1D7PM

Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
LNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNCLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C2 domain of human factor VIII at 1.5 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords COAGULATION FACTOR VIII PRECURSOR
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1d7pM00
3HNMA 2KD7A 1GU3A 2VZTA 2VZ1A 1W0NA 4QB2A 2XHNA 2VQUA 3C7EA 1UY3A 2VZQA 1TVGA 4QX1A 1K45A 2ORXA 4MO3M 3OB8A 4QX0A 2WYSA 2EIBA 4CU8A 3ETPA 1UYYA 2Y8KA 3WF4A 3WQBA 3VD9A 2VMCA 3F2ZA 1W8OA 1W9WA 2BGPA 2W1QA 5JMOA 2VZSA 3K75B 1W9SA 4DXRA 2V5DA 3ABZA 1NAEA 2J1SA 2WABA 2W94A 2CDOA 5JUVA 4ZXEA 4LPLA 2V72A 1JYXA 4XUQA 3VD4A 4JHZA 4M4RA 2VZPA 3GDBA 5CYYA 3SKVA 1JZ6A 1W8NA 1EUUA 3LEKA 3LEGA 3PUIA 3NRUA 3LE0A 1UWWA 2YC4A 3ZM8A 3VDAA 3OG2A 3FN9A 2EIDA 1OH4A 1UYXA 2VO5A 2Y6HA 2ZEYA 1CIYA 2W5FA 2WN2A 3MO4A 1KGYA 1L7RA 2XOMA 4XUPA 3UNPA 1UMIA 1JZ2A 2WQ8A 2HLEA 3OGSA 3UESA 1UZ0A 5EJZB 2WUHA 3HJRA 4QDSA 5EIYB 4A41A 2DDUA 2WO2A 1JZ8A 2QQLA 2VCBA 3DYMA 1PX4A 1XPWA 4A44A 2VCAA 2VOTA 1P8JA 1TG7A 2ZEZA 4ZZ5A 4W8JA 2WAAA 4W50A 5B4XA 2ZXQA 1GUIA 3I2JA 1BHGA 1SHWB 3I3DA 4QB1A 4QX2A 3WF0A 5A1AA 3OBAA 1J83A 3WEZA 2BERA 4OZOA 4PQQA 1UXXX 1W9TA 3DYOA 2W1UA 3CMGA 5HXMA 2YB7A 1EUTA 1JYVA 4QDRA 5IFPA 2ORZA 3C7FA 1UY2A 1LNSA 1JHJA 1XC6A 2C4XA 5FUIA 3WF2A 4IUGA 1UXZA 2VR4A 1US2A 3T2PA 3LEIA 4AAXA 2B9VA 3LPFA 1UX7A 3NJVA 2WBKA 4RYDA 1J84A 2BGOA 2JDAA 1PMHX 3A23A 4JX0A 4MGSA 2W95A 3CIHA 3C7OA 4XUNA 5JXHA 4QDQA 5IHRA 1ULOA 4D0QA 5LCWL 4MGQA 2XQXA 2EIEA 1SDDB 2PQSA 2YFZA 3K46A 5JXGA 4QB6A 3T0DA 3CKHA 4XUOA 4TXWA 2QQJA 5DPNA 4YPJA 2Y6LA 2VZRA 3IAPA 2VZ3A 2Y6JA 3C8XA 4UI9L 3CQOA 2RJ2A 3VD5A 3K4AA 4D8MA 3OEAA 4JKKA 4CU9A 1US3A 3EYPA 3ACFA 3JXSA 3SKJE 4DXTA 5JR2A 4DEVA 2WAOA 3U37A 1RYYA 1PMJX 1W99A 4PT6A 2VMFA 4GWIA 1NUKA 4DUXA 1JYNA 1KEXA 2RVAA 3J7HA 4BDVB 3FHQA 1JU4A 3W5MA 3MUZ1 1UY0A 5JXJA 2J1UA 2JKXA 3BN6A 2VCCA 5HPOA 2C26A 2E26A 4ARXA 3WSOA 3OEBA 2E33A 3W5NA 2YC2A 4BK5A 2QQMA 4ZZ8A 1DLCA 3GXUA 4L0PA 3IB3A 3WF3A 2ZEWA 4QX3A 1K12A 3AC0A 4KI5M 4KWUA 3BGAA 3THDA 2WO3A 1H6YA 4E8DA 5C70A 1IQDC 2VTFA 3CZJA 1GOHA 4A45A 1K3IA 4OMDA 4A42A 4A4AA 2VZVA 3HEIA 3IIIA 3C7HA 4ET7A 3DYPA 4MADA 4XVHA 1YQ2A 5B4NA 1CZVA 3T08A 2VMDA 3A22A 2J7MA 2L9LA 2W87A 2YG0A 2DCKA 2QQKA 2LW8A 4QPWA 3T0BA 1GQPA 1GNYA 2W92A 3P6BA 4DUVA 3FHAA 2B4KA 3T0AA 2R7EB 3DECA 3I3EA 4ZY9A 1O8PA 3WNOA 1GMMA 1H6XA 3HPNA 3K77A 3T09A 2Y64A 1NX9A 3PUHA 3HNYM 1DP0A 1GOGA 3T2QA 2VL4A 4E8CA 1XNTA 3HN3A 3ACGA 4Z2AA 5JXIA 2QQOA 4AG4A 1WKYA 1JYWA 3P1IA 1O8SA 3I2FA 3I97A 2E31A 2CDPA 4BJ0A 2HYXA 3HOBA 1K42A 3WNLA 3ECQA 3NJXA 2J1VA 3MV01 3EB7A 1OD3A 2WZEA 1T2XA 2X09A 3LPGA 4DUWA 4P08A 3FL7A 4GWJA 2WO1A 5CZKA 4OYUA 3K4ZA 1XNAA 4PF1A 2X05A 3CDZB 5LA1A 4GZ9A 4XURA 1JZ4A 2E32A 3WNPA 2J1RA 1NKGA 1F4AA 4CUBA 3HNBM 4OUEA 2Z4FA 2QBXA 2VZOA 3GM8A 1JZ5A 3WNMA 1ULPA 3ACHA 5IYYA 3VD7A 2QQIA 2X10A 1D7PM 5G04L 3C7GA 1JU3A 3A21A 2VM9A 2C9KA 1F4HA 3VDCA 5DQ0A 5F7UA 4CU7A 5LA2A 1SG3A 3GGLA 4LHSA 4RN5A 2VC9A 3UETA 1L7QA 1OF3A 5C7GA 1WCQA 5DMYA 3IDAA 1GOFA 2ZEXA 4QAWA 3MBWA 1PX3A 1MPXA 3NNGA 3WF1A 5IJRA 1DYOA 4JKLA 2V4VA 2QQNA 1JZ3A 4OMCA 4CU6A 3A7QA 3LQCA 3T2OA 5EJ1B 4XZUG 2XONA 4CUCA 2W3JA 4XUTA 5C71A 1R64A 4P5YA 4JKMA 4DXSA 5G05L 5J1XA 1JZ7A 3MUY1 1HN1A 4M4PA 2VJXA 5IFTA 2W1WA 5LA0A 2OKXA 3ACIA 2VQTA 4W4ZA 2J1TA 3WNKA 1OF4A 4UOJA 3E1F1 2LS6A 2Y6KA 3SEPA 2WDBA 1O59A 4FI9A 4BK4A 3WNNA 2W46A 2Y6GA 3I2IA 2W1SA 4LQRA 2WN3A 3VDBA 4BXSV 2BZDA 5DN2A 1UYZA 1JI6A 4TTGA 4A3ZA 2W47A 3I2GA 3VD3A 3CZUA 3OGVA 4DEQA 3OGRA 4KMQA 4MOAA 2J1AA 1UY4A 2DCJA 2EICA 4ARYA 3I3BA 2RV9A 3D3AA 1UY1A 3SEEA 2WZ8A 1CZTA 1CX1A 2J1EA 1CZSA 5I0DA 2YFUA 2JD9A 1UMHA 2W9XA 4CUAA 3I2HA 4P00B 2VMEA 2J22A 3I2KA 1I5PA 3NQHA 4CVUA 3K4DA 3THCA 2ID4A 2VZUA 4P02B 4UAPA 1OT5A 2JE8A 4A6OA 4HG6B 3IAQA 2BBAA 3MV11 4LKSA 2W91A
chains in the Genus database with same CATH superfamily
1QDCA 1D4M3 1H9WA 1UOJA 1UOBA 2GNDA 1VRH3 2P3JA 2YXSA 3VBFB 2KD7A 1GU3A 2VZTA 3RMXA 2VZ1A 4QPIA 1A3KA 1REFA 5EPAA 1H9PA 1O4ZA 4PHZA 4QB2A 3J26N 4IV1A 1XNDA 4QPYA 1UY3A 4BIOA 4K40A 4QX1A 4GB31 2BGCA 2ZPXA 1HB4A 1Z0HA 2XVLA 2OT7A 4S2HA 4QX0A 2WYSA 4WVWA 5FXVA 3MICA 1IZ3A 1OMIA 3Q8BA 1R092 4X6QB 5A3LA 1FATA 1UYYA 2TBVA 4RGKA 3WF4A 1W3VA 2OUJA 2QZ3A 2WFF1 1W9WA 4K8RB 1W2OA 1MQTA 4ITCA 4G3YC 2Y33A 4XF1A 1JW6A 1W9SA 2BFUL 3S5AA 2J42A 3CU7A 2V5DA 2GALA 1NAEA 2W94A 2CDOA 1OLME 4E9KA 2ZGRA 1J58A 2DCTA 5JUVA 1GSLA 4CDUC 3H0OA 5F8PA 3OOXA 1UOFA 3VBHB 3JZVA 1C3HA 1VBB1 2I45A 1CJDA 2F4LA 4WVMB 1BK0A 2F6BA 1TMF2 4BU2A 4V2VA 2AREA 2Q8EA 3QLQA 1H0BA 1DCSA 2LM3A 4CEYB 3U4XA 3FWEA 1OFNA 1LGNA 4Q4Y1 4X8NA 1G7YA 1W8NA 4LIUA 2CGNA 4LR4A 1W8WA 5FBJA 3M7AA 5J48A 2WRAA 3AJZA 3LE0A 3ON7A 1U12A 3RQ0A 2DURA 3OG2A 3MLKA 4NMIA 3NNFA 3WG2A 4XQ4A 1DGLA 2CAVA 1QMJA 1UYXA 4DZGA 5KXCA 2Z5WA 2PHDA 1RVF2 4GWNA 2ZEYA 1BBT3 4NRQA 2JB8A 4XF3A 3MO4A 2TEPA 3M1HA 2XOMA 1S55A 3WW1A 3O12A 5GLWA 3JB8A 2HWD3 4RFRB 4X6RB 1OUSA 2A3YA 1J3QA 4N53A 1VBC1 5CNAA 3KGZA 1H4GA 1Z7S3 5FAXA 2E7TA 4UFLA 1UYPA 5EJZB 2WUHA 4AAPA 4AR2A 2XKPA 4N43A 3RZKA 4EN7B 2JG8C 4CEYA 2JX9A 1DGRN 2Q1MA 4UXAA 4XFAA 1C8NA 4FTSA 1ND2C 2DFBA 3GYDA 5L73A 2B8MA 4ASMB 2WNVC 4LLOA 3CJIA 1GWKA 4YG0A 5HXVA 3SQOA 3WW3A 4EYUA 1JZ8A 1QDOA 2NP0A 4Q29A 2VOTA 1TME3 1TG7A 4W8JA 4W50A 1G6NA 2ZXQA 3R4SA 4HVOA 4QHOA 3I2JA 3ZMNA 1KJRA 2YV8A 4FPJA 4EROA 1UD1A 3LF7A 5F2SA 3TEWA 5LK7B 3AKTA 4BMBA 4BH9A 2GP3A 5FUPA 3ZOIA 4BMEA 3WEZA 3WT3A 2BERA 1QY4A 1OUXA 5FYBA 1C5IA 1SCRA 1W8ZA 2XXZA 3K3OA 4WM7C 2XLFA 1D4M2 1UXXX 2PMWB 1XRUA 2JDHA 2DWRA 2W1UA 1YIPA 1RUF1 5K4LA 4RGGA 1DQ5A 1RHI1 2GN3A 1JYVA 3VBOB 4CCNA 2WZR2 2ET7A 1PVC2 2RDSA 4UYBA 5IFPA 4B7EA 3L9JT 4MZUA 4QD2A 1R1ZA 3WP3A 2XH6A 4EQVA 5FYYA 2HWE3 1APNA 3POJA 4AFCA 2LTNA 1XC6A 1OOPB 3C2UA 4CEWB 1I6XA 4JRAA 3WF2A 4IUGA 4HSJA 1WD4A 4XC9A 2R062 1MEC2 2HEYF 3T2PA 5A6QA 2QQUA 4IL7A 2F4PA 2Z79A 3OPWA 3H1WA 4JDOA 3T1LA 3VKMA 5HCAA 3TYJA 2GU9A 3NSTA 2XGXA 1E57A 3TN91 4L97A 3OTFA 2OA2A 1IG0A 1LOFC 1UZZA 2DUQA 1MVEA 5T5PA 2BNNA 1JUIA 3PHMA 1QJZA 5E16A 2UU8A 4TLGA 1AR62 1U5IA 2TUNA 1J1TA 1CONA 2HEWF 4D7YA 2A7AA 3KM5A 4LO8A 1S0JA 4CEWC 2W95A 1ONAA 3CIHA 2Q5TA 3DPRA 3NW4A 4HVRA 5A7WB 1XE7A 3NVCA 2K2SA 3RZGA 1YC61 4Y3OA 4NIIA 2FCUA 4XPVA 2Y38A 5FTTC 4INDA 4Z92B 4LOSA 1H1AA 3VKFC 2ZHNA 3VBSB 3D6EA 4LLFA 1S0IA 2A6XA 3K46A 1PM7A 1AX1A 4JC1A 4BQ5A 1REDA 2JE9A 2NN8A 5EHDA 1HB1A 1PIV3 3CKHA 1DGWA 5DPNA 4N43C 2VZRA 4D3WA 4MGIE 3BU0A 4UI9L 3BKZA 1YQ6A 3CQOA 2QJVA 2IXIA 4ZONA 4XJWA 4LBQA 2X5IB 1BBT2 3K4AA 2ERFA 4RFT0 2PLV3 4BCUA 1W9YA 2ZMLA 3OEAA 4JKKA 4CU9A 1CN1A 3ZN6A 3ACFA 3SKJE 4YZ3A 1PO23 5JR2A 4AI9A 2WS92 5FY5A 1PMJX 5C3QA 1OURA 5C9AB 4IE6A 4PT6A 1JYNA 5A3TA 3O1SA 3K3NA 1QJY3 4KU7A 3UYJA 2ARAA 2KA3A 3PURA 5FZ9A 4CP1A 1UY0A 5FR3A 2J1UA 3HAGA 1H8VA 3U11A 3WR0A 1TQ5A 3BN6A 3BTAA 4B4RA 1W2NA 1D4VB 1S4CA 2E26A 4ARXA 1NT0A 3WSOA 2WC2A 5FQ0B 4DINB 1H2MA 1QOSA 3D82A 1PO22 1H4HA 4IEPA 4L0PA 3VUOA 1EAH1 4EN0A 2VVEA 4Q0SA 1BMV1 2CTVA 2FDHA 1W3XA 4QXCA 5CFCC 1DHKB 5FLJA 1LODA 3H3ZA 3LOIA 2YC0A 4XBLA 1K12A 5F3GA 1O5LA 1RUH1 4D6RA 4Y33A 1T6BX 5JI7A 4YSFA 3A4UA 3KCXA 5C70A 3LA7A 1YLLA 3IBMA 1IQDC 2VTFA 4Q4X1 4DXZA 3NV4A 4A42A 2HKXA 2OVUA 2IUWA 4A4AA 2VZVA 2BJSA 1XNBA 1DDLA 3BALA 2IXJA 3SCFA 3OGGA 3C7HA 5AFEA 1VBB3 5D8AC 4IQPA 4MADA 2WZR3 1GP6A 4W65A 2ARCA 5FYHA 3N9NA 5KHIA 3O5SA 1AL22 5A32A 4UBHA 3T08A 5JSRA 3A22A 2J7MA 2L9LA 2YG0A 3RZLA 2XVGA 3WY6A 1Z7S1 5JIUA 3S0MA 1FV3A 4IE4A 2P3IA 4QPWA 4IGOA 3P6BA 4FOYA 4DUVA 3SITA 3FHAA 4OI4A 5FO7B 3POWA 3QOPA 5BNNC 1PO13 3N7LA 3H1MA 3WOGA 2IFRA 1PO11 1VRH2 1EV13 2IC1A 2RS52 3FLRA 2B4KA 2I74A 5FO9B 3NV1A 4FPEA 4ZKTB 3VV1A 1V00A 3TEYA 4CXYA 1W0OA 5CEHA 5GKAC 1NA1B 3WNOA 2EF6A 1VBB2 1GMMA 3KT7A 4PIZA 3TNQA 1CIWA 1NX9A 2R1BA 1ND3B 3N9LA 5FY9A 3HNYM 3I59B 5FY1A 2VL4A 1G9CA 4NR1A 4EZHA 4KWLA 5JXIA 4P9XA 2QQOA 2RG4A 3GHMA 1S0BA 2GC0A 3ZFEA 2EALA 4HOOA 3KMHA 3HVDA 3P1IA 4P9WA 4FOWA 4Y4YA 2VY0A 5FPZA 2D93A 5JOWA 2PFWA 5FYTA 3DL3A 1AR83 5EFUA 1CAUA 2ZX3A 4BJ0A 1GFF2 2OZ6A 4J6GA 4G9SB 1OI6A 2HYXA 5CU1A 3WP5A 3FJSA 3Q8AA 1KJLA 2UWBA 3LGRA 2B42B 3AFGA 1WLWA 2OPKA 2ZTNA 4YZ5A 1AR61 4HK9A 4EWAA 2J1VA 1I1EA 3I2OA 2O8OA 2WA3A 3VN4A 1X8MA 1AYN2 2W2IA 3DCQA 2XPJA 4NVPA 3RVHA 2WFPA 1S0DA 2FBEA 1NA1A 1HDKA 1OSGA 2HYKA 3FL7A 4JGYA 4MHRA 4R52A 4XAEA 2G4IA 3OPTA 5GJ6A 4E2SA 1CWPA 2GH2A 4BQWA 4PLOA 5BNOB 2OPWA 4GMP3 4LUKA 4XTPA 1DG6A 4XURA 1WA6X 1HRI2 4MXVA 5A80A 1NQDA 4GH4A 4XJ9A 5K9YA 4Z2WA 4XIKA 2V09A 3ZKYA 2UY8A 2W0XA 1NKGA 2KM2A 5FWEA 1F4AA 1ZRFA 2D98A 3THPA 4XYXA 5CFDA 2GN7A 4Q4W3 1Q8SA 2VZOA 4N8MA 4N90A 4L99A 1RUI1 2JECA 1ZNPA 1NY71 3O1UA 2PLV1 1GYKA 3LIHA 5IAVA 3B93A 4QPIB 4HN0A 2AH2A 3OY8B 5APAA 4K8FA 4HKWA 1UZWA 4UF0B 2B45X 2XVKA 2RDQA 1LR5A 1YI7A 1MVQA 2A1XA 2H0VA 2ZGUA 5LRRA 5LBBA 3R0RA 3LZZA 4E4DX 5KHGA 2CY6A 4O61A 5DQ0A 4BQ3A 1G9FA 1R081 2DVGA 4CU7A 1VAMA 1L7LA 1GWLA 3MI8A 1OPOA 5IWFA 1GANA 4RN5A 3JBG2 1AR91 2JIJA 1X82A 4NJ4A 5D8AB 5C7GA 1OF3A 4HMZA 5KR7A 2Y34A 2Q8DA 1S0GA 2X29A 5EV7A 1S2KA 2B9UA 2VVDA 3K2OA 3PLQA 4GH4B 1WCQA 1Q3EA 5DMYA 2PHRA 1K5JA 1GOFA 2RMU3 4OULA 4QAWA 5CFDB 2LROA 1YUDA 1AJOA 5FZ4A 4HSLA 4QMAA 5FLHA 4S2FA 4XJAA 1SPPB 5GZEA 3TN92 4HPKB 3VBHA 4U2AA 1ZZ7A 5EWSA 1DYOA 5L7OA 2D97A 4JKLA 2V4VA 3ATGA 3VDDB 2FDKA 3EBRA 2VBBA 3MF6A 1AR72 4COVA 5M0TA 1HX6A 1C57A 4S2GA 2QCSB 4V2WA 4HL0A 3ETQA 1BEV1 1LHVA 3LDRA 5FMBA 5FCCA 4AVSA 1QNWA 1OKQA 4XUTA 2A71A 1PVC1 1C8M3 1QEXA 4A2UA 5FKCA 3MLJA 1JZ7A 3X29B 3BIWE 1QJX2 3DPRC 1AYN3 4LBLA 1UZYA 5F9TA 3AVRA 2VJXA 1GZWB 2W1WA 5LA0A 1FXZA 3ACIA 3ES4A 4GMP0 1QJU3 3PIGA 4IV3A 4RR3C 5F3IA 3WX5A 2Y6KA 2RJLA 5K0UB 2JDYA 2Q1FA 3NV3A 3RYPA 5CG9A 3IPVA 1CAVA 4XABA 5A3UA 3ZXLA 2WLQA 1LOFA 2C5DA 3DKQA 2WDBA 5CFDC 1SPPA 4NWVA 4YM0A 2BYVE 4B4QA 4BK4A 1IPKA 3WNNA 1DQ1A 2IXLA 1AYM3 3KV9A 1A6CA 2H0BA 2W1SA 2P3KA 2ADEA 3I2IA 4M3CF 4S2DA 2WN3A 3VDDA 5DAWA 3VDBA 1AHSA 3O1VA 2A6WA 4YVWA 3URFA 4JV4A 5DN2A 1UYZA 1JI6A 1HXS1 3TWIA 3ZVXA 5FDBA 5LBEA 2VTXA 2W47A 2AYHA 4IGQA 4UBGA 2GH8A 3UGGA 1X9TA 3N36A 3OGVA 1NXD1 1QQP2 3OGRA 1RUE3 4MOAA 4GAZA 5IVVA 2YPJA 2YU2A 3HT1A 4JQTA 3AFKA 1EPWA 1Y4WA 3I3BA 2RS32 5ANQA 3RI8A 3B5LB 4EZ4A 4UW3A 1S1AA 2VW2A 3L2HA 4PDWA 3SEEA 2WZ8A 1JYCA 5FMOL 1CZTA 5HV4A 3IMMA 5JMCA 1CX1A 1JYTA 1CZSA 1H2LA 1Q5OA 2R071 5GLUA 5T3NA 3ZYHA 5I0DA 4QPIC 4AWDA 2W9XA 3D4KA 4XQWA 1X9PA 2R0HA 1WCUA 4XOGA 4YW1A 5K0UA 2VOVA 1BBT1 3LDBA 4GB32 5FREA 4TSVA 3U1XA 3M8LA 4URTA 5JXHA 1I5PA 5E88A 5FZFA 3IZOA 3NQHA 1HQLA 4E4HA 1BVVA 3AYCA 5HCBA 2ZOEB 3NV2A 3IDEA 1NE4A 5E8AA 2ID4A 3WV6A 3VBOA 4I09A 4IEZA 1YFXA 4UT5A 2A5ZA 2WQ4A 1GKBA 1MS1A 1W06A 3JQXA 1WLTA 2WNUA 1NCRA 5FZ3A 5L9BA 3PVOA 2VNRA 4LA2A 2HWB1 3T30A 3WP6A 3MIEA 4D6QA 4AEJA 1AL21 2XL7A 1PGL2 3ZX7A 1DIWA 2ZAAA 1ZBE3 3ZLIA 3O0XA 4C0BA 1W0NA 1LGCA 2P17A 2ZGNA 3OCPA 4XE9A 4HETA 3VBRC 1ULCA 4FAGA 2VQUA 4HBNA 2VZQA 1STMA 2ZABA 5A6YA 4GQ7A 3UGFA 4COZA 5H9SA 3WQ7A 4KH9A 1KFUL 4MO3M 1UU4A 1UN1A 3OBTA 4WVZA 1O3SA 2EIBA 4C91A 3ETPA 2Y8KA 5DAXA 3LA3A 2OQ7A 3WQBA 2VMCA 3VD9A 1W8OA 3LOBA 3JD71 4CDQA 1OHFA 2PHUA 3J8F2 5FJKA 5FK7A 4Q1RA 2VXRA 4LKDA 2BVVA 4RHV2 2CHHA 1D0GA 3G6JB 3B00A 3RDIA 2GC3A 1ND3C 3ABZA 4R8HA 4Y1VA 3ROUA 3CEWA 5FXWA 3SC7X 3VL8A 1BMV2 1PIV2 4QKNA 1UKGA 2JG8B 2DF7A 4TLFA 4XFBA 1ASJ2 4ZXEA 2WNUC 4LT5A 1N3PA 2VUAA 5FOJB 1RMU3 4H7LA 5CA6A 4R4ZA 5FYZA 1ZRRA 4XDOA 3NNJA 4JHZA 4JTNA 4M4RA 1ULEA 1YI9A 3ENRA 4MGZE 3AMHA 2PAMA 4JCKA 2JDMA 1UX6A 1YQ5A 1HJFA 3NWKA 4QU1A 5J98B 1EUUA 2ZS6B 5FMDA 1KS4A 4DS0A 2HWC3 3ZM8A 2NMOA 1WZXA 3VDAA 1K42A 4FVVA 4QPGB 3UL2A 3BUCA 2P4EA 3BTYA 3HT2A 2WNEA 3U75A 3Q8EA 1OH4A 3I8TA 1IPSA 3ZR5A 4YZ1A 1EAH2 5JPMB 1OA4A 1XSRA 1S2EA 3BPZA 3WDVA 2Y6HA 1KDKA 4AVAA 3WNXA 1QQP3 1VBA1 1L7RA 3RZZA 4P14A 2FDJA 4XUPA 1A8MA 3VBRB 1W8UA 2NZ9A 1PK6C 1SEFA 4O9EA 3SXWA 5FBZA 5CFCB 1HRV3 1LHUA 2HLEA 3MYXA 3W21A 3ZDVA 4CYDA 3OGSA 3MHZA 2VH9A 3VZKA 1VLNA 1COV2 3AK0A 4CDUB 4XFGA 1YO8A 4CUGA 1VIWB 4A41A 2VULA 4GB33 5IAXA 2BWCA 2BDRA 3T4HB 2UWCA 5A1LA 5FZ6A 4ORFA 2VCBA 1PX4A 3ZN4A 1XPWA 4A44A 5T55A 1GQHA 5IATA 4FT8A 1TNFA 2AGSA 2YGLA 1P8JA 1RUG1 1WWYA 3VB9A 2FZ1A 2WWUA 1DQ2A 2WAAA 1IS5A 1GUIA 4N7UA 5C9AC 4Y5TA 1AR92 5AFBA 3O7OA 2C1FA 1J3RA 5GLVA 3BI3A 4QB1A 1XBFA 3WF0A 3ZR6A 5A1AA 2QQVA 3QD6A 3PU3A 5FZCA 2VG9A 1W8HA 2AZ5A 3AYEA 1W6PA 2WO7A 3EQEA 1QU0A 3SMHA 4BOWA 5ACA3 5J96B 2A6YA 2JDZA 2IXHA 4FOQA 4YFZA 1WW6A 3J8F3 4WM8A 4Y22B 4YW7A 3DYOA 4ISRA 3AJYA 4AK3A 4HT1T 4K3UA 1RUC3 2YB7A 5HCFA 4QDRA 2Q0AA 4BA6A 3C7FA 5K7PA 1OOPA 1RHI2 4ZS3A 1RJ7A 1PNFA 1R082 5FRAA 1POQA 2WINB 1W04A 5KHKA 3LSDA 1UXZA 1RC6A 3RZJA 4W6XA 1OA2A 1US2A 2MEV3 4AAXA 4AW7A 1Q43A 2BOIA 2B9VA 3ZXGA 2YROA 3AKPA 1AR73 5A3PA 3NJVA 3ALQA 1SCSA 4IERA 1Q8QA 1QKQA 5JCTA 1HJGA 3IDCB 1LECA 2ZCWA 4XFIA 4OUMA 1YQCA 3WLUA 5IK5A 4YW3A 2RR13 2EXKA 3DPRB 4JX0A 1KQRA 1MS4A 2OQ6A 4WZCA 4KWJA 3RI9A 5J37A 1UZVA 3M3QA 5CBLA 2BQPA 1G9BA 2P5BA 2XKOA 2ZX1A 2EIGA 3UGHA 3C7OA 4XUNA 2VU9A 4NN0A 1BJQA 4QHZA 3KD4A 5DAVA 1F2NA 3WUDA 2ZBJA 1R1A3 2VCMA 4QDQA 5A3WA 5IHRA 5FYUA 4LHNA 5JZGB 4MGQA 1Y9MA 2PQSA 4Z8BA 2YFZA 5L36A 4BQ4A 5JXGA 4QXHA 3JCIA 2PHXA 3M3OA 3ZYPA 3T0DA 4IDZA 3VDDC 2QQJA 1VAKA 2JDKA 1SQ4A 3IAPA 3BCWA 2YGMA 2CGPA 5CKNA 5DAQA 1LOBA 4YFWA 1WGPA 4FXGB 1H30A 4AQ6A 1QGLA 2JXAA 1XB9A 1XE8A 2HWC1 4JZRA 4DIQA 4YM3A 4IV3C 2DVDA 2VMGA 4DXTA 5BNPA 4DEVA 3EMRA 3WINE 2WAOA 2WT2A 3BU7A 3BYWA 1RYYA 1OA3A 2WR9A 4XXAA 4YLZA 3KQ4B 2VMFA 3EHKA 4QGNA 1VBD2 4TZDA 1KEXA 2HWE1 1R1A1 3HQUA 1UOGA 3FC0A 4GD4A 3M3CA 2WNVB 4CP0A 4E2GA 5ACA2 3OSDA 2G9GA 5FP7A 1KITA 2VMIA 2VCCA 3E5QA 5FQ0A 5HPOA 5JZGA 2ZZJA 1YRZA 1O3QA 4K9SA 3OEBA 2YC2A 4AI3A 4AVVA 4BK5A 1ENRA 1FOD3 1X33A 4BE3A 3WF3A 4FO9A 1LOCA 2QZ2A 5AVPA 5EXOA 1OXCA 2OXBA 3JD73 3DXUA 3H8UA 1J3PA 3N7MA 4QKBA 1PGL1 2A75A 4Y20B 2YPDA 3TN93 4RD7A 1AF9A 1N1YA 3D5OA 4HPKA 3AC0A 2P2KA 4JDMA 1E5HA 2PHLA 3BGAA 2DU0A 2YDEA 4Y26A 3THDA 4AQ2A 4BISA 1PMIA 1H6YA 4CDXB 4AI8A 4L2NA 3AZWA 4LHLA 1RUE1 3FFQA 3POEA 1K3IA 1EY2A 1NYWA 5E89A 1LHWA 5BNOC 5A7PA 2GDFA 1FOD2 2R49A 4Q0VA 1PK6A 1TME2 3ZYBA 2BVBA 2E9QA 5CKQA 4AVCA 4Y4RA 5BYNA 5TSWA 1W2TA 1WUVA 1AL23 4AEKA 2QQKA 5F6KA 3RGBA 2D5HA 4YW5A 3D0SA 3H1YA 1F5FA 2NLRA 4QM9A 3NJZA 1JXNA 4N7IA 4AHWA 2R042 2R072 2VBPA 3OF1A 3B69A 5LA9A 5T5JA 1GQPA 1GNYA 3T0BA 3DV8A 5L9RA 3WDUA 3OUIA 1O4TA 1DFQA 1UAIA 3S30A 5A7OA 2GP5A 4K6BA 5FPAA 3NJYA 1PGSA 4KG8A 1REEA 4B4PA 3ILFA 1XJAA 3I3EA 3LEMA 5GALA 3HBZA 3GZAA 3DN7A 3ITQA 5DZGA 1ND3A 3BOPA 3CHXA 1H6XA 4IE5A 5IVYA 1OQDA 2QDNA 2XDVA 2Y64A 5AC92 1RUD3 3PUHA 5FZ7A 5JSOA 3H8XA 5FP4A 2N7GA 4BXFA 3CBNA 3OJBA 3UJOA 1JMUB 1S0EA 1XOYA 2AENA 2HWF3 3H7JA 3MW4A 4QKFA 3UKVA 1W28A 1UCXA 2EAAA 4LBMA 1H8TC 1VPHA 2XQRA 3JBG1 2QFEA 4XHXA 4J1XA 2JG9C 3I2FA 4I0AA 4KU8A 1DZQA 2E31A 2RM22 4JGYC 2XR4A 1LKNA 2XJSA 2CDPA 2W08A 3LSEA 5KXEA 1BYHA 3MGUA 1FPN2 4DB5A 2VXJA 3CL1A 2B39A 1KXGA 1HRV1 4OCTA 3PDQA 1RUJ1 2ZHMA 4LO7A 3ECQA 4FFGA 4XJUA 3BTXA 3EB7A 1NZIA 3VGIA 1OD3A 1RMU2 1N1SA 3ORJA 4LOTA 4XHBA 1ALYA 5DZEA 2AEYA 3LPGA 3KSCA 4CDXC 4I0WB 4FPOB 4GWJA 5EJ3A 4MGTA 3K4ZA 1NZCA 4AI1A 2RM23 3AMNA 3I2DA 3TBDA 3SHRA 5IVEA 1K5MC 2X05A 2XMLA 5ACA1 3SNMA 1QJU1 3N3HA 4PI0A 4GZ9A 3WNPA 1GICA 5JIAA 4CDWB 2XUEA 2FDFA 5I0UA 4K1ZA 2WNUB 3WUCA 4CUBA 1GZ9A 1N3OA 3HNBM 4IEWA 4OUEA 2Z4FA 4AYUA 4QKDA 5K0UC 4KWKA 3Q8FA 3GHNA 4IESA 3RJRA 3V64A 4QXKA 3H3LA 4NAMA 5IYYA 3ZXAC 4D7SA 4UF0A 5F3CA 3KF3A 2EVXA 4A7YA 2QQIA 5A3NA 5CISA 2UURA 3DEMA 1LCLA 1NY72 4MYEA 4XFFA 5G04L 2E6VA 5H9PA 4Y1UA 5DUXA 4RSUA 1N1TA 5FZDA 3SLIA 1F31A 1F8VA 4ASKA 1BEV2 1WBFA 5F39A 2EAKA 2XLGA 3GGLA 4EWEA 2HWD1 2Q1ZB 4XDQA 2R0FA 5D8AA 2WFF2 4CDQB 3BIEA 2VC9A 1QQP1 3UETA 2VTXJ 1XYOA 5JOZA 3RZMA 3GCXA 1H1IA 3AZVA 3M3IA 3HBKA 4K1YA 4RHV3 1UNBA 5DDJ1 4AI2A 4CDWA 1V6JA 2ZGMA 3WHTA 4QQLA 3AYAA 5KXDA 1AR63 1FX5A 1UF2C 1UIJA 3B9IA 1G8WA 3LFMA 4NHYA 1JN2P 3ZPYA 4RQPA 2BU9A 4EN8B 3D8CA 1MPXA 1ZRDA 4XJ8A 4I3GA 1I3HA 2VPVA 4PI2A 4IE0A 4XILA 5IJRA 3KCYA 3KV4A 1HB2A 1J1LA 4N43B 3WF1A 3EO6A 1TEIA 2VAUA 4Q4V2 3VHOA 3B01A 3IT8A 1BCXA 4BIFA 2R32A 2V73A 4QGLA 3LQCA 3RWNA 4DO0A 1DZRA 5C3OA 2BRTA 4L92A 3KF5A 4XZUG 4KBBA 3MEPA 5C71A 1JOPA 3ELNA 5FZ8A 4A7ZA 4FPLA 4DXSA 2ES3A 4ZS2A 1QJEA 4QPGA 1YXWA 5G05L 1QJX3 4Q4W1 4NIGA 1HN1A 2TNFA 2A70A 3MIFA 3N35A 5DDJ3 5EQUA 4ZXKA 1BK1A 3P3NA 4M4PA 2IFWA 5IFTA 2BTVC 3NAPB 4LK7A 5JI9A 2VQTA 2WL1A 1OQ1A 5FYMA 1EV11 3WCSA 3E1F1 4R9CA 2LS6A 4BLJA 3V0AB 3PMSA 5ISLA 4COUA 3O1PA 3VBUB 4R9AA 5JLVA 2XLAA 4LBNA 2O8QA 4RQPB 2ADDA 3SEPA 1GR3A 1O59A 2FDGA 5FZOB 4D94A 2RDNA 2W46A 2Y6GA 3AVSA 1D0HA 1ZBA3 4XZPA 1JTZX 3T3YA 1DYKA 2KR2A 2VW1A 3U07A 4URAA 3BTZA 2CGOA 4IEOA 1WW5A 2RJKA 4A3ZA 2DU1A 1JODA 3I2GA 1RJ8A 5BNNA 2W39A 1UIKA 2VMHA 4IEVA 1DGRA 4KMQA 4Q4X3 3VBOC 4OHYA 2D6MA 2J1AA 5FXZA 1O4YA 3EXUA 1R1A2 4I3PA 2DCJA 2RS33 4QQOA 2E63A 4FBFA 2RV9A 4MLOA 5EZWA 1AR81 1XNKA 3D3AA 4OLLA 4P9YA 3ZYRA 2HWB3 2BNMA 3KZ4C 1Z7S2 2ZA9A 4FCAA 2Q30A 3HQRA 2YFUA 1HIXA 2FQPA 2JD9A 1UMHA 2SLIA 3J4UH 3I2HA 1W6MA 2XUMA 2VMEA 4NWWA 4P00B 1B35B 1CX4A 2OUHA 1EYBA 2J22A 3IWZA 3V0AA 4LE3A 1QF3A 1CJPA 5A6ZA 4PDWC 1RVF3 1IG3A 3I2KA 1W6OB 3GBFA 4Q4X2 5FZOA 1B09A 4IEXA 4OUSA 4FPKA 1VE0A 3K4DA 5JWPA 4LXLA 5C6CA 1N3QA 1OT5A 5D1IA 3RFRA 2K46A 5FLIA 3WQ1A 5LW9A 4MGYE 1BVP1 2NPIA 4H7MA 1FAYA 2D40A 1BEV3 5A1FA 4A6OA 3O1TA 1D2SA 5FUNA 4HG6B 2BBAA 3MV11 5FY8A 4LKSA 2W91A 3HNMA 4CDWC 3M70A 3ZPOA 1ZBE2 3MFAA 4GH4C 4N9IA 1W39A 4AGVA 2XJQA 2Y0IA 1RUNA 4ZHNA 3C7EA 3JB4C 4AEDC 1TVGA 1QH6A 4OI2A 1K45A 4YGDA 1PZ8A 4WZFA 4CCMA 2XJTA 3HWJA 1WMFA 4JGZC 1V6NA 2WA4A 1RUH3 3PVNA 3VHPA 2QE3A 2FZ2A 2VVFA 2UWAA 4LNVA 5IVFA 1TMF3 3F2ZA 5C8CA 3FLPA 2RS53 2BGPA 1SBFA 4UFHA 5JMOA 2VZSA 1Y43B 1NLRA 3ILNA 3K75B 1O6UA 5LBCA 4AXOA 4DXRA 4I0BA 4QWNA 1G9AA 5T5OA 4O9GA 5E6HA 3MIDA 4FFHA 4CP9A 1WW4A 2EXJA 2WABA 4YGBA 1SLLA 3VL9A 5IK4A 5I0RA 4LBOA 5L7OC 4OHWA 5KBFA 4N53C 1JYXA 3OYWA 4RS5B 4GALA 4LO6B 5FZEA 4LKFA 1O3TA 1U5YA 5F32A 4OFGA 1ZRIA 3JU9A 4P9LA 2PHWA 1G86A 1MEC3 2ZHLA 3APBA 4AE2A 1RUI3 4FTEA 1RUJ2 1ZX5A 2CNAA 3F95A 5F3EA 5FZMA 2VZPA 2DTWA 3GDBA 1IHMA 1MS8A 4FXKB 5DAPA 3MW2A 4HFSA 3ZSEA 3SKVA 5ABJA 1JZ6A 1R091 4JVAA 4P9GA 2R30A 3E6BA 3LEKA 4FPHA 4NPLA 4W6WA 3DKWA 1YEWA 2E7AA 3LEGA 1VBD3 3T1MA 2P1BA 5JR7B 1LRHA 1UWWA 2YC4A 2NQYA 1SBEA 4QGMA 4E8CA 1RITA 3FN9A 2GZWA 4Q4W2 1E5RA 1LOGA 4F8AA 4CXWA 4QQ2A 2K0GA 2VO5A 3PUSA 1H2NA 1RUI2 4M01A 5K8SA 2C6SA 1CIYA 2W5FA 5T54A 4Y24A 2WN2A 4CP9B 1KGYA 5CFCA 3LIGA 5JOYA 3UNPA 2XJPA 5LBFA 1UMIA 5GZFA 2BEOA 3PTYA 2WQ8A 1FPN3 3J7LA 2ZX2A 5IUQA 3V56A 3ZSLA 3UESA 3USUA 1UZ0A 2B5HA 3ME2A 4Y20A 2ZZQA 3VBSC 3HJRA 4DY3A 4NE9A 3HMYA 3NMBA 4PQ9A 1TME1 4XF4A 2DDUA 2WO2A 3ZFEB 3NAPC 1RXGA 4RR3A 3QACA 2QQLA 3DYMA 3H7YA 4FPCA 4XFCA 2ENRA 2RS13 3ZDSA 2ZEZA 5C3RA 2FCVA 2CL2A 1X36A 2C24A 3I3DA 4B1LA 4FP3A 4TN7A 4PCRA 1OKOA 3GBWA 3ZXKA 4COYA 2LRPA 4QX2A 3OBAA 2A3WA 1J83A 3FBYA 5A33B 1NQJA 2CWSA 5JPNB 4OHZA 2IVJA 1ND2A 4GMP1 5FZGA 1F35A 2WS91 3IDBB 4WM8B 3WDXA 4LHKA 2DBNA 4XEZA 2FD8A 3AXEA 3KT1A 1GQGA 3THTA 4AVBA 3RWKX 1AX2A 3CMGA 2QQWA 1RUF3 5EP9A 5FP9A 4CE8A 4ISQA 1J59A 4L8QA 2ORZA 4FFIA 4IGPA 1XE0A 3N7JA 1JHJA 4B3NA 4ATEA 2BOJA 2P6CA 5FOBB 4CCDA 2D3SA 1LEDA 3LEIA 4D6SA 3LPFA 4WM7B 5FPXA 1POV1 2QDRA 1V0AA 2RS31 4SBVA 2XJUA 1W8TA 1L3JA 5JZGC 2H6BA 1RINA 3I49A 1MZEA 3OY8A 4KG0A 4HKOA 1RMU1 5DXDA 4RYDA 4A6SA 1CESA 5LWBA 3TEXA 5BNQA 4QQPA 3U4SA 1MZFA 1J84A 1LOEA 1SLTA 1W03A 2PA7A 4Q8LA 5FXXA 2K9ZA 2FMDA 3PJYA 1V6LA 2VW0A 4AHZA 4BHPA 4E27A 3ZN5A 4EV0A 1SMVA 3TNPB 5FYCA 1ZBA1 3ZFGC 3A23A 3OBRA 4BQYA 4MGSA 2ZAHA 3GNEA 1FV2A 1O7FA 1XU1A 2XBO1 2ZX4A 3PVBB 5CB7A 2F17A 1VBC2 3AKQA 1XNCA 3FX3A 4ATFA 1VMFA 1QJU2 3MF9A 3N9QA 4Q4V3 3SCGA 3TAYA 4AVTA 2ZGKA 4YGCA 1ULOA 1W6QB 2E7QA 3WCRA 4D0QA 4YVWC 4LUMA 4NHLA 2VOXA 2XQXA 2EIEA 3MPBA 3ZIXA 3B7MA 3BPSA 1IQAA 4XUOA 4TXWA 2RHPA 1C1FA 1PO21 3ZYIB 2ZGPA 2E53A 3BODA 4W6YA 3C8XA 4WM7A 4XCBA 1QXRA 2XL9A 3RRDA 3NO8A 4NUBA 2UYAA 2VD7A 4JHTA 4YVSC 4D8MA 5J09A 2ATFA 1MZ5A 1US3A 1NOVA 1S0FA 1OLMA 4IV1B 2RS12 3FBMA 4Q4Y3 3MIGA 1PNGA 3W58A 1FNYA 1OH3A 1W99A 1MACA 4LBQD 4GWIA 5FPBA 2VOKA 4META 4DUXA 1NE6A 2ZMKA 2RVAA 4LMFA 3J7HA 2WKKA 4G4FA 3FHQA 1JU4A 5T5LA 3ZFFB 4AI0A 2WNVA 2C0ZA 4CTEA 4R9DA 4SLIA 1QXJA 2JKXA 3OUJA 5T50A 1EAH3 3KT4A 3LD8A 4CEYC 4QX7A 4XJZA 4JAAA 1MQTB 1ST8A 1CD3G 4RL7A 1FT9A 2D3PA 1DQ4A 4RHV1 1WMEA 2XB6C 2QQMA 4ZZ8A 1DLCA 3GXUA 3VBHC 5CG8A 2WWJA 5FZ1A 4K20A 3IB3A 4AF9A 2WS93 1CAVB 4R4XA 3BB6A 1NXMA 2ZEWA 5F2WA 2GMPA 2JB4A 1HRV2 4L9BA 4A7KA 3AX4A 1VB2A 5CKMA 2JIGA 5FO8B 2BW8A 3FZ3A 1UU5A 1QJY1 2IXKA 1VB4A 4KI5M 4KWUA 3MPPG 4CDXA 5EYXA 4E8DA 4XF9A 4U36A 4MV2A 5FZIA 1UL9A 5FWJA 4J25A 3JBG3 4A45A 2FHRA 4BPZA 5FMOS 3TB0A 1G9DA 2ET1A 1PK6B 3IKWA 5FP8A 3IIIA 4OI0A 4HVQA 4ET7A 2HWF1 4Z07A 3T2TA 1HV0A 1BXHA 1GNHA 4R9BA 1CZVA 2D6PA 3FLTA 4BB3A 3AM2A 1WLDA 2AUYA 2W87A 3RS6A 3I3MA 2DCKA 1UPSA 2FDIA 1WBLA 1PIV1 4JGZA 2R1DA 2X8KA 2GAUA 2XHKA 1UMZA 1MS0A 4DPNA 4QPGC 1FPN1 2R043 5D2AA 1C28A 2XJVA 4M0HA 4MH0E 3NAPA 4HLTA 3WDTA 3IN9A 2YHJA 4C1XA 3J9SA 4M00A 3DUIA 3DECA 2G1MA 1O8PA 1SZBA 1AYN1 5EYYA 1C5HA 3K77A 2BBVA 1ZM1A 3VLBB 4P9IA 1FMD2 2D6OX 3DGTA 2WLPA 4TWTA 1DP0A 3AP5A 1GOGA 4PF5A 3T2QA 4D69A 3ZMOA 1OPMA 1EP0A 1XNTA 2WT1A 3HN3A 3LKJA 3MDPA 3OGJA 2GNTA 5CVRA 3ACGA 4Z2AA 3LFIA 5AC91 4XCAA 1WKYA 4Q8KA 3AB0A 1MS3A 1HRI1 3P5BA 2YBSA 2YUEA 3KQRA 5J7MA 2EXIA 5FZBA 1O8SA 1A78A 4IEYA 5FV3A 5GM0A 3WG4A 1QH7A 3HOBA 3POIA 1W6NB 2XWJB 1HRI3 3H3UA 2EXHA 4C90A 3WNLA 1HQWA 2A6ZA 4QT6A 1JHNA 4Q0QA 4KL1A 5E1RA 3NJXA 3PUAA 5IK7A 4LEJA 4X8PA 4E2QA 1M06G 1OLRA 3QH6A 3ZYGA 1T2XA 1ODMA 1RUD1 2HJIA 3ZIWA 4MXWB 1Y9GA 1LGBA 4I2OA 1WA4A 2WO1A 1WCSA 4OYUA 4UFMA 4Q4Y2 1T6GC 3N7KA 1VALA 3PL0A 1POV0 3UT0A 1AXZA 3UKNA 4PF1A 2Q4SA 1PM4A 1TZOA 2XJRA 4GA9A 3WG1A 1JZ4A 3HR9A 1N1VA 2ARXA 5LY2A 2J1RA 3ZXEA 4FQ4A 2Y26A 3AP9A 2JG8A 4H3WA 5F5QA 1WMDA 3CLPA 2QBXA 2WYFA 3GM8A 2W52A 2ZGSA 4AOCA 5KXBA 4NHXA 3RJ2X 2HEVF 4QX8A 2RE9A 4B1MA 1JH5A 1AZDA 2D6KA 2RDRA 3ACHA 3I7DA 4UFJA 1XSQA 2JD4A 4YZ4A 3S7EA 2AEZA 3E5UA 3PIJA 2UYBA 2YZ4A 4OHXA 2X10A 1D7PM 4RA0A 4MUVA 1OVSA 1SLBA 1AUYA 2XG3A 4IXLA 5BV6A 1LJ7A 2QVSB 1LU1A 1HXS2 3S5QA 1PHMA 1WCKA 1JU3A 3A21A 2BFUS 3BOWA 3Q9OA 3WDWA 5FJHA 3TOJA 3CNAA 3VDCA 2ZHKA 3NNLA 4J1WA 3LAGA 2O0OA 1XYPA 1SG3A 5LA2A 4YYOA 2WFF3 1Y3TA 1X7NA 2DVBA 2P37A 3HIFA 3SISA 3W59A 5CAZA 2RMU1 1SDWA 1ZA7A 3SCHA 2V4AA 3AP7A 1HB3A 2KXLA 1RVF1 2CAUA 4LTAA 2WZPP 3VBSA 3R05A 1V70A 2BWAA 3GF6A 3M4FA 4WBBA 1Z78A 3AYDA 4XBNA 3MBWA 1C8M1 3AMPA 3POGA 2RR12 4GJYA 1PX3A 1W9FA 4YVSA 3N9OA 4YRDA 1GNZA 2JDNA 2X5IA 3PTRB 4CDUA 4KNCA 1PO12 1VRH1 2QQNA 3E97A 1D4M1 5FPUA 4PIXA 1JZ3A 3W20A 3ZN6B 4YARA 4OMCA 3VZNA 2OIIA 3H8OA 1DU3D 1WLCA 4LE4A 1QWRA 4DQAA 4Q5OA 4NRPA 3VKOA 4Y5Z0 2VUJA 3N4MA 1WMXA 2JENA 2I2SA 3B3QE 2ZJCA 5EJ1B 1JBCA 1FMD3 2Z69A 1MZ6A 4GIQA 4YW2A 4AL9A 2W3JA 5LB6A 4CUCA 2PHFA 1R64A 3AKRA 4JKMA 1AL0G 5GZGA 3CF6E 3O1RA 1UPIA 1S0CA 3RSJA 1Y9QA 3O1OA 3RZHA 1ENQA 4FFFA 3PUQA 5J1XA 4AQSA 2WSVA 3MUY1 1VJ2A 3PU8A 1JYIA 2IWGB 3AZZA 2AR6A 1W6PB 4LA3A 4UWDA 2WIIB 1VR3A 3VBUA 1DLLA 1OOPC 3AMMA 4IV1C 4Y22A 1VBA2 4AGRA 2O14A 2V5YA 3SH5A 1OQEA 5C4WA 4LIVA 4YVSB 4FI9A 2P3YA 3ZXJA 4CCLA 1RUD2 3C3VA 3R4DB 1RB8G 1LULA 1FNZA 3WW4A 5FY4A 4Q27A 4Q0PA 1ZZ9A 4BXSV 2BZDA 1YFUA 4KGQA 5A70A 2RS11 1CGPA 4PBPA 4Y1XA 2WZR1 3MLLA 3I54A 4TTGA 3WHUA 4PLNA 3K51A 3S7IA 1QXPA 1YQ8A 1CVNA 3CZUA 3N9PA 1O91A 2LUWA 2GC2A 1CAWA 1V6OA 2GNBA 5H9RA 4EE2A 4HXCA 5LZ6A 4LITA 5D21A 3OBZA 3V0BA 4QU2A 2ETEA 4AHXA 4ARYA 1AVBA 2EICA 2HWB2 5F37A 3CO2A 3VZJA 5FZHA 1SBDA 1SLAA 2MEV1 2ZMNA 4AEDA 2JE7A 5FMCA 1HW5A 3LB9A 1WW7A 3I4IA 1W6MB 2VUCA 5F5IA 1B35A 2DUPA 5A33A 3WZ1A 4CUAA 5KHJA 4H14A 4DFSA 1XQNA 1ND2B 2D3RA 3B9CA 4OZXA 1PVXA 1U5XA 4I30A 3ZYFA 1YYNA 5FPVA 4AHYA 4QX5A 1RUE2 2DBIA 4LULA 3H9AA 4DY5A 1V9U1 1O3RA 1UQXA 2OX0A 2IVIB 3QH7A 5FZKA 4CVUA 4HN1A 1HN0A 1YWKA 3I59A 5FZLA 1DYPA 5H9QA 4NAOA 4LKEA 1H8TA 5C33A 1IGOA 1ZZ8A 5I8TA 4F83A 1V6MA 1NCQC 3ZSMA 2CU5A 1CAWB 3IAQA 2VE1A 5KC5A 4OHVA 4Q2FA 2HBUA 4C8DA 3FUOA 5FIXA 4KQ7A 2XHNA 2D6NA 3KVAA 4IETA 5I93A 1UW8A 2XBO2 2FCTA 2SBAA 2MHFA 3WDYA 1M4WA 2HH9A 4XAAA 3U78A 3AL5A 1YJLA 2ORXA 4XETA 1RUH2 3OB8A 3AKSA 1S2BA 4NO4A 4NIHA 3USSA 4CU8A 2ZX0A 4E4SA 5C8CB 1ZRCA 2BNOA 1DQ0A 1V6IA 5JAXA 2ARBA 1YCIA 3TEZA 2A6VA 1QHDA 2W1QA 5LASA 1IS4A 1GWMA 4NROA 1VBA3 2GNMA 4XF0A 2XWBB 3SH3A 1UO9A 1AJKA 3OUHA 4CZSA 2J1SA 4O7XA 1E5IA 1QOOA 1MS5A 4LO4B 2WNOA 3OYWB 4RS5A 4LPLA 2V72A 4M3CA 4YWAA 5I8SA 3UJQA 4BZ4A 4CCKA 4XUQA 1VMHA 2ZGTA 4MVTA 3VD4A 3QBQA 2D5FA 2EA7A 1ZVFA 2YMZA 4GKXA 2OS2A 4QM8A 5CYYA 1CQ9A 5L19A 1QIQA 4YW6A 1X50A 1NA1C 1H2KA 1JS9A 2E51A 1SFPA 5DUVA 1ZA4A 3E5XA 3PUIA 3HD8B 4QXBA 3NRUA 5BUVA 1TNRA 3ZFFA 5FYVA 5C8CC 4NPMA 2EIDA 2D43A 4OVEA 2Q8OA 1IOAA 3S6PA 3VBFC 4YZ2A 5FFOC 3KWVA 2G19A 2QUOA 5FK8A 2DUOA 4EJRA 1X8EA 1NCRC 3FMGA 4TYSA 3K48A 4CA9A 4UW4A 3A0KA 1IS6A 3KS7A 3U14A 4DNYA 3O1MA 1OD5A 1JZ2A 2RS51 4M3CB 2BPA2 1AXYA 1TMF1 4XFHA 3GZTB 5FP3A 4ES9A 3FHIB 3I3QA 1I5ZA 2R6QA 3JQWA 4N53B 4RS5C 3IIAA 5FY7A 4QDSA 1ZBA2 4UFIA 2NM1A 2NMNA 3POYA 5L7OB 3AZYA 3ZO0B 5EIYB 1HLCA 3NNMA 5DG2A 3VKLA 1MQTC 4JRLA 1DGWX 4RR3B 5DABA 3WVJA 5HI0A 4LK6A 1N47A 2BUKA 4XXPA 4Y1YA 4EN6B 5C5TA 3WG3A 4YM1A 3FUQA 1GZCA 4CP2A 2VCAA 3CJIB 5LEJA 2DTYA 1NLSA 4HZFA 3UV9A 4ZZ5A 5HBAA 4Q26A 5CADA 2JDUA 5B4XA 1KD7A 3JD72 2PQQA 1BHGA 1SHWB 4AQTA 1TE1B 1RGSA 4JGZB 1IKQA 3PVEA 1RUOA 5I91A 1GZWA 2LALA 1E5SA 3D0JA 3IM0A 4AFAA 4OZOA 2GMMA 4PQQA 5A7NA 1W9TA 3IPVB 3PJQA 5CIRA 2WQZC 5DZFA 5HXMA 1EUTA 1GV9A 2GC1A 1FI2A 1FYUA 1SFYA 3LA2A 3POBA 1UY2A 5FZ0A 3KGLA 3MFCA 5SV5A 2QQPA 1K5MA 1LNSA 1PVC3 2OW4A 4YVWB 3VHRA 2GSYA 2R073 3E6CC 1VBE1 3AP4A 1W90A 2C4XA 5FUIA 1LHOA 4JDNA 3KHCA 1CAXA 3OPZA 2VR4A 5BXXA 2CSGA 5ANNA 4QHBA 2QTWB 2JDPA 3VBFA 1UX7A 1AR82 1GP5A 2GMEA 5HCHA 4MX3A 4GXLA 1F5JA 3LDKA 4CCCA 4PDWB 2WBKA 1KRIA 1W6NA 2O1QA 2HWC2 4EN9B 1B35C 2BGOA 1JOJA 3L2YA 5GZCA 2JDAA 1ZZ6A 2I07B 5LEKA 1CPNA 1ULFA 3NL1A 4FSJA 1PMHX 3BVCA 4ONUA 1C4RA 5C3SA 1XU2A 1RUC1 5BNPC 1SLCA 3W9AA 1UKRA 3B02A 5F5AA 5FYSA 2ILMA 1VBC3 4NHKA 4IEQA 3J8F1 4PIYA 4A3XA 4CCJA 2VQ0A 1W6QA 3OD0A 1ACCA 1YJKA 3CJXA 4LORA 4XACA 3PNAA 1Y7BA 2Q8CA 5JDBA 5FKBA 5B2GB 3H50A 5LCWL 4CXXA 5JSPA 2R041 3ZSKA 3VKNA 1SDDB 3GALA 1XYNA 4B7KA 4ZPIA 2VOWA 4QB6A 1CAXB 4EWDA 1C8M2 2PYTA 1IPJA 2RR11 2Y6LA 1QJX1 4YPJA 2OYZA 4CPBD 1RXFA 5IVJA 2DCZA 2VZ3A 1RL3A 2Y6JA 2QKDA 2Y60A 4WVMA 2P34A 2AC1A 2RJ2A 4XW3A 3VD5A 3AP6A 2IXCA 4GWMA 3EYPA 3JXSA 3VBUC 2PN5A 1AR71 2ZGQA 4Z1VA 4HK8A 4CSWA 4MG2A 4LBKA 5C8WA 2JICA 4FQZA 5F5CA 3U37A 1AX0A 1ZZBA 4I01A 1C1LA 3KVBA 1NUKA 1W2UA 1ENXA 4IEUA 1AYM2 2ZACA 2AACA 4BDVB 2DYCA 4FTBA 3TRSB 3W5MA 5LRSA 3MUZ1 4V1PA 4PLMA 1BQPA 2RM21 5BY5A 3UKTA 3DXTA 3LCPA 5JXJA 4NIAA 3QCWA 1OLQA 5GLZA 1OBNA 2C26A 4YW4A 3R6SA 3ILRA 2YY1A 5FZAA 2E33A 3WP4A 3W5NA 1NG0A 4MGKE 1MR5A 4OQ8A 2G9ZA 1ULDA 1SACA 2PHTA 4ZU5A 5GZDA 4C1WA 2VNOA 3ASIA 1UU6A 1ZZCA 5DG1A 3H8RA 1AR93 1CPMA 1LAJA 2MNGA 4QX3A 4Y1ZA 5GLTA 4OI1A 1LOAA 5HV0A 3R4UA 4LO5B 3E6DA 4HONA 1R083 3RPQA 2B46X 3UK9A 5AVAA 1W0PA 5A6XA 5IT6A 5JVVA 4HKLA 3EJKA 2WO3A 1VAVA 1A34A 1VP6A 1SFNA 5IVCA 2ZGLA 3CZJA 1GOHA 3O0WA 5BNNB 4OMDA 3M3EA 3KB5A 1VBE3 4M3CE 2WJSA 3HQXA 5FPLA 5T52A 3HEIA 4LBJA 4KBZA 4YNIA 3DYPA 4AGGA 1GZTA 4GULA 1YQ2A 4XVHA 2DV9A 5B4NA 3MIBA 5J36A 2JKBA 2VMDA 3VHNA 4BQXA 2VBDA 3KV6A 4N9HA 1RIRA 2PXJA 3U0ZA 5A32B 3GZUC 2DFCA 2HWF2 3N9MA 2LW8A 1LESA 2YBKA 3INAA 3WXPA 4B29A 4NPRA 2W92A 4P5HA 5A7QA 4WV8A 5A7SA 2YYOA 1LB2A 1W05A 4DOUA 1OVPA 2X53S 3RMYA 4AZZA 4BQ1A 3VBRA 1W2AX 1BKZA 4ZU4A 1EV12 3AZXA 3T0AA 2R7EB 4Q4V1 3ZKUA 2PELA 3ZYJB 4MSVA 1W6OA 4ZY9A 4CCEA 1HKDA 2ZKNA 3KHBA 4LJHA 3WD5A 4CCOA 5IK8A 1I9RA 3HPNA 3T09A 5C4WB 1PZ7A 2XBO3 2JEMA 3GCWA 4BM8A 5C4WC 2DCYA 2JG9A 4CRQA 4Q1PA 5LY1A 1VRBA 3FE5A 1YFYA 2A73B 4CEWA 1FMD1 4AG4A 2VGDA 1LEMA 1JYWA 1RUJ3 2BV4A 5DDJ2 3J7MA 5DUWA 1WCDJ 1POV3 2R16A 3I97A 3V0BB 4HANA 1Q8PA 5IW0A 3V65A 4XMIA 4UW6A 1MEC1 4B8EA 1LU2A 5KWRA 4AEDB 4DMIA 4JTOA 5C3PA 3DF0A 1ASJ1 1H1MA 1YNAA 2Y6FA 2C9AA 2G9FA 3GZEA 4FPGA 3VZMA 1F9KA 5FYIA 4H55A 3POSA 3MV01 3GJAA 4YG3A 5FY0A 1JUHA 3VZOA 2WZEA 1DF0A 1U0AA 2X09A 4MXWA 5A7WA 4PBOA 4DRRA 4PJYA 4Y5SA 4DUWA 4FPYA 4P08A 2WT0A 1Q8VA 2X5IC 5CZKA 4NIDA 3RYRA 1XNAA 2VNGA 2CYFA 3HN1A 2YBPA 4JGYB 3WW2A 5A3OA 2JG9B 2HWD2 3G7DA 5F6LB 1EPZA 4BYYA 1VBD1 3ZXDA 3CDZB 4AFDA 5LA1A 2Z2SB 2UY9A 5BNOA 1YHFA 2MPFA 2E32A 2WSUA 1H8TB 1KDMA 3U10A 4BWOA 4BLIA 1GP4A 1V6KA 5IVBA 1QNYA 5L9VA 4FP2A 1JZ5A 1NCQA 4LBQB 3WNMA 4H2AA 2P6HA 2VNVA 1ULPA 4XTMA 2FMYA 3O0VA 1ODNA 1ZBE1 3ES1A 3VD7A 3SH4A 1RUF2 3ZSJA 1KFXL 1O5UA 1HXS3 2IZWA 1BZWA 4NRMA 5KHHA 1F15A 5C9AA 1URXA 5ABJB 3C7GA 1BLZA 2VM9A 2C9KA 1AYM1 1F4HA 2HWE2 4CPBA 3MW3A 4JQRA 5F7UA 1COV3 4P9JA 1OC1A 1Q56A 3OD4A 4Z82A 5A3MA 1PGW1 5KC6A 4AFMA 4OQ9A 3MIHA 4LHSA 3ZFFC 3M2MA 1ULGA 3POFA 4ASLA 2VECA 5I0TA 4FAHA 2PTMA 4ZU7A 1DQ6A 2QNKA 1L7QA 1FOD1 2D7FA 1VBE2 1LHNA 3AXDA 2RMU2 1HQNA 4IW3A 3NKGA 4UW5A 1XXNA 3IDAA 2ZEXA 1QOTA 3B94A 4C0HA 4RQPC 3VZLA 3T4VA 3KCCA 1ASJ3 1PZ9A 1NCQB 1GLHA 3RNSA 3NNGA 3KLSA 3USUB 2R063 1ZREA 2WWSA 1COV1 1A8DA 2VUDA 1R093 4AEMA 2PAEA 1ENSA 4XDPA 3WQ0A 1CR7A 5BNPB 4CU6A 1DZTA 2VQAA 2ZGOA 4UFKA 2JWPA 3A7QA 2B7YA 2BP6A 3T2OA 3NKTA 1RUC2 2R061 4YM2A 2XONA 4COWA 2D6LX 5AC93 1RTVA 2Z42A 2A3XA 4E4ZA 5SV8A 1JOBA 4GJZA 4P5YA 1AXKA 4QQHA 1IKPA 2ZKLA 1IS3A 1RUG2 1V9U3 1RHI3 3P3PA 4FOVA 3S57A 4I02A 2W68A 4WVVA 3ZFGB 4XIOA 4M0NA 1YIFA 2MEV2 4K7JA 2PLV2 3GBGA 3AMQA 3GJBA 2OKXA 3RG0A 5ERLA 4W4ZA 2J1TA 3WNKA 1OF4A 4UOJA 4KGGA 1SLIA 2JJ6A 4IV3B 3ST7A 5I0SA 2H6CA 2Y0OA 3Q8CA 1QJY2 4Q0UA 4LQRA 3O14A 4O65A 1U5ZA 1LENA 1RUG3 1V9U2 2CWMA 3PMEA 1Q8OA 5LATA 4F3JA 3AL6A 1W8FA 4CDQC 1WD3A 3VD3A 5J3UA 1GBGA 4DRVA 2HBTA 5LK5A 4DEQA 5JOXA 4YGEA 2DVAA 4XQDA 3A0NA 4XBQA 1UY4A 4L11A 5DUUA 3KV5A 1CAUB 3LWCA 5F1RA 1D2QA 4K21A 1UY1A 4YG6A 2NYYA 5I8YA 3ZFGA 4GKYA 4WM8C 3JUUA 1MS9A 2CV6A 1ZYBA 3FFZA 4FPFA 2J1EA 2OZJA 3CJIC 4XMAA 5BPXA 1QJFA 5C5UA 1HV1A 4RGAA 4AFBA 1NLQA 4IE7A 3ACLA 2D44A 2DVFA 3J7NA 3ZXFA 5ABJC 3RYKA 4F7ZA 2PAKA 1OFSA 4NOTA 3MZHA 1DBNA 3IMNA 3H42B 3THCA 1PGW2 2VZUA 1VMJA 4P02B 4UAPA 4D7TA 1YFWA 4NHMA 1K5MB 3ZFEC 2YU1A 2JE8A 4BQ2A 1LTEA 4MHUA 1KS5A 4ES8A 1NCRB
chains in the Genus database with same CATH topology
3HNMA 2KD7A 1GU3A 2VZTA 2VZ1A 1W0NA 4QB2A 2XHNA 2VQUA 3C7EA 1UY3A 2VZQA 1TVGA 4QX1A 1K45A 2ORXA 4MO3M 3OB8A 4QX0A 2WYSA 2EIBA 4CU8A 3ETPA 1UYYA 2Y8KA 3WF4A 3WQBA 3VD9A 2VMCA 3F2ZA 1W8OA 1W9WA 2BGPA 2W1QA 5JMOA 2VZSA 3K75B 1W9SA 4DXRA 2V5DA 3ABZA 1NAEA 2J1SA 2WABA 2W94A 2CDOA 5JUVA 4ZXEA 4LPLA 2V72A 1JYXA 4XUQA 3VD4A 4JHZA 4M4RA 2VZPA 3GDBA 5CYYA 3SKVA 1JZ6A 1W8NA 1EUUA 3LEKA 3LEGA 3PUIA 3NRUA 3LE0A 1UWWA 2YC4A 3ZM8A 3VDAA 3OG2A 3FN9A 2EIDA 1OH4A 1UYXA 2VO5A 2Y6HA 2ZEYA 1CIYA 2W5FA 2WN2A 3MO4A 1KGYA 1L7RA 2XOMA 4XUPA 3UNPA 1UMIA 1JZ2A 2WQ8A 2HLEA 3OGSA 3UESA 1UZ0A 5EJZB 2WUHA 3HJRA 4QDSA 5EIYB 4A41A 2DDUA 2WO2A 1JZ8A 2QQLA 2VCBA 3DYMA 1PX4A 1XPWA 4A44A 2VCAA 2VOTA 1P8JA 1TG7A 2ZEZA 4ZZ5A 4W8JA 2WAAA 4W50A 5B4XA 2ZXQA 1GUIA 3I2JA 1BHGA 1SHWB 3I3DA 4QB1A 4QX2A 3WF0A 5A1AA 3OBAA 1J83A 3WEZA 2BERA 4OZOA 4PQQA 1UXXX 1W9TA 3DYOA 2W1UA 3CMGA 5HXMA 2YB7A 1EUTA 1JYVA 4QDRA 5IFPA 2ORZA 3C7FA 1UY2A 1LNSA 1JHJA 1XC6A 2C4XA 5FUIA 3WF2A 4IUGA 1UXZA 2VR4A 1US2A 3T2PA 3LEIA 4AAXA 2B9VA 3LPFA 1UX7A 3NJVA 2WBKA 4RYDA 1J84A 2BGOA 2JDAA 1PMHX 3A23A 4JX0A 4MGSA 2W95A 3CIHA 3C7OA 4XUNA 5JXHA 4QDQA 5IHRA 1ULOA 4D0QA 5LCWL 4MGQA 2XQXA 2EIEA 1SDDB 2PQSA 2YFZA 3K46A 5JXGA 4QB6A 3T0DA 3CKHA 4XUOA 4TXWA 2QQJA 5DPNA 4YPJA 2Y6LA 2VZRA 3IAPA 2VZ3A 2Y6JA 3C8XA 4UI9L 3CQOA 2RJ2A 3VD5A 3K4AA 4D8MA 3OEAA 4JKKA 4CU9A 1US3A 3EYPA 3ACFA 3JXSA 3SKJE 4DXTA 5JR2A 4DEVA 2WAOA 3U37A 1RYYA 1PMJX 1W99A 4PT6A 2VMFA 4GWIA 1NUKA 4DUXA 1JYNA 1KEXA 2RVAA 3J7HA 4BDVB 3FHQA 1JU4A 3W5MA 3MUZ1 1UY0A 5JXJA 2J1UA 2JKXA 3BN6A 2VCCA 5HPOA 2C26A 2E26A 4ARXA 3WSOA 3OEBA 2E33A 3W5NA 2YC2A 4BK5A 2QQMA 4ZZ8A 1DLCA 3GXUA 4L0PA 3IB3A 3WF3A 2ZEWA 4QX3A 1K12A 3AC0A 4KI5M 4KWUA 3BGAA 3THDA 2WO3A 1H6YA 4E8DA 5C70A 1IQDC 2VTFA 3CZJA 1GOHA 4A45A 1K3IA 4OMDA 4A42A 4A4AA 2VZVA 3HEIA 3IIIA 3C7HA 4ET7A 3DYPA 4MADA 4XVHA 1YQ2A 5B4NA 1CZVA 3T08A 2VMDA 3A22A 2J7MA 2L9LA 2W87A 2YG0A 2DCKA 2QQKA 2LW8A 4QPWA 3T0BA 1GQPA 1GNYA 2W92A 3P6BA 4DUVA 3FHAA 2B4KA 3T0AA 2R7EB 3DECA 3I3EA 4ZY9A 1O8PA 3WNOA 1GMMA 1H6XA 3HPNA 3K77A 3T09A 2Y64A 1NX9A 3PUHA 3HNYM 1DP0A 1GOGA 3T2QA 2VL4A 4E8CA 1XNTA 3HN3A 3ACGA 4Z2AA 5JXIA 2QQOA 4AG4A 1WKYA 1JYWA 3P1IA 1O8SA 3I2FA 3I97A 2E31A 2CDPA 4BJ0A 2HYXA 3HOBA 1K42A 3WNLA 3ECQA 3NJXA 2J1VA 3MV01 3EB7A 1OD3A 2WZEA 1T2XA 2X09A 3LPGA 4DUWA 4P08A 3FL7A 4GWJA 2WO1A 5CZKA 4OYUA 3K4ZA 1XNAA 4PF1A 2X05A 3CDZB 5LA1A 4GZ9A 4XURA 1JZ4A 2E32A 3WNPA 2J1RA 1NKGA 1F4AA 4CUBA 3HNBM 4OUEA 2Z4FA 2QBXA 2VZOA 3GM8A 1JZ5A 3WNMA 1ULPA 3ACHA 5IYYA 3VD7A 2QQIA 2X10A 1D7PM 5G04L 3C7GA 1JU3A 3A21A 2VM9A 2C9KA 1F4HA 3VDCA 5DQ0A 5F7UA 4CU7A 5LA2A 1SG3A 3GGLA 4LHSA 4RN5A 2VC9A 3UETA 1L7QA 1OF3A 5C7GA 1WCQA 5DMYA 3IDAA 1GOFA 2ZEXA 4QAWA 3MBWA 1PX3A 1MPXA 3NNGA 3WF1A 5IJRA 1DYOA 4JKLA 2V4VA 2QQNA 1JZ3A 4OMCA 4CU6A 3A7QA 3LQCA 3T2OA 5EJ1B 4XZUG 2XONA 4CUCA 2W3JA 4XUTA 5C71A 1R64A 4P5YA 4JKMA 4DXSA 5G05L 5J1XA 1JZ7A 3MUY1 1HN1A 4M4PA 2VJXA 5IFTA 2W1WA 5LA0A 2OKXA 3ACIA 2VQTA 4W4ZA 2J1TA 3WNKA 1OF4A 4UOJA 3E1F1 2LS6A 2Y6KA 3SEPA 2WDBA 1O59A 4FI9A 4BK4A 3WNNA 2W46A 2Y6GA 3I2IA 2W1SA 4LQRA 2WN3A 3VDBA 4BXSV 2BZDA 5DN2A 1UYZA 1JI6A 4TTGA 4A3ZA 2W47A 3I2GA 3VD3A 3CZUA 3OGVA 4DEQA 3OGRA 4KMQA 4MOAA 2J1AA 1UY4A 2DCJA 2EICA 4ARYA 3I3BA 2RV9A 3D3AA 1UY1A 3SEEA 2WZ8A 1CZTA 1CX1A 2J1EA 1CZSA 5I0DA 2YFUA 2JD9A 1UMHA 2W9XA 4CUAA 3I2HA 4P00B 2VMEA 2J22A 3I2KA 1I5PA 3NQHA 4CVUA 3K4DA 3THCA 2ID4A 2VZUA 4P02B 4UAPA 1OT5A 2JE8A 4A6OA 4HG6B 3IAQA 2BBAA 3MV11 4LKSA 2W91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNM A;  2KD7 A;  1GU3 A;  2VZT A;  2VZ1 A;  1W0N A;  4QB2 A;  2XHN A;  2VQU A;  3C7E A;  1UY3 A;  2VZQ A;  1TVG A;  4QX1 A;  1K45 A;  2ORX A;  4MO3 M;  3OB8 A;  4QX0 A;  2WYS A;  2EIB A;  4CU8 A;  3ETP A;  1UYY A;  2Y8K A;  3WF4 A;  3WQB A;  3VD9 A;  2VMC A;  3F2Z A;  1W8O A;  1W9W A;  2BGP A;  2W1Q A;  5JMO A;  2VZS A;  3K75 B;  1W9S A;  4DXR A;  2V5D A;  3ABZ A;  1NAE A;  2J1S A;  2WAB A;  2W94 A;  2CDO A;  5JUV A;  4ZXE A;  4LPL A;  2V72 A;  1JYX A;  4XUQ A;  3VD4 A;  4JHZ A;  4M4R A;  2VZP A;  3GDB A;  5CYY A;  3SKV A;  1JZ6 A;  1W8N A;  1EUU A;  3LEK A;  3LEG A;  3PUI A;  3NRU A;  3LE0 A;  1UWW A;  2YC4 A;  3ZM8 A;  3VDA A;  3OG2 A;  3FN9 A;  2EID A;  1OH4 A;  1UYX A;  2VO5 A;  2Y6H A;  2ZEY A;  1CIY A;  2W5F A;  2WN2 A;  3MO4 A;  1KGY A;  1L7R A;  2XOM A;  4XUP A;  3UNP A;  1UMI A;  1JZ2 A;  2WQ8 A;  2HLE A;  3OGS A;  3UES A;  1UZ0 A;  5EJZ B;  2WUH A;  3HJR A;  4QDS A;  5EIY B;  4A41 A;  2DDU A;  2WO2 A;  1JZ8 A;  2QQL A;  2VCB A;  3DYM A;  1PX4 A;  1XPW A;  4A44 A;  2VCA A;  2VOT A;  1P8J A;  1TG7 A;  2ZEZ A;  4ZZ5 A;  4W8J A;  2WAA A;  4W50 A;  5B4X A;  2ZXQ A;  1GUI A;  3I2J A;  1BHG A;  1SHW B;  3I3D A;  4QB1 A;  4QX2 A;  3WF0 A;  5A1A A;  3OBA A;  1J83 A;  3WEZ A;  2BER A;  4OZO A;  4PQQ A;  1UXX X;  1W9T A;  3DYO A;  2W1U A;  3CMG A;  5HXM A;  2YB7 A;  1EUT A;  1JYV A;  4QDR A;  5IFP A;  2ORZ A;  3C7F A;  1UY2 A;  1LNS A;  1JHJ A;  1XC6 A;  2C4X A;  5FUI A;  3WF2 A;  4IUG A;  1UXZ A;  2VR4 A;  1US2 A;  3T2P A;  3LEI A;  4AAX A;  2B9V A;  3LPF A;  1UX7 A;  3NJV A;  2WBK A;  4RYD A;  1J84 A;  2BGO A;  2JDA A;  1PMH X;  3A23 A;  4JX0 A;  4MGS A;  2W95 A;  3CIH A;  3C7O A;  4XUN A;  5JXH A;  4QDQ A;  5IHR A;  1ULO A;  4D0Q A;  5LCW L;  4MGQ A;  2XQX A;  2EIE A;  1SDD B;  2PQS A;  2YFZ A;  3K46 A;  5JXG A;  4QB6 A;  3T0D A;  3CKH A;  4XUO A;  4TXW A;  2QQJ A;  5DPN A;  4YPJ A;  2Y6L A;  2VZR A;  3IAP A;  2VZ3 A;  2Y6J A;  3C8X A;  4UI9 L;  3CQO A;  2RJ2 A;  3VD5 A;  3K4A A;  4D8M A;  3OEA A;  4JKK A;  4CU9 A;  1US3 A;  3EYP A;  3ACF A;  3JXS A;  3SKJ E;  4DXT A;  5JR2 A;  4DEV A;  2WAO A;  3U37 A;  1RYY A;  1PMJ X;  1W99 A;  4PT6 A;  2VMF A;  4GWI A;  1NUK A;  4DUX A;  1JYN A;  1KEX A;  2RVA A;  3J7H A;  4BDV B;  3FHQ A;  1JU4 A;  3W5M A;  3MUZ 1;  1UY0 A;  5JXJ A;  2J1U A;  2JKX A;  3BN6 A;  2VCC A;  5HPO A;  2C26 A;  2E26 A;  4ARX A;  3WSO A;  3OEB A;  2E33 A;  3W5N A;  2YC2 A;  4BK5 A;  2QQM A;  4ZZ8 A;  1DLC A;  3GXU A;  4L0P A;  3IB3 A;  3WF3 A;  2ZEW A;  4QX3 A;  1K12 A;  3AC0 A;  4KI5 M;  4KWU A;  3BGA A;  3THD A;  2WO3 A;  1H6Y A;  4E8D A;  5C70 A;  1IQD C;  2VTF A;  3CZJ A;  1GOH A;  4A45 A;  1K3I A;  4OMD A;  4A42 A;  4A4A A;  2VZV A;  3HEI A;  3III A;  3C7H A;  4ET7 A;  3DYP A;  4MAD A;  4XVH A;  1YQ2 A;  5B4N A;  1CZV A;  3T08 A;  2VMD A;  3A22 A;  2J7M A;  2L9L A;  2W87 A;  2YG0 A;  2DCK A;  2QQK A;  2LW8 A;  4QPW A;  3T0B A;  1GQP A;  1GNY A;  2W92 A;  3P6B A;  4DUV A;  3FHA A;  2B4K A;  3T0A A;  2R7E B;  3DEC A;  3I3E A;  4ZY9 A;  1O8P A;  3WNO A;  1GMM A;  1H6X A;  3HPN A;  3K77 A;  3T09 A;  2Y64 A;  1NX9 A;  3PUH A;  3HNY M;  1DP0 A;  1GOG A;  3T2Q A;  2VL4 A;  4E8C A;  1XNT A;  3HN3 A;  3ACG A;  4Z2A A;  5JXI A;  2QQO A;  4AG4 A;  1WKY A;  1JYW A;  3P1I A;  1O8S A;  3I2F A;  3I97 A;  2E31 A;  2CDP A;  4BJ0 A;  2HYX A;  3HOB A;  1K42 A;  3WNL A;  3ECQ A;  3NJX A;  2J1V A;  3MV0 1;  3EB7 A;  1OD3 A;  2WZE A;  1T2X A;  2X09 A;  3LPG A;  4DUW A;  4P08 A;  3FL7 A;  4GWJ A;  2WO1 A;  5CZK A;  4OYU A;  3K4Z A;  1XNA A;  4PF1 A;  2X05 A;  3CDZ B;  5LA1 A;  4GZ9 A;  4XUR A;  1JZ4 A;  2E32 A;  3WNP A;  2J1R A;  1NKG A;  1F4A A;  4CUB A;  3HNB M;  4OUE A;  2Z4F A;  2QBX A;  2VZO A;  3GM8 A;  1JZ5 A;  3WNM A;  1ULP A;  3ACH A;  5IYY A;  3VD7 A;  2QQI A;  2X10 A;  1D7P M;  5G04 L;  3C7G A;  1JU3 A;  3A21 A;  2VM9 A;  2C9K A;  1F4H A;  3VDC A;  5DQ0 A;  5F7U A;  4CU7 A;  5LA2 A;  1SG3 A;  3GGL A;  4LHS A;  4RN5 A;  2VC9 A;  3UET A;  1L7Q A;  1OF3 A;  5C7G A;  1WCQ A;  5DMY A;  3IDA A;  1GOF A;  2ZEX A;  4QAW A;  3MBW A;  1PX3 A;  1MPX A;  3NNG A;  3WF1 A;  5IJR A;  1DYO A;  4JKL A;  2V4V A;  2QQN A;  1JZ3 A;  4OMC A;  4CU6 A;  3A7Q A;  3LQC A;  3T2O A;  5EJ1 B;  4XZU G;  2XON A;  4CUC A;  2W3J A;  4XUT A;  5C71 A;  1R64 A;  4P5Y A;  4JKM A;  4DXS A;  5G05 L;  5J1X A;  1JZ7 A;  3MUY 1;  1HN1 A;  4M4P A;  2VJX A;  5IFT A;  2W1W A;  5LA0 A;  2OKX A;  3ACI A;  2VQT A;  4W4Z A;  2J1T A;  3WNK A;  1OF4 A;  4UOJ A;  3E1F 1;  2LS6 A;  2Y6K A;  3SEP A;  2WDB A;  1O59 A;  4FI9 A;  4BK4 A;  3WNN A;  2W46 A;  2Y6G A;  3I2I A;  2W1S A;  4LQR A;  2WN3 A;  3VDB A;  4BXS V;  2BZD A;  5DN2 A;  1UYZ A;  1JI6 A;  4TTG A;  4A3Z A;  2W47 A;  3I2G A;  3VD3 A;  3CZU A;  3OGV A;  4DEQ A;  3OGR A;  4KMQ A;  4MOA A;  2J1A A;  1UY4 A;  2DCJ A;  2EIC A;  4ARY A;  3I3B A;  2RV9 A;  3D3A A;  1UY1 A;  3SEE A;  2WZ8 A;  1CZT A;  1CX1 A;  2J1E A;  1CZS A;  5I0D A;  2YFU A;  2JD9 A;  1UMH A;  2W9X A;  4CUA A;  3I2H A;  4P00 B;  2VME A;  2J22 A;  3I2K A;  1I5P A;  3NQH A;  4CVU A;  3K4D A;  3THC A;  2ID4 A;  2VZU A;  4P02 B;  4UAP A;  1OT5 A;  2JE8 A;  4A6O A;  4HG6 B;  3IAQ A;  2BBA A;  3MV1 1;  4LKS A;  2W91 A; 
#chains in the Genus database with same CATH topology
 1QDC A;  1D4M 3;  1H9W A;  1UOJ A;  1UOB A;  2GND A;  1VRH 3;  2P3J A;  2YXS A;  3VBF B;  2KD7 A;  1GU3 A;  2VZT A;  3RMX A;  2VZ1 A;  4QPI A;  1A3K A;  1REF A;  5EPA A;  1H9P A;  1O4Z A;  4PHZ A;  4QB2 A;  3J26 N;  4IV1 A;  1XND A;  4QPY A;  1UY3 A;  4BIO A;  4K40 A;  4QX1 A;  4GB3 1;  2BGC A;  2ZPX A;  1HB4 A;  1Z0H A;  2XVL A;  2OT7 A;  4S2H A;  4QX0 A;  2WYS A;  4WVW A;  5FXV A;  3MIC A;  1IZ3 A;  1OMI A;  3Q8B A;  1R09 2;  4X6Q B;  5A3L A;  1FAT A;  1UYY A;  2TBV A;  4RGK A;  3WF4 A;  1W3V A;  2OUJ A;  2QZ3 A;  2WFF 1;  1W9W A;  4K8R B;  1W2O A;  1MQT A;  4ITC A;  4G3Y C;  2Y33 A;  4XF1 A;  1JW6 A;  1W9S A;  2BFU L;  3S5A A;  2J42 A;  3CU7 A;  2V5D A;  2GAL A;  1NAE A;  2W94 A;  2CDO A;  1OLM E;  4E9K A;  2ZGR A;  1J58 A;  2DCT A;  5JUV A;  1GSL A;  4CDU C;  3H0O A;  5F8P A;  3OOX A;  1UOF A;  3VBH B;  3JZV A;  1C3H A;  1VBB 1;  2I45 A;  1CJD A;  2F4L A;  4WVM B;  1BK0 A;  2F6B A;  1TMF 2;  4BU2 A;  4V2V A;  2ARE A;  2Q8E A;  3QLQ A;  1H0B A;  1DCS A;  2LM3 A;  4CEY B;  3U4X A;  3FWE A;  1OFN A;  1LGN A;  4Q4Y 1;  4X8N A;  1G7Y A;  1W8N A;  4LIU A;  2CGN A;  4LR4 A;  1W8W A;  5FBJ A;  3M7A A;  5J48 A;  2WRA A;  3AJZ A;  3LE0 A;  3ON7 A;  1U12 A;  3RQ0 A;  2DUR A;  3OG2 A;  3MLK A;  4NMI A;  3NNF A;  3WG2 A;  4XQ4 A;  1DGL A;  2CAV A;  1QMJ A;  1UYX A;  4DZG A;  5KXC A;  2Z5W A;  2PHD A;  1RVF 2;  4GWN A;  2ZEY A;  1BBT 3;  4NRQ A;  2JB8 A;  4XF3 A;  3MO4 A;  2TEP A;  3M1H A;  2XOM A;  1S55 A;  3WW1 A;  3O12 A;  5GLW A;  3JB8 A;  2HWD 3;  4RFR B;  4X6R B;  1OUS A;  2A3Y A;  1J3Q A;  4N53 A;  1VBC 1;  5CNA A;  3KGZ A;  1H4G A;  1Z7S 3;  5FAX A;  2E7T A;  4UFL A;  1UYP A;  5EJZ B;  2WUH A;  4AAP A;  4AR2 A;  2XKP A;  4N43 A;  3RZK A;  4EN7 B;  2JG8 C;  4CEY A;  2JX9 A;  1DGR N;  2Q1M A;  4UXA A;  4XFA A;  1C8N A;  4FTS A;  1ND2 C;  2DFB A;  3GYD A;  5L73 A;  2B8M A;  4ASM B;  2WNV C;  4LLO A;  3CJI A;  1GWK A;  4YG0 A;  5HXV A;  3SQO A;  3WW3 A;  4EYU A;  1JZ8 A;  1QDO A;  2NP0 A;  4Q29 A;  2VOT A;  1TME 3;  1TG7 A;  4W8J A;  4W50 A;  1G6N A;  2ZXQ A;  3R4S A;  4HVO A;  4QHO A;  3I2J A;  3ZMN A;  1KJR A;  2YV8 A;  4FPJ A;  4ERO A;  1UD1 A;  3LF7 A;  5F2S A;  3TEW A;  5LK7 B;  3AKT A;  4BMB A;  4BH9 A;  2GP3 A;  5FUP A;  3ZOI A;  4BME A;  3WEZ A;  3WT3 A;  2BER A;  1QY4 A;  1OUX A;  5FYB A;  1C5I A;  1SCR A;  1W8Z A;  2XXZ A;  3K3O A;  4WM7 C;  2XLF A;  1D4M 2;  1UXX X;  2PMW B;  1XRU A;  2JDH A;  2DWR A;  2W1U A;  1YIP A;  1RUF 1;  5K4L A;  4RGG A;  1DQ5 A;  1RHI 1;  2GN3 A;  1JYV A;  3VBO B;  4CCN A;  2WZR 2;  2ET7 A;  1PVC 2;  2RDS A;  4UYB A;  5IFP A;  4B7E A;  3L9J T;  4MZU A;  4QD2 A;  1R1Z A;  3WP3 A;  2XH6 A;  4EQV A;  5FYY A;  2HWE 3;  1APN A;  3POJ A;  4AFC A;  2LTN A;  1XC6 A;  1OOP B;  3C2U A;  4CEW B;  1I6X A;  4JRA A;  3WF2 A;  4IUG A;  4HSJ A;  1WD4 A;  4XC9 A;  2R06 2;  1MEC 2;  2HEY F;  3T2P A;  5A6Q A;  2QQU A;  4IL7 A;  2F4P A;  2Z79 A;  3OPW A;  3H1W A;  4JDO A;  3T1L A;  3VKM A;  5HCA A;  3TYJ A;  2GU9 A;  3NST A;  2XGX A;  1E57 A;  3TN9 1;  4L97 A;  3OTF A;  2OA2 A;  1IG0 A;  1LOF C;  1UZZ A;  2DUQ A;  1MVE A;  5T5P A;  2BNN A;  1JUI A;  3PHM A;  1QJZ A;  5E16 A;  2UU8 A;  4TLG A;  1AR6 2;  1U5I A;  2TUN A;  1J1T A;  1CON A;  2HEW F;  4D7Y A;  2A7A A;  3KM5 A;  4LO8 A;  1S0J A;  4CEW C;  2W95 A;  1ONA A;  3CIH A;  2Q5T A;  3DPR A;  3NW4 A;  4HVR A;  5A7W B;  1XE7 A;  3NVC A;  2K2S A;  3RZG A;  1YC6 1;  4Y3O A;  4NII A;  2FCU A;  4XPV A;  2Y38 A;  5FTT C;  4IND A;  4Z92 B;  4LOS A;  1H1A A;  3VKF C;  2ZHN A;  3VBS B;  3D6E A;  4LLF A;  1S0I A;  2A6X A;  3K46 A;  1PM7 A;  1AX1 A;  4JC1 A;  4BQ5 A;  1RED A;  2JE9 A;  2NN8 A;  5EHD A;  1HB1 A;  1PIV 3;  3CKH A;  1DGW A;  5DPN A;  4N43 C;  2VZR A;  4D3W A;  4MGI E;  3BU0 A;  4UI9 L;  3BKZ A;  1YQ6 A;  3CQO A;  2QJV A;  2IXI A;  4ZON A;  4XJW A;  4LBQ A;  2X5I B;  1BBT 2;  3K4A A;  2ERF A;  4RFT 0;  2PLV 3;  4BCU A;  1W9Y A;  2ZML A;  3OEA A;  4JKK A;  4CU9 A;  1CN1 A;  3ZN6 A;  3ACF A;  3SKJ E;  4YZ3 A;  1PO2 3;  5JR2 A;  4AI9 A;  2WS9 2;  5FY5 A;  1PMJ X;  5C3Q A;  1OUR A;  5C9A B;  4IE6 A;  4PT6 A;  1JYN A;  5A3T A;  3O1S A;  3K3N A;  1QJY 3;  4KU7 A;  3UYJ A;  2ARA A;  2KA3 A;  3PUR A;  5FZ9 A;  4CP1 A;  1UY0 A;  5FR3 A;  2J1U A;  3HAG A;  1H8V A;  3U11 A;  3WR0 A;  1TQ5 A;  3BN6 A;  3BTA A;  4B4R A;  1W2N A;  1D4V B;  1S4C A;  2E26 A;  4ARX A;  1NT0 A;  3WSO A;  2WC2 A;  5FQ0 B;  4DIN B;  1H2M A;  1QOS A;  3D82 A;  1PO2 2;  1H4H A;  4IEP A;  4L0P A;  3VUO A;  1EAH 1;  4EN0 A;  2VVE A;  4Q0S A;  1BMV 1;  2CTV A;  2FDH A;  1W3X A;  4QXC A;  5CFC C;  1DHK B;  5FLJ A;  1LOD A;  3H3Z A;  3LOI A;  2YC0 A;  4XBL A;  1K12 A;  5F3G A;  1O5L A;  1RUH 1;  4D6R A;  4Y33 A;  1T6B X;  5JI7 A;  4YSF A;  3A4U A;  3KCX A;  5C70 A;  3LA7 A;  1YLL A;  3IBM A;  1IQD C;  2VTF A;  4Q4X 1;  4DXZ A;  3NV4 A;  4A42 A;  2HKX A;  2OVU A;  2IUW A;  4A4A A;  2VZV A;  2BJS A;  1XNB A;  1DDL A;  3BAL A;  2IXJ A;  3SCF A;  3OGG A;  3C7H A;  5AFE A;  1VBB 3;  5D8A C;  4IQP A;  4MAD A;  2WZR 3;  1GP6 A;  4W65 A;  2ARC A;  5FYH A;  3N9N A;  5KHI A;  3O5S A;  1AL2 2;  5A32 A;  4UBH A;  3T08 A;  5JSR A;  3A22 A;  2J7M A;  2L9L A;  2YG0 A;  3RZL A;  2XVG A;  3WY6 A;  1Z7S 1;  5JIU A;  3S0M A;  1FV3 A;  4IE4 A;  2P3I A;  4QPW A;  4IGO A;  3P6B A;  4FOY A;  4DUV A;  3SIT A;  3FHA A;  4OI4 A;  5FO7 B;  3POW A;  3QOP A;  5BNN C;  1PO1 3;  3N7L A;  3H1M A;  3WOG A;  2IFR A;  1PO1 1;  1VRH 2;  1EV1 3;  2IC1 A;  2RS5 2;  3FLR A;  2B4K A;  2I74 A;  5FO9 B;  3NV1 A;  4FPE A;  4ZKT B;  3VV1 A;  1V00 A;  3TEY A;  4CXY A;  1W0O A;  5CEH A;  5GKA C;  1NA1 B;  3WNO A;  2EF6 A;  1VBB 2;  1GMM A;  3KT7 A;  4PIZ A;  3TNQ A;  1CIW A;  1NX9 A;  2R1B A;  1ND3 B;  3N9L A;  5FY9 A;  3HNY M;  3I59 B;  5FY1 A;  2VL4 A;  1G9C A;  4NR1 A;  4EZH A;  4KWL A;  5JXI A;  4P9X A;  2QQO A;  2RG4 A;  3GHM A;  1S0B A;  2GC0 A;  3ZFE A;  2EAL A;  4HOO A;  3KMH A;  3HVD A;  3P1I A;  4P9W A;  4FOW A;  4Y4Y A;  2VY0 A;  5FPZ A;  2D93 A;  5JOW A;  2PFW A;  5FYT A;  3DL3 A;  1AR8 3;  5EFU A;  1CAU A;  2ZX3 A;  4BJ0 A;  1GFF 2;  2OZ6 A;  4J6G A;  4G9S B;  1OI6 A;  2HYX A;  5CU1 A;  3WP5 A;  3FJS A;  3Q8A A;  1KJL A;  2UWB A;  3LGR A;  2B42 B;  3AFG A;  1WLW A;  2OPK A;  2ZTN A;  4YZ5 A;  1AR6 1;  4HK9 A;  4EWA A;  2J1V A;  1I1E A;  3I2O A;  2O8O A;  2WA3 A;  3VN4 A;  1X8M A;  1AYN 2;  2W2I A;  3DCQ A;  2XPJ A;  4NVP A;  3RVH A;  2WFP A;  1S0D A;  2FBE A;  1NA1 A;  1HDK A;  1OSG A;  2HYK A;  3FL7 A;  4JGY A;  4MHR A;  4R52 A;  4XAE A;  2G4I A;  3OPT A;  5GJ6 A;  4E2S A;  1CWP A;  2GH2 A;  4BQW A;  4PLO A;  5BNO B;  2OPW A;  4GMP 3;  4LUK A;  4XTP A;  1DG6 A;  4XUR A;  1WA6 X;  1HRI 2;  4MXV A;  5A80 A;  1NQD A;  4GH4 A;  4XJ9 A;  5K9Y A;  4Z2W A;  4XIK A;  2V09 A;  3ZKY A;  2UY8 A;  2W0X A;  1NKG A;  2KM2 A;  5FWE A;  1F4A A;  1ZRF A;  2D98 A;  3THP A;  4XYX A;  5CFD A;  2GN7 A;  4Q4W 3;  1Q8S A;  2VZO A;  4N8M A;  4N90 A;  4L99 A;  1RUI 1;  2JEC A;  1ZNP A;  1NY7 1;  3O1U A;  2PLV 1;  1GYK A;  3LIH A;  5IAV A;  3B93 A;  4QPI B;  4HN0 A;  2AH2 A;  3OY8 B;  5APA A;  4K8F A;  4HKW A;  1UZW A;  4UF0 B;  2B45 X;  2XVK A;  2RDQ A;  1LR5 A;  1YI7 A;  1MVQ A;  2A1X A;  2H0V A;  2ZGU A;  5LRR A;  5LBB A;  3R0R A;  3LZZ A;  4E4D X;  5KHG A;  2CY6 A;  4O61 A;  5DQ0 A;  4BQ3 A;  1G9F A;  1R08 1;  2DVG A;  4CU7 A;  1VAM A;  1L7L A;  1GWL A;  3MI8 A;  1OPO A;  5IWF A;  1GAN A;  4RN5 A;  3JBG 2;  1AR9 1;  2JIJ A;  1X82 A;  4NJ4 A;  5D8A B;  5C7G A;  1OF3 A;  4HMZ A;  5KR7 A;  2Y34 A;  2Q8D A;  1S0G A;  2X29 A;  5EV7 A;  1S2K A;  2B9U A;  2VVD A;  3K2O A;  3PLQ A;  4GH4 B;  1WCQ A;  1Q3E A;  5DMY A;  2PHR A;  1K5J A;  1GOF A;  2RMU 3;  4OUL A;  4QAW A;  5CFD B;  2LRO A;  1YUD A;  1AJO A;  5FZ4 A;  4HSL A;  4QMA A;  5FLH A;  4S2F A;  4XJA A;  1SPP B;  5GZE A;  3TN9 2;  4HPK B;  3VBH A;  4U2A A;  1ZZ7 A;  5EWS A;  1DYO A;  5L7O A;  2D97 A;  4JKL A;  2V4V A;  3ATG A;  3VDD B;  2FDK A;  3EBR A;  2VBB A;  3MF6 A;  1AR7 2;  4COV A;  5M0T A;  1HX6 A;  1C57 A;  4S2G A;  2QCS B;  4V2W A;  4HL0 A;  3ETQ A;  1BEV 1;  1LHV A;  3LDR A;  5FMB A;  5FCC A;  4AVS A;  1QNW A;  1OKQ A;  4XUT A;  2A71 A;  1PVC 1;  1C8M 3;  1QEX A;  4A2U A;  5FKC A;  3MLJ A;  1JZ7 A;  3X29 B;  3BIW E;  1QJX 2;  3DPR C;  1AYN 3;  4LBL A;  1UZY A;  5F9T A;  3AVR A;  2VJX A;  1GZW B;  2W1W A;  5LA0 A;  1FXZ A;  3ACI A;  3ES4 A;  4GMP 0;  1QJU 3;  3PIG A;  4IV3 A;  4RR3 C;  5F3I A;  3WX5 A;  2Y6K A;  2RJL A;  5K0U B;  2JDY A;  2Q1F A;  3NV3 A;  3RYP A;  5CG9 A;  3IPV A;  1CAV A;  4XAB A;  5A3U A;  3ZXL A;  2WLQ A;  1LOF A;  2C5D A;  3DKQ A;  2WDB A;  5CFD C;  1SPP A;  4NWV A;  4YM0 A;  2BYV E;  4B4Q A;  4BK4 A;  1IPK A;  3WNN A;  1DQ1 A;  2IXL A;  1AYM 3;  3KV9 A;  1A6C A;  2H0B A;  2W1S A;  2P3K A;  2ADE A;  3I2I A;  4M3C F;  4S2D A;  2WN3 A;  3VDD A;  5DAW A;  3VDB A;  1AHS A;  3O1V A;  2A6W A;  4YVW A;  3URF A;  4JV4 A;  5DN2 A;  1UYZ A;  1JI6 A;  1HXS 1;  3TWI A;  3ZVX A;  5FDB A;  5LBE A;  2VTX A;  2W47 A;  2AYH A;  4IGQ A;  4UBG A;  2GH8 A;  3UGG A;  1X9T A;  3N36 A;  3OGV A;  1NXD 1;  1QQP 2;  3OGR A;  1RUE 3;  4MOA A;  4GAZ A;  5IVV A;  2YPJ A;  2YU2 A;  3HT1 A;  4JQT A;  3AFK A;  1EPW A;  1Y4W A;  3I3B A;  2RS3 2;  5ANQ A;  3RI8 A;  3B5L B;  4EZ4 A;  4UW3 A;  1S1A A;  2VW2 A;  3L2H A;  4PDW A;  3SEE A;  2WZ8 A;  1JYC A;  5FMO L;  1CZT A;  5HV4 A;  3IMM A;  5JMC A;  1CX1 A;  1JYT A;  1CZS A;  1H2L A;  1Q5O A;  2R07 1;  5GLU A;  5T3N A;  3ZYH A;  5I0D A;  4QPI C;  4AWD A;  2W9X A;  3D4K A;  4XQW A;  1X9P A;  2R0H A;  1WCU A;  4XOG A;  4YW1 A;  5K0U A;  2VOV A;  1BBT 1;  3LDB A;  4GB3 2;  5FRE A;  4TSV A;  3U1X A;  3M8L A;  4URT A;  5JXH A;  1I5P A;  5E88 A;  5FZF A;  3IZO A;  3NQH A;  1HQL A;  4E4H A;  1BVV A;  3AYC A;  5HCB A;  2ZOE B;  3NV2 A;  3IDE A;  1NE4 A;  5E8A A;  2ID4 A;  3WV6 A;  3VBO A;  4I09 A;  4IEZ A;  1YFX A;  4UT5 A;  2A5Z A;  2WQ4 A;  1GKB A;  1MS1 A;  1W06 A;  3JQX A;  1WLT A;  2WNU A;  1NCR A;  5FZ3 A;  5L9B A;  3PVO A;  2VNR A;  4LA2 A;  2HWB 1;  3T30 A;  3WP6 A;  3MIE A;  4D6Q A;  4AEJ A;  1AL2 1;  2XL7 A;  1PGL 2;  3ZX7 A;  1DIW A;  2ZAA A;  1ZBE 3;  3ZLI A;  3O0X A;  4C0B A;  1W0N A;  1LGC A;  2P17 A;  2ZGN A;  3OCP A;  4XE9 A;  4HET A;  3VBR C;  1ULC A;  4FAG A;  2VQU A;  4HBN A;  2VZQ A;  1STM A;  2ZAB A;  5A6Y A;  4GQ7 A;  3UGF A;  4COZ A;  5H9S A;  3WQ7 A;  4KH9 A;  1KFU L;  4MO3 M;  1UU4 A;  1UN1 A;  3OBT A;  4WVZ A;  1O3S A;  2EIB A;  4C91 A;  3ETP A;  2Y8K A;  5DAX A;  3LA3 A;  2OQ7 A;  3WQB A;  2VMC A;  3VD9 A;  1W8O A;  3LOB A;  3JD7 1;  4CDQ A;  1OHF A;  2PHU A;  3J8F 2;  5FJK A;  5FK7 A;  4Q1R A;  2VXR A;  4LKD A;  2BVV A;  4RHV 2;  2CHH A;  1D0G A;  3G6J B;  3B00 A;  3RDI A;  2GC3 A;  1ND3 C;  3ABZ A;  4R8H A;  4Y1V A;  3ROU A;  3CEW A;  5FXW A;  3SC7 X;  3VL8 A;  1BMV 2;  1PIV 2;  4QKN A;  1UKG A;  2JG8 B;  2DF7 A;  4TLF A;  4XFB A;  1ASJ 2;  4ZXE A;  2WNU C;  4LT5 A;  1N3P A;  2VUA A;  5FOJ B;  1RMU 3;  4H7L A;  5CA6 A;  4R4Z A;  5FYZ A;  1ZRR A;  4XDO A;  3NNJ A;  4JHZ A;  4JTN A;  4M4R A;  1ULE A;  1YI9 A;  3ENR A;  4MGZ E;  3AMH A;  2PAM A;  4JCK A;  2JDM A;  1UX6 A;  1YQ5 A;  1HJF A;  3NWK A;  4QU1 A;  5J98 B;  1EUU A;  2ZS6 B;  5FMD A;  1KS4 A;  4DS0 A;  2HWC 3;  3ZM8 A;  2NMO A;  1WZX A;  3VDA A;  1K42 A;  4FVV A;  4QPG B;  3UL2 A;  3BUC A;  2P4E A;  3BTY A;  3HT2 A;  2WNE A;  3U75 A;  3Q8E A;  1OH4 A;  3I8T A;  1IPS A;  3ZR5 A;  4YZ1 A;  1EAH 2;  5JPM B;  1OA4 A;  1XSR A;  1S2E A;  3BPZ A;  3WDV A;  2Y6H A;  1KDK A;  4AVA A;  3WNX A;  1QQP 3;  1VBA 1;  1L7R A;  3RZZ A;  4P14 A;  2FDJ A;  4XUP A;  1A8M A;  3VBR B;  1W8U A;  2NZ9 A;  1PK6 C;  1SEF A;  4O9E A;  3SXW A;  5FBZ A;  5CFC B;  1HRV 3;  1LHU A;  2HLE A;  3MYX A;  3W21 A;  3ZDV A;  4CYD A;  3OGS A;  3MHZ A;  2VH9 A;  3VZK A;  1VLN A;  1COV 2;  3AK0 A;  4CDU B;  4XFG A;  1YO8 A;  4CUG A;  1VIW B;  4A41 A;  2VUL A;  4GB3 3;  5IAX A;  2BWC A;  2BDR A;  3T4H B;  2UWC A;  5A1L A;  5FZ6 A;  4ORF A;  2VCB A;  1PX4 A;  3ZN4 A;  1XPW A;  4A44 A;  5T55 A;  1GQH A;  5IAT A;  4FT8 A;  1TNF A;  2AGS A;  2YGL A;  1P8J A;  1RUG 1;  1WWY A;  3VB9 A;  2FZ1 A;  2WWU A;  1DQ2 A;  2WAA A;  1IS5 A;  1GUI A;  4N7U A;  5C9A C;  4Y5T A;  1AR9 2;  5AFB A;  3O7O A;  2C1F A;  1J3R A;  5GLV A;  3BI3 A;  4QB1 A;  1XBF A;  3WF0 A;  3ZR6 A;  5A1A A;  2QQV A;  3QD6 A;  3PU3 A;  5FZC A;  2VG9 A;  1W8H A;  2AZ5 A;  3AYE A;  1W6P A;  2WO7 A;  3EQE A;  1QU0 A;  3SMH A;  4BOW A;  5ACA 3;  5J96 B;  2A6Y A;  2JDZ A;  2IXH A;  4FOQ A;  4YFZ A;  1WW6 A;  3J8F 3;  4WM8 A;  4Y22 B;  4YW7 A;  3DYO A;  4ISR A;  3AJY A;  4AK3 A;  4HT1 T;  4K3U A;  1RUC 3;  2YB7 A;  5HCF A;  4QDR A;  2Q0A A;  4BA6 A;  3C7F A;  5K7P A;  1OOP A;  1RHI 2;  4ZS3 A;  1RJ7 A;  1PNF A;  1R08 2;  5FRA A;  1POQ A;  2WIN B;  1W04 A;  5KHK A;  3LSD A;  1UXZ A;  1RC6 A;  3RZJ A;  4W6X A;  1OA2 A;  1US2 A;  2MEV 3;  4AAX A;  4AW7 A;  1Q43 A;  2BOI A;  2B9V A;  3ZXG A;  2YRO A;  3AKP A;  1AR7 3;  5A3P A;  3NJV A;  3ALQ A;  1SCS A;  4IER A;  1Q8Q A;  1QKQ A;  5JCT A;  1HJG A;  3IDC B;  1LEC A;  2ZCW A;  4XFI A;  4OUM A;  1YQC A;  3WLU A;  5IK5 A;  4YW3 A;  2RR1 3;  2EXK A;  3DPR B;  4JX0 A;  1KQR A;  1MS4 A;  2OQ6 A;  4WZC A;  4KWJ A;  3RI9 A;  5J37 A;  1UZV A;  3M3Q A;  5CBL A;  2BQP A;  1G9B A;  2P5B A;  2XKO A;  2ZX1 A;  2EIG A;  3UGH A;  3C7O A;  4XUN A;  2VU9 A;  4NN0 A;  1BJQ A;  4QHZ A;  3KD4 A;  5DAV A;  1F2N A;  3WUD A;  2ZBJ A;  1R1A 3;  2VCM A;  4QDQ A;  5A3W A;  5IHR A;  5FYU A;  4LHN A;  5JZG B;  4MGQ A;  1Y9M A;  2PQS A;  4Z8B A;  2YFZ A;  5L36 A;  4BQ4 A;  5JXG A;  4QXH A;  3JCI A;  2PHX A;  3M3O A;  3ZYP A;  3T0D A;  4IDZ A;  3VDD C;  2QQJ A;  1VAK A;  2JDK A;  1SQ4 A;  3IAP A;  3BCW A;  2YGM A;  2CGP A;  5CKN A;  5DAQ A;  1LOB A;  4YFW A;  1WGP A;  4FXG B;  1H30 A;  4AQ6 A;  1QGL A;  2JXA A;  1XB9 A;  1XE8 A;  2HWC 1;  4JZR A;  4DIQ A;  4YM3 A;  4IV3 C;  2DVD A;  2VMG A;  4DXT A;  5BNP A;  4DEV A;  3EMR A;  3WIN E;  2WAO A;  2WT2 A;  3BU7 A;  3BYW A;  1RYY A;  1OA3 A;  2WR9 A;  4XXA A;  4YLZ A;  3KQ4 B;  2VMF A;  3EHK A;  4QGN A;  1VBD 2;  4TZD A;  1KEX A;  2HWE 1;  1R1A 1;  3HQU A;  1UOG A;  3FC0 A;  4GD4 A;  3M3C A;  2WNV B;  4CP0 A;  4E2G A;  5ACA 2;  3OSD A;  2G9G A;  5FP7 A;  1KIT A;  2VMI A;  2VCC A;  3E5Q A;  5FQ0 A;  5HPO A;  5JZG A;  2ZZJ A;  1YRZ A;  1O3Q A;  4K9S A;  3OEB A;  2YC2 A;  4AI3 A;  4AVV A;  4BK5 A;  1ENR A;  1FOD 3;  1X33 A;  4BE3 A;  3WF3 A;  4FO9 A;  1LOC A;  2QZ2 A;  5AVP A;  5EXO A;  1OXC A;  2OXB A;  3JD7 3;  3DXU A;  3H8U A;  1J3P A;  3N7M A;  4QKB A;  1PGL 1;  2A75 A;  4Y20 B;  2YPD A;  3TN9 3;  4RD7 A;  1AF9 A;  1N1Y A;  3D5O A;  4HPK A;  3AC0 A;  2P2K A;  4JDM A;  1E5H A;  2PHL A;  3BGA A;  2DU0 A;  2YDE A;  4Y26 A;  3THD A;  4AQ2 A;  4BIS A;  1PMI A;  1H6Y A;  4CDX B;  4AI8 A;  4L2N A;  3AZW A;  4LHL A;  1RUE 1;  3FFQ A;  3POE A;  1K3I A;  1EY2 A;  1NYW A;  5E89 A;  1LHW A;  5BNO C;  5A7P A;  2GDF A;  1FOD 2;  2R49 A;  4Q0V A;  1PK6 A;  1TME 2;  3ZYB A;  2BVB A;  2E9Q A;  5CKQ A;  4AVC A;  4Y4R A;  5BYN A;  5TSW A;  1W2T A;  1WUV A;  1AL2 3;  4AEK A;  2QQK A;  5F6K A;  3RGB A;  2D5H A;  4YW5 A;  3D0S A;  3H1Y A;  1F5F A;  2NLR A;  4QM9 A;  3NJZ A;  1JXN A;  4N7I A;  4AHW A;  2R04 2;  2R07 2;  2VBP A;  3OF1 A;  3B69 A;  5LA9 A;  5T5J A;  1GQP A;  1GNY A;  3T0B A;  3DV8 A;  5L9R A;  3WDU A;  3OUI A;  1O4T A;  1DFQ A;  1UAI A;  3S30 A;  5A7O A;  2GP5 A;  4K6B A;  5FPA A;  3NJY A;  1PGS A;  4KG8 A;  1REE A;  4B4P A;  3ILF A;  1XJA A;  3I3E A;  3LEM A;  5GAL A;  3HBZ A;  3GZA A;  3DN7 A;  3ITQ A;  5DZG A;  1ND3 A;  3BOP A;  3CHX A;  1H6X A;  4IE5 A;  5IVY A;  1OQD A;  2QDN A;  2XDV A;  2Y64 A;  5AC9 2;  1RUD 3;  3PUH A;  5FZ7 A;  5JSO A;  3H8X A;  5FP4 A;  2N7G A;  4BXF A;  3CBN A;  3OJB A;  3UJO A;  1JMU B;  1S0E A;  1XOY A;  2AEN A;  2HWF 3;  3H7J A;  3MW4 A;  4QKF A;  3UKV A;  1W28 A;  1UCX A;  2EAA A;  4LBM A;  1H8T C;  1VPH A;  2XQR A;  3JBG 1;  2QFE A;  4XHX A;  4J1X A;  2JG9 C;  3I2F A;  4I0A A;  4KU8 A;  1DZQ A;  2E31 A;  2RM2 2;  4JGY C;  2XR4 A;  1LKN A;  2XJS A;  2CDP A;  2W08 A;  3LSE A;  5KXE A;  1BYH A;  3MGU A;  1FPN 2;  4DB5 A;  2VXJ A;  3CL1 A;  2B39 A;  1KXG A;  1HRV 1;  4OCT A;  3PDQ A;  1RUJ 1;  2ZHM A;  4LO7 A;  3ECQ A;  4FFG A;  4XJU A;  3BTX A;  3EB7 A;  1NZI A;  3VGI A;  1OD3 A;  1RMU 2;  1N1S A;  3ORJ A;  4LOT A;  4XHB A;  1ALY A;  5DZE A;  2AEY A;  3LPG A;  3KSC A;  4CDX C;  4I0W B;  4FPO B;  4GWJ A;  5EJ3 A;  4MGT A;  3K4Z A;  1NZC A;  4AI1 A;  2RM2 3;  3AMN A;  3I2D A;  3TBD A;  3SHR A;  5IVE A;  1K5M C;  2X05 A;  2XML A;  5ACA 1;  3SNM A;  1QJU 1;  3N3H A;  4PI0 A;  4GZ9 A;  3WNP A;  1GIC A;  5JIA A;  4CDW B;  2XUE A;  2FDF A;  5I0U A;  4K1Z A;  2WNU B;  3WUC A;  4CUB A;  1GZ9 A;  1N3O A;  3HNB M;  4IEW A;  4OUE A;  2Z4F A;  4AYU A;  4QKD A;  5K0U C;  4KWK A;  3Q8F A;  3GHN A;  4IES A;  3RJR A;  3V64 A;  4QXK A;  3H3L A;  4NAM A;  5IYY A;  3ZXA C;  4D7S A;  4UF0 A;  5F3C A;  3KF3 A;  2EVX A;  4A7Y A;  2QQI A;  5A3N A;  5CIS A;  2UUR A;  3DEM A;  1LCL A;  1NY7 2;  4MYE A;  4XFF A;  5G04 L;  2E6V A;  5H9P A;  4Y1U A;  5DUX A;  4RSU A;  1N1T A;  5FZD A;  3SLI A;  1F31 A;  1F8V A;  4ASK A;  1BEV 2;  1WBF A;  5F39 A;  2EAK A;  2XLG A;  3GGL A;  4EWE A;  2HWD 1;  2Q1Z B;  4XDQ A;  2R0F A;  5D8A A;  2WFF 2;  4CDQ B;  3BIE A;  2VC9 A;  1QQP 1;  3UET A;  2VTX J;  1XYO A;  5JOZ A;  3RZM A;  3GCX A;  1H1I A;  3AZV A;  3M3I A;  3HBK A;  4K1Y A;  4RHV 3;  1UNB A;  5DDJ 1;  4AI2 A;  4CDW A;  1V6J A;  2ZGM A;  3WHT A;  4QQL A;  3AYA A;  5KXD A;  1AR6 3;  1FX5 A;  1UF2 C;  1UIJ A;  3B9I A;  1G8W A;  3LFM A;  4NHY A;  1JN2 P;  3ZPY A;  4RQP A;  2BU9 A;  4EN8 B;  3D8C A;  1MPX A;  1ZRD A;  4XJ8 A;  4I3G A;  1I3H A;  2VPV A;  4PI2 A;  4IE0 A;  4XIL A;  5IJR A;  3KCY A;  3KV4 A;  1HB2 A;  1J1L A;  4N43 B;  3WF1 A;  3EO6 A;  1TEI A;  2VAU A;  4Q4V 2;  3VHO A;  3B01 A;  3IT8 A;  1BCX A;  4BIF A;  2R32 A;  2V73 A;  4QGL A;  3LQC A;  3RWN A;  4DO0 A;  1DZR A;  5C3O A;  2BRT A;  4L92 A;  3KF5 A;  4XZU G;  4KBB A;  3MEP A;  5C71 A;  1JOP A;  3ELN A;  5FZ8 A;  4A7Z A;  4FPL A;  4DXS A;  2ES3 A;  4ZS2 A;  1QJE A;  4QPG A;  1YXW A;  5G05 L;  1QJX 3;  4Q4W 1;  4NIG A;  1HN1 A;  2TNF A;  2A70 A;  3MIF A;  3N35 A;  5DDJ 3;  5EQU A;  4ZXK A;  1BK1 A;  3P3N A;  4M4P A;  2IFW A;  5IFT A;  2BTV C;  3NAP B;  4LK7 A;  5JI9 A;  2VQT A;  2WL1 A;  1OQ1 A;  5FYM A;  1EV1 1;  3WCS A;  3E1F 1;  4R9C A;  2LS6 A;  4BLJ A;  3V0A B;  3PMS A;  5ISL A;  4COU A;  3O1P A;  3VBU B;  4R9A A;  5JLV A;  2XLA A;  4LBN A;  2O8Q A;  4RQP B;  2ADD A;  3SEP A;  1GR3 A;  1O59 A;  2FDG A;  5FZO B;  4D94 A;  2RDN A;  2W46 A;  2Y6G A;  3AVS A;  1D0H A;  1ZBA 3;  4XZP A;  1JTZ X;  3T3Y A;  1DYK A;  2KR2 A;  2VW1 A;  3U07 A;  4URA A;  3BTZ A;  2CGO A;  4IEO A;  1WW5 A;  2RJK A;  4A3Z A;  2DU1 A;  1JOD A;  3I2G A;  1RJ8 A;  5BNN A;  2W39 A;  1UIK A;  2VMH A;  4IEV A;  1DGR A;  4KMQ A;  4Q4X 3;  3VBO C;  4OHY A;  2D6M A;  2J1A A;  5FXZ A;  1O4Y A;  3EXU A;  1R1A 2;  4I3P A;  2DCJ A;  2RS3 3;  4QQO A;  2E63 A;  4FBF A;  2RV9 A;  4MLO A;  5EZW A;  1AR8 1;  1XNK A;  3D3A A;  4OLL A;  4P9Y A;  3ZYR A;  2HWB 3;  2BNM A;  3KZ4 C;  1Z7S 2;  2ZA9 A;  4FCA A;  2Q30 A;  3HQR A;  2YFU A;  1HIX A;  2FQP A;  2JD9 A;  1UMH A;  2SLI A;  3J4U H;  3I2H A;  1W6M A;  2XUM A;  2VME A;  4NWW A;  4P00 B;  1B35 B;  1CX4 A;  2OUH A;  1EYB A;  2J22 A;  3IWZ A;  3V0A A;  4LE3 A;  1QF3 A;  1CJP A;  5A6Z A;  4PDW C;  1RVF 3;  1IG3 A;  3I2K A;  1W6O B;  3GBF A;  4Q4X 2;  5FZO A;  1B09 A;  4IEX A;  4OUS A;  4FPK A;  1VE0 A;  3K4D A;  5JWP A;  4LXL A;  5C6C A;  1N3Q A;  1OT5 A;  5D1I A;  3RFR A;  2K46 A;  5FLI A;  3WQ1 A;  5LW9 A;  4MGY E;  1BVP 1;  2NPI A;  4H7M A;  1FAY A;  2D40 A;  1BEV 3;  5A1F A;  4A6O A;  3O1T A;  1D2S A;  5FUN A;  4HG6 B;  2BBA A;  3MV1 1;  5FY8 A;  4LKS A;  2W91 A;  3HNM A;  4CDW C;  3M70 A;  3ZPO A;  1ZBE 2;  3MFA A;  4GH4 C;  4N9I A;  1W39 A;  4AGV A;  2XJQ A;  2Y0I A;  1RUN A;  4ZHN A;  3C7E A;  3JB4 C;  4AED C;  1TVG A;  1QH6 A;  4OI2 A;  1K45 A;  4YGD A;  1PZ8 A;  4WZF A;  4CCM A;  2XJT A;  3HWJ A;  1WMF A;  4JGZ C;  1V6N A;  2WA4 A;  1RUH 3;  3PVN A;  3VHP A;  2QE3 A;  2FZ2 A;  2VVF A;  2UWA A;  4LNV A;  5IVF A;  1TMF 3;  3F2Z A;  5C8C A;  3FLP A;  2RS5 3;  2BGP A;  1SBF A;  4UFH A;  5JMO A;  2VZS A;  1Y43 B;  1NLR A;  3ILN A;  3K75 B;  1O6U A;  5LBC A;  4AXO A;  4DXR A;  4I0B A;  4QWN A;  1G9A A;  5T5O A;  4O9G A;  5E6H A;  3MID A;  4FFH A;  4CP9 A;  1WW4 A;  2EXJ A;  2WAB A;  4YGB A;  1SLL A;  3VL9 A;  5IK4 A;  5I0R A;  4LBO A;  5L7O C;  4OHW A;  5KBF A;  4N53 C;  1JYX A;  3OYW A;  4RS5 B;  4GAL A;  4LO6 B;  5FZE A;  4LKF A;  1O3T A;  1U5Y A;  5F32 A;  4OFG A;  1ZRI A;  3JU9 A;  4P9L A;  2PHW A;  1G86 A;  1MEC 3;  2ZHL A;  3APB A;  4AE2 A;  1RUI 3;  4FTE A;  1RUJ 2;  1ZX5 A;  2CNA A;  3F95 A;  5F3E A;  5FZM A;  2VZP A;  2DTW A;  3GDB A;  1IHM A;  1MS8 A;  4FXK B;  5DAP A;  3MW2 A;  4HFS A;  3ZSE A;  3SKV A;  5ABJ A;  1JZ6 A;  1R09 1;  4JVA A;  4P9G A;  2R30 A;  3E6B A;  3LEK A;  4FPH A;  4NPL A;  4W6W A;  3DKW A;  1YEW A;  2E7A A;  3LEG A;  1VBD 3;  3T1M A;  2P1B A;  5JR7 B;  1LRH A;  1UWW A;  2YC4 A;  2NQY A;  1SBE A;  4QGM A;  4E8C A;  1RIT A;  3FN9 A;  2GZW A;  4Q4W 2;  1E5R A;  1LOG A;  4F8A A;  4CXW A;  4QQ2 A;  2K0G A;  2VO5 A;  3PUS A;  1H2N A;  1RUI 2;  4M01 A;  5K8S A;  2C6S A;  1CIY A;  2W5F A;  5T54 A;  4Y24 A;  2WN2 A;  4CP9 B;  1KGY A;  5CFC A;  3LIG A;  5JOY A;  3UNP A;  2XJP A;  5LBF A;  1UMI A;  5GZF A;  2BEO A;  3PTY A;  2WQ8 A;  1FPN 3;  3J7L A;  2ZX2 A;  5IUQ A;  3V56 A;  3ZSL A;  3UES A;  3USU A;  1UZ0 A;  2B5H A;  3ME2 A;  4Y20 A;  2ZZQ A;  3VBS C;  3HJR A;  4DY3 A;  4NE9 A;  3HMY A;  3NMB A;  4PQ9 A;  1TME 1;  4XF4 A;  2DDU A;  2WO2 A;  3ZFE B;  3NAP C;  1RXG A;  4RR3 A;  3QAC A;  2QQL A;  3DYM A;  3H7Y A;  4FPC A;  4XFC A;  2ENR A;  2RS1 3;  3ZDS A;  2ZEZ A;  5C3R A;  2FCV A;  2CL2 A;  1X36 A;  2C24 A;  3I3D A;  4B1L A;  4FP3 A;  4TN7 A;  4PCR A;  1OKO A;  3GBW A;  3ZXK A;  4COY A;  2LRP A;  4QX2 A;  3OBA A;  2A3W A;  1J83 A;  3FBY A;  5A33 B;  1NQJ A;  2CWS A;  5JPN B;  4OHZ A;  2IVJ A;  1ND2 A;  4GMP 1;  5FZG A;  1F35 A;  2WS9 1;  3IDB B;  4WM8 B;  3WDX A;  4LHK A;  2DBN A;  4XEZ A;  2FD8 A;  3AXE A;  3KT1 A;  1GQG A;  3THT A;  4AVB A;  3RWK X;  1AX2 A;  3CMG A;  2QQW A;  1RUF 3;  5EP9 A;  5FP9 A;  4CE8 A;  4ISQ A;  1J59 A;  4L8Q A;  2ORZ A;  4FFI A;  4IGP A;  1XE0 A;  3N7J A;  1JHJ A;  4B3N A;  4ATE A;  2BOJ A;  2P6C A;  5FOB B;  4CCD A;  2D3S A;  1LED A;  3LEI A;  4D6S A;  3LPF A;  4WM7 B;  5FPX A;  1POV 1;  2QDR A;  1V0A A;  2RS3 1;  4SBV A;  2XJU A;  1W8T A;  1L3J A;  5JZG C;  2H6B A;  1RIN A;  3I49 A;  1MZE A;  3OY8 A;  4KG0 A;  4HKO A;  1RMU 1;  5DXD A;  4RYD A;  4A6S A;  1CES A;  5LWB A;  3TEX A;  5BNQ A;  4QQP A;  3U4S A;  1MZF A;  1J84 A;  1LOE A;  1SLT A;  1W03 A;  2PA7 A;  4Q8L A;  5FXX A;  2K9Z A;  2FMD A;  3PJY A;  1V6L A;  2VW0 A;  4AHZ A;  4BHP A;  4E27 A;  3ZN5 A;  4EV0 A;  1SMV A;  3TNP B;  5FYC A;  1ZBA 1;  3ZFG C;  3A23 A;  3OBR A;  4BQY A;  4MGS A;  2ZAH A;  3GNE A;  1FV2 A;  1O7F A;  1XU1 A;  2XBO 1;  2ZX4 A;  3PVB B;  5CB7 A;  2F17 A;  1VBC 2;  3AKQ A;  1XNC A;  3FX3 A;  4ATF A;  1VMF A;  1QJU 2;  3MF9 A;  3N9Q A;  4Q4V 3;  3SCG A;  3TAY A;  4AVT A;  2ZGK A;  4YGC A;  1ULO A;  1W6Q B;  2E7Q A;  3WCR A;  4D0Q A;  4YVW C;  4LUM A;  4NHL A;  2VOX A;  2XQX A;  2EIE A;  3MPB A;  3ZIX A;  3B7M A;  3BPS A;  1IQA A;  4XUO A;  4TXW A;  2RHP A;  1C1F A;  1PO2 1;  3ZYI B;  2ZGP A;  2E53 A;  3BOD A;  4W6Y A;  3C8X A;  4WM7 A;  4XCB A;  1QXR A;  2XL9 A;  3RRD A;  3NO8 A;  4NUB A;  2UYA A;  2VD7 A;  4JHT A;  4YVS C;  4D8M A;  5J09 A;  2ATF A;  1MZ5 A;  1US3 A;  1NOV A;  1S0F A;  1OLM A;  4IV1 B;  2RS1 2;  3FBM A;  4Q4Y 3;  3MIG A;  1PNG A;  3W58 A;  1FNY A;  1OH3 A;  1W99 A;  1MAC A;  4LBQ D;  4GWI A;  5FPB A;  2VOK A;  4MET A;  4DUX A;  1NE6 A;  2ZMK A;  2RVA A;  4LMF A;  3J7H A;  2WKK A;  4G4F A;  3FHQ A;  1JU4 A;  5T5L A;  3ZFF B;  4AI0 A;  2WNV A;  2C0Z A;  4CTE A;  4R9D A;  4SLI A;  1QXJ A;  2JKX A;  3OUJ A;  5T50 A;  1EAH 3;  3KT4 A;  3LD8 A;  4CEY C;  4QX7 A;  4XJZ A;  4JAA A;  1MQT B;  1ST8 A;  1CD3 G;  4RL7 A;  1FT9 A;  2D3P A;  1DQ4 A;  4RHV 1;  1WME A;  2XB6 C;  2QQM A;  4ZZ8 A;  1DLC A;  3GXU A;  3VBH C;  5CG8 A;  2WWJ A;  5FZ1 A;  4K20 A;  3IB3 A;  4AF9 A;  2WS9 3;  1CAV B;  4R4X A;  3BB6 A;  1NXM A;  2ZEW A;  5F2W A;  2GMP A;  2JB4 A;  1HRV 2;  4L9B A;  4A7K A;  3AX4 A;  1VB2 A;  5CKM A;  2JIG A;  5FO8 B;  2BW8 A;  3FZ3 A;  1UU5 A;  1QJY 1;  2IXK A;  1VB4 A;  4KI5 M;  4KWU A;  3MPP G;  4CDX A;  5EYX A;  4E8D A;  4XF9 A;  4U36 A;  4MV2 A;  5FZI A;  1UL9 A;  5FWJ A;  4J25 A;  3JBG 3;  4A45 A;  2FHR A;  4BPZ A;  5FMO S;  3TB0 A;  1G9D A;  2ET1 A;  1PK6 B;  3IKW A;  5FP8 A;  3III A;  4OI0 A;  4HVQ A;  4ET7 A;  2HWF 1;  4Z07 A;  3T2T A;  1HV0 A;  1BXH A;  1GNH A;  4R9B A;  1CZV A;  2D6P A;  3FLT A;  4BB3 A;  3AM2 A;  1WLD A;  2AUY A;  2W87 A;  3RS6 A;  3I3M A;  2DCK A;  1UPS A;  2FDI A;  1WBL A;  1PIV 1;  4JGZ A;  2R1D A;  2X8K A;  2GAU A;  2XHK A;  1UMZ A;  1MS0 A;  4DPN A;  4QPG C;  1FPN 1;  2R04 3;  5D2A A;  1C28 A;  2XJV A;  4M0H A;  4MH0 E;  3NAP A;  4HLT A;  3WDT A;  3IN9 A;  2YHJ A;  4C1X A;  3J9S A;  4M00 A;  3DUI A;  3DEC A;  2G1M A;  1O8P A;  1SZB A;  1AYN 1;  5EYY A;  1C5H A;  3K77 A;  2BBV A;  1ZM1 A;  3VLB B;  4P9I A;  1FMD 2;  2D6O X;  3DGT A;  2WLP A;  4TWT A;  1DP0 A;  3AP5 A;  1GOG A;  4PF5 A;  3T2Q A;  4D69 A;  3ZMO A;  1OPM A;  1EP0 A;  1XNT A;  2WT1 A;  3HN3 A;  3LKJ A;  3MDP A;  3OGJ A;  2GNT A;  5CVR A;  3ACG A;  4Z2A A;  3LFI A;  5AC9 1;  4XCA A;  1WKY A;  4Q8K A;  3AB0 A;  1MS3 A;  1HRI 1;  3P5B A;  2YBS A;  2YUE A;  3KQR A;  5J7M A;  2EXI A;  5FZB A;  1O8S A;  1A78 A;  4IEY A;  5FV3 A;  5GM0 A;  3WG4 A;  1QH7 A;  3HOB A;  3POI A;  1W6N B;  2XWJ B;  1HRI 3;  3H3U A;  2EXH A;  4C90 A;  3WNL A;  1HQW A;  2A6Z A;  4QT6 A;  1JHN A;  4Q0Q A;  4KL1 A;  5E1R A;  3NJX A;  3PUA A;  5IK7 A;  4LEJ A;  4X8P A;  4E2Q A;  1M06 G;  1OLR A;  3QH6 A;  3ZYG A;  1T2X A;  1ODM A;  1RUD 1;  2HJI A;  3ZIW A;  4MXW B;  1Y9G A;  1LGB A;  4I2O A;  1WA4 A;  2WO1 A;  1WCS A;  4OYU A;  4UFM A;  4Q4Y 2;  1T6G C;  3N7K A;  1VAL A;  3PL0 A;  1POV 0;  3UT0 A;  1AXZ A;  3UKN A;  4PF1 A;  2Q4S A;  1PM4 A;  1TZO A;  2XJR A;  4GA9 A;  3WG1 A;  1JZ4 A;  3HR9 A;  1N1V A;  2ARX A;  5LY2 A;  2J1R A;  3ZXE A;  4FQ4 A;  2Y26 A;  3AP9 A;  2JG8 A;  4H3W A;  5F5Q A;  1WMD A;  3CLP A;  2QBX A;  2WYF A;  3GM8 A;  2W52 A;  2ZGS A;  4AOC A;  5KXB A;  4NHX A;  3RJ2 X;  2HEV F;  4QX8 A;  2RE9 A;  4B1M A;  1JH5 A;  1AZD A;  2D6K A;  2RDR A;  3ACH A;  3I7D A;  4UFJ A;  1XSQ A;  2JD4 A;  4YZ4 A;  3S7E A;  2AEZ A;  3E5U A;  3PIJ A;  2UYB A;  2YZ4 A;  4OHX A;  2X10 A;  1D7P M;  4RA0 A;  4MUV A;  1OVS A;  1SLB A;  1AUY A;  2XG3 A;  4IXL A;  5BV6 A;  1LJ7 A;  2QVS B;  1LU1 A;  1HXS 2;  3S5Q A;  1PHM A;  1WCK A;  1JU3 A;  3A21 A;  2BFU S;  3BOW A;  3Q9O A;  3WDW A;  5FJH A;  3TOJ A;  3CNA A;  3VDC A;  2ZHK A;  3NNL A;  4J1W A;  3LAG A;  2O0O A;  1XYP A;  1SG3 A;  5LA2 A;  4YYO A;  2WFF 3;  1Y3T A;  1X7N A;  2DVB A;  2P37 A;  3HIF A;  3SIS A;  3W59 A;  5CAZ A;  2RMU 1;  1SDW A;  1ZA7 A;  3SCH A;  2V4A A;  3AP7 A;  1HB3 A;  2KXL A;  1RVF 1;  2CAU A;  4LTA A;  2WZP P;  3VBS A;  3R05 A;  1V70 A;  2BWA A;  3GF6 A;  3M4F A;  4WBB A;  1Z78 A;  3AYD A;  4XBN A;  3MBW A;  1C8M 1;  3AMP A;  3POG A;  2RR1 2;  4GJY A;  1PX3 A;  1W9F A;  4YVS A;  3N9O A;  4YRD A;  1GNZ A;  2JDN A;  2X5I A;  3PTR B;  4CDU A;  4KNC A;  1PO1 2;  1VRH 1;  2QQN A;  3E97 A;  1D4M 1;  5FPU A;  4PIX A;  1JZ3 A;  3W20 A;  3ZN6 B;  4YAR A;  4OMC A;  3VZN A;  2OII A;  3H8O A;  1DU3 D;  1WLC A;  4LE4 A;  1QWR A;  4DQA A;  4Q5O A;  4NRP A;  3VKO A;  4Y5Z 0;  2VUJ A;  3N4M A;  1WMX A;  2JEN A;  2I2S A;  3B3Q E;  2ZJC A;  5EJ1 B;  1JBC A;  1FMD 3;  2Z69 A;  1MZ6 A;  4GIQ A;  4YW2 A;  4AL9 A;  2W3J A;  5LB6 A;  4CUC A;  2PHF A;  1R64 A;  3AKR A;  4JKM A;  1AL0 G;  5GZG A;  3CF6 E;  3O1R A;  1UPI A;  1S0C A;  3RSJ A;  1Y9Q A;  3O1O A;  3RZH A;  1ENQ A;  4FFF A;  3PUQ A;  5J1X A;  4AQS A;  2WSV A;  3MUY 1;  1VJ2 A;  3PU8 A;  1JYI A;  2IWG B;  3AZZ A;  2AR6 A;  1W6P B;  4LA3 A;  4UWD A;  2WII B;  1VR3 A;  3VBU A;  1DLL A;  1OOP C;  3AMM A;  4IV1 C;  4Y22 A;  1VBA 2;  4AGR A;  2O14 A;  2V5Y A;  3SH5 A;  1OQE A;  5C4W A;  4LIV A;  4YVS B;  4FI9 A;  2P3Y A;  3ZXJ A;  4CCL A;  1RUD 2;  3C3V A;  3R4D B;  1RB8 G;  1LUL A;  1FNZ A;  3WW4 A;  5FY4 A;  4Q27 A;  4Q0P A;  1ZZ9 A;  4BXS V;  2BZD A;  1YFU A;  4KGQ A;  5A70 A;  2RS1 1;  1CGP A;  4PBP A;  4Y1X A;  2WZR 1;  3MLL A;  3I54 A;  4TTG A;  3WHU A;  4PLN A;  3K51 A;  3S7I A;  1QXP A;  1YQ8 A;  1CVN A;  3CZU A;  3N9P A;  1O91 A;  2LUW A;  2GC2 A;  1CAW A;  1V6O A;  2GNB A;  5H9R A;  4EE2 A;  4HXC A;  5LZ6 A;  4LIT A;  5D21 A;  3OBZ A;  3V0B A;  4QU2 A;  2ETE A;  4AHX A;  4ARY A;  1AVB A;  2EIC A;  2HWB 2;  5F37 A;  3CO2 A;  3VZJ A;  5FZH A;  1SBD A;  1SLA A;  2MEV 1;  2ZMN A;  4AED A;  2JE7 A;  5FMC A;  1HW5 A;  3LB9 A;  1WW7 A;  3I4I A;  1W6M B;  2VUC A;  5F5I A;  1B35 A;  2DUP A;  5A33 A;  3WZ1 A;  4CUA A;  5KHJ A;  4H14 A;  4DFS A;  1XQN A;  1ND2 B;  2D3R A;  3B9C A;  4OZX A;  1PVX A;  1U5X A;  4I30 A;  3ZYF A;  1YYN A;  5FPV A;  4AHY A;  4QX5 A;  1RUE 2;  2DBI A;  4LUL A;  3H9A A;  4DY5 A;  1V9U 1;  1O3R A;  1UQX A;  2OX0 A;  2IVI B;  3QH7 A;  5FZK A;  4CVU A;  4HN1 A;  1HN0 A;  1YWK A;  3I59 A;  5FZL A;  1DYP A;  5H9Q A;  4NAO A;  4LKE A;  1H8T A;  5C33 A;  1IGO A;  1ZZ8 A;  5I8T A;  4F83 A;  1V6M A;  1NCQ C;  3ZSM A;  2CU5 A;  1CAW B;  3IAQ A;  2VE1 A;  5KC5 A;  4OHV A;  4Q2F A;  2HBU A;  4C8D A;  3FUO A;  5FIX A;  4KQ7 A;  2XHN A;  2D6N A;  3KVA A;  4IET A;  5I93 A;  1UW8 A;  2XBO 2;  2FCT A;  2SBA A;  2MHF A;  3WDY A;  1M4W A;  2HH9 A;  4XAA A;  3U78 A;  3AL5 A;  1YJL A;  2ORX A;  4XET A;  1RUH 2;  3OB8 A;  3AKS A;  1S2B A;  4NO4 A;  4NIH A;  3USS A;  4CU8 A;  2ZX0 A;  4E4S A;  5C8C B;  1ZRC A;  2BNO A;  1DQ0 A;  1V6I A;  5JAX A;  2ARB A;  1YCI A;  3TEZ A;  2A6V A;  1QHD A;  2W1Q A;  5LAS A;  1IS4 A;  1GWM A;  4NRO A;  1VBA 3;  2GNM A;  4XF0 A;  2XWB B;  3SH3 A;  1UO9 A;  1AJK A;  3OUH A;  4CZS A;  2J1S A;  4O7X A;  1E5I A;  1QOO A;  1MS5 A;  4LO4 B;  2WNO A;  3OYW B;  4RS5 A;  4LPL A;  2V72 A;  4M3C A;  4YWA A;  5I8S A;  3UJQ A;  4BZ4 A;  4CCK A;  4XUQ A;  1VMH A;  2ZGT A;  4MVT A;  3VD4 A;  3QBQ A;  2D5F A;  2EA7 A;  1ZVF A;  2YMZ A;  4GKX A;  2OS2 A;  4QM8 A;  5CYY A;  1CQ9 A;  5L19 A;  1QIQ A;  4YW6 A;  1X50 A;  1NA1 C;  1H2K A;  1JS9 A;  2E51 A;  1SFP A;  5DUV A;  1ZA4 A;  3E5X A;  3PUI A;  3HD8 B;  4QXB A;  3NRU A;  5BUV A;  1TNR A;  3ZFF A;  5FYV A;  5C8C C;  4NPM A;  2EID A;  2D43 A;  4OVE A;  2Q8O A;  1IOA A;  3S6P A;  3VBF C;  4YZ2 A;  5FFO C;  3KWV A;  2G19 A;  2QUO A;  5FK8 A;  2DUO A;  4EJR A;  1X8E A;  1NCR C;  3FMG A;  4TYS A;  3K48 A;  4CA9 A;  4UW4 A;  3A0K A;  1IS6 A;  3KS7 A;  3U14 A;  4DNY A;  3O1M A;  1OD5 A;  1JZ2 A;  2RS5 1;  4M3C B;  2BPA 2;  1AXY A;  1TMF 1;  4XFH A;  3GZT B;  5FP3 A;  4ES9 A;  3FHI B;  3I3Q A;  1I5Z A;  2R6Q A;  3JQW A;  4N53 B;  4RS5 C;  3IIA A;  5FY7 A;  4QDS A;  1ZBA 2;  4UFI A;  2NM1 A;  2NMN A;  3POY A;  5L7O B;  3AZY A;  3ZO0 B;  5EIY B;  1HLC A;  3NNM A;  5DG2 A;  3VKL A;  1MQT C;  4JRL A;  1DGW X;  4RR3 B;  5DAB A;  3WVJ A;  5HI0 A;  4LK6 A;  1N47 A;  2BUK A;  4XXP A;  4Y1Y A;  4EN6 B;  5C5T A;  3WG3 A;  4YM1 A;  3FUQ A;  1GZC A;  4CP2 A;  2VCA A;  3CJI B;  5LEJ A;  2DTY A;  1NLS A;  4HZF A;  3UV9 A;  4ZZ5 A;  5HBA A;  4Q26 A;  5CAD A;  2JDU A;  5B4X A;  1KD7 A;  3JD7 2;  2PQQ A;  1BHG A;  1SHW B;  4AQT A;  1TE1 B;  1RGS A;  4JGZ B;  1IKQ A;  3PVE A;  1RUO A;  5I91 A;  1GZW A;  2LAL A;  1E5S A;  3D0J A;  3IM0 A;  4AFA A;  4OZO A;  2GMM A;  4PQQ A;  5A7N A;  1W9T A;  3IPV B;  3PJQ A;  5CIR A;  2WQZ C;  5DZF A;  5HXM A;  1EUT A;  1GV9 A;  2GC1 A;  1FI2 A;  1FYU A;  1SFY A;  3LA2 A;  3POB A;  1UY2 A;  5FZ0 A;  3KGL A;  3MFC A;  5SV5 A;  2QQP A;  1K5M A;  1LNS A;  1PVC 3;  2OW4 A;  4YVW B;  3VHR A;  2GSY A;  2R07 3;  3E6C C;  1VBE 1;  3AP4 A;  1W90 A;  2C4X A;  5FUI A;  1LHO A;  4JDN A;  3KHC A;  1CAX A;  3OPZ A;  2VR4 A;  5BXX A;  2CSG A;  5ANN A;  4QHB A;  2QTW B;  2JDP A;  3VBF A;  1UX7 A;  1AR8 2;  1GP5 A;  2GME A;  5HCH A;  4MX3 A;  4GXL A;  1F5J A;  3LDK A;  4CCC A;  4PDW B;  2WBK A;  1KRI A;  1W6N A;  2O1Q A;  2HWC 2;  4EN9 B;  1B35 C;  2BGO A;  1JOJ A;  3L2Y A;  5GZC A;  2JDA A;  1ZZ6 A;  2I07 B;  5LEK A;  1CPN A;  1ULF A;  3NL1 A;  4FSJ A;  1PMH X;  3BVC A;  4ONU A;  1C4R A;  5C3S A;  1XU2 A;  1RUC 1;  5BNP C;  1SLC A;  3W9A A;  1UKR A;  3B02 A;  5F5A A;  5FYS A;  2ILM A;  1VBC 3;  4NHK A;  4IEQ A;  3J8F 1;  4PIY A;  4A3X A;  4CCJ A;  2VQ0 A;  1W6Q A;  3OD0 A;  1ACC A;  1YJK A;  3CJX A;  4LOR A;  4XAC A;  3PNA A;  1Y7B A;  2Q8C A;  5JDB A;  5FKB A;  5B2G B;  3H50 A;  5LCW L;  4CXX A;  5JSP A;  2R04 1;  3ZSK A;  3VKN A;  1SDD B;  3GAL A;  1XYN A;  4B7K A;  4ZPI A;  2VOW A;  4QB6 A;  1CAX B;  4EWD A;  1C8M 2;  2PYT A;  1IPJ A;  2RR1 1;  2Y6L A;  1QJX 1;  4YPJ A;  2OYZ A;  4CPB D;  1RXF A;  5IVJ A;  2DCZ A;  2VZ3 A;  1RL3 A;  2Y6J A;  2QKD A;  2Y60 A;  4WVM A;  2P34 A;  2AC1 A;  2RJ2 A;  4XW3 A;  3VD5 A;  3AP6 A;  2IXC A;  4GWM A;  3EYP A;  3JXS A;  3VBU C;  2PN5 A;  1AR7 1;  2ZGQ A;  4Z1V A;  4HK8 A;  4CSW A;  4MG2 A;  4LBK A;  5C8W A;  2JIC A;  4FQZ A;  5F5C A;  3U37 A;  1AX0 A;  1ZZB A;  4I01 A;  1C1L A;  3KVB A;  1NUK A;  1W2U A;  1ENX A;  4IEU A;  1AYM 2;  2ZAC A;  2AAC A;  4BDV B;  2DYC A;  4FTB A;  3TRS B;  3W5M A;  5LRS A;  3MUZ 1;  4V1P A;  4PLM A;  1BQP A;  2RM2 1;  5BY5 A;  3UKT A;  3DXT A;  3LCP A;  5JXJ A;  4NIA A;  3QCW A;  1OLQ A;  5GLZ A;  1OBN A;  2C26 A;  4YW4 A;  3R6S A;  3ILR A;  2YY1 A;  5FZA A;  2E33 A;  3WP4 A;  3W5N A;  1NG0 A;  4MGK E;  1MR5 A;  4OQ8 A;  2G9Z A;  1ULD A;  1SAC A;  2PHT A;  4ZU5 A;  5GZD A;  4C1W A;  2VNO A;  3ASI A;  1UU6 A;  1ZZC A;  5DG1 A;  3H8R A;  1AR9 3;  1CPM A;  1LAJ A;  2MNG A;  4QX3 A;  4Y1Z A;  5GLT A;  4OI1 A;  1LOA A;  5HV0 A;  3R4U A;  4LO5 B;  3E6D A;  4HON A;  1R08 3;  3RPQ A;  2B46 X;  3UK9 A;  5AVA A;  1W0P A;  5A6X A;  5IT6 A;  5JVV A;  4HKL A;  3EJK A;  2WO3 A;  1VAV A;  1A34 A;  1VP6 A;  1SFN A;  5IVC A;  2ZGL A;  3CZJ A;  1GOH A;  3O0W A;  5BNN B;  4OMD A;  3M3E A;  3KB5 A;  1VBE 3;  4M3C E;  2WJS A;  3HQX A;  5FPL A;  5T52 A;  3HEI A;  4LBJ A;  4KBZ A;  4YNI A;  3DYP A;  4AGG A;  1GZT A;  4GUL A;  1YQ2 A;  4XVH A;  2DV9 A;  5B4N A;  3MIB A;  5J36 A;  2JKB A;  2VMD A;  3VHN A;  4BQX A;  2VBD A;  3KV6 A;  4N9H A;  1RIR A;  2PXJ A;  3U0Z A;  5A32 B;  3GZU C;  2DFC A;  2HWF 2;  3N9M A;  2LW8 A;  1LES A;  2YBK A;  3INA A;  3WXP A;  4B29 A;  4NPR A;  2W92 A;  4P5H A;  5A7Q A;  4WV8 A;  5A7S A;  2YYO A;  1LB2 A;  1W05 A;  4DOU A;  1OVP A;  2X53 S;  3RMY A;  4AZZ A;  4BQ1 A;  3VBR A;  1W2A X;  1BKZ A;  4ZU4 A;  1EV1 2;  3AZX A;  3T0A A;  2R7E B;  4Q4V 1;  3ZKU A;  2PEL A;  3ZYJ B;  4MSV A;  1W6O A;  4ZY9 A;  4CCE A;  1HKD A;  2ZKN A;  3KHB A;  4LJH A;  3WD5 A;  4CCO A;  5IK8 A;  1I9R A;  3HPN A;  3T09 A;  5C4W B;  1PZ7 A;  2XBO 3;  2JEM A;  3GCW A;  4BM8 A;  5C4W C;  2DCY A;  2JG9 A;  4CRQ A;  4Q1P A;  5LY1 A;  1VRB A;  3FE5 A;  1YFY A;  2A73 B;  4CEW A;  1FMD 1;  4AG4 A;  2VGD A;  1LEM A;  1JYW A;  1RUJ 3;  2BV4 A;  5DDJ 2;  3J7M A;  5DUW A;  1WCD J;  1POV 3;  2R16 A;  3I97 A;  3V0B B;  4HAN A;  1Q8P A;  5IW0 A;  3V65 A;  4XMI A;  4UW6 A;  1MEC 1;  4B8E A;  1LU2 A;  5KWR A;  4AED B;  4DMI A;  4JTO A;  5C3P A;  3DF0 A;  1ASJ 1;  1H1M A;  1YNA A;  2Y6F A;  2C9A A;  2G9F A;  3GZE A;  4FPG A;  3VZM A;  1F9K A;  5FYI A;  4H55 A;  3POS A;  3MV0 1;  3GJA A;  4YG3 A;  5FY0 A;  1JUH A;  3VZO A;  2WZE A;  1DF0 A;  1U0A A;  2X09 A;  4MXW A;  5A7W A;  4PBO A;  4DRR A;  4PJY A;  4Y5S A;  4DUW A;  4FPY A;  4P08 A;  2WT0 A;  1Q8V A;  2X5I C;  5CZK A;  4NID A;  3RYR A;  1XNA A;  2VNG A;  2CYF A;  3HN1 A;  2YBP A;  4JGY B;  3WW2 A;  5A3O A;  2JG9 B;  2HWD 2;  3G7D A;  5F6L B;  1EPZ A;  4BYY A;  1VBD 1;  3ZXD A;  3CDZ B;  4AFD A;  5LA1 A;  2Z2S B;  2UY9 A;  5BNO A;  1YHF A;  2MPF A;  2E32 A;  2WSU A;  1H8T B;  1KDM A;  3U10 A;  4BWO A;  4BLI A;  1GP4 A;  1V6K A;  5IVB A;  1QNY A;  5L9V A;  4FP2 A;  1JZ5 A;  1NCQ A;  4LBQ B;  3WNM A;  4H2A A;  2P6H A;  2VNV A;  1ULP A;  4XTM A;  2FMY A;  3O0V A;  1ODN A;  1ZBE 1;  3ES1 A;  3VD7 A;  3SH4 A;  1RUF 2;  3ZSJ A;  1KFX L;  1O5U A;  1HXS 3;  2IZW A;  1BZW A;  4NRM A;  5KHH A;  1F15 A;  5C9A A;  1URX A;  5ABJ B;  3C7G A;  1BLZ A;  2VM9 A;  2C9K A;  1AYM 1;  1F4H A;  2HWE 2;  4CPB A;  3MW3 A;  4JQR A;  5F7U A;  1COV 3;  4P9J A;  1OC1 A;  1Q56 A;  3OD4 A;  4Z82 A;  5A3M A;  1PGW 1;  5KC6 A;  4AFM A;  4OQ9 A;  3MIH A;  4LHS A;  3ZFF C;  3M2M A;  1ULG A;  3POF A;  4ASL A;  2VEC A;  5I0T A;  4FAH A;  2PTM A;  4ZU7 A;  1DQ6 A;  2QNK A;  1L7Q A;  1FOD 1;  2D7F A;  1VBE 2;  1LHN A;  3AXD A;  2RMU 2;  1HQN A;  4IW3 A;  3NKG A;  4UW5 A;  1XXN A;  3IDA A;  2ZEX A;  1QOT A;  3B94 A;  4C0H A;  4RQP C;  3VZL A;  3T4V A;  3KCC A;  1ASJ 3;  1PZ9 A;  1NCQ B;  1GLH A;  3RNS A;  3NNG A;  3KLS A;  3USU B;  2R06 3;  1ZRE A;  2WWS A;  1COV 1;  1A8D A;  2VUD A;  1R09 3;  4AEM A;  2PAE A;  1ENS A;  4XDP A;  3WQ0 A;  1CR7 A;  5BNP B;  4CU6 A;  1DZT A;  2VQA A;  2ZGO A;  4UFK A;  2JWP A;  3A7Q A;  2B7Y A;  2BP6 A;  3T2O A;  3NKT A;  1RUC 2;  2R06 1;  4YM2 A;  2XON A;  4COW A;  2D6L X;  5AC9 3;  1RTV A;  2Z42 A;  2A3X A;  4E4Z A;  5SV8 A;  1JOB A;  4GJZ A;  4P5Y A;  1AXK A;  4QQH A;  1IKP A;  2ZKL A;  1IS3 A;  1RUG 2;  1V9U 3;  1RHI 3;  3P3P A;  4FOV A;  3S57 A;  4I02 A;  2W68 A;  4WVV A;  3ZFG B;  4XIO A;  4M0N A;  1YIF A;  2MEV 2;  4K7J A;  2PLV 2;  3GBG A;  3AMQ A;  3GJB A;  2OKX A;  3RG0 A;  5ERL A;  4W4Z A;  2J1T A;  3WNK A;  1OF4 A;  4UOJ A;  4KGG A;  1SLI A;  2JJ6 A;  4IV3 B;  3ST7 A;  5I0S A;  2H6C A;  2Y0O A;  3Q8C A;  1QJY 2;  4Q0U A;  4LQR A;  3O14 A;  4O65 A;  1U5Z A;  1LEN A;  1RUG 3;  1V9U 2;  2CWM A;  3PME A;  1Q8O A;  5LAT A;  4F3J A;  3AL6 A;  1W8F A;  4CDQ C;  1WD3 A;  3VD3 A;  5J3U A;  1GBG A;  4DRV A;  2HBT A;  5LK5 A;  4DEQ A;  5JOX A;  4YGE A;  2DVA A;  4XQD A;  3A0N A;  4XBQ A;  1UY4 A;  4L11 A;  5DUU A;  3KV5 A;  1CAU B;  3LWC A;  5F1R A;  1D2Q A;  4K21 A;  1UY1 A;  4YG6 A;  2NYY A;  5I8Y A;  3ZFG A;  4GKY A;  4WM8 C;  3JUU A;  1MS9 A;  2CV6 A;  1ZYB A;  3FFZ A;  4FPF A;  2J1E A;  2OZJ A;  3CJI C;  4XMA A;  5BPX A;  1QJF A;  5C5U A;  1HV1 A;  4RGA A;  4AFB A;  1NLQ A;  4IE7 A;  3ACL A;  2D44 A;  2DVF A;  3J7N A;  3ZXF A;  5ABJ C;  3RYK A;  4F7Z A;  2PAK A;  1OFS A;  4NOT A;  3MZH A;  1DBN A;  3IMN A;  3H42 B;  3THC A;  1PGW 2;  2VZU A;  1VMJ A;  4P02 B;  4UAP A;  4D7T A;  1YFW A;  4NHM A;  1K5M B;  3ZFE C;  2YU1 A;  2JE8 A;  4BQ2 A;  1LTE A;  4MHU A;  1KS5 A;  4ES8 A;  1NCR B; 
#chains in the Genus database with same CATH homology
 3HNM A;  2KD7 A;  1GU3 A;  2VZT A;  2VZ1 A;  1W0N A;  4QB2 A;  2XHN A;  2VQU A;  3C7E A;  1UY3 A;  2VZQ A;  1TVG A;  4QX1 A;  1K45 A;  2ORX A;  4MO3 M;  3OB8 A;  4QX0 A;  2WYS A;  2EIB A;  4CU8 A;  3ETP A;  1UYY A;  2Y8K A;  3WF4 A;  3WQB A;  3VD9 A;  2VMC A;  3F2Z A;  1W8O A;  1W9W A;  2BGP A;  2W1Q A;  5JMO A;  2VZS A;  3K75 B;  1W9S A;  4DXR A;  2V5D A;  3ABZ A;  1NAE A;  2J1S A;  2WAB A;  2W94 A;  2CDO A;  5JUV A;  4ZXE A;  4LPL A;  2V72 A;  1JYX A;  4XUQ A;  3VD4 A;  4JHZ A;  4M4R A;  2VZP A;  3GDB A;  5CYY A;  3SKV A;  1JZ6 A;  1W8N A;  1EUU A;  3LEK A;  3LEG A;  3PUI A;  3NRU A;  3LE0 A;  1UWW A;  2YC4 A;  3ZM8 A;  3VDA A;  3OG2 A;  3FN9 A;  2EID A;  1OH4 A;  1UYX A;  2VO5 A;  2Y6H A;  2ZEY A;  1CIY A;  2W5F A;  2WN2 A;  3MO4 A;  1KGY A;  1L7R A;  2XOM A;  4XUP A;  3UNP A;  1UMI A;  1JZ2 A;  2WQ8 A;  2HLE A;  3OGS A;  3UES A;  1UZ0 A;  5EJZ B;  2WUH A;  3HJR A;  4QDS A;  5EIY B;  4A41 A;  2DDU A;  2WO2 A;  1JZ8 A;  2QQL A;  2VCB A;  3DYM A;  1PX4 A;  1XPW A;  4A44 A;  2VCA A;  2VOT A;  1P8J A;  1TG7 A;  2ZEZ A;  4ZZ5 A;  4W8J A;  2WAA A;  4W50 A;  5B4X A;  2ZXQ A;  1GUI A;  3I2J A;  1BHG A;  1SHW B;  3I3D A;  4QB1 A;  4QX2 A;  3WF0 A;  5A1A A;  3OBA A;  1J83 A;  3WEZ A;  2BER A;  4OZO A;  4PQQ A;  1UXX X;  1W9T A;  3DYO A;  2W1U A;  3CMG A;  5HXM A;  2YB7 A;  1EUT A;  1JYV A;  4QDR A;  5IFP A;  2ORZ A;  3C7F A;  1UY2 A;  1LNS A;  1JHJ A;  1XC6 A;  2C4X A;  5FUI A;  3WF2 A;  4IUG A;  1UXZ A;  2VR4 A;  1US2 A;  3T2P A;  3LEI A;  4AAX A;  2B9V A;  3LPF A;  1UX7 A;  3NJV A;  2WBK A;  4RYD A;  1J84 A;  2BGO A;  2JDA A;  1PMH X;  3A23 A;  4JX0 A;  4MGS A;  2W95 A;  3CIH A;  3C7O A;  4XUN A;  5JXH A;  4QDQ A;  5IHR A;  1ULO A;  4D0Q A;  5LCW L;  4MGQ A;  2XQX A;  2EIE A;  1SDD B;  2PQS A;  2YFZ A;  3K46 A;  5JXG A;  4QB6 A;  3T0D A;  3CKH A;  4XUO A;  4TXW A;  2QQJ A;  5DPN A;  4YPJ A;  2Y6L A;  2VZR A;  3IAP A;  2VZ3 A;  2Y6J A;  3C8X A;  4UI9 L;  3CQO A;  2RJ2 A;  3VD5 A;  3K4A A;  4D8M A;  3OEA A;  4JKK A;  4CU9 A;  1US3 A;  3EYP A;  3ACF A;  3JXS A;  3SKJ E;  4DXT A;  5JR2 A;  4DEV A;  2WAO A;  3U37 A;  1RYY A;  1PMJ X;  1W99 A;  4PT6 A;  2VMF A;  4GWI A;  1NUK A;  4DUX A;  1JYN A;  1KEX A;  2RVA A;  3J7H A;  4BDV B;  3FHQ A;  1JU4 A;  3W5M A;  3MUZ 1;  1UY0 A;  5JXJ A;  2J1U A;  2JKX A;  3BN6 A;  2VCC A;  5HPO A;  2C26 A;  2E26 A;  4ARX A;  3WSO A;  3OEB A;  2E33 A;  3W5N A;  2YC2 A;  4BK5 A;  2QQM A;  4ZZ8 A;  1DLC A;  3GXU A;  4L0P A;  3IB3 A;  3WF3 A;  2ZEW A;  4QX3 A;  1K12 A;  3AC0 A;  4KI5 M;  4KWU A;  3BGA A;  3THD A;  2WO3 A;  1H6Y A;  4E8D A;  5C70 A;  1IQD C;  2VTF A;  3CZJ A;  1GOH A;  4A45 A;  1K3I A;  4OMD A;  4A42 A;  4A4A A;  2VZV A;  3HEI A;  3III A;  3C7H A;  4ET7 A;  3DYP A;  4MAD A;  4XVH A;  1YQ2 A;  5B4N A;  1CZV A;  3T08 A;  2VMD A;  3A22 A;  2J7M A;  2L9L A;  2W87 A;  2YG0 A;  2DCK A;  2QQK A;  2LW8 A;  4QPW A;  3T0B A;  1GQP A;  1GNY A;  2W92 A;  3P6B A;  4DUV A;  3FHA A;  2B4K A;  3T0A A;  2R7E B;  3DEC A;  3I3E A;  4ZY9 A;  1O8P A;  3WNO A;  1GMM A;  1H6X A;  3HPN A;  3K77 A;  3T09 A;  2Y64 A;  1NX9 A;  3PUH A;  3HNY M;  1DP0 A;  1GOG A;  3T2Q A;  2VL4 A;  4E8C A;  1XNT A;  3HN3 A;  3ACG A;  4Z2A A;  5JXI A;  2QQO A;  4AG4 A;  1WKY A;  1JYW A;  3P1I A;  1O8S A;  3I2F A;  3I97 A;  2E31 A;  2CDP A;  4BJ0 A;  2HYX A;  3HOB A;  1K42 A;  3WNL A;  3ECQ A;  3NJX A;  2J1V A;  3MV0 1;  3EB7 A;  1OD3 A;  2WZE A;  1T2X A;  2X09 A;  3LPG A;  4DUW A;  4P08 A;  3FL7 A;  4GWJ A;  2WO1 A;  5CZK A;  4OYU A;  3K4Z A;  1XNA A;  4PF1 A;  2X05 A;  3CDZ B;  5LA1 A;  4GZ9 A;  4XUR A;  1JZ4 A;  2E32 A;  3WNP A;  2J1R A;  1NKG A;  1F4A A;  4CUB A;  3HNB M;  4OUE A;  2Z4F A;  2QBX A;  2VZO A;  3GM8 A;  1JZ5 A;  3WNM A;  1ULP A;  3ACH A;  5IYY A;  3VD7 A;  2QQI A;  2X10 A;  1D7P M;  5G04 L;  3C7G A;  1JU3 A;  3A21 A;  2VM9 A;  2C9K A;  1F4H A;  3VDC A;  5DQ0 A;  5F7U A;  4CU7 A;  5LA2 A;  1SG3 A;  3GGL A;  4LHS A;  4RN5 A;  2VC9 A;  3UET A;  1L7Q A;  1OF3 A;  5C7G A;  1WCQ A;  5DMY A;  3IDA A;  1GOF A;  2ZEX A;  4QAW A;  3MBW A;  1PX3 A;  1MPX A;  3NNG A;  3WF1 A;  5IJR A;  1DYO A;  4JKL A;  2V4V A;  2QQN A;  1JZ3 A;  4OMC A;  4CU6 A;  3A7Q A;  3LQC A;  3T2O A;  5EJ1 B;  4XZU G;  2XON A;  4CUC A;  2W3J A;  4XUT A;  5C71 A;  1R64 A;  4P5Y A;  4JKM A;  4DXS A;  5G05 L;  5J1X A;  1JZ7 A;  3MUY 1;  1HN1 A;  4M4P A;  2VJX A;  5IFT A;  2W1W A;  5LA0 A;  2OKX A;  3ACI A;  2VQT A;  4W4Z A;  2J1T A;  3WNK A;  1OF4 A;  4UOJ A;  3E1F 1;  2LS6 A;  2Y6K A;  3SEP A;  2WDB A;  1O59 A;  4FI9 A;  4BK4 A;  3WNN A;  2W46 A;  2Y6G A;  3I2I A;  2W1S A;  4LQR A;  2WN3 A;  3VDB A;  4BXS V;  2BZD A;  5DN2 A;  1UYZ A;  1JI6 A;  4TTG A;  4A3Z A;  2W47 A;  3I2G A;  3VD3 A;  3CZU A;  3OGV A;  4DEQ A;  3OGR A;  4KMQ A;  4MOA A;  2J1A A;  1UY4 A;  2DCJ A;  2EIC A;  4ARY A;  3I3B A;  2RV9 A;  3D3A A;  1UY1 A;  3SEE A;  2WZ8 A;  1CZT A;  1CX1 A;  2J1E A;  1CZS A;  5I0D A;  2YFU A;  2JD9 A;  1UMH A;  2W9X A;  4CUA A;  3I2H A;  4P00 B;  2VME A;  2J22 A;  3I2K A;  1I5P A;  3NQH A;  4CVU A;  3K4D A;  3THC A;  2ID4 A;  2VZU A;  4P02 B;  4UAP A;  1OT5 A;  2JE8 A;  4A6O A;  4HG6 B;  3IAQ A;  2BBA A;  3MV1 1;  4LKS A;  2W91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...