA 2VZVA 1UZ0A 1QF3A 3IBMA 2VOXA 5GZEA 4Y33A 1QH6A 4X8PA 5A3NA 1W0PA 1OFSA 3DPRB 3VHRA 4PDWC 3HBKA 4XXAA 5FZLA 5GZDA 1OLME 3VHPA 4QX0A 2DCZA 3ZN5A 2QQUA 3K4DA 4Z1VA 1FAYA 2PN5A 1H0BA 4M00A 3VD9A 1JOPA 4FPOB 1GLHA 3P6BA 4BIOA 5JPMB 4DEQA 1S2KA 3CU7A 4HN0A 3RDIA 1FV3A 4QQOA 3U4SA 4AAXA 2XJRA 2J1UA 3IPVB 3KM5A 3ZSEA 4AHYA 3VBUA 1DGRN 3ZXAC 4F7ZA 5FOJB 1UZYA 1VBB3 1ZA4A 4XZPA 1US2A 2RJKA 5A33A 1W3VA 4OHVA 1YC61 3BVCA 3ME2A 5A3WA 3NVCA 1UU4A 2YC0A 4U36A 3ZYIB 1NCRA 2B9VA 2CV6A 1MS3A 5K4LA 4UFMA 3WNOA 1AR72 4YG0A 3WINE 1MZEA 2YBKA 1PZ9A 3OPZA 1VBA2 4XQWA 4EN6B 2C5DA 4RHV3 5AFEA 2QQIA 5F3EA 4AHWA 5T50A 5CFCA 3I3BA 2JG9A 4MGZE 3AX4A 4AWDA 1UO9A 1QY4A 5FWJA 3O1UA 2B45X 4FVVA 4LR4A 1NE6A 1WMXA 5F3IA 1COV1 1DG6A 4GWNA 5ABJB 4QGLA 3NNMA 2A3WA 2HLEA 4LOTA 1VE0A 2RV9A 4C1XA 4N90A 1SLCA 5FUIA 1K3IA 1RITA 4JTNA 4Y5TA 4YLZA 1UZWA 1AYM1 2K0GA 4WVWA 3TOJA 1JUIA 3CKHA 1Q56A 4INDA 1P8JA 1W6MA 4W50A 3T0BA 2P6CA 3LPFA 2BV4A 4CA9A 4N8MA 3BOWA 2J1AA 3OGRA 1XSQA 1CZTA 3QLQA 3SXWA 2CL2A 1VIWB 5FY9A 1CJDA 2H0VA 1TE1B 2HEYF 1OF4A 2WS92 1NCQA 2R061 5LBFA 1FOD2 5FP9A 1MR5A 4CUGA 5CNAA 2KXLA 2VOTA 1DP0A 2A7AA 1BBT2 2JDNA 1KD7A 2IXHA 5FLJA 4AVVA 2BYVE 2X8KA 1XE0A 3FN9A 1ULEA 4JCKA 4RQPC 1PO21 1CJPA 2D44A 2ZGPA 1GWMA 4NIIA 4CP1A 1UQXA 2O14A 2FZ2A 1REFA 1ULCA 5A1FA 2A6XA 4K8FA 2UY8A 3WUCA 1AL23 3K3OA 2XJSA 2Y6GA 3B94A 5FZGA 5HXVA 3VBRC 3VKOA 1F9KA 3KVBA 2VZSA 3WF4A 2FCUA 2VZUA 4CP2A 4Q4X2 2XWJB 3NV1A 5EWSA 2F17A 4GQ7A 5FIXA 3T3YA 4N43B 4D6RA 4HVQA 5BUVA 3O0VA 1JYIA 3AMPA 3M3OA 3PL0A 1AJOA 2DCJA 3MPPG 5FQ0B 5J7MA 2JDUA 1TMF2 1CQ9A 1VBE2 1AYM3 3SH4A 1LECA 2ZEWA 1N3QA 2ZKNA 3T08A 1GNHA 4AVAA 3USUA 2V73A 3LPGA 5K9YA 3AFGA 1JI6A 1POV1 5DAVA 3VBFC 2VR4A 1YJKA 1GFF2 1PZ7A 1UPIA 3E5QA 1SBFA 3QACA 1AX2A 3B93A 5FMBA 1NY72 1DQ4A 2QFEA 3I97A 3PUAA 4GWJA 5KHHA 2VZOA 5FYVA 1WCKA 4QX2A 4LXLA 4DUVA 1AR73 1S0IA 3UETA 2LALA 5FXZA 3B01A 1WD3A 1TVGA 2Y0OA 4AG4A 4CCMA 3OG2A 2X10A 1D2SA 1RL3A 5HCBA 1S0CA 2RM21 1E5IA 1PK6B 2LTNA 1EY2A 2XVLA 5JAXA 3FZ3A 1Q8QA 4QB2A 1UCXA 3VD7A 5D8AA 4GB31 5IVEA 1O3QA 2FHRA 5C8CA 3IAQA 4OLLA 4NAOA 1SDDB 3Q8CA 5ACA2 1W8HA 2VC9A 3WDTA 2RG4A 4XDOA 3TEYA 3PMSA 3ALQA 4PF1A 3J7HA 4CEWC 4LKFA 4ES8A 5G05L 1CAWA 1VALA 3ZOIA 2ZABA 4DXSA 1GV9A 4A2UA 4ZS2A 1MEC2 1LGBA 2DVDA 1UMZA 3B02A 3SKJE 1REEA 2E32A 3CMGA 4EZHA 2Q1ZB 4MX3A 1O4TA 3M3IA 4Y4YA 1HIXA 1E5SA 4EE2A 1R082 2VZRA 3KQ4B 3AKSA 4YVWC 3W21A 5KHGA 5IJRA 4AW7A 1F31A 3T1LA 2P34A 4ITCA 4QAWA 2HWC1 1AL22 1HJFA 5FY5A 2IXIA 4UF0B 5FY0A 5FP4A 1N1VA 4QDQA 4S2DA 3VZOA 1XNAA 3HQXA 2VTXA 5LY1A 1BKZA 2BNMA 2VY0A 3JQXA 3QH6A 1OD3A 5JSPA 1YXWA 4I09A 4BQXA 1BBT1 1AHSA 2GN7A 2ZS6B 4QQLA 2XVKA 4LKDA 4CSWA 4YM1A 5IYYA 1DBNA 1VMHA 4ISQA 3ZFGC 5M0TA 2F4LA 1CAXB 1XBFA 4LBOA 2JD4A 5DQ0A 3W9AA 5BNNA 2VCCA 1RUF3 4DMIA 5JOYA 3W5NA 2IWGB 2ZACA 5CEHA 5F32A 4E8CA 3NJZA 1BHGA 1B35B 3Q8BA 3FFZA 2VVFA 4YVSC 5IWFA 4P08A 1PX3A 2CDOA 4EN7B 2WFF3 1FI2A 4NROA 2GNMA 2F6BA 3TB0A 1W8WA 1E57A 1ZBA1 3NV2A 4UOJA 5FYTA 2HWB3 1ZRFA 2K9ZA 2D6PA 3SHRA 1L7QA 4GULA 4O65A 1SHWB 3BIWE 1AR92 2WL1A 5CBLA 1FV2A 1EV13 1YQ5A 3VBOB 4I0AA 5EJ1B 1EPZA 1EUUA 2Z5WA 1UYPA 2ZTNA 2EIGA 4UBHA 1A34A 5C4WB 3H8XA 4OQ9A 3PVOA 3UESA 5KC5A 5SV8A 1KDMA 1LHOA 1TEIA 4Y20B 4BK4A 2Y6LA 1KJRA 2W52A 2YROA 4PIYA 1Z7S2 2YPJA 5DUUA 1GWKA 3O12A 1NKGA 1GUIA 2WN3A 1H2MA 2P3YA 3ZIWA 1JHJA 1QNYA 1O4YA 1FMD2 2RR13 3C7EA 5IT6A 4RR3C 4F8AA 3LCPA 3POEA 3GBFA 3T2OA 1G7YA 2Q8OA 1XSRA 4XFFA 5BYNA 2YZ4A 5FKBA 2W0XA 2YFUA 3FHIB 3WP6A 2VW2A 2VUCA 2ZGRA 3I3EA 4OI2A 5FUPA 1G9AA 2JG9C 3APBA 4FOYA 4QPGC 2PHRA 1MS1A 2WYSA 1LHNA 2WNUC 3C8XA 4QDRA 4YW5A 1PGL1 2WQZC 4O7XA 4MADA 3W5MA 3T4VA 2PLV3 2R043 1RXFA 3RI9A 2J22A 4CXXA 4RS5A 4B1MA 2C4XA 4P9WA 4CDWA 3FBMA 5JIUA 3A22A 2EIEA 4QX3A 3I59B 2R16A 2C6SA 5ANQA 5JI7A 4BDVB 2DUQA 1IZ3A 3G6JB 2UWBA 1JH5A 1I3HA 3NV3A 2DFCA 1ZZ6A 3BTZA 3IIAA 2DBNA 3AL6A 1WMDA 2L9LA 2WKKA 5JXHA 2P17A 3VBHA 3J8F1 5LRSA 5IK4A 2J1VA 5FZEA 1LOBA 1UKRA 3WVJA 4G4FA 5F7UA 2HWC2 3BTXA 1AL21 1ALYA 2NMOA 2QE3A 3N3HA 3MUZ1 4UW5A 5GKAC 3N9QA 2PMWB 2OW4A 1J3PA 3GZUC 1IKQA 1NLSA 3NAPA 4NMIA 4DXTA 1O3SA 3MPBA 2E53A 4JDNA 4QHBA 4LT5A 1CX1A 2E7TA 4JHTA 1FPN3 1KXGA 1ASJ3 1LKNA 3GHNA 3HN1A 3KWVA 4QPIB 1V9U3 3L9JT 5A32A 2WN2A 5C9AC 1GP5A 1IPKA 3WNLA 5H9SA 2UWAA 2VXJA 5FP7A 3ZVXA 4JRLA 5AC91 3OYWB 1MZ5A 2VBPA 1AXKA 1YJLA 3I4IA 5KXEA 4N9IA 1AR93 1IHMA 4RGGA 4WVZA 3ZMOA 3I2OA 4YWAA 1HQNA 1W05A 4HBNA 5A7PA 2N7GA 3SKVA 4E27A 2W47A 2BFUS 1S0DA 1RUD2 3WW2A 5C3QA 1LB2A 4OI1A 2WJSA 4LBQD 5F5AA 3LKJA 2W1QA 1LENA 1YI9A 4EQVA 4KG8A 1U5XA 1W0OA 2BW8A 5A3TA 4ONUA 1VBB2 4XCBA 2WNVA 2ZGOA 4K21A 5L9BA 5C5TA 5IFTA 4R9CA 4LKSA 3LSDA 2YC4A 1GU3A 1YIPA 1JYXA 1OI6A 1T2XA 1U5ZA 4LPLA 5C33A 4DZGA 2BNNA 1NG0A 1FNYA 3TNQA 1W2NA 3HN3A 3J7MA 4QKDA 5DZEA 4JGYC 5CISA 5C6CA 2XUEA 3DPRA 2VXRA 2ZAAA 4W65A 1GQGA 2FBEA 4FFGA 4U2AA 2R6QA 4BPZA 3M2MA 1DIWA 1QJU3 3KCCA 1W9FA 1HRV1 5F3CA 2ZHKA 1O3TA 4XDQA 3N7MA 2Y6FA 4XILA 2QZ2A 2GNTA 4DRVA 3OUJA 4RS5B 5GM0A 2WSUA 4FSJA 1RUH2 4AVTA 3FJSA 2XDVA 5EJZB 5FZBA 4L2NA 3OBAA 5HCFA 4LKEA 3DN7A 2QQOA 4ZXKA 5J3UA 3DYMA 1A78A 5I8TA 3VBUB 4IEQA 5FZAA 1MZFA 4JGZA 4PBOA 4QD2A 5CADA 3ETQA 4AGVA 1QMJA 5A70A 2WDBA 1F8VA 3WR0A 2GDFA 4URTA 3LEMA 4Q26A 4PF5A 2WO3A 3HD8B 2BERA 4KU8A 1XNCA 2JDMA 3WP3A 2Y60A 1AX0A 1YLLA 1YRZA 3H1YA 2BBVA 3JCIA 4OMDA 4XFIA 3IZOA 5C4WA 2WUHA 3WNPA 1OA4A 2OPWA 5L7OC 3ZXFA 1AR81 1VBE3 1WCDJ 4GMP3 3RMYA 1J3RA 3J8F2 3AMMA 5BNNB 2DVGA 4MV2A 2AH2A 1J84A 2PHXA 4UFIA 2ZEXA 4YZ5A 1C8NA 1VBA1 5FWEA 4YGCA 3ZYFA 5FZFA 4DXRA 2XWBB 5FPXA 1XPWA 3KZ4C 1AXZA 1UOJA 2XG3A 1DQ1A 2R073 1H9PA 4OVEA 4CU8A 4MGQA 4XAEA 5F5CA 1IOAA 3ECQA 2XHNA 3KGZA 2D40A 2VNGA 3S5QA 3I7DA 4Q29A 2JD9A 3OEAA 4P5YA 1UIJA 4UBGA 3QD6A 4MVTA 5FZ7A 4L8QA 1J83A 4ARXA 5HV0A 3H42B 2YGLA 4NHKA 5AC92 2CAVA 1H9WA 1AYM2 1W6OB 1H1AA 2JDAA 3MV11 3MZHA 3GYDA 2ZMLA 2WRAA 2VO5A 1LODA 2R0HA 3WG1A 3WXPA 3J9SA 3RG0A 4ATFA 1UU5A 3KV6A 5FY8A 3AP7A 1PO11 5DZFA 5LRRA 1WW6A 3CDZB 1QDCA 2P37A 4NHLA 1JZ8A 2BTVC 4K3UA 1Q43A 3E6BA 2KM2A 3LQCA 2CWMA 2D5HA 2JDHA 4LHKA 1QQP1 4AGRA 4CU6A 1UYZA 1UOBA 2RHPA 2OT7A 2RDQA 2PHLA 1FX5A 3OUIA 4NJ4A 4ZPIA 2XPJA 2ET7A 5CKQA 1PO22 3ZM8A 4OI0A 2GN3A 2JG8B 2VOKA 3FUOA 5FRAA 2TUNA 2VW1A 1CONA 1CZVA 1RVF2 2GZWA 2VBBA 2VNRA 2RDSA 3O14A 4GH4B 4HN1A 4PI2A 3UKNA 4QX8A 3O1PA 4HVOA 3ZIXA 4L9BA 2NM1A 3I2GA 3WSOA 4LULA 2WYFA 5FQ0A 5LB6A 2BUKA 4YW7A 1CGPA 3PLQA 2P4EA 1PVC3 4UYBA 1HRV2 3C7OA 2XB6C 3ITQA 4QHZA 1ASJ1 1VMJA 2XGXA 4QKFA 3UGGA 1NLQA 4YM3A 5A33B 1RUH1 1W28A 3VKLA 3WNNA 1HDKA 3LOBA 1O8PA 2CYFA 2FCVA 4L92A 2A1XA 4WVVA 4EJRA 1VAKA 2YXSA 1W2OA 4K6BA 2GH2A 4COWA 1GQPA 1OOPC 5T5JA 2VMDA 2ZMNA 3J8F3 5FPLA 3GBGA 1ND3A 3K3NA 4HK8A 4EYUA 2ADEA 4DY3A 3MUY1 1COV2 2YY1A 2R063 1OHFA 3U1XA 1NY71 2ZZJA 2VM9A 3DPRC 2BDRA 1PK6A 2DTYA 1RUJ1 2MEV1 1DLLA 4GJYA 2YYOA 4BQ4A 4OZOA 3OF1A 1QJX1 5I0TA 2QQWA 4AVSA 3SC7X 1A3KA 3O1RA 2WAOA 2I74A 4JAAA 1DYPA 3NV4A 1V6JA 2ID4A 1AF9A 2ZHMA 1W0NA 4A4AA 3INAA 3ZFFA 2GALA 3A0KA 2VH9A 5FUNA 4ZZ8A 1V6MA 1PVXA 1GICA 4AFDA 3WEZA 4IEVA 1CAWB 2BU9A 4PDWA 1IS6A 1Y9MA 3KV4A 4XFBA 3IMNA 4I02A 3WDYA 4XETA 5LW9A 1HJGA 4M3CB 1W6QB 2QZ3A 5DPNA 1WCUA 1KRIA 4ZZ5A 1WWYA 5K0UC 1CAVA 2E63A 4LBQA 1EV12 1CD3G 2C0ZA 2VJXA 4HETA 1WBLA 4O9EA 2D6NA 4XVHA 2I2SA 5CFDA 2GU9A 2LS6A 1AR62 2QKDA 2WS93 3GF6A 4JQRA 4CPBD 1X36A 2XOMA 3MW2A 4HSJA 3S5AA 5FBZA 5GLZA 4JGZB 1UY1A 3UJOA 1W8NA 1APNA 2Q8CA 1RHI1 1NA1B 2WWUA 2FCTA 5IAXA 2VMHA 2WAAA 1UL9A 4GH4C 1F15A 4LEJA 1V6LA 5LY2A 1YFYA 1HX6A 4YW6A 1MQTA 4BYYA 1PO12 4FTSA 4E4ZA 5EHDA 4QB1A 1W99A 1BCXA 1NYWA 2VD7A 4CEWB 3PUIA 3TN92 4AOCA 4E2SA 2ZGNA 5FREA 1QJY1 4ES9A 2GC0A 3IDEA 1DQ0A 1V6OA 3EQEA 4R4ZA 4J1WA 3FHQA 1RUI1 4Y1XA 4YYOA 1HW5A 2XJTA 2JDZA 2G9GA 4D7SA 3NKGA 2VQTA 5F37A 5A7SA 3H8UA 2UU8A 1QJX3 3QBQA 4L11A 2JDYA 4NO4A 1KJLA 4QXKA 2FDFA 4RHV1 4MYEA 4SLIA 2IFRA 3MV01 4YG3A 3NW4A 1RB8G 2OZJA 4E2GA 2ERFA 1OQ1A 1TZOA 3IN9A 1WBFA 1VBD2 1BVP1 4WM8C 4ZKTB 3F95A 2F4PA 4HZFA 1UOGA 4I3PA 5EYYA 2VNVA 3SISA 3THTA 3CHXA 2HWD1 3VKNA 1ZM1A 2W1UA 2RM22 1QH7A 3AKQA 4YW2A 2SBAA 3THCA 5F9TA 2XXZA 1RUE3 3AKTA 1G9FA 5LEJA 5IVYA 1RYYA 3HPNA 2XBO3 3LEKA 1ASJ2 4XUQA 5L9RA 4Y4RA 4L0PA 1Q5OA 3ZLIA 4QPGA 3ZXEA 3MYXA 3AYEA 3B00A 3D3AA 3HNBM 3I3QA 1O7FA 3PHMA 1NAEA 3M3CA 2ZOEB 2OQ6A 2RS32 5ACA1 5JXGA 5JDBA 3ZXKA 4Q4V1 4G3YC 4XIKA 1JZ5A 3GZAA 1PIV1 2QTWB 5CVRA 3ZDSA 1V00A 5F39A 2P2KA 1KQRA 1ZZCA 2Q1MA 3D0SA 2WA4A 3CQOA 3DL3A 3V65A 2RS11 1SCSA 1OLQA 1RUJ2 1OT5A 3ZR6A 5I0UA 2BPA2 3T2QA 3WNMA 1N3OA 1WW7A 4BE3A 3JBG2 4RA0A 2ZGKA 1H8TC 5APAA 2J1TA 2OPKA 2Y6KA 4N7UA 2BWCA 2XKOA 2JG8C 5J09A 1EPWA 2RJ2A 2E6VA 2VMFA 4HMZA 4QPIC 4AI0A 4BQ3A 4E8DA 5DMYA 4QX5A 1R081 2TBVA 4Z82A 3T2PA 5LK5A 4FFIA 1O91A 3ZX7A 1DGWA 2G19A 1XRUA 2IXKA 1NLRA 1UPSA 3NRUA 1BYHA 1OKQA 5E8AA 3ZFEA 5KR7A 2QQVA 3ZR5A 5CFDB 4AFBA 2AEZA 3VZMA 3GDBA 4HFSA 2CGOA 2ZX1A 4IQPA 1JYNA 2XJPA 3IMMA 4B29A 5F5IA 5A7NA 2D6KA 1EV11 5C3RA 5FYHA 2AZ5A 1HN1A 2WT1A 5FXVA 5K0UA 3CO2A 2CGPA 5B4NA 2E9QA 4Y22A 5KHIA 2V4AA 5DAXA 1D4M2 5E6HA 5IVBA 1UN1A 2JEMA 1GZCA 2A6YA 2AEYA 1ND3B 3R4SA 4LOSA 2HYKA 1H2NA 3D82A 4UWDA 1S2BA 1YEWA 3K77A 2Q5TA 1RHI2 4QHOA 1IS4A 2WWSA 3LDRA 2A3XA 2ILMA 5FTTC 3DXTA 3UKVA 2IXLA 1U0AA 2Z42A 2HWF3 4EV0A 4XFCA 4Q4Y2 1QXPA 1B35A 1QJY2 1JYVA 4LTAA 2Y26A 3F2ZA 1BEV3 1ND2B 2G9FA 4UFKA 5C70A 1Q8VA 1ZZ7A 4IERA 4BZ4A 4P02B 3ZYGA 1R083 2QDNA 4LO6B 4RHV2 2VW0A 3TNPB 2FDIA 3VBOA 2GSYA 1SACA 4TZDA 1W2AX 4LIVA 2ATFA 1LOGA 2P3JA 4RL7A 2R32A 3OGSA 1UD1A 2ZGSA 3VB9A 3JQWA 2XBO2 4OZXA 2BJSA 4KWUA 3ZKUA 2BZDA 4CP9B 3ZN4A 3FHAA 3M8LA 5IUQA 4QWNA 1L7RA 1SZBA 1Y4WA 5BY5A 3CL1A 1RIRA 2EXJA 5C9AB 4MG2A 3DGTA 5IVFA 1W90A 1JW6A 5EXOA 3BUCA 4B7KA 2BWAA 1YNAA 4CZSA 1YWKA 5GLTA 3NKTA 2FDGA 5C8CC 1VPHA 4RFRB 4CEYB 5F5QA 3M3QA 3H1MA 2XJVA 3KB5A 4OUMA 3RNSA 3K2OA 1DZRA 3AXDA 3C3VA 4FAGA 4BJ0A 1JZ4A 3GZEA 1PGL2 3DYOA 4RSUA 3MFAA 1K5MA 2HWF2 4B7EA 4D7TA 5E1RA 2WLQA 2XKPA 1FXZA 1O59A 1S0GA 1YFWA 2V4VA 4H2AA 4OHZA 4CDQC 1W6PB 4M3CA 1SLLA 3E6DA 4A45A 2GC1A 5HXMA 2JE9A 2B8MA 5F2SA 3VGIA 2VZQA 1CAVB 4LBQB 3S6PA 4OHYA 5FZDA 2KR2A 3ZFEB 3S30A 4P9JA 1POQA 2WSVA 5FYIA 4XYXA 2PLV2 3P3PA 3EO6A 2EAKA 3HT1A 3PIJA 4NVPA 1REDA 5LATA 3ZDVA 2WT2A 5FZKA 5F6KA 4E4DX 1FPN1 1ZNPA 3N4MA 3KSCA 2XQRA 5HBAA 4BXSV 1LGCA 3GALA 4KWKA 1V70A 2W9XA 1W9YA 4AF9A 3RGBA 4YVWB 3VKMA 3U37A 1HXS2 3OBTA 4OYUA 2DWRA 3V0BB 1J1LA 5FY4A 1UMIA 2ZCWA 3LEGA 3KCXA 4I3GA 3ACLA 5CFCB 4LBKA 1GWLA 2XL7A 3NAPB 1C5IA 1RTVA 2PHUA 5A6QA 3E1F1 1GQHA 3P3NA 4FAHA 5A80A 1DHKB 1AR82 2VMGA 1R091 4QM8A 5ABJA 1C57A 3VZKA 5A32B 3SCFA 1QJY3 2YUEA 5DZGA 1M06G 1V9U2 1ODMA 2OZ6A 4KBBA 5A7WA 5JLVA 3AZZA 4H7MA 4RQPB 4KQ7A 4QKNA 4A7ZA 1C8M2 5BNOA 3WQ1A 4MXWA 2BRTA 2GMEA 4Y5Z0 5C8WA 1W8UA 3W59A 5KC6A 3DEMA 1JODA 1NCQC 5EYXA 3AZYA 2WINB 2HJIA 2WWJA 4LJHA 2DBIA 4Q0UA 1OPOA 1YQ6A 5J36A 1KS5A 2PAKA 4WV8A 4I0WB 1NOVA 1OMIA 1H2KA 4G9SB 1QDOA 1YCIA 3RZZA 4YM2A 1QOTA 1X9TA 2RR11 3VBHC 2PHDA 2ENRA 5FLHA 2QVSB 3RVHA 1F5FA 4B3NA 5J48A 2W95A 4OMCA 3PMEA 4PHZA 2XLGA 4Q4W1 1WCSA 1QXJA 3H50A 3POBA 4FCAA 2J1EA 4NN0A 1LJ7A 3H8OA 4L99A 3NNGA 2DTWA 3R0RA 2KA3A 1NQDA 3JU9A 3WDVA 4IL7A 3V0AB 1UY4A 2WNUB 1R1A3 2K2SA 2CNAA 4M4RA 1TNFA 5FZCA 1BJQA 2W08A 3GGLA 1MEC3 3HIFA 3I2DA 4GMP0 3O1TA 2W3JA 3GXUA 2QNKA 4XEZA 2W39A 3K75B 1XNKA 1ENSA 1W6PA 1DZTA 5BNNC 2D7FA 2P6HA 3NJVA 3RJRA 1PGSA 1QQP2 1W2UA 3H3ZA 2YG0A 3ZPOA 2D97A 4Z8BA 1G86A 4RR3B 1C1FA 2W2IA 1OURA 1R093 3OGGA 5FOBB 1VJ2A 1ZYBA 2B9UA 2WNVC 4KWJA 4CRQA 5FZ4A 3ACIA 1YO8A 4LE3A 1C28A 3USUB 3VZLA 5BPXA 3O0XA 2ZGQA 1H6YA 5A1AA 5FYUA 1WZXA 1ACCA 4K7JA 4BB3A 5A6XA 3U14A 1HQWA 3EMRA 3LA3A 1ZZ9A 2I07B 4AI9A 1AR63 1CN1A 5K0UB 2Y6JA 1UXZA 5CIRA 3AP5A 2JXAA 2VOWA 1IG0A 3AMQA 4AEDB 4CDXC 3FE5A 3JD73 4CU7A 2PA7A 2VMCA 4XW3A 3VDDA 3VDAA 2W1WA 5LA2A 1VBC2 2WABA 4LHNA 1X82A 2G4IA 1HXS1 1K5MC 3KMHA 3ACGA 4LA2A 1GNZA 4K8RB 5C9AA 1R1A2 4R9BA 2HWD3 4Q2FA 2IUWA 4QXBA 4NWVA 2AUYA 2VG9A 5FO7B 4YVSA 1ND2A 2RS33 2JE8A 2VQAA 5H9PA 5LA9A 4MGTA 1BEV1 4QPWA 3H3UA 4FXKB 2VOVA 4TN7A 2CSGA 3D5OA 4X8NA 4BOWA 2JKXA 2D43A 5CZKA 1UXXX 3AP6A 4CDXA 3U11A 4BHPA 4HG6B 4YARA 1V9U1 2X53S 4IW3A 5JR2A 1LHVA 1X8EA 2P3IA 1JTZX 2D3RA 2OA2A 4DUXA 1BQPA 3M7AA 1KFXL 2A6VA 3IIIA 4CP9A 1H4HA 1DGLA 2XL9A 3PTRB 4YNIA 3ABZA 3NWKA 4B4RA 2RM23 3MICA 3H7YA 2E33A 1OSGA 1W9WA 3PVBB 5JXIA 1RUOA 1RUE1 3FX3A 3KV5A 2X05A 4F83A 4BU2A 3N9NA 4OCTA 4CDWC 4TXWA 4J1XA 3O1SA 2VZTA 1J58A 2RR12 3ATGA 4B1LA 1RGSA 3GM8A 2WNUA 1RVF1 1YYNA 3PU8A 4Y1ZA 3LZZA 3OY8A 3PTYA 2FDJA 2RMU1 4CPBA 1LEDA 3AVRA 5DUXA 2Q4SA 4FQZA 5E88A 4M3CF 3MLLA 3IB3A 3JB4C 4I01A 1I5ZA 1F35A 1NQJA 1OUXA 1D2QA 1F4HA 4AXOA 2OUJA 1XC6A 3AJZA 1Y43B 3AYAA 3BCWA 3TWIA 2OXBA 2LW8A 3KQRA 4H14A 3AP9A 3U10A 5HCHA 3B9IA 3LA2A 4XBQA 1ZREA 1ULPA 4KGGA 2AYHA 3N7LA 4BXFA 3TN91 4D6QA 1PM7A 1ENRA 2X5IB 2NN8A 2HKXA 1GZ9A 1HV1A 2J7MA 4AHZA 4ZU7A 4QM9A 3ZPYA 2ZGLA 3D6EA 1HLCA 2CDPA 4N9HA 4M0NA 4HKLA 3ACHA 4RQPA 3U78A 1S0BA 1ZVFA 4WZFA 5A6ZA 4D3WA 3EJKA 4CCCA 1ULFA 4BLJA 1NCRB 4PI0A 2BGOA 1I1EA 4FQ4A 4P00B 3CJIC 4O9GA 2MEV2 2DVAA 3OD0A 4ZHNA 2BVVA 3A21A 3OPWA 1QIQA 5JSOA 3LAGA 2WO2A 2R042 1GOHA 3VDDB 4WVMB 1VRH3 3PDQA 2HWD2 5SV5A 3WDUA 2H6CA 4Y20A 4FTEA 4LO8A 1D4M3 4TWTA 1PO23 1QHDA 5DN2A 4DS0A 1DFQA 1SLIA 3P1IA 3TYJA 5ABJC 4PBPA 4KNCA 4ASLA 4QB6A 3G7DA 2V5YA 2PAMA 1JU3A 1UYYA 3CZJA 1C1LA 4MLOA 1OC1A 4XXPA 3UGHA 4V2WA 1VBC1 5FFOC 2JKBA 2RJLA 1X9PA 1PIV2 5CKMA 5JIAA 3WCRA 3WQ7A 3ZXJA 5C71A 2D93A 1W8FA 2BBAA 3ETPA 3NMBA 1IQDC 1HRI2 4FPFA 4ISRA 1XYNA 5BNPC 3ZFGA 4A42A 3POWA 4QQHA 2JX9A 3HOBA 4CCKA 2W92A 2XMLA 1BK1A 4C91A 5C3SA 1V0AA 4AI8A 3WNKA 1H1IA 4CCEA 4FBFA 5FYCA 2HBUA 3J7NA 4DRRA 4FOVA 3LSEA 3QH7A 4HKWA 3L2HA 2VZPA 2V09A 4IE7A 1WUVA 4LITA 4S2HA 4XF9A 3TEXA 2RDRA 1MS9A 1RMU3 1U5YA 3O1MA 2AC1A 1BMV1 2VUAA 2UY9A 4PLOA 5EP9A 2JICA 3KVAA 3LIGA 1ZBE3 5FYZA 3WCSA 5HPOA 3H8RA 2VVEA 2CTVA 3MGUA 5GZFA 1CPMA 5LCWL 2JB8A 3GHMA 3U0ZA 3VBHB 1RUI2 2QQNA 3ZKYA 4EWEA 1BK0A 3LEIA 3MIGA 4CVUA 4K40A 1PNFA 4LA3A 1XYPA 3DCQA 4B8EA 4HOOA 3KT7A 4N43A 1UKGA 2R49A 2VULA 3I8TA 3TN93 4ASKA 5A3UA 1VBD1 1X8MA 2OQ7A 5FMDA 4JVAA 1D4M1 1HXS3 4XPVA 1KITA 3CJIA 5DABA 1SBDA 1DYOA 1PIV3 1MVQA 2D5FA 3RZKA 2ZHNA 3H0OA 1W9TA 3LGRA 3I2IA 4CU9A 5GJ6A 1OXCA 2GH8A 4V2VA 4Q0VA 3SH3A 2P1BA 1VB4A 4MGYE 3WF1A 4GWMA 4COVA 1CAUA 4KH9A 2DFBA 3HAGA 3ZXLA 5JI9A 4AL9A 4NHMA 5CFCC 2MEV3 2WIIB 2FQPA 2Q1FA 3IAPA 5FP3A 5L9VA 2FMYA 4GXLA 1G9CA 4W6YA 3ZYRA 2YU2A 2QJVA 5BXXA 5JWPA 1SLTA 2DDUA 2HEVF 3VBFA 3ZO0B 5IFPA 3B69A 1G6NA 3EB7A 3NNFA 4AE2A 4EN8B 1MS5A 3JBG1 3POGA 1N47A 1JXNA 4YG6A 1LU1A 1ONAA 2GP5A 2R041 5KBFA 3MI8A 4MXVA 3AC0A 4DNYA 4J25A 3DYPA 3GZTB 4NPRA 1POV0 1QU0A 4MSVA 4PLNA 5DUVA 3WT3A 4BISA 5HCAA 2RMU3 3OY8B 2VGDA 2R7EB 1L3JA 4GB32 4K1YA 1RUF2 1Z0HA 3BI3A 5KWRA 3PU3A 1W6MB 3WY6A 4CCNA 3I2KA 4LLFA 1PK6C 2FMDA 1MZ6A 2R30A 4CDUA 5LWBA 2B42B 1GR3A 1LOAA 3HVDA 5FZHA 4FPJA 1W8ZA 3IM0A 1DLCA 2LROA 1XE8A 1UX6A 2JJ6A 4I30A 4W4ZA 4Y26A 4HK9A 3A0NA 4AFCA 4LK6A 3RI8A 4BQYA 1RUC3 2JDKA 4HVRA 4URAA 3WOGA 3CZUA 2VUJA 3D4KA 3UNPA 2DU0A 2A6WA 3D8CA 1RUI3 1ND2C 5DUWA 3RRDA 3N7KA 4OFGA 1HB3A 1H30A 4MUVA 3IKWA 4UFHA 4MOAA 5CKNA 4LBLA 4EN9B 1LTEA 3ZYJB 4BMBA 1LOCA 3OUHA 2EXIA 3PURA 5FDBA 4Y22B 3SMHA 1AJKA 3RZGA 1JOJA 1XB9A 1UWWA 3JXSA 3JB8A 2AENA 3WQBA 1G8WA 1TMF1 4CCDA 5GZCA 3VDDC 2C26A 1JHNA 4YW4A 3HBZA 5I93A 1TME1 1RVF3 4N43C 2ETEA 2GAUA 3R6SA 1K12A 2VPVA 1VB2A 2NLRA 4C0HA 4Y1VA 1VLNA 4IETA 2HH9A 4XQ4A 2D3SA 3B5LB 2WFF1 2R1DA 3BALA 5K8SA 4ATEA 1MVEA 4IV1A 5J98B 4A44A 1VBC3 2VQ0A 4N7IA 4S2GA 2O1QA 1AUYA 4A3ZA 4NHXA 4YRDA 5FZ0A 3AM2A 4MXWB 2HEWF 3BTAA 4FPCA 3WX5A 4XJUA 2VCMA 3OJBA 3VV1A 1WW5A 2VU9A 2Z79A 1R092 3RYRA 4AVCA 4D8MA 1OA3A 1WLWA 3I2JA 3WP4A 4C8DA 4LUMA 4N53C 4XOGA 1ENXA 4MH0E 2YGMA 2D6MA 2SLIA 3BYWA 4ZXEA 4N53A 2JIJA 1X33A 3DKQA 1RUC1 2Z2SB 4BQ1A 4UAPA 1O5UA 3CF6E 3BGAA 4WVMA 3SEPA 4XAAA 5T5OA 1H8TB 4R9DA 5IK8A 1LESA 3D0JA 1SQ4A 2ZX4A 3KGLA 1I5PA 1OUSA 1LOFC 4QMAA 5FK8A 3U75A 1KFUL 1HN0A 1TMF3 2ZGUA 5DAPA 1AYN1 4FTBA 2LUWA 3MIBA 1GBGA 2G1MA 2EVXA 5K7PA 3M3EA 5ACA3 5JSRA 1X7NA 5C7GA 1SFPA 1LEMA 1SLBA 1YQ8A 1IKPA 1COV3 2JECA 2QQPA 4JZRA 4CDQA 3ZFGB 1KS4A 4B4PA 3MIHA 4IEZA 2PLV1 3AVSA 4DO0A 1MQTC 2PFWA 3GCXA 1UMHA 4MGKE 4J6GA 4CDUB 1CZSA 5FPUA 1FPN2 2QCSB 3FWEA 4GH4A 4COYA 2C24A 4GZ9A 4MO3M 2I45A 5EQUA 2IFWA 3V0AA 2IXJA 1NA1C 2ZKLA 1JMUB 1RJ7A 3ORJA 3T0AA 3I59A 3VL9A 4LO4B 5KHJA 1S2EA 3HNMA 2OYZA 3KT1A 3UL2A 2DUPA 4LHLA 5TSWA 4GMP1 4UI9L 1OVPA 2ZJCA 3URFA 3RZHA 4UF0A 4QT6A 3ES4A 1NZCA 2ZPXA 3MBWA 1VAVA 2IVIB 3NJYA 3AL5A 4LIUA 4FXGB 3CEWA 1A6CA 1OD5A 1XU1A 4IGOA 4XQDA 4BA6A 3N9OA 4TLGA 4XF3A 3WV6A 1LU2A 4NIGA 5J96B 3QOPA 3NL1A 3HMYA 4K20A 2YC2A 4L97A 1O6UA 5E16A 5AVPA 3VBSA 1C8M1 2A73B 1AR91 1S1AA 2DURA 3RS6A 1OH4A 2ZX3A 2YDEA 2ZBJA 3EHKA 4E4HA 4XMIA 4GALA 1A8DA 5F2WA 1B35C 3UJQA 4LNVA 5LASA 5A7WB 1VRBA 3T4HB 4DQAA 1MPXA 1NXD1 3MW4A 1IS3A 1OQDA 5LEKA 1D0HA 3OB8A 1UAIA 4IEXA 4ZS3A 5I8SA 1Z7S1 2BVBA 3PVEA 1N3PA 1V6KA 3OGVA 1JYCA 3MIDA 2UYBA 4BCUA 2WQ4A 4H55A 3RWKX 3UGFA 4JKLA 4CCJA 4FOWA 4Q0QA 4FP2A 1FMD1 4V1PA 3BIEA 2X09A 3ZYBA 1XNTA 5A3MA 3VD4A 3VBFB 3KHBA 5GALA 3USSA 1IPJA 3BPSA 5GZGA 2QUOA 4JGZC 2YB7A 4ZONA 4HSLA 4UW3A 3K51A 5FZIA 1VRH1 1DGRA 2BGCA 5AFBA 3KV9A 1QJU1 2VZ1A 1RUE2 3S57A 1UZZA 4IEYA 4Y1YA 2EA7A 3CBNA 1S0EA 3AZXA 3MFCA 4WM7C 2XJQA 4Y3OA 2TNFA 1O4ZA 2WZPP 3V56A 4PIZA 4HANA 4W8JA 2J1RA 4KGQA 2XONA 3T09A 1AXYA 3VUOA 1V6NA 3IWZA 1AYN2 3ACFA 5IVCA 1AX1A 1MS8A 4GKXA 5GLVA 1W8OA 3NJXA 4QU2A 4AEDC 1OOPB 4XFAA 3ST7A 1NT0A 1MS0A 1S0JA 1KDKA 1NCQB 4CUAA 4XFHA 2JWPA
chains in the Genus database with same CATH topology
3SKVA 1K42A 3C7HA 2W47A 1UY4A 4M4RA 4D0QA 3GGLA 2W3JA 3GXUA 2ORZA 2W1QA 4YPJA 2EIDA 3K75B 4XUOA 3NJVA 1UY2A 1NUKA 5B4XA 2YG0A 5IFTA 4LKSA 2YC4A 1R64A 1GU3A 1JYXA 3T0DA 1T2XA 4LPLA 4DUWA 4DEVA 3ACIA 3HN3A 5A1AA 1H6YA 5EIYB 3HEIA 1F4AA 3NQHA 2OKXA 2BGPA 1JZ2A 3A23A 2Y6JA 1UXZA 2EICA 2W91A 1SG3A 4XZUG 2VMCA 5EJZB 2WZEA 3VDAA 3EYPA 5LA0A 2W1WA 3OBAA 4XUNA 5LA2A 2QQOA 3DYMA 1UYXA 2WABA 3ACGA 2W1SA 2WDBA 3I3DA 3HNYM 1CIYA 2WO3A 3I2FA 2BERA 2Y64A 2EIBA 2JE8A 4OMDA 4QPWA 5I0DA 2WUHA 3VD5A 3K46A 3WNPA 2JKXA 2KD7A 1UXXX 5CZKA 3VD3A 4HG6B 5JR2A 4M4PA 1OF3A 4MGSA 1J84A 4DUXA 2ZEXA 2WBKA 2WQ8A 4DXRA 3IIIA 1XPWA 4GWIA 2RVAA 3C7FA 3ABZA 1WKYA 2E33A 4CU8A 4XUTA 1W9WA 4MGQA 4ARYA 2ZEYA 5JXIA 2X05A 2W87A 2J1SA 1UY0A 2XHNA 3ECQA 1H6XA 1WCQA 2JD9A 4A6OA 4TXWA 1K45A 3OEAA 4P5YA 2VZTA 4ARXA 1J83A 3FL7A 3GM8A 4IUGA 4BK5A 1JU4A 5IHRA 2YFZA 3IB3A 4CUCA 2QQLA 2JDAA 1F4HA 2W94A 3MV11 1XC6A 5JUVA 2VO5A 5JXJA 2LW8A 1KEXA 1TG7A 1ULPA 3CDZB 5J1XA 1JZ8A 3SEEA 2Y6HA 2J7MA 3LQCA 4CU6A 2VTFA 2CDPA 1UYZA 3ACHA 2QBXA 3ZM8A 1D7PM 2BGOA 3DECA 1CZVA 4P00B 4ET7A 3A21A 3I2GA 3WSOA 1PMJX 2WO2A 1GOHA 2Z4FA 2W5FA 2ORXA 3C7OA 2VZVA 1UZ0A 5DN2A 2V72A 3P1IA 2ZXQA 4ZY9A 3WNNA 1O8PA 4QB6A 1JU3A 1O8SA 1UYYA 3CZJA 1JZ6A 1GQPA 4QX0A 2VMDA 3K4DA 3MO4A 5C71A 3VD9A 3A7QA 3MUY1 2BBAA 3ETPA 3P6BA 1IQDC 4A41A 2DCKA 4DEQA 4A42A 2VM9A 3HOBA 2V5DA 4AAXA 2W92A 4QX2A 4CU7A 2J1UA 4QB1A 2PQSA 3WNKA 4OZOA 2QQMA 1US2A 3LE0A 3PUHA 3K4ZA 2VZPA 5JMOA 2WAOA 2ID4A 1W0NA 2B9VA 4A4AA 3WNOA 4JKMA 5G04L 4ZZ8A 2QQIA 3WEZA 5HPOA 1UY3A 3I3BA 3WF3A 5LCWL 2WO1A 5DPNA 1GMMA 2QQNA 4ZZ5A 3LEIA 4CVUA 5LA1A 2VJXA 2HLEA 4XVHA 2LS6A 4CUBA 2RV9A 5FUIA 1K3IA 2XOMA 1UY1A 3CKHA 1DYOA 1W8NA 1W9TA 1P8JA 4W50A 3T0BA 3LPFA 2WAAA 3I2IA 4CU9A 2J1AA 3OGRA 1GNYA 1CZTA 1W99A 3WF1A 3PUIA 1OF4A 1NX9A 4PT6A 3FHQA 1ULOA 2VOTA 1DP0A 2VQTA 3IAPA 3FN9A 2W46A 1JYWA 3MV01 2DDUA 5IFPA 3EB7A 2Y6GA 2VZSA 3WF4A 1US3A 3AC0A 4KI5M 2VZUA 2E26A 2W1UA 3VDCA 1JZ7A 3DYPA 3THCA 4RN5A 1RYYA 3HPNA 3LEKA 1PMHX 4XUQA 1JZ3A 2R7EB 2DCJA 4L0PA 1KGYA 3D3AA 3HNBM 2ZEWA 3VDBA 1NAEA 3T08A 3I2KA 5JXGA 3LPGA 3C7GA 1JZ5A 1JI6A 2VR4A 1DLCA 4W4ZA 3CQOA 3I97A 4GWJA 3CZUA 2VZOA 1GOFA 1OT5A 3BN6A 3T2QA 3WNMA 3UNPA 4DUVA 3IDAA 3UETA 2J1TA 2Y6KA 1TVGA 1UX7A 4AG4A 2RJ2A 2VMFA 3OG2A 2X10A 4MOAA 4E8DA 5DMYA 4QX1A 2HYXA 3T2PA 4QB2A 1UWWA 3JXSA 3VD7A 3WQBA 1EUTA 2C26A 3NRUA 3IAQA 1W9SA 1SDDB 2VC9A 3GDBA 1JYNA 1K12A 4PF1A 3J7HA 1HN1A 5G05L 4JHZA 4KMQA 4DXSA 4A44A 5B4NA 4A3ZA 2VCAA 3SKJE 2E32A 3CMGA 4D8MA 2WZ8A 3K77A 3I2JA 3WF2A 2VZRA 3HJRA 4ZXEA 5IJRA 2Y8KA 4QAWA 4UAPA 5CYYA 3BGAA 3SEPA 4QDQA 1JYVA 1XNAA 3F2ZA 3THDA 2E31A 1OD3A 5C70A 5IYYA 4P02B 1I5PA 5DQ0A 4Z2AA 2VCCA 4LHSA 3W5NA 3OGSA 4E8CA 1BHGA 4RYDA 5C7GA 4KWUA 2BZDA 3FHAA 4P08A 1PX3A 1L7RA 4XURA 2CDOA 1UMHA 4LQRA 1CZSA 4UOJA 1YQ2A 2VCBA 4XUPA 3WF0A 1L7QA 4GZ9A 4MO3M 2QQKA 1SHWB 5EJ1B 1EUUA 3T0AA 4PQQA 2C9KA 4JKKA 3HNMA 3UESA 4BJ0A 1JZ4A 3DYOA 1GOGA 4UI9L 4BK4A 2Y6LA 2B4KA 1O59A 3MBWA 2V4VA 1NKGA 2VL4A 4A45A 1GUIA 2VMEA 2WN3A 5HXMA 2VZQA 1JHJA 3C7EA 4OUEA 3T2OA 2YC2A 4CUAA 4BXSV 1LNSA 2YFUA 3I3EA 1OH4A 4TTGA 2W9XA 2WYSA 3C8XA 4QDRA 3U37A 1MPXA 4OYUA 4MADA 3W5MA 3OB8A 2J22A 3CIHA 1UMIA 3LEGA 2C4XA 3OEBA 3A22A 2EIEA 4QX3A 4BDVB 3OGVA 3E1F1 2ZEZA 4JKLA 4FI9A 2VQUA 2L9LA 2X09A 5JXHA 1XNTA 3VD4A 4QDSA 2J1VA 2YB7A 5F7UA 2VZ3A 3MUZ1 4DXTA 4JX0A 2VZ1A 1CX1A 2XQXA 3K4AA 4W8JA 2J1RA 2WN2A 2XONA 3T09A 3WNLA 3ACFA 2W95A 4OMCA 1W8OA 3NJXA 2QQJA 2J1EA 3NNGA 1PX4A 3I2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SKV A;  1K42 A;  3C7H A;  2W47 A;  1UY4 A;  4M4R A;  4D0Q A;  3GGL A;  2W3J A;  3GXU A;  2ORZ A;  2W1Q A;  4YPJ A;  2EID A;  3K75 B;  4XUO A;  3NJV A;  1UY2 A;  1NUK A;  5B4X A;  2YG0 A;  5IFT A;  4LKS A;  2YC4 A;  1R64 A;  1GU3 A;  1JYX A;  3T0D A;  1T2X A;  4LPL A;  4DUW A;  4DEV A;  3ACI A;  3HN3 A;  5A1A A;  1H6Y A;  5EIY B;  3HEI A;  1F4A A;  3NQH A;  2OKX A;  2BGP A;  1JZ2 A;  3A23 A;  2Y6J A;  1UXZ A;  2EIC A;  2W91 A;  1SG3 A;  4XZU G;  2VMC A;  5EJZ B;  2WZE A;  3VDA A;  3EYP A;  5LA0 A;  2W1W A;  3OBA A;  4XUN A;  5LA2 A;  2QQO A;  3DYM A;  1UYX A;  2WAB A;  3ACG A;  2W1S A;  2WDB A;  3I3D A;  3HNY M;  1CIY A;  2WO3 A;  3I2F A;  2BER A;  2Y64 A;  2EIB A;  2JE8 A;  4OMD A;  4QPW A;  5I0D A;  2WUH A;  3VD5 A;  3K46 A;  3WNP A;  2JKX A;  2KD7 A;  1UXX X;  5CZK A;  3VD3 A;  4HG6 B;  5JR2 A;  4M4P A;  1OF3 A;  4MGS A;  1J84 A;  4DUX A;  2ZEX A;  2WBK A;  2WQ8 A;  4DXR A;  3III A;  1XPW A;  4GWI A;  2RVA A;  3C7F A;  3ABZ A;  1WKY A;  2E33 A;  4CU8 A;  4XUT A;  1W9W A;  4MGQ A;  4ARY A;  2ZEY A;  5JXI A;  2X05 A;  2W87 A;  2J1S A;  1UY0 A;  2XHN A;  3ECQ A;  1H6X A;  1WCQ A;  2JD9 A;  4A6O A;  4TXW A;  1K45 A;  3OEA A;  4P5Y A;  2VZT A;  4ARX A;  1J83 A;  3FL7 A;  3GM8 A;  4IUG A;  4BK5 A;  1JU4 A;  5IHR A;  2YFZ A;  3IB3 A;  4CUC A;  2QQL A;  2JDA A;  1F4H A;  2W94 A;  3MV1 1;  1XC6 A;  5JUV A;  2VO5 A;  5JXJ A;  2LW8 A;  1KEX A;  1TG7 A;  1ULP A;  3CDZ B;  5J1X A;  1JZ8 A;  3SEE A;  2Y6H A;  2J7M A;  3LQC A;  4CU6 A;  2VTF A;  2CDP A;  1UYZ A;  3ACH A;  2QBX A;  3ZM8 A;  1D7P M;  2BGO A;  3DEC A;  1CZV A;  4P00 B;  4ET7 A;  3A21 A;  3I2G A;  3WSO A;  1PMJ X;  2WO2 A;  1GOH A;  2Z4F A;  2W5F A;  2ORX A;  3C7O A;  2VZV A;  1UZ0 A;  5DN2 A;  2V72 A;  3P1I A;  2ZXQ A;  4ZY9 A;  3WNN A;  1O8P A;  4QB6 A;  1JU3 A;  1O8S A;  1UYY A;  3CZJ A;  1JZ6 A;  1GQP A;  4QX0 A;  2VMD A;  3K4D A;  3MO4 A;  5C71 A;  3VD9 A;  3A7Q A;  3MUY 1;  2BBA A;  3ETP A;  3P6B A;  1IQD C;  4A41 A;  2DCK A;  4DEQ A;  4A42 A;  2VM9 A;  3HOB A;  2V5D A;  4AAX A;  2W92 A;  4QX2 A;  4CU7 A;  2J1U A;  4QB1 A;  2PQS A;  3WNK A;  4OZO A;  2QQM A;  1US2 A;  3LE0 A;  3PUH A;  3K4Z A;  2VZP A;  5JMO A;  2WAO A;  2ID4 A;  1W0N A;  2B9V A;  4A4A A;  3WNO A;  4JKM A;  5G04 L;  4ZZ8 A;  2QQI A;  3WEZ A;  5HPO A;  1UY3 A;  3I3B A;  3WF3 A;  5LCW L;  2WO1 A;  5DPN A;  1GMM A;  2QQN A;  4ZZ5 A;  3LEI A;  4CVU A;  5LA1 A;  2VJX A;  2HLE A;  4XVH A;  2LS6 A;  4CUB A;  2RV9 A;  5FUI A;  1K3I A;  2XOM A;  1UY1 A;  3CKH A;  1DYO A;  1W8N A;  1W9T A;  1P8J A;  4W50 A;  3T0B A;  3LPF A;  2WAA A;  3I2I A;  4CU9 A;  2J1A A;  3OGR A;  1GNY A;  1CZT A;  1W99 A;  3WF1 A;  3PUI A;  1OF4 A;  1NX9 A;  4PT6 A;  3FHQ A;  1ULO A;  2VOT A;  1DP0 A;  2VQT A;  3IAP A;  3FN9 A;  2W46 A;  1JYW A;  3MV0 1;  2DDU A;  5IFP A;  3EB7 A;  2Y6G A;  2VZS A;  3WF4 A;  1US3 A;  3AC0 A;  4KI5 M;  2VZU A;  2E26 A;  2W1U A;  3VDC A;  1JZ7 A;  3DYP A;  3THC A;  4RN5 A;  1RYY A;  3HPN A;  3LEK A;  1PMH X;  4XUQ A;  1JZ3 A;  2R7E B;  2DCJ A;  4L0P A;  1KGY A;  3D3A A;  3HNB M;  2ZEW A;  3VDB A;  1NAE A;  3T08 A;  3I2K A;  5JXG A;  3LPG A;  3C7G A;  1JZ5 A;  1JI6 A;  2VR4 A;  1DLC A;  4W4Z A;  3CQO A;  3I97 A;  4GWJ A;  3CZU A;  2VZO A;  1GOF A;  1OT5 A;  3BN6 A;  3T2Q A;  3WNM A;  3UNP A;  4DUV A;  3IDA A;  3UET A;  2J1T A;  2Y6K A;  1TVG A;  1UX7 A;  4AG4 A;  2RJ2 A;  2VMF A;  3OG2 A;  2X10 A;  4MOA A;  4E8D A;  5DMY A;  4QX1 A;  2HYX A;  3T2P A;  4QB2 A;  1UWW A;  3JXS A;  3VD7 A;  3WQB A;  1EUT A;  2C26 A;  3NRU A;  3IAQ A;  1W9S A;  1SDD B;  2VC9 A;  3GDB A;  1JYN A;  1K12 A;  4PF1 A;  3J7H A;  1HN1 A;  5G05 L;  4JHZ A;  4KMQ A;  4DXS A;  4A44 A;  5B4N A;  4A3Z A;  2VCA A;  3SKJ E;  2E32 A;  3CMG A;  4D8M A;  2WZ8 A;  3K77 A;  3I2J A;  3WF2 A;  2VZR A;  3HJR A;  4ZXE A;  5IJR A;  2Y8K A;  4QAW A;  4UAP A;  5CYY A;  3BGA A;  3SEP A;  4QDQ A;  1JYV A;  1XNA A;  3F2Z A;  3THD A;  2E31 A;  1OD3 A;  5C70 A;  5IYY A;  4P02 B;  1I5P A;  5DQ0 A;  4Z2A A;  2VCC A;  4LHS A;  3W5N A;  3OGS A;  4E8C A;  1BHG A;  4RYD A;  5C7G A;  4KWU A;  2BZD A;  3FHA A;  4P08 A;  1PX3 A;  1L7R A;  4XUR A;  2CDO A;  1UMH A;  4LQR A;  1CZS A;  4UOJ A;  1YQ2 A;  2VCB A;  4XUP A;  3WF0 A;  1L7Q A;  4GZ9 A;  4MO3 M;  2QQK A;  1SHW B;  5EJ1 B;  1EUU A;  3T0A A;  4PQQ A;  2C9K A;  4JKK A;  3HNM A;  3UES A;  4BJ0 A;  1JZ4 A;  3DYO A;  1GOG A;  4UI9 L;  4BK4 A;  2Y6L A;  2B4K A;  1O59 A;  3MBW A;  2V4V A;  1NKG A;  2VL4 A;  4A45 A;  1GUI A;  2VME A;  2WN3 A;  5HXM A;  2VZQ A;  1JHJ A;  3C7E A;  4OUE A;  3T2O A;  2YC2 A;  4CUA A;  4BXS V;  1LNS A;  2YFU A;  3I3E A;  1OH4 A;  4TTG A;  2W9X A;  2WYS A;  3C8X A;  4QDR A;  3U37 A;  1MPX A;  4OYU A;  4MAD A;  3W5M A;  3OB8 A;  2J22 A;  3CIH A;  1UMI A;  3LEG A;  2C4X A;  3OEB A;  3A22 A;  2EIE A;  4QX3 A;  4BDV B;  3OGV A;  3E1F 1;  2ZEZ A;  4JKL A;  4FI9 A;  2VQU A;  2L9L A;  2X09 A;  5JXH A;  1XNT A;  3VD4 A;  4QDS A;  2J1V A;  2YB7 A;  5F7U A;  2VZ3 A;  3MUZ 1;  4DXT A;  4JX0 A;  2VZ1 A;  1CX1 A;  2XQX A;  3K4A A;  4W8J A;  2J1R A;  2WN2 A;  2XON A;  3T09 A;  3WNL A;  3ACF A;  2W95 A;  4OMC A;  1W8O A;  3NJX A;  2QQJ A;  2J1E A;  3NNG A;  1PX4 A;  3I2H A; 
#chains in the Genus database with same CATH topology
 2X5I A;  4NID A;  4IGP A;  3ASI A;  4HKO A;  4XCA A;  3C7H A;  1K42 A;  2HBT A;  1H8V A;  1Z7S 3;  3CNA A;  5EFU A;  4IE0 A;  2A5Z A;  3AYD A;  3LWC A;  3RJ2 X;  5FO8 B;  3POF A;  1WME A;  3J4U H;  4XIO A;  2CAU A;  3H7J A;  3AKR A;  1UNB A;  2GNB A;  4NHY A;  3ZSM A;  1RUJ 3;  4XUO A;  4OUL A;  1W06 A;  3P5B A;  4LE4 A;  5KHK A;  2WR9 A;  3LOI A;  5B4X A;  5FZ6 A;  1G9B A;  1GZT A;  1N1S A;  3THP A;  5BNP A;  2H6B A;  1A8M A;  5T54 A;  4DIN B;  2CU5 A;  2ZAH A;  3BPZ A;  4XBN A;  4YZ3 A;  4A6S A;  3VZJ A;  3T0D A;  5FMO S;  1DDL A;  3SCH A;  1DZQ A;  4DUW A;  4DEV A;  1SFY A;  4H7L A;  2ZX2 A;  1WW4 A;  1BEV 2;  1YI7 A;  2XH6 A;  1YFX A;  2VMI A;  1E5H A;  1W3X A;  1ZBE 1;  4ERO A;  5EIY B;  1OKO A;  3HQR A;  2E7A A;  3PJQ A;  1JZ2 A;  2WC2 A;  1QQP 3;  4AI1 A;  3A23 A;  5JZG B;  1OVS A;  3ILN A;  1RUD 1;  2NPI A;  2W91 A;  4NRM A;  4FFH A;  4XZU G;  3ZFE C;  5LA0 A;  2WZE A;  3VZN A;  3NST A;  3SCG A;  3KF3 A;  2PAE A;  2DU1 A;  5AC9 3;  1UYX A;  4BH9 A;  4IV3 A;  1ZA7 A;  3OD4 A;  3MF6 A;  3GNE A;  4QQ2 A;  4JTO A;  1W6O A;  2W1S A;  4NE9 A;  2CY6 A;  4UT5 A;  4D6S A;  4C90 A;  1Z78 A;  5IVJ A;  1TNR A;  3OOX A;  2IVJ A;  1E5R A;  2PXJ A;  1CIY A;  3I2F A;  1Q8P A;  1WLD A;  4OHW A;  1G9D A;  1AZD A;  3SLI A;  1H8T A;  1QOO A;  1BLZ A;  2RMU 2;  5JR7 B;  4HT1 T;  4DY5 A;  1JS9 A;  5I0D A;  1HB4 A;  3K46 A;  3PUQ A;  4CEY C;  4EN0 A;  5BNO C;  2HWC 3;  3PIG A;  1FOD 3;  3KF5 A;  3BKZ A;  2OUH A;  4QXH A;  1H2L A;  3KT4 A;  4AQT A;  5L19 A;  3VLB B;  2PHF A;  5FPA A;  3B7M A;  4XTM A;  1AYN 3;  1OF3 A;  4CCL A;  3HWJ A;  3MLJ A;  3POY A;  1XYO A;  2WBK A;  4P14 A;  4I2O A;  1OLR A;  1MAC A;  3C7F A;  3MEP A;  4CDQ B;  1HV0 A;  1WKY A;  4RGK A;  1OBN A;  1RJ8 A;  4ARY A;  5A1L A;  5FCC A;  1QOS A;  3ZSL A;  2WLP A;  1OPM A;  5BV6 A;  2RS5 1;  4NPL A;  4IEW A;  1H6X A;  1WCQ A;  1ZBA 3;  2ZHL A;  5FJK A;  4A6O A;  1K45 A;  1RUD 3;  5IW0 A;  5KXC A;  1Q8S A;  2ARA A;  1W04 A;  4Q4X 3;  3FMG A;  1PGW 1;  3JD7 1;  5FR3 A;  3C2U A;  3FL7 A;  1WA6 X;  1JU4 A;  2OII A;  3VBU C;  5LBE A;  2X29 A;  5H9Q A;  2MPF A;  4AK3 A;  1DU3 D;  1CWP A;  3MHZ A;  4AFM A;  2RE9 A;  4GB3 3;  4CUC A;  1CAU B;  3WW1 A;  2VNO A;  2QQL A;  3LB9 A;  2W94 A;  4PCR A;  5JUV A;  5KXB A;  4YVW A;  2NMN A;  2NZ9 A;  4QXC A;  1H4G A;  3BB6 A;  1LCL A;  2WNE A;  4YZ2 A;  2XLA A;  2PYT A;  4IE5 A;  3MIF A;  1CAX A;  1YHF A;  5FKC A;  4CE8 A;  1STM A;  5J1X A;  4LUK A;  2IZW A;  5DXD A;  1XE7 A;  4LLO A;  3SEE A;  4JGY B;  1RIN A;  3E6C C;  1R1Z A;  2VTF A;  3NO8 A;  3I49 A;  3O7O A;  3LD8 A;  3SH5 A;  3MLK A;  1HRI 1;  1C8M 3;  4WM7 A;  4P9Y A;  1YFU A;  1D7P M;  4BWO A;  4JV4 A;  3KS7 A;  5T5L A;  4DXZ A;  4CEY A;  4AQ6 A;  2D3P A;  4A7K A;  2VE1 A;  1OA2 A;  1U5I A;  5FMO L;  1QJX 2;  4XFG A;  5D8A C;  5CFD C;  3TEZ A;  2JEN A;  3AMN A;  2W5F A;  3HT2 A;  2ORX A;  4PDW B;  5CB7 A;  4AAP A;  2ZGT A;  2OVU A;  1BMV 2;  2FD8 A;  2C9A A;  4IV3 B;  4FPE A;  4KBZ A;  3E97 A;  3LDK A;  1WLC A;  2HWE 3;  3B3Q E;  4OUS A;  1Q8O A;  1YUD A;  1FT9 A;  4QGN A;  2V72 A;  4R9A A;  2ZXQ A;  4AFA A;  4ZY9 A;  3BU7 A;  3ZN6 B;  4I0B A;  4JDM A;  4FPK A;  4P9G A;  1RUF 1;  1O8S A;  5DDJ 2;  3M70 A;  3WG2 A;  1JZ6 A;  5CG9 A;  5L73 A;  3MO4 A;  1O5L A;  2PEL A;  4NAM A;  4NOT A;  5FZ8 A;  1CX4 A;  2TEP A;  3A7Q A;  3S7I A;  4QKB A;  4A41 A;  2DCK A;  1AL0 G;  2RDN A;  4XHX A;  5D1I A;  5KXD A;  1HKD A;  4YZ1 A;  1SFN A;  4W6W A;  4XDP A;  3POS A;  2BNO A;  4P9X A;  2V5D A;  1CPN A;  1XND A;  1EP0 A;  2R07 2;  3ENR A;  4MHU A;  1MQT B;  2B39 A;  2PQS A;  3J26 N;  3LFM A;  3N9P A;  2B7Y A;  2B5H A;  1N1Y A;  2O0O A;  4A3X A;  2R1B A;  2QQM A;  1QKQ A;  2YPD A;  2DF7 A;  3V0B A;  3LE0 A;  3AFK A;  3DKW A;  3K4Z A;  3PUH A;  5JMO A;  1H1M A;  5T5P A;  5J37 A;  5H9R A;  1FYU A;  4XF1 A;  5FYY A;  1J59 A;  1Y7B A;  4NRQ A;  3RZM A;  5A3P A;  1GSL A;  3OPT A;  1ND3 C;  1ODN A;  3JBG 3;  3A4U A;  4JKM A;  1OOP A;  4RR3 A;  5G04 L;  4OI4 A;  2YBP A;  4GKY A;  4XJW A;  3WLU A;  4D69 A;  3CJI B;  4M0H A;  2VAU A;  1WMF A;  1UY3 A;  2VUD A;  1DF0 A;  3WF3 A;  4AI2 A;  3FLP A;  3EXU A;  2WO1 A;  2CGN A;  3FC0 A;  1WLT A;  1ZZB A;  2FDH A;  5F8P A;  2GND A;  2DYC A;  4WZC A;  1RUG 2;  1GMM A;  3FLT A;  3RMX A;  3ZXG A;  4AQ2 A;  2OX0 A;  3WG4 A;  5I0S A;  1RMU 2;  5HI0 A;  3LA7 A;  2WNO A;  3WW3 A;  5LA1 A;  4PQ9 A;  5A7Q A;  1SBE A;  3AZW A;  3H3L A;  2A71 A;  2X5I C;  3JD7 2;  2WFF 2;  1XOY A;  4IV3 C;  4Q4V 3;  4CUB A;  2CWS A;  4LK7 A;  4AED A;  5L7O A;  1VAM A;  3K48 A;  5C4W C;  4YSF A;  1C3H A;  4E4S A;  5I91 A;  2Q0A A;  4SBV A;  5T52 A;  3SQO A;  4JDO A;  3BU0 A;  4YGD A;  4FPL A;  3PVN A;  4QPI A;  1GNY A;  4WM7 B;  4WM8 B;  1LHW A;  4QPY A;  4Q1P A;  1NX9 A;  4PT6 A;  1RUN A;  4YVS B;  1IGO A;  2RS3 1;  4IGQ A;  4RFT 0;  1ULO A;  3ZFF B;  1LOF A;  4YM0 A;  1J3Q A;  3OYW A;  1RXG A;  3MW3 A;  4GIQ A;  4O61 A;  2DCY A;  2EXH A;  2W46 A;  1UIK A;  2HWE 1;  1JYW A;  3MIE A;  1UOF A;  1QJZ A;  5JOX A;  1LUL A;  5FZ9 A;  2C1F A;  1AR6 1;  3PNA A;  2NP0 A;  3VBR A;  4E9K A;  1W6Q A;  3H9A A;  4DB5 A;  2VEC A;  1B09 A;  1JBC A;  2VBD A;  2A6Z A;  1PM4 A;  3FFQ A;  1SEF A;  4XJ9 A;  3VBO C;  1US3 A;  4KI5 M;  4TLF A;  5A7O A;  4P9L A;  2E26 A;  3IT8 A;  3N36 A;  4FPG A;  3VDC A;  1JZ7 A;  3RZL A;  5HV4 A;  1CIW A;  4RN5 A;  3TAY A;  3AMH A;  3V64 A;  1C4R A;  2EF6 A;  2IXC A;  1PMH X;  1BZW A;  2Q30 A;  4GD4 A;  1SPP B;  1JZ3 A;  3BOP A;  4DIQ A;  2DVB A;  1KGY A;  5A3O A;  3X29 B;  2WS9 1;  3VDB A;  1ULD A;  3KCY A;  3UT0 A;  2R06 2;  5FZ1 A;  1QXR A;  5FPB A;  1TME 2;  4PLM A;  3WDX A;  3N35 A;  2QDR A;  4IE4 A;  3C7G A;  5CAZ A;  5I0R A;  4EWD A;  1L7L A;  5FZ3 A;  4HLT A;  5FPZ A;  4FOQ A;  1LHU A;  3QCW A;  4CEW A;  4Z92 B;  4Q5O A;  3T30 A;  1GP6 A;  4DPN A;  1ULG A;  1GOF A;  3BN6 A;  2J42 A;  3H1W A;  2UWC A;  2ADD A;  1C5H A;  2AGS A;  2D98 A;  3HQU A;  4M01 A;  2AR6 A;  3IDA A;  3KD4 A;  4YFZ A;  3OBR A;  4DOU A;  1UX7 A;  1UW8 A;  2XR4 A;  3RSJ A;  3OBZ A;  2XHK A;  4Q4X 1;  1HB1 A;  3HR9 A;  1RC6 A;  4QX1 A;  2HYX A;  5E89 A;  3MDP A;  3S7E A;  3M4F A;  4UFJ A;  3ZYP A;  1RUC 2;  4B4Q A;  2ZZQ A;  3MF9 A;  5F6L B;  1K5J A;  1IQA A;  1EUT A;  1FAT A;  4GJZ A;  5JCT A;  1W9S A;  2G9Z A;  3ELN A;  4UW6 A;  4S2F A;  2H0B A;  4Q4V 2;  1RUG 1;  2FZ1 A;  2GC3 A;  3AZV A;  3AXE A;  1W03 A;  2PHT A;  4PJY A;  2WZR 3;  5A6Y A;  2D6O X;  2YV8 A;  5FP8 A;  1BXH A;  1W2T A;  3WHU A;  3ZN6 A;  4JHZ A;  2R0F A;  2RS1 2;  4KMQ A;  5D2A A;  2BEO A;  1PVC 1;  4JGY A;  4UFL A;  2NQY A;  3ES1 A;  3RZJ A;  4IXL A;  3ZMN A;  1OLM A;  4KWL A;  4XAC A;  2VCA A;  2XBO 1;  1RUH 3;  2P3K A;  3AP4 A;  1D0G A;  3WP5 A;  2WZ8 A;  3DXU A;  5DAW A;  2NYY A;  4PIX A;  3RYK A;  3KHC A;  3WNX A;  4TYS A;  3ZFF C;  5JOW A;  1ZZ8 A;  4IEO A;  1QJF A;  3WF2 A;  5L36 A;  4W6X A;  2WFP A;  5JOZ A;  3HJR A;  3J7L A;  2Y8K A;  3POI A;  1AR8 3;  2YHJ A;  5FY1 A;  1K5M B;  5FZM A;  4QU1 A;  1ZRC A;  5CYY A;  4BLI A;  1VRH 2;  5IAT A;  5CA6 A;  1QJU 2;  5FYB A;  3THD A;  1CVN A;  1NE4 A;  2E31 A;  2K46 A;  3VBR B;  4JRA A;  5IVV A;  4NUB A;  1ST8 A;  4FPY A;  3OGJ A;  2WA3 A;  1WD4 A;  4YGB A;  2E51 A;  3E5U A;  3OSD A;  4Z2A A;  1GZW B;  1IS5 A;  2DUO A;  4LHS A;  3SIT A;  1LOE A;  5BNQ A;  4CP0 A;  4IES A;  3SNM A;  1BVV A;  3CJX A;  4RYD A;  1ZRI A;  4FPH A;  4XE9 A;  1PHM A;  1WGP A;  2DV9 A;  3L2Y A;  4FP3 A;  3I54 A;  2IC1 A;  2Y33 A;  4XUR A;  1JUH A;  5FBJ A;  1UU6 A;  1S0F A;  1Y9Q A;  3AK0 A;  4LQR A;  1YQ2 A;  2VCB A;  4XUP A;  3WF0 A;  1PZ8 A;  1DYK A;  5GLU A;  4C0B A;  3TEW A;  2EAL A;  2MNG A;  2JDP A;  2BFU L;  2QQK A;  2JG8 A;  3NAP C;  4Q4Y 1;  1VBE 1;  3GBW A;  2XLF A;  5BNP B;  4XHB A;  3ZYH A;  3KLS A;  4XJZ A;  4PQQ A;  4Y5S A;  2C9K A;  3Q9O A;  4JKK A;  4NIA A;  1NZI A;  1XU2 A;  4Y1U A;  4LMF A;  4AHX A;  1GOG A;  3OCP A;  2A70 A;  4BME A;  1XJA A;  4X6R B;  3DUI A;  1UF2 C;  2ZGM A;  4F3J A;  2B4K A;  1O3R A;  3O0W A;  3M1H A;  2D6L X;  5JZG A;  4MGI E;  2VL4 A;  2VME A;  1LR5 A;  2EXK A;  2XUM A;  1VBA 3;  4Z07 A;  1BBT 3;  1VMF A;  1XXN A;  1ZBE 2;  3N9M A;  3WDW A;  4AEJ A;  3WUD A;  2WZR 2;  1W6N B;  4RS5 C;  4OUE A;  1CES A;  3O5S A;  3PJY A;  5FZO B;  4Q0S A;  5C3P A;  1CR7 A;  3WG3 A;  1ZBA 2;  3B9C A;  1U12 A;  4BM8 A;  3R4D B;  4Q4W 3;  5L7O B;  1NCR C;  5LBB A;  1OH3 A;  1DQ5 A;  4XJ8 A;  5AVA A;  1LNS A;  2Y38 A;  2ZMK A;  4E2Q A;  1EAH 1;  3Q8F A;  5B2G B;  2A75 A;  4D7Y A;  4TTG A;  1VP6 A;  4X6Q B;  4LBM A;  3RYP A;  2JIG A;  1V6I A;  3UKT A;  3N7J A;  3T1M A;  4IEP A;  4GA9 A;  2XJU A;  2PHW A;  2GMP A;  3CIH A;  3I3M A;  2HWF 1;  5D8A B;  4MHR A;  3LFI A;  3OEB A;  5C8C B;  1RHI 3;  2ES3 A;  1PVC 2;  1GAN A;  1EYB A;  2ARC A;  2YMZ A;  5D21 A;  5EV7 A;  4EWA A;  1MEC 1;  4Q8K A;  4FFF A;  1GYK A;  2ZEZ A;  2HWB 1;  2BQP A;  3DV8 A;  3TBD A;  4FI9 A;  4Q4Y 3;  2VQU A;  3JZV A;  4KL1 A;  5JVV A;  5ISL A;  1DQ2 A;  1M4W A;  1GKB A;  1GP4 A;  1Y9G A;  4QDS A;  1HB2 A;  1PNG A;  3WQ0 A;  4CTE A;  2BOI A;  2FDK A;  5FO9 B;  1QNW A;  2PTM A;  4XC9 A;  3U4X A;  2GMM A;  1MS4 A;  2VZ3 A;  4CDW B;  2BP6 A;  3LF7 A;  4A7Y A;  1DQ6 A;  1XNB A;  1X50 A;  2UYA A;  5FJH A;  2Q8D A;  4JX0 A;  1Q3E A;  1IPS A;  4HXC A;  5F1R A;  1LRH A;  4ASM B;  4ZU4 A;  4XBL A;  3LIH A;  1ZX5 A;  2XQX A;  1SPP A;  3K4A A;  2W68 A;  5EJ3 A;  3FBY A;  1PGW 2;  2DCT A;  4LBJ A;  4ORF A;  5JMC A;  1Y3T A;  4CDU C;  2AAC A;  4K9S A;  4R8H A;  5FYM A;  2O8Q A;  2PQQ A;  4GAZ A;  5LK7 B;  1EAH 3;  1POV 3;  1QEX A;  2QQJ A;  4Q0P A;  5FXW A;  4AEK A;  1PX4 A;  5DDJ 3;  3I2H A;  3ILR A;  3WHT A;  3VN4 A;  4AVB A;  4AYU A;  5I8Y A;  3VL8 A;  4M3C E;  2RS5 3;  3UK9 A;  5FMC A;  1RUG 3;  4BQW A;  4D0Q A;  4Q1R A;  4NWW A;  2Y0I A;  2VVD A;  5JPN B;  3VKF C;  1TQ5 A;  2ORZ A;  4YPJ A;  2EID A;  4XF0 A;  4XTP A;  4IV1 B;  4LO7 A;  3IPV A;  4FO9 A;  4RGA A;  4HPK B;  1I6X A;  1OFN A;  3AYC A;  5T55 A;  5FY7 A;  1NUK A;  1UY2 A;  1FNZ A;  4JQT A;  5ANN A;  3U07 A;  3VBS C;  2ET1 A;  1YIF A;  4LO5 B;  1ENQ A;  3TRS B;  4BQ2 A;  5BNO B;  4IDZ A;  5FLI A;  2Q8E A;  4QGM A;  4UW4 A;  4CDX B;  1R64 A;  5A3L A;  4CXW A;  2A3Y A;  1QWR A;  3IDB B;  4KU7 A;  1DCS A;  3WW4 A;  5IK7 A;  5GLW A;  4IEU A;  3IDC B;  4AI3 A;  2GC2 A;  3UV9 A;  1J1T A;  4Q4W 2;  1WA4 A;  1JN2 P;  3HEI A;  3NNJ A;  5LZ6 A;  5EPA A;  1F4A A;  3NQH A;  2WZR 1;  2OKX A;  3FUQ A;  2BGP A;  4QX7 A;  2ZX0 A;  5T3N A;  4QQP A;  1ZRD A;  3LDB A;  2WNV B;  4TSV A;  5LBC A;  1VBD 3;  1UZV A;  4YZ4 A;  5DG1 A;  1VR3 A;  2EIC A;  4YW3 A;  4COZ A;  5FV3 A;  4ZU5 A;  4YW1 A;  4JC1 A;  1SG3 A;  4Q8L A;  1IG3 A;  3DF0 A;  4R4X A;  3JUU A;  1EAH 2;  3EYP A;  3WD5 A;  3Q8E A;  5DDJ 1;  4XUN A;  1SCR A;  2ZA9 A;  4CXY A;  1NA1 A;  1W39 A;  3T2T A;  4D94 A;  3O1V A;  4AR2 A;  5JZG C;  2ARX A;  2DVF A;  2RS5 2;  3GCW A;  3ON7 A;  3RQ0 A;  3BOD A;  3WZ1 A;  4BIF A;  4OQ8 A;  4OHX A;  3I3D A;  3HNY M;  3GJA A;  4Y24 A;  1PMI A;  2JE7 A;  1T6G C;  3RPQ A;  1T6B X;  2Y64 A;  3W20 A;  2EIB A;  1PO1 3;  4NIH A;  3ZSJ A;  3PUS A;  4LBN A;  4Z2W A;  2HWB 2;  4NR1 A;  1HRI 3;  1QGL A;  3VD5 A;  4EZ4 A;  5DG2 A;  3EBR A;  4K1Z A;  2YU1 A;  4AQS A;  2KD7 A;  3OTF A;  4NPM A;  3VD3 A;  3POJ A;  1W8T A;  3N9L A;  1GZW A;  3RFR A;  3AJY A;  4AGG A;  4P9I A;  4M4P A;  4MGS A;  4UXA A;  1AR7 1;  4CCO A;  2CHH A;  4XF4 A;  2WQ8 A;  1AVB A;  2VTX J;  2Z69 A;  2P5B A;  4GWI A;  4AEM A;  2XVG A;  2RVA A;  3NNL A;  4IE6 A;  3ILF A;  4XUT A;  1W6N A;  2ZEY A;  5FZO A;  2W87 A;  2J1S A;  1UY0 A;  1SDW A;  5FAX A;  1DGW X;  1F5J A;  2ARE A;  4N53 B;  4KG0 A;  1RMU 1;  1R1A 1;  2UUR A;  3AB0 A;  1F2N A;  3Q8A A;  1XQN A;  4NRP A;  3W58 A;  5IK5 A;  4YFW A;  4QPG B;  5CU1 A;  1JYT A;  2E7Q A;  2JG9 B;  3FLR A;  2BOJ A;  1LGN A;  4H3W A;  2JB4 A;  2YBS A;  4IUG A;  2LM3 A;  2MHF A;  4HL0 A;  3RWN A;  3VHN A;  4BK5 A;  4C1W A;  5FPV A;  5IHR A;  3VBS B;  1S4C A;  1QJE A;  2WT0 A;  4WBB A;  2EAA A;  4XAB A;  4WM8 A;  5C5U A;  2YFZ A;  3R05 A;  4HON A;  4IV1 C;  4CYD A;  1I9R A;  1LAJ A;  1TME 3;  4HPK A;  3BTY A;  4XJA A;  3AKP A;  4XMA A;  5JXJ A;  3CLP A;  4COU A;  3ZSK A;  1YQC A;  1N1T A;  1KEX A;  1S55 A;  1TG7 A;  2ARB A;  2B46 X;  1JOB A;  4FT8 A;  5CG8 A;  5FK7 A;  4P5H A;  1FMD 3;  4BQ5 A;  2OS2 A;  2RS1 3;  4YGE A;  1FOD 1;  2Y6H A;  1SMV A;  1VBB 1;  5IAV A;  3ZXD A;  1OQE A;  3R4U A;  1SLA A;  2QBX A;  1HRV 3;  5C3O A;  2HWE 2;  5ERL A;  3UYJ A;  4MET A;  2GP3 A;  3GJB A;  3DEC A;  5F3G A;  1D4V B;  4ET7 A;  1URX A;  3O1O A;  2R07 1;  3VHO A;  4AZZ A;  5FYS A;  1ZRR A;  1HQL A;  1PMJ X;  4MZU A;  5EZW A;  3S0M A;  3E5X A;  5FXX A;  1NXM A;  2Z4F A;  4LOR A;  2O8O A;  2LRP A;  2Y34 A;  4DFS A;  4Q27 A;  2WO7 A;  4RD7 A;  5DAQ A;  4R52 A;  3ROU A;  2VZV A;  1UZ0 A;  1QF3 A;  3IBM A;  2VOX A;  5GZE A;  4Y33 A;  1QH6 A;  4X8P A;  5A3N A;  1W0P A;  1OFS A;  3DPR B;  3VHR A;  4PDW C;  3HBK A;  4XXA A;  5FZL A;  5GZD A;  1OLM E;  3VHP A;  4QX0 A;  2DCZ A;  3ZN5 A;  2QQU A;  3K4D A;  4Z1V A;  1FAY A;  2PN5 A;  1H0B A;  4M00 A;  3VD9 A;  1JOP A;  4FPO B;  1GLH A;  3P6B A;  4BIO A;  5JPM B;  4DEQ A;  1S2K A;  3CU7 A;  4HN0 A;  3RDI A;  1FV3 A;  4QQO A;  3U4S A;  4AAX A;  2XJR A;  2J1U A;  3IPV B;  3KM5 A;  3ZSE A;  4AHY A;  3VBU A;  1DGR N;  3ZXA C;  4F7Z A;  5FOJ B;  1UZY A;  1VBB 3;  1ZA4 A;  4XZP A;  1US2 A;  2RJK A;  5A33 A;  1W3V A;  4OHV A;  1YC6 1;  3BVC A;  3ME2 A;  5A3W A;  3NVC A;  1UU4 A;  2YC0 A;  4U36 A;  3ZYI B;  1NCR A;  2B9V A;  2CV6 A;  1MS3 A;  5K4L A;  4UFM A;  3WNO A;  1AR7 2;  4YG0 A;  3WIN E;  1MZE A;  2YBK A;  1PZ9 A;  3OPZ A;  1VBA 2;  4XQW A;  4EN6 B;  2C5D A;  4RHV 3;  5AFE A;  2QQI A;  5F3E A;  4AHW A;  5T50 A;  5CFC A;  3I3B A;  2JG9 A;  4MGZ E;  3AX4 A;  4AWD A;  1UO9 A;  1QY4 A;  5FWJ A;  3O1U A;  2B45 X;  4FVV A;  4LR4 A;  1NE6 A;  1WMX A;  5F3I A;  1COV 1;  1DG6 A;  4GWN A;  5ABJ B;  4QGL A;  3NNM A;  2A3W A;  2HLE A;  4LOT A;  1VE0 A;  2RV9 A;  4C1X A;  4N90 A;  1SLC A;  5FUI A;  1K3I A;  1RIT A;  4JTN A;  4Y5T A;  4YLZ A;  1UZW A;  1AYM 1;  2K0G A;  4WVW A;  3TOJ A;  1JUI A;  3CKH A;  1Q56 A;  4IND A;  1P8J A;  1W6M A;  4W50 A;  3T0B A;  2P6C A;  3LPF A;  2BV4 A;  4CA9 A;  4N8M A;  3BOW A;  2J1A A;  3OGR A;  1XSQ A;  1CZT A;  3QLQ A;  3SXW A;  2CL2 A;  1VIW B;  5FY9 A;  1CJD A;  2H0V A;  1TE1 B;  2HEY F;  1OF4 A;  2WS9 2;  1NCQ A;  2R06 1;  5LBF A;  1FOD 2;  5FP9 A;  1MR5 A;  4CUG A;  5CNA A;  2KXL A;  2VOT A;  1DP0 A;  2A7A A;  1BBT 2;  2JDN A;  1KD7 A;  2IXH A;  5FLJ A;  4AVV A;  2BYV E;  2X8K A;  1XE0 A;  3FN9 A;  1ULE A;  4JCK A;  4RQP C;  1PO2 1;  1CJP A;  2D44 A;  2ZGP A;  1GWM A;  4NII A;  4CP1 A;  1UQX A;  2O14 A;  2FZ2 A;  1REF A;  1ULC A;  5A1F A;  2A6X A;  4K8F A;  2UY8 A;  3WUC A;  1AL2 3;  3K3O A;  2XJS A;  2Y6G A;  3B94 A;  5FZG A;  5HXV A;  3VBR C;  3VKO A;  1F9K A;  3KVB A;  2VZS A;  3WF4 A;  2FCU A;  2VZU A;  4CP2 A;  4Q4X 2;  2XWJ B;  3NV1 A;  5EWS A;  2F17 A;  4GQ7 A;  5FIX A;  3T3Y A;  4N43 B;  4D6R A;  4HVQ A;  5BUV A;  3O0V A;  1JYI A;  3AMP A;  3M3O A;  3PL0 A;  1AJO A;  2DCJ A;  3MPP G;  5FQ0 B;  5J7M A;  2JDU A;  1TMF 2;  1CQ9 A;  1VBE 2;  1AYM 3;  3SH4 A;  1LEC A;  2ZEW A;  1N3Q A;  2ZKN A;  3T08 A;  1GNH A;  4AVA A;  3USU A;  2V73 A;  3LPG A;  5K9Y A;  3AFG A;  1JI6 A;  1POV 1;  5DAV A;  3VBF C;  2VR4 A;  1YJK A;  1GFF 2;  1PZ7 A;  1UPI A;  3E5Q A;  1SBF A;  3QAC A;  1AX2 A;  3B93 A;  5FMB A;  1NY7 2;  1DQ4 A;  2QFE A;  3I97 A;  3PUA A;  4GWJ A;  5KHH A;  2VZO A;  5FYV A;  1WCK A;  4QX2 A;  4LXL A;  4DUV A;  1AR7 3;  1S0I A;  3UET A;  2LAL A;  5FXZ A;  3B01 A;  1WD3 A;  1TVG A;  2Y0O A;  4AG4 A;  4CCM A;  3OG2 A;  2X10 A;  1D2S A;  1RL3 A;  5HCB A;  1S0C A;  2RM2 1;  1E5I A;  1PK6 B;  2LTN A;  1EY2 A;  2XVL A;  5JAX A;  3FZ3 A;  1Q8Q A;  4QB2 A;  1UCX A;  3VD7 A;  5D8A A;  4GB3 1;  5IVE A;  1O3Q A;  2FHR A;  5C8C A;  3IAQ A;  4OLL A;  4NAO A;  1SDD B;  3Q8C A;  5ACA 2;  1W8H A;  2VC9 A;  3WDT A;  2RG4 A;  4XDO A;  3TEY A;  3PMS A;  3ALQ A;  4PF1 A;  3J7H A;  4CEW C;  4LKF A;  4ES8 A;  5G05 L;  1CAW A;  1VAL A;  3ZOI A;  2ZAB A;  4DXS A;  1GV9 A;  4A2U A;  4ZS2 A;  1MEC 2;  1LGB A;  2DVD A;  1UMZ A;  3B02 A;  3SKJ E;  1REE A;  2E32 A;  3CMG A;  4EZH A;  2Q1Z B;  4MX3 A;  1O4T A;  3M3I A;  4Y4Y A;  1HIX A;  1E5S A;  4EE2 A;  1R08 2;  2VZR A;  3KQ4 B;  3AKS A;  4YVW C;  3W21 A;  5KHG A;  5IJR A;  4AW7 A;  1F31 A;  3T1L A;  2P34 A;  4ITC A;  4QAW A;  2HWC 1;  1AL2 2;  1HJF A;  5FY5 A;  2IXI A;  4UF0 B;  5FY0 A;  5FP4 A;  1N1V A;  4QDQ A;  4S2D A;  3VZO A;  1XNA A;  3HQX A;  2VTX A;  5LY1 A;  1BKZ A;  2BNM A;  2VY0 A;  3JQX A;  3QH6 A;  1OD3 A;  5JSP A;  1YXW A;  4I09 A;  4BQX A;  1BBT 1;  1AHS A;  2GN7 A;  2ZS6 B;  4QQL A;  2XVK A;  4LKD A;  4CSW A;  4YM1 A;  5IYY A;  1DBN A;  1VMH A;  4ISQ A;  3ZFG C;  5M0T A;  2F4L A;  1CAX B;  1XBF A;  4LBO A;  2JD4 A;  5DQ0 A;  3W9A A;  5BNN A;  2VCC A;  1RUF 3;  4DMI A;  5JOY A;  3W5N A;  2IWG B;  2ZAC A;  5CEH A;  5F32 A;  4E8C A;  3NJZ A;  1BHG A;  1B35 B;  3Q8B A;  3FFZ A;  2VVF A;  4YVS C;  5IWF A;  4P08 A;  1PX3 A;  2CDO A;  4EN7 B;  2WFF 3;  1FI2 A;  4NRO A;  2GNM A;  2F6B A;  3TB0 A;  1W8W A;  1E57 A;  1ZBA 1;  3NV2 A;  4UOJ A;  5FYT A;  2HWB 3;  1ZRF A;  2K9Z A;  2D6P A;  3SHR A;  1L7Q A;  4GUL A;  4O65 A;  1SHW B;  3BIW E;  1AR9 2;  2WL1 A;  5CBL A;  1FV2 A;  1EV1 3;  1YQ5 A;  3VBO B;  4I0A A;  5EJ1 B;  1EPZ A;  1EUU A;  2Z5W A;  1UYP A;  2ZTN A;  2EIG A;  4UBH A;  1A34 A;  5C4W B;  3H8X A;  4OQ9 A;  3PVO A;  3UES A;  5KC5 A;  5SV8 A;  1KDM A;  1LHO A;  1TEI A;  4Y20 B;  4BK4 A;  2Y6L A;  1KJR A;  2W52 A;  2YRO A;  4PIY A;  1Z7S 2;  2YPJ A;  5DUU A;  1GWK A;  3O12 A;  1NKG A;  1GUI A;  2WN3 A;  1H2M A;  2P3Y A;  3ZIW A;  1JHJ A;  1QNY A;  1O4Y A;  1FMD 2;  2RR1 3;  3C7E A;  5IT6 A;  4RR3 C;  4F8A A;  3LCP A;  3POE A;  3GBF A;  3T2O A;  1G7Y A;  2Q8O A;  1XSR A;  4XFF A;  5BYN A;  2YZ4 A;  5FKB A;  2W0X A;  2YFU A;  3FHI B;  3WP6 A;  2VW2 A;  2VUC A;  2ZGR A;  3I3E A;  4OI2 A;  5FUP A;  1G9A A;  2JG9 C;  3APB A;  4FOY A;  4QPG C;  2PHR A;  1MS1 A;  2WYS A;  1LHN A;  2WNU C;  3C8X A;  4QDR A;  4YW5 A;  1PGL 1;  2WQZ C;  4O7X A;  4MAD A;  3W5M A;  3T4V A;  2PLV 3;  2R04 3;  1RXF A;  3RI9 A;  2J22 A;  4CXX A;  4RS5 A;  4B1M A;  2C4X A;  4P9W A;  4CDW A;  3FBM A;  5JIU A;  3A22 A;  2EIE A;  4QX3 A;  3I59 B;  2R16 A;  2C6S A;  5ANQ A;  5JI7 A;  4BDV B;  2DUQ A;  1IZ3 A;  3G6J B;  2UWB A;  1JH5 A;  1I3H A;  3NV3 A;  2DFC A;  1ZZ6 A;  3BTZ A;  3IIA A;  2DBN A;  3AL6 A;  1WMD A;  2L9L A;  2WKK A;  5JXH A;  2P17 A;  3VBH A;  3J8F 1;  5LRS A;  5IK4 A;  2J1V A;  5FZE A;  1LOB A;  1UKR A;  3WVJ A;  4G4F A;  5F7U A;  2HWC 2;  3BTX A;  1AL2 1;  1ALY A;  2NMO A;  2QE3 A;  3N3H A;  3MUZ 1;  4UW5 A;  5GKA C;  3N9Q A;  2PMW B;  2OW4 A;  1J3P A;  3GZU C;  1IKQ A;  1NLS A;  3NAP A;  4NMI A;  4DXT A;  1O3S A;  3MPB A;  2E53 A;  4JDN A;  4QHB A;  4LT5 A;  1CX1 A;  2E7T A;  4JHT A;  1FPN 3;  1KXG A;  1ASJ 3;  1LKN A;  3GHN A;  3HN1 A;  3KWV A;  4QPI B;  1V9U 3;  3L9J T;  5A32 A;  2WN2 A;  5C9A C;  1GP5 A;  1IPK A;  3WNL A;  5H9S A;  2UWA A;  2VXJ A;  5FP7 A;  3ZVX A;  4JRL A;  5AC9 1;  3OYW B;  1MZ5 A;  2VBP A;  1AXK A;  1YJL A;  3I4I A;  5KXE A;  4N9I A;  1AR9 3;  1IHM A;  4RGG A;  4WVZ A;  3ZMO A;  3I2O A;  4YWA A;  1HQN A;  1W05 A;  4HBN A;  5A7P A;  2N7G A;  3SKV A;  4E27 A;  2W47 A;  2BFU S;  1S0D A;  1RUD 2;  3WW2 A;  5C3Q A;  1LB2 A;  4OI1 A;  2WJS A;  4LBQ D;  5F5A A;  3LKJ A;  2W1Q A;  1LEN A;  1YI9 A;  4EQV A;  4KG8 A;  1U5X A;  1W0O A;  2BW8 A;  5A3T A;  4ONU A;  1VBB 2;  4XCB A;  2WNV A;  2ZGO A;  4K21 A;  5L9B A;  5C5T A;  5IFT A;  4R9C A;  4LKS A;  3LSD A;  2YC4 A;  1GU3 A;  1YIP A;  1JYX A;  1OI6 A;  1T2X A;  1U5Z A;  4LPL A;  5C33 A;  4DZG A;  2BNN A;  1NG0 A;  1FNY A;  3TNQ A;  1W2N A;  3HN3 A;  3J7M A;  4QKD A;  5DZE A;  4JGY C;  5CIS A;  5C6C A;  2XUE A;  3DPR A;  2VXR A;  2ZAA A;  4W65 A;  1GQG A;  2FBE A;  4FFG A;  4U2A A;  2R6Q A;  4BPZ A;  3M2M A;  1DIW A;  1QJU 3;  3KCC A;  1W9F A;  1HRV 1;  5F3C A;  2ZHK A;  1O3T A;  4XDQ A;  3N7M A;  2Y6F A;  4XIL A;  2QZ2 A;  2GNT A;  4DRV A;  3OUJ A;  4RS5 B;  5GM0 A;  2WSU A;  4FSJ A;  1RUH 2;  4AVT A;  3FJS A;  2XDV A;  5EJZ B;  5FZB A;  4L2N A;  3OBA A;  5HCF A;  4LKE A;  3DN7 A;  2QQO A;  4ZXK A;  5J3U A;  3DYM A;  1A78 A;  5I8T A;  3VBU B;  4IEQ A;  5FZA A;  1MZF A;  4JGZ A;  4PBO A;  4QD2 A;  5CAD A;  3ETQ A;  4AGV A;  1QMJ A;  5A70 A;  2WDB A;  1F8V A;  3WR0 A;  2GDF A;  4URT A;  3LEM A;  4Q26 A;  4PF5 A;  2WO3 A;  3HD8 B;  2BER A;  4KU8 A;  1XNC A;  2JDM A;  3WP3 A;  2Y60 A;  1AX0 A;  1YLL A;  1YRZ A;  3H1Y A;  2BBV A;  3JCI A;  4OMD A;  4XFI A;  3IZO A;  5C4W A;  2WUH A;  3WNP A;  1OA4 A;  2OPW A;  5L7O C;  3ZXF A;  1AR8 1;  1VBE 3;  1WCD J;  4GMP 3;  3RMY A;  1J3R A;  3J8F 2;  3AMM A;  5BNN B;  2DVG A;  4MV2 A;  2AH2 A;  1J84 A;  2PHX A;  4UFI A;  2ZEX A;  4YZ5 A;  1C8N A;  1VBA 1;  5FWE A;  4YGC A;  3ZYF A;  5FZF A;  4DXR A;  2XWB B;  5FPX A;  1XPW A;  3KZ4 C;  1AXZ A;  1UOJ A;  2XG3 A;  1DQ1 A;  2R07 3;  1H9P A;  4OVE A;  4CU8 A;  4MGQ A;  4XAE A;  5F5C A;  1IOA A;  3ECQ A;  2XHN A;  3KGZ A;  2D40 A;  2VNG A;  3S5Q A;  3I7D A;  4Q29 A;  2JD9 A;  3OEA A;  4P5Y A;  1UIJ A;  4UBG A;  3QD6 A;  4MVT A;  5FZ7 A;  4L8Q A;  1J83 A;  4ARX A;  5HV0 A;  3H42 B;  2YGL A;  4NHK A;  5AC9 2;  2CAV A;  1H9W A;  1AYM 2;  1W6O B;  1H1A A;  2JDA A;  3MV1 1;  3MZH A;  3GYD A;  2ZML A;  2WRA A;  2VO5 A;  1LOD A;  2R0H A;  3WG1 A;  3WXP A;  3J9S A;  3RG0 A;  4ATF A;  1UU5 A;  3KV6 A;  5FY8 A;  3AP7 A;  1PO1 1;  5DZF A;  5LRR A;  1WW6 A;  3CDZ B;  1QDC A;  2P37 A;  4NHL A;  1JZ8 A;  2BTV C;  4K3U A;  1Q43 A;  3E6B A;  2KM2 A;  3LQC A;  2CWM A;  2D5H A;  2JDH A;  4LHK A;  1QQP 1;  4AGR A;  4CU6 A;  1UYZ A;  1UOB A;  2RHP A;  2OT7 A;  2RDQ A;  2PHL A;  1FX5 A;  3OUI A;  4NJ4 A;  4ZPI A;  2XPJ A;  2ET7 A;  5CKQ A;  1PO2 2;  3ZM8 A;  4OI0 A;  2GN3 A;  2JG8 B;  2VOK A;  3FUO A;  5FRA A;  2TUN A;  2VW1 A;  1CON A;  1CZV A;  1RVF 2;  2GZW A;  2VBB A;  2VNR A;  2RDS A;  3O14 A;  4GH4 B;  4HN1 A;  4PI2 A;  3UKN A;  4QX8 A;  3O1P A;  4HVO A;  3ZIX A;  4L9B A;  2NM1 A;  3I2G A;  3WSO A;  4LUL A;  2WYF A;  5FQ0 A;  5LB6 A;  2BUK A;  4YW7 A;  1CGP A;  3PLQ A;  2P4E A;  1PVC 3;  4UYB A;  1HRV 2;  3C7O A;  2XB6 C;  3ITQ A;  4QHZ A;  1ASJ 1;  1VMJ A;  2XGX A;  4QKF A;  3UGG A;  1NLQ A;  4YM3 A;  5A33 B;  1RUH 1;  1W28 A;  3VKL A;  3WNN A;  1HDK A;  3LOB A;  1O8P A;  2CYF A;  2FCV A;  4L92 A;  2A1X A;  4WVV A;  4EJR A;  1VAK A;  2YXS A;  1W2O A;  4K6B A;  2GH2 A;  4COW A;  1GQP A;  1OOP C;  5T5J A;  2VMD A;  2ZMN A;  3J8F 3;  5FPL A;  3GBG A;  1ND3 A;  3K3N A;  4HK8 A;  4EYU A;  2ADE A;  4DY3 A;  3MUY 1;  1COV 2;  2YY1 A;  2R06 3;  1OHF A;  3U1X A;  1NY7 1;  2ZZJ A;  2VM9 A;  3DPR C;  2BDR A;  1PK6 A;  2DTY A;  1RUJ 1;  2MEV 1;  1DLL A;  4GJY A;  2YYO A;  4BQ4 A;  4OZO A;  3OF1 A;  1QJX 1;  5I0T A;  2QQW A;  4AVS A;  3SC7 X;  1A3K A;  3O1R A;  2WAO A;  2I74 A;  4JAA A;  1DYP A;  3NV4 A;  1V6J A;  2ID4 A;  1AF9 A;  2ZHM A;  1W0N A;  4A4A A;  3INA A;  3ZFF A;  2GAL A;  3A0K A;  2VH9 A;  5FUN A;  4ZZ8 A;  1V6M A;  1PVX A;  1GIC A;  4AFD A;  3WEZ A;  4IEV A;  1CAW B;  2BU9 A;  4PDW A;  1IS6 A;  1Y9M A;  3KV4 A;  4XFB A;  3IMN A;  4I02 A;  3WDY A;  4XET A;  5LW9 A;  1HJG A;  4M3C B;  1W6Q B;  2QZ3 A;  5DPN A;  1WCU A;  1KRI A;  4ZZ5 A;  1WWY A;  5K0U C;  1CAV A;  2E63 A;  4LBQ A;  1EV1 2;  1CD3 G;  2C0Z A;  2VJX A;  4HET A;  1WBL A;  4O9E A;  2D6N A;  4XVH A;  2I2S A;  5CFD A;  2GU9 A;  2LS6 A;  1AR6 2;  2QKD A;  2WS9 3;  3GF6 A;  4JQR A;  4CPB D;  1X36 A;  2XOM A;  3MW2 A;  4HSJ A;  3S5A A;  5FBZ A;  5GLZ A;  4JGZ B;  1UY1 A;  3UJO A;  1W8N A;  1APN A;  2Q8C A;  1RHI 1;  1NA1 B;  2WWU A;  2FCT A;  5IAX A;  2VMH A;  2WAA A;  1UL9 A;  4GH4 C;  1F15 A;  4LEJ A;  1V6L A;  5LY2 A;  1YFY A;  1HX6 A;  4YW6 A;  1MQT A;  4BYY A;  1PO1 2;  4FTS A;  4E4Z A;  5EHD A;  4QB1 A;  1W99 A;  1BCX A;  1NYW A;  2VD7 A;  4CEW B;  3PUI A;  3TN9 2;  4AOC A;  4E2S A;  2ZGN A;  5FRE A;  1QJY 1;  4ES9 A;  2GC0 A;  3IDE A;  1DQ0 A;  1V6O A;  3EQE A;  4R4Z A;  4J1W A;  3FHQ A;  1RUI 1;  4Y1X A;  4YYO A;  1HW5 A;  2XJT A;  2JDZ A;  2G9G A;  4D7S A;  3NKG A;  2VQT A;  5F37 A;  5A7S A;  3H8U A;  2UU8 A;  1QJX 3;  3QBQ A;  4L11 A;  2JDY A;  4NO4 A;  1KJL A;  4QXK A;  2FDF A;  4RHV 1;  4MYE A;  4SLI A;  2IFR A;  3MV0 1;  4YG3 A;  3NW4 A;  1RB8 G;  2OZJ A;  4E2G A;  2ERF A;  1OQ1 A;  1TZO A;  3IN9 A;  1WBF A;  1VBD 2;  1BVP 1;  4WM8 C;  4ZKT B;  3F95 A;  2F4P A;  4HZF A;  1UOG A;  4I3P A;  5EYY A;  2VNV A;  3SIS A;  3THT A;  3CHX A;  2HWD 1;  3VKN A;  1ZM1 A;  2W1U A;  2RM2 2;  1QH7 A;  3AKQ A;  4YW2 A;  2SBA A;  3THC A;  5F9T A;  2XXZ A;  1RUE 3;  3AKT A;  1G9F A;  5LEJ A;  5IVY A;  1RYY A;  3HPN A;  2XBO 3;  3LEK A;  1ASJ 2;  4XUQ A;  5L9R A;  4Y4R A;  4L0P A;  1Q5O A;  3ZLI A;  4QPG A;  3ZXE A;  3MYX A;  3AYE A;  3B00 A;  3D3A A;  3HNB M;  3I3Q A;  1O7F A;  3PHM A;  1NAE A;  3M3C A;  2ZOE B;  2OQ6 A;  2RS3 2;  5ACA 1;  5JXG A;  5JDB A;  3ZXK A;  4Q4V 1;  4G3Y C;  4XIK A;  1JZ5 A;  3GZA A;  1PIV 1;  2QTW B;  5CVR A;  3ZDS A;  1V00 A;  5F39 A;  2P2K A;  1KQR A;  1ZZC A;  2Q1M A;  3D0S A;  2WA4 A;  3CQO A;  3DL3 A;  3V65 A;  2RS1 1;  1SCS A;  1OLQ A;  1RUJ 2;  1OT5 A;  3ZR6 A;  5I0U A;  2BPA 2;  3T2Q A;  3WNM A;  1N3O A;  1WW7 A;  4BE3 A;  3JBG 2;  4RA0 A;  2ZGK A;  1H8T C;  5APA A;  2J1T A;  2OPK A;  2Y6K A;  4N7U A;  2BWC A;  2XKO A;  2JG8 C;  5J09 A;  1EPW A;  2RJ2 A;  2E6V A;  2VMF A;  4HMZ A;  4QPI C;  4AI0 A;  4BQ3 A;  4E8D A;  5DMY A;  4QX5 A;  1R08 1;  2TBV A;  4Z82 A;  3T2P A;  5LK5 A;  4FFI A;  1O91 A;  3ZX7 A;  1DGW A;  2G19 A;  1XRU A;  2IXK A;  1NLR A;  1UPS A;  3NRU A;  1BYH A;  1OKQ A;  5E8A A;  3ZFE A;  5KR7 A;  2QQV A;  3ZR5 A;  5CFD B;  4AFB A;  2AEZ A;  3VZM A;  3GDB A;  4HFS A;  2CGO A;  2ZX1 A;  4IQP A;  1JYN A;  2XJP A;  3IMM A;  4B29 A;  5F5I A;  5A7N A;  2D6K A;  1EV1 1;  5C3R A;  5FYH A;  2AZ5 A;  1HN1 A;  2WT1 A;  5FXV A;  5K0U A;  3CO2 A;  2CGP A;  5B4N A;  2E9Q A;  4Y22 A;  5KHI A;  2V4A A;  5DAX A;  1D4M 2;  5E6H A;  5IVB A;  1UN1 A;  2JEM A;  1GZC A;  2A6Y A;  2AEY A;  1ND3 B;  3R4S A;  4LOS A;  2HYK A;  1H2N A;  3D82 A;  4UWD A;  1S2B A;  1YEW A;  3K77 A;  2Q5T A;  1RHI 2;  4QHO A;  1IS4 A;  2WWS A;  3LDR A;  2A3X A;  2ILM A;  5FTT C;  3DXT A;  3UKV A;  2IXL A;  1U0A A;  2Z42 A;  2HWF 3;  4EV0 A;  4XFC A;  4Q4Y 2;  1QXP A;  1B35 A;  1QJY 2;  1JYV A;  4LTA A;  2Y26 A;  3F2Z A;  1BEV 3;  1ND2 B;  2G9F A;  4UFK A;  5C70 A;  1Q8V A;  1ZZ7 A;  4IER A;  4BZ4 A;  4P02 B;  3ZYG A;  1R08 3;  2QDN A;  4LO6 B;  4RHV 2;  2VW0 A;  3TNP B;  2FDI A;  3VBO A;  2GSY A;  1SAC A;  4TZD A;  1W2A X;  4LIV A;  2ATF A;  1LOG A;  2P3J A;  4RL7 A;  2R32 A;  3OGS A;  1UD1 A;  2ZGS A;  3VB9 A;  3JQW A;  2XBO 2;  4OZX A;  2BJS A;  4KWU A;  3ZKU A;  2BZD A;  4CP9 B;  3ZN4 A;  3FHA A;  3M8L A;  5IUQ A;  4QWN A;  1L7R A;  1SZB A;  1Y4W A;  5BY5 A;  3CL1 A;  1RIR A;  2EXJ A;  5C9A B;  4MG2 A;  3DGT A;  5IVF A;  1W90 A;  1JW6 A;  5EXO A;  3BUC A;  4B7K A;  2BWA A;  1YNA A;  4CZS A;  1YWK A;  5GLT A;  3NKT A;  2FDG A;  5C8C C;  1VPH A;  4RFR B;  4CEY B;  5F5Q A;  3M3Q A;  3H1M A;  2XJV A;  3KB5 A;  4OUM A;  3RNS A;  3K2O A;  1DZR A;  3AXD A;  3C3V A;  4FAG A;  4BJ0 A;  1JZ4 A;  3GZE A;  1PGL 2;  3DYO A;  4RSU A;  3MFA A;  1K5M A;  2HWF 2;  4B7E A;  4D7T A;  5E1R A;  2WLQ A;  2XKP A;  1FXZ A;  1O59 A;  1S0G A;  1YFW A;  2V4V A;  4H2A A;  4OHZ A;  4CDQ C;  1W6P B;  4M3C A;  1SLL A;  3E6D A;  4A45 A;  2GC1 A;  5HXM A;  2JE9 A;  2B8M A;  5F2S A;  3VGI A;  2VZQ A;  1CAV B;  4LBQ B;  3S6P A;  4OHY A;  5FZD A;  2KR2 A;  3ZFE B;  3S30 A;  4P9J A;  1POQ A;  2WSV A;  5FYI A;  4XYX A;  2PLV 2;  3P3P A;  3EO6 A;  2EAK A;  3HT1 A;  3PIJ A;  4NVP A;  1RED A;  5LAT A;  3ZDV A;  2WT2 A;  5FZK A;  5F6K A;  4E4D X;  1FPN 1;  1ZNP A;  3N4M A;  3KSC A;  2XQR A;  5HBA A;  4BXS V;  1LGC A;  3GAL A;  4KWK A;  1V70 A;  2W9X A;  1W9Y A;  4AF9 A;  3RGB A;  4YVW B;  3VKM A;  3U37 A;  1HXS 2;  3OBT A;  4OYU A;  2DWR A;  3V0B B;  1J1L A;  5FY4 A;  1UMI A;  2ZCW A;  3LEG A;  3KCX A;  4I3G A;  3ACL A;  5CFC B;  4LBK A;  1GWL A;  2XL7 A;  3NAP B;  1C5I A;  1RTV A;  2PHU A;  5A6Q A;  3E1F 1;  1GQH A;  3P3N A;  4FAH A;  5A80 A;  1DHK B;  1AR8 2;  2VMG A;  1R09 1;  4QM8 A;  5ABJ A;  1C57 A;  3VZK A;  5A32 B;  3SCF A;  1QJY 3;  2YUE A;  5DZG A;  1M06 G;  1V9U 2;  1ODM A;  2OZ6 A;  4KBB A;  5A7W A;  5JLV A;  3AZZ A;  4H7M A;  4RQP B;  4KQ7 A;  4QKN A;  4A7Z A;  1C8M 2;  5BNO A;  3WQ1 A;  4MXW A;  2BRT A;  2GME A;  4Y5Z 0;  5C8W A;  1W8U A;  3W59 A;  5KC6 A;  3DEM A;  1JOD A;  1NCQ C;  5EYX A;  3AZY A;  2WIN B;  2HJI A;  2WWJ A;  4LJH A;  2DBI A;  4Q0U A;  1OPO A;  1YQ6 A;  5J36 A;  1KS5 A;  2PAK A;  4WV8 A;  4I0W B;  1NOV A;  1OMI A;  1H2K A;  4G9S B;  1QDO A;  1YCI A;  3RZZ A;  4YM2 A;  1QOT A;  1X9T A;  2RR1 1;  3VBH C;  2PHD A;  2ENR A;  5FLH A;  2QVS B;  3RVH A;  1F5F A;  4B3N A;  5J48 A;  2W95 A;  4OMC A;  3PME A;  4PHZ A;  2XLG A;  4Q4W 1;  1WCS A;  1QXJ A;  3H50 A;  3POB A;  4FCA A;  2J1E A;  4NN0 A;  1LJ7 A;  3H8O A;  4L99 A;  3NNG A;  2DTW A;  3R0R A;  2KA3 A;  1NQD A;  3JU9 A;  3WDV A;  4IL7 A;  3V0A B;  1UY4 A;  2WNU B;  1R1A 3;  2K2S A;  2CNA A;  4M4R A;  1TNF A;  5FZC A;  1BJQ A;  2W08 A;  3GGL A;  1MEC 3;  3HIF A;  3I2D A;  4GMP 0;  3O1T A;  2W3J A;  3GXU A;  2QNK A;  4XEZ A;  2W39 A;  3K75 B;  1XNK A;  1ENS A;  1W6P A;  1DZT A;  5BNN C;  2D7F A;  2P6H A;  3NJV A;  3RJR A;  1PGS A;  1QQP 2;  1W2U A;  3H3Z A;  2YG0 A;  3ZPO A;  2D97 A;  4Z8B A;  1G86 A;  4RR3 B;  1C1F A;  2W2I A;  1OUR A;  1R09 3;  3OGG A;  5FOB B;  1VJ2 A;  1ZYB A;  2B9U A;  2WNV C;  4KWJ A;  4CRQ A;  5FZ4 A;  3ACI A;  1YO8 A;  4LE3 A;  1C28 A;  3USU B;  3VZL A;  5BPX A;  3O0X A;  2ZGQ A;  1H6Y A;  5A1A A;  5FYU A;  1WZX A;  1ACC A;  4K7J A;  4BB3 A;  5A6X A;  3U14 A;  1HQW A;  3EMR A;  3LA3 A;  1ZZ9 A;  2I07 B;  4AI9 A;  1AR6 3;  1CN1 A;  5K0U B;  2Y6J A;  1UXZ A;  5CIR A;  3AP5 A;  2JXA A;  2VOW A;  1IG0 A;  3AMQ A;  4AED B;  4CDX C;  3FE5 A;  3JD7 3;  4CU7 A;  2PA7 A;  2VMC A;  4XW3 A;  3VDD A;  3VDA A;  2W1W A;  5LA2 A;  1VBC 2;  2WAB A;  4LHN A;  1X82 A;  2G4I A;  1HXS 1;  1K5M C;  3KMH A;  3ACG A;  4LA2 A;  1GNZ A;  4K8R B;  5C9A A;  1R1A 2;  4R9B A;  2HWD 3;  4Q2F A;  2IUW A;  4QXB A;  4NWV A;  2AUY A;  2VG9 A;  5FO7 B;  4YVS A;  1ND2 A;  2RS3 3;  2JE8 A;  2VQA A;  5H9P A;  5LA9 A;  4MGT A;  1BEV 1;  4QPW A;  3H3U A;  4FXK B;  2VOV A;  4TN7 A;  2CSG A;  3D5O A;  4X8N A;  4BOW A;  2JKX A;  2D43 A;  5CZK A;  1UXX X;  3AP6 A;  4CDX A;  3U11 A;  4BHP A;  4HG6 B;  4YAR A;  1V9U 1;  2X53 S;  4IW3 A;  5JR2 A;  1LHV A;  1X8E A;  2P3I A;  1JTZ X;  2D3R A;  2OA2 A;  4DUX A;  1BQP A;  3M7A A;  1KFX L;  2A6V A;  3III A;  4CP9 A;  1H4H A;  1DGL A;  2XL9 A;  3PTR B;  4YNI A;  3ABZ A;  3NWK A;  4B4R A;  2RM2 3;  3MIC A;  3H7Y A;  2E33 A;  1OSG A;  1W9W A;  3PVB B;  5JXI A;  1RUO A;  1RUE 1;  3FX3 A;  3KV5 A;  2X05 A;  4F83 A;  4BU2 A;  3N9N A;  4OCT A;  4CDW C;  4TXW A;  4J1X A;  3O1S A;  2VZT A;  1J58 A;  2RR1 2;  3ATG A;  4B1L A;  1RGS A;  3GM8 A;  2WNU A;  1RVF 1;  1YYN A;  3PU8 A;  4Y1Z A;  3LZZ A;  3OY8 A;  3PTY A;  2FDJ A;  2RMU 1;  4CPB A;  1LED A;  3AVR A;  5DUX A;  2Q4S A;  4FQZ A;  5E88 A;  4M3C F;  3MLL A;  3IB3 A;  3JB4 C;  4I01 A;  1I5Z A;  1F35 A;  1NQJ A;  1OUX A;  1D2Q A;  1F4H A;  4AXO A;  2OUJ A;  1XC6 A;  3AJZ A;  1Y43 B;  3AYA A;  3BCW A;  3TWI A;  2OXB A;  2LW8 A;  3KQR A;  4H14 A;  3AP9 A;  3U10 A;  5HCH A;  3B9I A;  3LA2 A;  4XBQ A;  1ZRE A;  1ULP A;  4KGG A;  2AYH A;  3N7L A;  4BXF A;  3TN9 1;  4D6Q A;  1PM7 A;  1ENR A;  2X5I B;  2NN8 A;  2HKX A;  1GZ9 A;  1HV1 A;  2J7M A;  4AHZ A;  4ZU7 A;  4QM9 A;  3ZPY A;  2ZGL A;  3D6E A;  1HLC A;  2CDP A;  4N9H A;  4M0N A;  4HKL A;  3ACH A;  4RQP A;  3U78 A;  1S0B A;  1ZVF A;  4WZF A;  5A6Z A;  4D3W A;  3EJK A;  4CCC A;  1ULF A;  4BLJ A;  1NCR B;  4PI0 A;  2BGO A;  1I1E A;  4FQ4 A;  4P00 B;  3CJI C;  4O9G A;  2MEV 2;  2DVA A;  3OD0 A;  4ZHN A;  2BVV A;  3A21 A;  3OPW A;  1QIQ A;  5JSO A;  3LAG A;  2WO2 A;  2R04 2;  1GOH A;  3VDD B;  4WVM B;  1VRH 3;  3PDQ A;  2HWD 2;  5SV5 A;  3WDU A;  2H6C A;  4Y20 A;  4FTE A;  4LO8 A;  1D4M 3;  4TWT A;  1PO2 3;  1QHD A;  5DN2 A;  4DS0 A;  1DFQ A;  1SLI A;  3P1I A;  3TYJ A;  5ABJ C;  4PBP A;  4KNC A;  4ASL A;  4QB6 A;  3G7D A;  2V5Y A;  2PAM A;  1JU3 A;  1UYY A;  3CZJ A;  1C1L A;  4MLO A;  1OC1 A;  4XXP A;  3UGH A;  4V2W A;  1VBC 1;  5FFO C;  2JKB A;  2RJL A;  1X9P A;  1PIV 2;  5CKM A;  5JIA A;  3WCR A;  3WQ7 A;  3ZXJ A;  5C71 A;  2D93 A;  1W8F A;  2BBA A;  3ETP A;  3NMB A;  1IQD C;  1HRI 2;  4FPF A;  4ISR A;  1XYN A;  5BNP C;  3ZFG A;  4A42 A;  3POW A;  4QQH A;  2JX9 A;  3HOB A;  4CCK A;  2W92 A;  2XML A;  1BK1 A;  4C91 A;  5C3S A;  1V0A A;  4AI8 A;  3WNK A;  1H1I A;  4CCE A;  4FBF A;  5FYC A;  2HBU A;  3J7N A;  4DRR A;  4FOV A;  3LSE A;  3QH7 A;  4HKW A;  3L2H A;  2VZP A;  2V09 A;  4IE7 A;  1WUV A;  4LIT A;  4S2H A;  4XF9 A;  3TEX A;  2RDR A;  1MS9 A;  1RMU 3;  1U5Y A;  3O1M A;  2AC1 A;  1BMV 1;  2VUA A;  2UY9 A;  4PLO A;  5EP9 A;  2JIC A;  3KVA A;  3LIG A;  1ZBE 3;  5FYZ A;  3WCS A;  5HPO A;  3H8R A;  2VVE A;  2CTV A;  3MGU A;  5GZF A;  1CPM A;  5LCW L;  2JB8 A;  3GHM A;  3U0Z A;  3VBH B;  1RUI 2;  2QQN A;  3ZKY A;  4EWE A;  1BK0 A;  3LEI A;  3MIG A;  4CVU A;  4K40 A;  1PNF A;  4LA3 A;  1XYP A;  3DCQ A;  4B8E A;  4HOO A;  3KT7 A;  4N43 A;  1UKG A;  2R49 A;  2VUL A;  3I8T A;  3TN9 3;  4ASK A;  5A3U A;  1VBD 1;  1X8M A;  2OQ7 A;  5FMD A;  4JVA A;  1D4M 1;  1HXS 3;  4XPV A;  1KIT A;  3CJI A;  5DAB A;  1SBD A;  1DYO A;  1PIV 3;  1MVQ A;  2D5F A;  3RZK A;  2ZHN A;  3H0O A;  1W9T A;  3LGR A;  3I2I A;  4CU9 A;  5GJ6 A;  1OXC A;  2GH8 A;  4V2V A;  4Q0V A;  3SH3 A;  2P1B A;  1VB4 A;  4MGY E;  3WF1 A;  4GWM A;  4COV A;  1CAU A;  4KH9 A;  2DFB A;  3HAG A;  3ZXL A;  5JI9 A;  4AL9 A;  4NHM A;  5CFC C;  2MEV 3;  2WII B;  2FQP A;  2Q1F A;  3IAP A;  5FP3 A;  5L9V A;  2FMY A;  4GXL A;  1G9C A;  4W6Y A;  3ZYR A;  2YU2 A;  2QJV A;  5BXX A;  5JWP A;  1SLT A;  2DDU A;  2HEV F;  3VBF A;  3ZO0 B;  5IFP A;  3B69 A;  1G6N A;  3EB7 A;  3NNF A;  4AE2 A;  4EN8 B;  1MS5 A;  3JBG 1;  3POG A;  1N47 A;  1JXN A;  4YG6 A;  1LU1 A;  1ONA A;  2GP5 A;  2R04 1;  5KBF A;  3MI8 A;  4MXV A;  3AC0 A;  4DNY A;  4J25 A;  3DYP A;  3GZT B;  4NPR A;  1POV 0;  1QU0 A;  4MSV A;  4PLN A;  5DUV A;  3WT3 A;  4BIS A;  5HCA A;  2RMU 3;  3OY8 B;  2VGD A;  2R7E B;  1L3J A;  4GB3 2;  4K1Y A;  1RUF 2;  1Z0H A;  3BI3 A;  5KWR A;  3PU3 A;  1W6M B;  3WY6 A;  4CCN A;  3I2K A;  4LLF A;  1PK6 C;  2FMD A;  1MZ6 A;  2R30 A;  4CDU A;  5LWB A;  2B42 B;  1GR3 A;  1LOA A;  3HVD A;  5FZH A;  4FPJ A;  1W8Z A;  3IM0 A;  1DLC A;  2LRO A;  1XE8 A;  1UX6 A;  2JJ6 A;  4I30 A;  4W4Z A;  4Y26 A;  4HK9 A;  3A0N A;  4AFC A;  4LK6 A;  3RI8 A;  4BQY A;  1RUC 3;  2JDK A;  4HVR A;  4URA A;  3WOG A;  3CZU A;  2VUJ A;  3D4K A;  3UNP A;  2DU0 A;  2A6W A;  3D8C A;  1RUI 3;  1ND2 C;  5DUW A;  3RRD A;  3N7K A;  4OFG A;  1HB3 A;  1H30 A;  4MUV A;  3IKW A;  4UFH A;  4MOA A;  5CKN A;  4LBL A;  4EN9 B;  1LTE A;  3ZYJ B;  4BMB A;  1LOC A;  3OUH A;  2EXI A;  3PUR A;  5FDB A;  4Y22 B;  3SMH A;  1AJK A;  3RZG A;  1JOJ A;  1XB9 A;  1UWW A;  3JXS A;  3JB8 A;  2AEN A;  3WQB A;  1G8W A;  1TMF 1;  4CCD A;  5GZC A;  3VDD C;  2C26 A;  1JHN A;  4YW4 A;  3HBZ A;  5I93 A;  1TME 1;  1RVF 3;  4N43 C;  2ETE A;  2GAU A;  3R6S A;  1K12 A;  2VPV A;  1VB2 A;  2NLR A;  4C0H A;  4Y1V A;  1VLN A;  4IET A;  2HH9 A;  4XQ4 A;  2D3S A;  3B5L B;  2WFF 1;  2R1D A;  3BAL A;  5K8S A;  4ATE A;  1MVE A;  4IV1 A;  5J98 B;  4A44 A;  1VBC 3;  2VQ0 A;  4N7I A;  4S2G A;  2O1Q A;  1AUY A;  4A3Z A;  4NHX A;  4YRD A;  5FZ0 A;  3AM2 A;  4MXW B;  2HEW F;  3BTA A;  4FPC A;  3WX5 A;  4XJU A;  2VCM A;  3OJB A;  3VV1 A;  1WW5 A;  2VU9 A;  2Z79 A;  1R09 2;  3RYR A;  4AVC A;  4D8M A;  1OA3 A;  1WLW A;  3I2J A;  3WP4 A;  4C8D A;  4LUM A;  4N53 C;  4XOG A;  1ENX A;  4MH0 E;  2YGM A;  2D6M A;  2SLI A;  3BYW A;  4ZXE A;  4N53 A;  2JIJ A;  1X33 A;  3DKQ A;  1RUC 1;  2Z2S B;  4BQ1 A;  4UAP A;  1O5U A;  3CF6 E;  3BGA A;  4WVM A;  3SEP A;  4XAA A;  5T5O A;  1H8T B;  4R9D A;  5IK8 A;  1LES A;  3D0J A;  1SQ4 A;  2ZX4 A;  3KGL A;  1I5P A;  1OUS A;  1LOF C;  4QMA A;  5FK8 A;  3U75 A;  1KFU L;  1HN0 A;  1TMF 3;  2ZGU A;  5DAP A;  1AYN 1;  4FTB A;  2LUW A;  3MIB A;  1GBG A;  2G1M A;  2EVX A;  5K7P A;  3M3E A;  5ACA 3;  5JSR A;  1X7N A;  5C7G A;  1SFP A;  1LEM A;  1SLB A;  1YQ8 A;  1IKP A;  1COV 3;  2JEC A;  2QQP A;  4JZR A;  4CDQ A;  3ZFG B;  1KS4 A;  4B4P A;  3MIH A;  4IEZ A;  2PLV 1;  3AVS A;  4DO0 A;  1MQT C;  2PFW A;  3GCX A;  1UMH A;  4MGK E;  4J6G A;  4CDU B;  1CZS A;  5FPU A;  1FPN 2;  2QCS B;  3FWE A;  4GH4 A;  4COY A;  2C24 A;  4GZ9 A;  4MO3 M;  2I45 A;  5EQU A;  2IFW A;  3V0A A;  2IXJ A;  1NA1 C;  2ZKL A;  1JMU B;  1RJ7 A;  3ORJ A;  3T0A A;  3I59 A;  3VL9 A;  4LO4 B;  5KHJ A;  1S2E A;  3HNM A;  2OYZ A;  3KT1 A;  3UL2 A;  2DUP A;  4LHL A;  5TSW A;  4GMP 1;  4UI9 L;  1OVP A;  2ZJC A;  3URF A;  3RZH A;  4UF0 A;  4QT6 A;  3ES4 A;  1NZC A;  2ZPX A;  3MBW A;  1VAV A;  2IVI B;  3NJY A;  3AL5 A;  4LIU A;  4FXG B;  3CEW A;  1A6C A;  1OD5 A;  1XU1 A;  4IGO A;  4XQD A;  4BA6 A;  3N9O A;  4TLG A;  4XF3 A;  3WV6 A;  1LU2 A;  4NIG A;  5J96 B;  3QOP A;  3NL1 A;  3HMY A;  4K20 A;  2YC2 A;  4L97 A;  1O6U A;  5E16 A;  5AVP A;  3VBS A;  1C8M 1;  2A73 B;  1AR9 1;  1S1A A;  2DUR A;  3RS6 A;  1OH4 A;  2ZX3 A;  2YDE A;  2ZBJ A;  3EHK A;  4E4H A;  4XMI A;  4GAL A;  1A8D A;  5F2W A;  1B35 C;  3UJQ A;  4LNV A;  5LAS A;  5A7W B;  1VRB A;  3T4H B;  4DQA A;  1MPX A;  1NXD 1;  3MW4 A;  1IS3 A;  1OQD A;  5LEK A;  1D0H A;  3OB8 A;  1UAI A;  4IEX A;  4ZS3 A;  5I8S A;  1Z7S 1;  2BVB A;  3PVE A;  1N3P A;  1V6K A;  3OGV A;  1JYC A;  3MID A;  2UYB A;  4BCU A;  2WQ4 A;  4H55 A;  3RWK X;  3UGF A;  4JKL A;  4CCJ A;  4FOW A;  4Q0Q A;  4FP2 A;  1FMD 1;  4V1P A;  3BIE A;  2X09 A;  3ZYB A;  1XNT A;  5A3M A;  3VD4 A;  3VBF B;  3KHB A;  5GAL A;  3USS A;  1IPJ A;  3BPS A;  5GZG A;  2QUO A;  4JGZ C;  2YB7 A;  4ZON A;  4HSL A;  4UW3 A;  3K51 A;  5FZI A;  1VRH 1;  1DGR A;  2BGC A;  5AFB A;  3KV9 A;  1QJU 1;  2VZ1 A;  1RUE 2;  3S57 A;  1UZZ A;  4IEY A;  4Y1Y A;  2EA7 A;  3CBN A;  1S0E A;  3AZX A;  3MFC A;  4WM7 C;  2XJQ A;  4Y3O A;  2TNF A;  1O4Z A;  2WZP P;  3V56 A;  4PIZ A;  4HAN A;  4W8J A;  2J1R A;  4KGQ A;  2XON A;  3T09 A;  1AXY A;  3VUO A;  1V6N A;  3IWZ A;  1AYN 2;  3ACF A;  5IVC A;  1AX1 A;  1MS8 A;  4GKX A;  5GLV A;  1W8O A;  3NJX A;  4QU2 A;  4AED C;  1OOP B;  4XFA A;  3ST7 A;  1NT0 A;  1MS0 A;  1S0J A;  1KDK A;  1NCQ B;  4CUA A;  4XFH A;  2JWP A; 
#chains in the Genus database with same CATH homology
 3SKV A;  1K42 A;  3C7H A;  2W47 A;  1UY4 A;  4M4R A;  4D0Q A;  3GGL A;  2W3J A;  3GXU A;  2ORZ A;  2W1Q A;  4YPJ A;  2EID A;  3K75 B;  4XUO A;  3NJV A;  1UY2 A;  1NUK A;  5B4X A;  2YG0 A;  5IFT A;  4LKS A;  2YC4 A;  1R64 A;  1GU3 A;  1JYX A;  3T0D A;  1T2X A;  4LPL A;  4DUW A;  4DEV A;  3ACI A;  3HN3 A;  5A1A A;  1H6Y A;  5EIY B;  3HEI A;  1F4A A;  3NQH A;  2OKX A;  2BGP A;  1JZ2 A;  3A23 A;  2Y6J A;  1UXZ A;  2EIC A;  2W91 A;  1SG3 A;  4XZU G;  2VMC A;  5EJZ B;  2WZE A;  3VDA A;  3EYP A;  5LA0 A;  2W1W A;  3OBA A;  4XUN A;  5LA2 A;  2QQO A;  3DYM A;  1UYX A;  2WAB A;  3ACG A;  2W1S A;  2WDB A;  3I3D A;  3HNY M;  1CIY A;  2WO3 A;  3I2F A;  2BER A;  2Y64 A;  2EIB A;  2JE8 A;  4OMD A;  4QPW A;  5I0D A;  2WUH A;  3VD5 A;  3K46 A;  3WNP A;  2JKX A;  2KD7 A;  1UXX X;  5CZK A;  3VD3 A;  4HG6 B;  5JR2 A;  4M4P A;  1OF3 A;  4MGS A;  1J84 A;  4DUX A;  2ZEX A;  2WBK A;  2WQ8 A;  4DXR A;  3III A;  1XPW A;  4GWI A;  2RVA A;  3C7F A;  3ABZ A;  1WKY A;  2E33 A;  4CU8 A;  4XUT A;  1W9W A;  4MGQ A;  4ARY A;  2ZEY A;  5JXI A;  2X05 A;  2W87 A;  2J1S A;  1UY0 A;  2XHN A;  3ECQ A;  1H6X A;  1WCQ A;  2JD9 A;  4A6O A;  4TXW A;  1K45 A;  3OEA A;  4P5Y A;  2VZT A;  4ARX A;  1J83 A;  3FL7 A;  3GM8 A;  4IUG A;  4BK5 A;  1JU4 A;  5IHR A;  2YFZ A;  3IB3 A;  4CUC A;  2QQL A;  2JDA A;  1F4H A;  2W94 A;  3MV1 1;  1XC6 A;  5JUV A;  2VO5 A;  5JXJ A;  2LW8 A;  1KEX A;  1TG7 A;  1ULP A;  3CDZ B;  5J1X A;  1JZ8 A;  3SEE A;  2Y6H A;  2J7M A;  3LQC A;  4CU6 A;  2VTF A;  2CDP A;  1UYZ A;  3ACH A;  2QBX A;  3ZM8 A;  1D7P M;  2BGO A;  3DEC A;  1CZV A;  4P00 B;  4ET7 A;  3A21 A;  3I2G A;  3WSO A;  1PMJ X;  2WO2 A;  1GOH A;  2Z4F A;  2W5F A;  2ORX A;  3C7O A;  2VZV A;  1UZ0 A;  5DN2 A;  2V72 A;  3P1I A;  2ZXQ A;  4ZY9 A;  3WNN A;  1O8P A;  4QB6 A;  1JU3 A;  1O8S A;  1UYY A;  3CZJ A;  1JZ6 A;  1GQP A;  4QX0 A;  2VMD A;  3K4D A;  3MO4 A;  5C71 A;  3VD9 A;  3A7Q A;  3MUY 1;  2BBA A;  3ETP A;  3P6B A;  1IQD C;  4A41 A;  2DCK A;  4DEQ A;  4A42 A;  2VM9 A;  3HOB A;  2V5D A;  4AAX A;  2W92 A;  4QX2 A;  4CU7 A;  2J1U A;  4QB1 A;  2PQS A;  3WNK A;  4OZO A;  2QQM A;  1US2 A;  3LE0 A;  3PUH A;  3K4Z A;  2VZP A;  5JMO A;  2WAO A;  2ID4 A;  1W0N A;  2B9V A;  4A4A A;  3WNO A;  4JKM A;  5G04 L;  4ZZ8 A;  2QQI A;  3WEZ A;  5HPO A;  1UY3 A;  3I3B A;  3WF3 A;  5LCW L;  2WO1 A;  5DPN A;  1GMM A;  2QQN A;  4ZZ5 A;  3LEI A;  4CVU A;  5LA1 A;  2VJX A;  2HLE A;  4XVH A;  2LS6 A;  4CUB A;  2RV9 A;  5FUI A;  1K3I A;  2XOM A;  1UY1 A;  3CKH A;  1DYO A;  1W8N A;  1W9T A;  1P8J A;  4W50 A;  3T0B A;  3LPF A;  2WAA A;  3I2I A;  4CU9 A;  2J1A A;  3OGR A;  1GNY A;  1CZT A;  1W99 A;  3WF1 A;  3PUI A;  1OF4 A;  1NX9 A;  4PT6 A;  3FHQ A;  1ULO A;  2VOT A;  1DP0 A;  2VQT A;  3IAP A;  3FN9 A;  2W46 A;  1JYW A;  3MV0 1;  2DDU A;  5IFP A;  3EB7 A;  2Y6G A;  2VZS A;  3WF4 A;  1US3 A;  3AC0 A;  4KI5 M;  2VZU A;  2E26 A;  2W1U A;  3VDC A;  1JZ7 A;  3DYP A;  3THC A;  4RN5 A;  1RYY A;  3HPN A;  3LEK A;  1PMH X;  4XUQ A;  1JZ3 A;  2R7E B;  2DCJ A;  4L0P A;  1KGY A;  3D3A A;  3HNB M;  2ZEW A;  3VDB A;  1NAE A;  3T08 A;  3I2K A;  5JXG A;  3LPG A;  3C7G A;  1JZ5 A;  1JI6 A;  2VR4 A;  1DLC A;  4W4Z A;  3CQO A;  3I97 A;  4GWJ A;  3CZU A;  2VZO A;  1GOF A;  1OT5 A;  3BN6 A;  3T2Q A;  3WNM A;  3UNP A;  4DUV A;  3IDA A;  3UET A;  2J1T A;  2Y6K A;  1TVG A;  1UX7 A;  4AG4 A;  2RJ2 A;  2VMF A;  3OG2 A;  2X10 A;  4MOA A;  4E8D A;  5DMY A;  4QX1 A;  2HYX A;  3T2P A;  4QB2 A;  1UWW A;  3JXS A;  3VD7 A;  3WQB A;  1EUT A;  2C26 A;  3NRU A;  3IAQ A;  1W9S A;  1SDD B;  2VC9 A;  3GDB A;  1JYN A;  1K12 A;  4PF1 A;  3J7H A;  1HN1 A;  5G05 L;  4JHZ A;  4KMQ A;  4DXS A;  4A44 A;  5B4N A;  4A3Z A;  2VCA A;  3SKJ E;  2E32 A;  3CMG A;  4D8M A;  2WZ8 A;  3K77 A;  3I2J A;  3WF2 A;  2VZR A;  3HJR A;  4ZXE A;  5IJR A;  2Y8K A;  4QAW A;  4UAP A;  5CYY A;  3BGA A;  3SEP A;  4QDQ A;  1JYV A;  1XNA A;  3F2Z A;  3THD A;  2E31 A;  1OD3 A;  5C70 A;  5IYY A;  4P02 B;  1I5P A;  5DQ0 A;  4Z2A A;  2VCC A;  4LHS A;  3W5N A;  3OGS A;  4E8C A;  1BHG A;  4RYD A;  5C7G A;  4KWU A;  2BZD A;  3FHA A;  4P08 A;  1PX3 A;  1L7R A;  4XUR A;  2CDO A;  1UMH A;  4LQR A;  1CZS A;  4UOJ A;  1YQ2 A;  2VCB A;  4XUP A;  3WF0 A;  1L7Q A;  4GZ9 A;  4MO3 M;  2QQK A;  1SHW B;  5EJ1 B;  1EUU A;  3T0A A;  4PQQ A;  2C9K A;  4JKK A;  3HNM A;  3UES A;  4BJ0 A;  1JZ4 A;  3DYO A;  1GOG A;  4UI9 L;  4BK4 A;  2Y6L A;  2B4K A;  1O59 A;  3MBW A;  2V4V A;  1NKG A;  2VL4 A;  4A45 A;  1GUI A;  2VME A;  2WN3 A;  5HXM A;  2VZQ A;  1JHJ A;  3C7E A;  4OUE A;  3T2O A;  2YC2 A;  4CUA A;  4BXS V;  1LNS A;  2YFU A;  3I3E A;  1OH4 A;  4TTG A;  2W9X A;  2WYS A;  3C8X A;  4QDR A;  3U37 A;  1MPX A;  4OYU A;  4MAD A;  3W5M A;  3OB8 A;  2J22 A;  3CIH A;  1UMI A;  3LEG A;  2C4X A;  3OEB A;  3A22 A;  2EIE A;  4QX3 A;  4BDV B;  3OGV A;  3E1F 1;  2ZEZ A;  4JKL A;  4FI9 A;  2VQU A;  2L9L A;  2X09 A;  5JXH A;  1XNT A;  3VD4 A;  4QDS A;  2J1V A;  2YB7 A;  5F7U A;  2VZ3 A;  3MUZ 1;  4DXT A;  4JX0 A;  2VZ1 A;  1CX1 A;  2XQX A;  3K4A A;  4W8J A;  2J1R A;  2WN2 A;  2XON A;  3T09 A;  3WNL A;  3ACF A;  2W95 A;  4OMC A;  1W8O A;  3NJX A;  2QQJ A;  2J1E A;  3NNG A;  1PX4 A;  3I2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...