1D7PM

Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
LNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNCLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAGULATION FACTOR VIII PRECURSOR
publication title Structure of the C2 domain of human factor VIII at 1.5 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1d7pM00
5JXIA 3WF1A 4MOAA 3MV11 2Y64A 3IDAA 3WNNA 3VD7A 3LEKA 3VD4A 4QAWA 2CDOA 1GOHA 5C7GA 2J1EA 4A44A 5I0DA 2VZTA 1H6YA 2WUHA 3P6BA 2WZ8A 3I3EA 4ZZ8A 2QQKA 1BHGA 4DEVA 2WO2A 3C7OA 3D3AA 1XPWA 3C8XA 3SEPA 4Z2AA 1PMJX 3F2ZA 4P02B 2JKXA 1XC6A 2E32A 2E26A 2Z4FA 2ORXA 4DXTA 1XNAA 3UNPA 1ULOA 2R7EB 3WF2A 5IFPA 4CUBA 3WNKA 1MPXA 5JXHA 1JYWA 3GXUA 3IAQA 5JXJA 3OB8A 1W8NA 3NNGA 4PT6A 4JKMA 1W9TA 2BBAA 3AC0A 1UY3A 1L7QA 1OF3A 4GWIA 4CU6A 1JZ7A 2ZXQA 5IHRA 3A7QA 3C7HA 3CZJA 2W91A 4KI5M 3HNYM 3NQHA 2VZSA 5B4NA 3OGRA 3W5NA 3LPGA 3I3DA 4XURA 1JHJA 4QDRA 4PF1A 3BGAA 3UESA 4AG4A 2BZDA 1NUKA 4OYUA 4MGSA 1JZ5A 3LE0A 4XZUG 1UX7A 1US2A 3CKHA 4P5YA 1J84A 2VZ1A 5IFTA 3K4DA 5HXMA 1JU3A 5DPNA 2RV9A 3OBAA 1DP0A 4E8DA 3CDZB 2ORZA 4GWJA 5G04L 2QQIA 2V4VA 2WZEA 4W8JA 1W9SA 5IJRA 1CZSA 3T2QA 2C4XA 1W99A 2QQLA 5LCWL 5FUIA 3WQBA 5HPOA 3OGSA 3LEIA 4AAXA 1K3IA 3DYOA 3THDA 1JYVA 1HN1A 3FHQA 4KWUA 2JDAA 2VCBA 2W47A 1UMIA 2YFUA 4ZXEA 2OKXA 3GM8A 3K77A 1UYXA 4P00B 5JMOA 4OMCA 2VCCA 3I2KA 5B4XA 4KMQA 1GOFA 3VDCA 3ZM8A 3VDBA 4OMDA 2VZVA 3HN3A 4D8MA 4A45A 3MBWA 1JI6A 2BGOA 1T2XA 1UY4A 2WBKA 4BJ0A 2ID4A 3WNPA 1LNSA 2BERA 3WF0A 3HEIA 4ARXA 1P8JA 4BK5A 4GZ9A 3C7FA 2ZEYA 3CMGA 3SKJE 4DEQA 2QQOA 3PUHA 1O8SA 4XUOA 2XONA 1KGYA 2EIDA 2J1AA 5LA0A 1TG7A 1K42A 2YC4A 2ZEZA 4BK4A 2DCKA 2X09A 4M4PA 3T09A 3K75B 2QQJA 5LA1A 4ET7A 4A6OA 1GUIA 2WO1A 1D7PM 1PX4A 2B4KA 2JE8A 1UXZA 1L7RA 3WF3A 3MUZ1 4TXWA 4JKKA 2Y6LA 5EJ1B 3LEGA 3T0BA 3WSOA 5EIYB 3T08A 2QQNA 4E8CA 2VO5A 3WNOA 3HNBM 2VQUA 3PUIA 1DLCA 2QQMA 2WAAA 2ZEXA 4QX2A 3GGLA 4MO3M 3NJXA 2L9LA 1JZ4A 4OUEA 1ULPA 1UY0A 3T2PA 3E1F1 3K4AA 2DCJA 4BXSV 1GNYA 2LW8A 3MV01 3UETA 2WABA 3I3BA 1OD3A 4MGQA 4QX3A 4DUWA 5JUVA 3OEBA 3DYPA 2W92A 2W95A 3I2JA 3A21A 4QX1A 1GMMA 3MUY1 2X10A 3ACFA 5EJZB 2WQ8A 3ETPA 5G05L 2VZ3A 2V5DA 3JXSA 4QPWA 2QBXA 1SDDB 1JYNA 2VMEA 1XNTA 4QDSA 1JZ3A 4FI9A 4OZOA 2Y6JA 3A23A 5JR2A 2WDBA 4ZY9A 4CU8A 2W1WA 4YPJA 2VL4A 3EYPA 2W1QA 4CUCA 3IIIA 1SHWB 3FHAA 4LKSA 2WO3A 3OG2A 4UOJA 1UY1A 4D0QA 5JXGA 2YG0A 4CVUA 3FL7A 1PMHX 2YB7A 3LQCA 2VMDA 4RN5A 2J7MA 2J1TA 1F4HA 1JZ6A 2XQXA 5A1AA 1JYXA 2E33A 1UYYA 2EIEA 2WN2A 2B9VA 4QB1A 2W9XA 2VZUA 5CZKA 3T0AA 5J1XA 3I97A 1R64A 1UZ0A 2VR4A 3DYMA 4DUVA 2BGPA 5DN2A 1CZVA 3OEAA 2C26A 1UMHA 2EIBA 1W9WA 4LQRA 2VQTA 3SEEA 3C7EA 1K12A 2J1UA 3NJVA 4CU7A 2WAOA 1JZ2A 4PQQA 1K45A 2VTFA 5C71A 4A4AA 1UY2A 1IQDC 1EUTA 3HOBA 1GOGA 4RYDA 3VDAA 3OGVA 2W5FA 1J83A 1DYOA 5C70A 2RJ2A 3ACIA 3HPNA 2VZPA 3CQOA 2CDPA 3WNMA 1US3A 2LS6A 2W1UA 1JZ8A 5F7UA 2VZRA 2W87A 2HYXA 3GDBA 4UAPA 2Y6HA 1O59A 2VC9A 4DXSA 1WKYA 3HNMA 5DMYA 4A42A 3WEZA 3VD9A 1YQ2A 2PQSA 2E31A 1GQPA 3ACGA 4XVHA 3VD3A 4QDQA 2VCAA 3ACHA 2DDUA 2WYSA 4MADA 4XUQA 4QX0A 2Y6KA 4XUPA 1UYZA 1O8PA 1OT5A 2VJXA 2VOTA 4HG6B 5LA2A 4JHZA 1PX3A 2EICA 2W1SA 4JX0A 2J1SA 5IYYA 3CIHA 1OH4A 1KEXA 4M4RA 3WF4A 2ZEWA 3K4ZA 2J1RA 1W0NA 4W4ZA 3THCA 1TVGA 1W8OA 3MO4A 2J1VA 3VD5A 4CU9A 2YFZA 3ECQA 4LHSA 1UWWA 2VZOA 3I2HA 5DQ0A 3FN9A 2RVAA 2W46A 3I2FA 3T0DA 4ZZ5A 1NKGA 4CUAA 4UI9L 4QB2A 3EB7A 1RYYA 3K46A 3T2OA 3J7HA 3W5MA 1H6XA 2Y6GA 4P08A 1JU4A 4DXRA 4A3ZA 2VZQA 4IUGA 1GU3A 4L0PA 1WCQA 3NRUA 1OF4A 3DECA 3A22A 2J22A 2C9KA 1CZTA 3ABZA 2V72A 1CIYA 2KD7A 1NX9A 2YC2A 1F4AA 4QB6A 2X05A 4DUXA 3IAPA 2VM9A 4JKLA 3C7GA 3IB3A 4W50A 2HLEA 3I2IA 1EUUA 1UXXX 4LPLA 3SKVA 2JD9A 2VMCA 2VMFA 2W3JA 2XHNA 2XOMA 4XUTA 3U37A 4ARYA 1I5PA 3LPFA 3P1IA 2W94A 3WNLA 1SG3A 1CX1A 3CZUA 2WN3A 3I2GA 5CYYA 4XUNA 4A41A 3HJRA 3BN6A 2Y8KA 1NAEA 4TTGA 4BDVB
chains in the Genus database with same CATH superfamily
4AQ2A 3KCYA 1A78A 4AI2A 4IGOA 2ZGTA 1PM4A 3NMBA 4QAWA 3ZKUA 4QXBA 3JBG1 1OBNA 2CDOA 3AFKA 2GH2A 5C7GA 5GZDA 1C57A 2PXJA 1TNFA 3VZOA 5I8YA 2PAMA 2VZTA 1RUE2 3BPSA 1CPMA 3P6BA 2WZ8A 1NCRC 4CA9A 3I3EA 1VAMA 2ZHLA 4XHBA 3S5AA 1W2AX 1Y7BA 4K8FA 2WO2A 1YNAA 2WQ4A 3WD5A 2CL2A 3ZX7A 3SEPA 3KQ4B 2B39A 2ZJCA 3JD72 3T4HB 1W04A 2RG4A 3MF9A 4P02B 4GKYA 2A6VA 2RMU1 4XOGA 4BQ1A 5AFBA 2XJSA 5IVBA 2GAUA 2NMOA 4YZ1A 5A70A 3VBHB 2DUPA 3T2TA 5FYIA 1LOAA 1XC6A 1E57A 1Y4WA 2CTVA 5FPZA 3ZIXA 1YQ6A 4RSUA 3QCWA 5GZCA 2E53A 4CCDA 2ORXA 1KRIA 4BWOA 4ASLA 5DDJ2 5LBEA 2A5ZA 2IXIA 2K2SA 1ULOA 3PMSA 4AFAA 4KGGA 1RUC2 2OQ7A 3WW4A 4CSWA 4YFWA 3NKGA 2XH6A 1VP6A 1ZRFA 4IGPA 3FC0A 1PO22 4CTEA 2CWSA 2R30A 4WM7C 1JYWA 1NQJA 5I0TA 2C24A 3GCWA 4PT6A 2Z42A 5DAVA 1TEIA 2NLRA 1D4VB 4S2DA 4DY5A 1AL0G 3PTYA 1AYN2 2ZXQA 5GM0A 2O8OA 4COVA 2FD8A 1GNZA 1VR3A 4FSJA 2ZHKA 2VULA 4AQTA 2PQQA 1AVBA 5B4NA 4Q4W3 1UL9A 3NKTA 3LPGA 2GC1A 1VBA1 2ET1A 4XURA 1ND3B 2JE9A 4F83A 1V6IA 4FAHA 4MGSA 2IFWA 4D6RA 2HWC2 3WT3A 3AYDA 2GALA 5IK4A 1RUG1 5FYHA 4AR2A 4XZUG 1US2A 2ZGMA 3N35A 3R4UA 5FPUA 4IEPA 2GMMA 2VZ1A 3K4DA 5HXMA 5FIXA 4DZGA 4R4XA 3ELNA 4XACA 1FATA 3LKJA 3ZFFA 3CDZB 4BYYA 2OPKA 4KWKA 4CRQA 3MIEA 3QH6A 4DOUA 2V4VA 1RUC1 3RG0A 4NHYA 3RYKA 1MEC3 2UYAA 3VZKA 2C4XA 4MZUA 1PO21 2I2SA 1FAYA 2XL7A 2QQLA 4HKLA 5FK7A 2BNOA 3AX4A 3RVHA 3MEPA 1VJ2A 2BW8A 3ZSMA 2EALA 3AL5A 3J4UH 5FR3A 3S0MA 4YGCA 3IDBB 3WV6A 3CJIA 4I02A 5APAA 1XU2A 3K2OA 1Z7S1 4IV1C 1AYN1 2W47A 1UMIA 4OCTA 1GWKA 2HYKA 4QX5A 2DVDA 4Q4Y1 4M3CE 1SBEA 4UF0B 2JEMA 3VBSA 4H3WA 4JRLA 4DS0A 1DGLA 5IUQA 1WLCA 3KGLA 2JG8A 1K5MB 3VBFB 3ZFEB 3ZM8A 1F5FA 1YLLA 1PMIA 1W2TA 1QDCA 3ZN4A 4E2GA 1S0JA 4XJZA 4JAAA 1RUH3 3HN3A 3RGBA 2XUMA 2ZPXA 2VG9A 2YZ4A 3I8TA 4U2AA 3S7IA 3WW2A 4A45A 3Q8CA 2HWC1 5FBJA 4NIIA 1T2XA 2EXHA 1QGLA 1XNBA 4Y5SA 2ID4A 1C8M3 2BERA 3QH7A 4ZU5A 5CFCA 3SISA 1BZWA 2W52A 1C8NA 1X7NA 1FYUA 4GZ9A 1NG0A 1VMJA 5EV7A 4XQ4A 3PUHA 1NLQA 2DBNA 3ON7A 1TMF3 2XJRA 2ZKLA 1HLCA 4LIVA 3ZYFA 4K3UA 4BK4A 2D40A 3LAGA 1W8WA 4YM2A 1RHI1 3KMHA 1OQEA 4NAOA 3K75B 4PJYA 2YMZA 2QQJA 5A33B 2YU2A 4AOCA 1JHNA 3NO8A 4IDZA 4AVTA 4K1ZA 2DVBA 3NVCA 2XVKA 3AXEA 5KR7A 2WO1A 3APBA 3OD4A 2AEYA 1LOFA 5C5TA 3E6CC 1UIJA 2NPIA 4CP9A 3EQEA 1W8TA 3L2YA 5FZAA 2ETEA 1EAH1 1I3HA 2XKPA 3WF3A 2ZAHA 4GB32 1YFUA 3LDKA 3MUZ1 4AI3A 3M7AA 3DKWA 1ZZCA 3LEGA 5EIYB 3N3HA 3O1VA 3S7EA 1QOOA 3AZYA 2QQNA 4QKNA 5A7SA 5A6YA 5C3PA 2P6HA 5SV8A 3H3UA 3BUCA 4WBBA 3BOPA 4GH4A 4I30A 1DLCA 4NR1A 2QQMA 4SBVA 3LA7A 2BFUS 3I2DA 4QX2A 3GGLA 3B01A 1SBDA 2L9LA 1JZ4A 1SLAA 1ULPA 4GAZA 3L2HA 3A0NA 1EP0A 1N3QA 2KR2A 3H1MA 1C5IA 4BQXA 5JZGA 2DCJA 3K3OA 1DFQA 1GNYA 2DYCA 4RQPA 5T50A 3HQRA 2WABA 4OFGA 1OD3A 4MGQA 2D5HA 1BBT1 2VVEA 4QX3A 4C91A 4H55A 4EWAA 3O14A 4DUWA 5JUVA 2R042 3HWJA 4R9DA 2W95A 4FTSA 3DPRC 3RMYA 5FYYA 1JUHA 2X8KA 1XYNA 5J36A 4QX1A 4HL0A 3H50A 4RHV1 4LKEA 3MUY1 2X5IB 1EPZA 4LBOA 3DXUA 3VZNA 1OKOA 4L11A 3GJBA 3N9QA 4M0NA 1R1A3 1YXWA 5FY7A 4CEWB 2D6PA 2PELA 3RNSA 4Z1VA 1MS9A 3MHZA 3O7OA 4A3XA 4GB31 2DU0A 1XNTA 4IL7A 1R083 4FI9A 1K5JA 3DKQA 1UAIA 2B5HA 3ATGA 4OI4A 5GLTA 1RJ7A 4GMP0 4YPJA 1UOGA 4LBNA 4XABA 1W03A 2W1QA 4XPVA 3ES4A 4CZSA 1GNHA 3RJ2X 2Y0OA 1QKQA 2LM3A 4V2WA 1QJU1 3RYPA 2O0OA 3D0SA 2WO7A 5BNNC 2F6BA 5FYCA 5KHGA 4AFDA 3RZLA 1UKGA 3M70A 4Y5Z0 4AVVA 3FL7A 4XMAA 2VMDA 3O0XA 2J1TA 3S5QA 1F4HA 4QPIA 3AJYA 2WLQA 3FX3A 2D6NA 3VN4A 1LENA 4XTPA 2JDZA 2XQRA 3ZYIB 4B29A 4Y3OA 1GLHA 2E33A 1GZWA 1UYYA 4X6QB 4Y26A 2R041 2BOIA 1V6NA 5GZGA 1H30A 5FZ9A 4QB1A 1I1EA 4CDWC 1HDKA 2FBEA 1AXYA 3U11A 1ZRRA 2VZUA 5CZKA 1H1AA 1YHFA 4XF3A 3I97A 5J1XA 2VR4A 2VTXJ 3H42B 3SCFA 4DUVA 5FP8A 4GJYA 4HSJA 1FXZA 3SXWA 1NCQA 1W6QA 2ZCWA 3GCXA 2V73A 1BJQA 5DUXA 5T5JA 4BMBA 1G9AA 4EQVA 1AR82 1HJGA 2EIBA 4Z07A 2CAVA 3KCXA 3SCGA 2VQTA 4WM7B 4AYUA 1CAVA 2YPDA 4Q4W2 1LHNA 2AENA 1K12A 2H6BA 1S0IA 3KD4A 5FDBA 5JIUA 3AMMA 1M4WA 3RMXA 1ZBA1 5KC6A 2VQ0A 1NA1A 1DQ6A 4MLOA 3RPQA 2MEV1 1PVC1 2QUOA 4ONUA 5LWBA 1QQP3 1K45A 2RS12 2WS93 1ZRCA 4HANA 2YC0A 3IM0A 4HPKA 1V6KA 4N53C 4WVZA 4HVQA 5F1RA 1XQNA 3KM5A 5AC93 3LD8A 2DVAA 4A4AA 1BVP1 1UY2A 2DCYA 2WJSA 2XJPA 4NJ4A 1OLMA 4NRMA 1BMV2 4PCRA 4Z92B 1W6NB 3WR0A 1NZCA 2VOWA 1GOGA 2MPFA 1VE0A 4RYDA 2VMIA 5C33A 2HWD3 1MEC2 1QXJA 1D4M1 3OBTA 4BQ5A 2R1DA 3I59B 5IVFA 2W0XA 1OD5A 1EPWA 1ZX5A 2CDPA 3WNMA 3G7DA 5LY1A 2W1UA 5CFCC 3HN1A 5K8SA 2W87A 2E63A 4XEZA 2HYXA 2R32A 1GWLA 3O0VA 4YZ3A 1HB2A 3VZMA 3O1PA 2VU9A 4HN1A 2Y6HA 3WOGA 5FXZA 1O59A 2F17A 2CNAA 1AR81 4P9IA 3WZ1A 3VL8A 1ZBE1 4DXSA 2Q5TA 3UYJA 3EMRA 2BJSA 3WG2A 4LT5A 3ZXKA 4LE3A 2YXSA 4YG6A 4AZZA 1HJFA 4Y22B 3VD9A 2PQSA 1BQPA 1YQ5A 2JX9A 2VPVA 3BOWA 4L92A 3RSJA 4F3JA 5FY8A 1HXS3 2AREA 1CGPA 1UKRA 3MI8A 1UZZA 5FY9A 4IV1B 1AXKA 1RUH2 4XYXA 3Q9OA 5FZOA 1LOFC 2RS11 2VCAA 3ACHA 1JOPA 3LB9A 3AZVA 1OC1A 3OY8B 5FYBA 2WIIB 1X8EA 2HEWF 2QDRA 4QD2A 1ZM1A 1UYZA 1HRV1 1C8M2 1S0EA 2WT2A 2XJVA 1AX2A 4Q4V1 4HG6B 4Y1UA 3TNQA 1BMV1 2RMU3 2DTYA 1PX3A 2W1SA 2J1SA 1V6LA 1KEXA 3WF4A 1B35A 4JTNA 1EY2A 3HQUA 3U10A 4B1MA 3ACLA 1HKDA 4LHKA 5EHDA 1TMF2 1J1TA 3THCA 3I49A 1DHKB 1JW6A 4P9LA 1DZQA 1JOBA 3N7MA 1WBLA 2PYTA 4HSLA 3DGTA 4IEWA 4AGVA 4ZKTB 2ZZQA 1BVVA 2VZOA 4COZA 4EROA 2OZJA 3FN9A 5JZGC 2YYOA 2BVVA 2QQWA 2W46A 4FCAA 4XQWA 4CP1A 1Q56A 2CSGA 5JI9A 1DGRN 4Y4YA 4I09A 4D3WA 5FMOS 4YVWA 2GNBA 3SLIA 1UO9A 2JB4A 3VHNA 1GWMA 3NV4A 5CBLA 4IEOA 1HX6A 4DFSA 1MVEA 1O5LA 2EIGA 3AYCA 1ENRA 4FBFA 3DV8A 3F95A 3PNAA 5LW9A 5CB7A 1UW8A 1CIWA 1PGL2 2VZQA 1RUH1 2Y0IA 3FLRA 4GD4A 4QWNA 3IZOA 4Y5TA 1MVQA 1VBA3 4D7TA 3WCSA 1OF4A 4BOWA 1UZVA 4WZCA 4Y4RA 1ALYA 1MZ5A 2J22A 4MGKE 2C9KA 4BZ4A 1CZTA 5DAPA 1AZDA 1C8M1 2W39A 2RJLA 2IUWA 1RUG3 2O8QA 2FDKA 1TME1 5JOYA 4QX8A 3MW2A 1LKNA 3C7GA 3BU0A 3N7LA 4RS5A 1J1LA 1STMA 3KB5A 3EJKA 1Y9QA 1KD7A 4R4ZA 2RDQA 5L73A 1GP6A 1OA2A 3SHRA 2YUEA 1BEV1 4PDWC 1N47A 1RUC3 1PHMA 3AP9A 1CJPA 4LE4A 3WQ0A 1A8DA 3FZ3A 2VMCA 4I0WB 1D2QA 1IS5A 2W3JA 4HK8A 3HBZA 4BPZA 4X8PA 5CISA 2D97A 1VBB3 4DXZA 4XFBA 1OFNA 3K51A 4QPIC 5FY0A 3WVJA 4ARYA 4GWNA 2RHPA 4FPHA 4RR3A 2R1BA 4IEUA 3VBUA 5C3QA 1O4YA 5H9SA 4QQOA 4GXLA 5CEHA 4Q29A 1W8UA 2BNNA 2W94A 1Z7S3 2HWE3 3PURA 4L9BA 3SC7X 1D2SA 1R1A2 4YW4A 1FV2A 3WNLA 2YBKA 2D6KA 2HWF1 4CCKA 3CZUA 2WC2A 3N9OA 3DPRB 4RA0A 4Q4Y3 5CYYA 1OFSA 4YSFA 1MZ6A 5BNQA 1VBC1 1R082 3LGRA 1C1FA 1Y9GA 3V0AB 1PGL1 3BN6A 5GZFA 3OUHA 1LGCA 2JENA 4N43A 4CCEA 4EV0A 1AHSA 2OYZA 4L2NA 4DNYA 3JB4C 3LIGA 2UY9A 4AI8A 3USUA 4XCAA 1DF0A 4AWDA 2K9ZA 4MYEA 4MOAA 5JXIA 1BK0A 3CHXA 4P14A 3MV11 2IVJA 2NYYA 3WNNA 3HD8B 3LEKA 5F39A 1Z78A 5HCAA 3BIEA 1L7LA 5FY1A 1F15A 4JV4A 3T4VA 5FOBB 4FPOB 4FPKA 5D21A 4MXWA 5H9PA 2NZ9A 1CAUA 2OX0A 4D7SA 2BP6A 1WCDJ 4JGYA 3VKLA 1H6YA 2VUAA 2TUNA 2WUHA 2XB6C 2QQKA 3ZKYA 2IWGB 4FOWA 2ZGRA 5DZFA 2VOVA 2ZGQA 1XPWA 3BTAA 3EHKA 5KHJA 1QOTA 3NV3A 4YGBA 1GV9A 1LOCA 2N7GA 1JBCA 3UK9A 4AEMA 4EYUA 1PMJX 1GANA 5F5CA 5BNNB 4MGIE 3I54A 3J9SA 5E1RA 2WNVC 4OHZA 4XBNA 1E5IA 3POJA 5FUPA 1GBGA 1RHI3 3B5LB 3OCPA 1MR5A 1QJEA 2YGLA 4HKOA 5DXDA 2E26A 3O12A 1AX0A 4LTAA 5FZ0A 2XPJA 4DXTA 1ZZ7A 4EJRA 2DTWA 3I2OA 2R7EB 3J8F1 4CDWB 4K1YA 3M3EA 3WNKA 1UU6A 5JXHA 1KS4A 3KLSA 2JKBA 3ZFFB 4Z2WA 1EAH3 3IAQA 5E8AA 1YQCA 1FMD3 3OB8A 1W8NA 1S2KA 3AKQA 3IBMA 3NNGA 1CESA 1POV1 3AP6A 3N7JA 4AQSA 2OXBA 3PVBB 4YRDA 1A34A 4KL1A 5A80A 5T54A 1QQP2 1WCSA 4R9BA 1NLRA 2WS92 1AJOA 1ACCA 3LDRA 3IPVA 5FZIA 1W8HA 3FLPA 3VZLA 4H2AA 5AVPA 3C7HA 3CZJA 1E5HA 2KM2A 3HNYM 4UFMA 4TYSA 5AC92 2VZSA 1HV0A 2ET7A 2PHRA 2DCZA 4AEDC 2A7AA 1PK6A 2UWBA 4FVVA 1JHJA 2BFUL 5GZEA 4CPBD 2PN5A 5BNPA 2A75A 4I0AA 4PF1A 3BGAA 1NUKA 4QGNA 3E5UA 5FYTA 5LASA 4KBBA 1WW7A 4N53B 1LULA 1BBT3 4AHYA 1CVNA 3UT0A 4CDXA 2B7YA 5LBBA 2OUJA 4A7YA 1B09A 4P5YA 1QU0A 1GSLA 2ZKNA 4W65A 2FZ1A 5IFTA 3MLJA 1W6MB 3OBAA 2IC1A 1DP0A 3CJXA 4N7IA 4RHV3 5DPNA 3ZXLA 4E8DA 1LOBA 2ILMA 2HH9A 4QXCA 3WG3A 5C9AA 5A3WA 2QQIA 2WZEA 4W8JA 4YZ5A 4IV3A 5CFCB 5F5QA 2C9AA 5HCBA 4B7EA 2JD4A 4ZU4A 5LCWL 3PTRB 2JG9A 5JWPA 2DUQA 1ND2A 4GB33 3EXUA 1HXS2 4MUVA 3OGSA 1OOPC 4FPGA 4WV8A 5FUIA 3WQBA 4DMIA 4JCKA 3B93A 3CEWA 2DCTA 3H1WA 3THPA 4AAXA 5JMCA 1Q8OA 1N1TA 4E4DX 4M3CA 3THDA 3WP3A 1JYVA 1QQP1 3ETQA 4IGQA 4MVTA 1J59A 2JDAA 2VCBA 4CEYC 4EN9B 2XDVA 1M06G 1RUD1 2MHFA 3WDYA 3SH4A 2D6LX 4DB5A 1PZ9A 1QJU3 5EFUA 2XJQA 1O3TA 3GM8A 1WMFA 2E9QA 4P00B 4R9CA 4K7JA 1WBFA 3BB6A 2BPA2 5HCFA 1GOFA 5D8AC 5A7PA 4W6XA 5JOZA 1WMXA 4CP9B 4D8MA 2TBVA 1S2EA 2JDYA 5FO9B 1WD3A 3MBWA 2Q30A 5GKAC 3PIGA 1YC61 1JI6A 3FUOA 4IETA 3AZXA 4LO7A 3V65A 1HV1A 2WBKA 4NWVA 4BJ0A 4FTBA 2JIJA 1AL21 2ZX3A 4M0HA 1XB9A 5FY4A 1HIXA 1UOFA 3MLLA 3WNPA 5IVVA 1YEWA 4DQAA 4QT6A 3P3NA 2ERFA 3ZYHA 4HN0A 2JDUA 4K6BA 2XL9A 4MH0E 3BVCA 5KXCA 2VXRA 1VMHA 2PHDA 4BK5A 1F2NA 5FWEA 4XZPA 3D4KA 3O5SA 3JU9A 4NPRA 1W9YA 4DEQA 2TNFA 2WR9A 5FMDA 4NPLA 2FCUA 2QQOA 2UU8A 4LHNA 4XUOA 2OS2A 5KHIA 1TNRA 5AVAA 1RJ8A 2EIDA 1R091 3AB0A 5TSWA 1WCKA 1K42A 2YC4A 1HXS1 2P3YA 4BIOA 5JZGB 4MXVA 3PUQA 2ZGKA 4M4PA 2DWRA 4RL7A 4LOTA 3O1TA 1VBA2 1YFWA 1ZBA3 2VECA 2BRTA 2IZWA 5FPAA 4O7XA 5LA1A 3LDBA 2MEV3 3IT8A 4LIUA 1PVC3 2E51A 1GUIA 1CAWB 4LO5B 5IVJA 3BTYA 4NHLA 3N4MA 1MS0A 1D7PM 2VTXA 3T1LA 1RUG2 4ZS2A 2JE8A 1A3KA 3RZMA 1RUF1 1UXZA 3UL2A 4LBQB 4I0BA 4XIKA 5BNOC 1O4TA 2Y6LA 5EJ1B 3WSOA 5F3GA 4JQTA 1DGWA 3D8CA 5KHKA 1RUNA 1CR7A 4BISA 4YVSA 1O4ZA 3VBOC 1CAXA 1GICA 2VQUA 2ARCA 1LHUA 4IEYA 2WAAA 1D4M3 4NHMA 1IS3A 4FT8A 5KBFA 5GALA 5DUUA 1Q5OA 1VBB2 4UFKA 2ZGLA 3KF3A 3OJBA 4F7ZA 4OVEA 1W2NA 4J1WA 3LFIA 5HCHA 4NHKA 4QQHA 3WLUA 5F3IA 4HBNA 4PDWB 4R8HA 4X6RB 5DAQA 4CCLA 5FYVA 2LW8A 1WW5A 1Z7S2 1ST8A 2HWE2 2Y26A 3I7DA 4NPMA 3RWKX 1AR83 3I3BA 3QBQA 4NVPA 1ZBE3 4Q4Y2 1X36A 2RR11 1H0BA 4AF9A 3WW3A 3DYPA 2W92A 4ES9A 1XE0A 3VGIA 4QPIB 5E88A 4TLGA 3I2JA 2JECA 5C3OA 2BV4A 4FPFA 3VBRA 3POIA 4META 3HVDA 4LLOA 1C3HA 1S55A 3MYXA 4S2FA 2AUYA 1IG0A 5ACA2 2B45X 2RS13 1MS1A 3ACFA 2PHLA 5LA9A 2VZ3A 4EN7B 4QXHA 2AGSA 5DG1A 2B9UA 1JYNA 1HRV3 5DZEA 4Q4V3 1X9TA 1RIRA 3CO2A 5I93A 2XXZA 4LUKA 1W6QB 4H7MA 3H3ZA 3HBKA 4LNVA 4LA3A 2WDBA 5FREA 5F6KA 4CU8A 3WP6A 2G9ZA 2W1WA 4EZ4A 3EYPA 2I74A 3B3QE 1IS6A 4OI0A 2K46A 3PJYA 2GC2A 4O65A 2WFF3 3OG2A 5IAVA 1VBB1 4Q8KA 3GHNA 4UOJA 1PK6C 4D0QA 5JXGA 1RHI2 1JODA 2YB7A 2MNGA 1COV1 1RMU3 4B3NA 2HWE1 5I91A 5DAXA 4OI1A 2JB8A 3ZXAC 3PHMA 3RWNA 4B7KA 2WNVB 2EIEA 1LHWA 4H7LA 4YM0A 4ISRA 1J3PA 5FK8A 4B4QA 5FMOL 2A3YA 3WDWA 1EAH2 2WA4A 1JMUB 4URAA 4JTOA 1W6PA 1FMD2 5K0UA 2D3PA 1R64A 3IMNA 5D1IA 3PUAA 5JCTA 5HV4A 1SLIA 4UFLA 4XF4A 5L7OA 1GKBA 5ACA1 1CZVA 4QQLA 2C1FA 4PIYA 2NMNA 5FYUA 1POQA 1S0DA 1OVSA 2JDHA 4LQRA 1H4GA 3LWCA 4WM8A 1IG3A 1QJZA 1PNFA 1I9RA 2XWBB 3AP7A 3B94A 3GZEA 3C7EA 4JHTA 4LKDA 3WUDA 2FDFA 1EV12 2Y60A 1TME3 2VW0A 4YM3A 1PZ7A 3ZIWA 2VAUA 4QQ2A 4E9KA 5FPVA 3GHMA 3OPZA 5CKMA 5FZLA 4JGZA 3V56A 4IE5A 4BMEA 5C4WA 3CLPA 5I0UA 1GQGA 1O3SA 2WAOA 5I8SA 5C3RA 3DN7A 1BBT2 1BEV3 3ZXEA 4FPCA 2GU9A 2IFRA 2PTMA 4LHLA 5FPLA 5C71A 4AEDB 5FLIA 5A6ZA 2Q0AA 4BCUA 1ULDA 5FZOB 3LF7A 4XFCA 2UY8A 4RHV2 1AR63 3BTZA 4EWDA 1MS5A 5CNAA 3VDDA 3KF5A 5C8WA 2W5FA 2XVGA 4URTA 5C70A 2ZGPA 4AHZA 2XWJB 2A3WA 2RJ2A 4UXAA 4XJWA 3VUOA 2R16A 1QDOA 2VZPA 2HWF3 1LJ7A 1X9PA 5CKQA 3TEWA 3CQOA 1SPPA 1US3A 3VKOA 2IXCA 3RS6A 1JZ8A 1B35B 1FMD1 1VBC3 2VZRA 2XHKA 2YHJA 3ASIA 3U75A 4DRVA 4EZHA 2PHFA 3O1SA 1I6XA 1REDA 3CF6E 1XNCA 4XJUA 1GZCA 4XXPA 1A6CA 3H8XA 4CXWA 5J96B 4QHOA 4L99A 2ZTNA 5DABA 1DBNA 4AW7A 2NN8A 1QJU2 4IEQA 3WEZA 1CWPA 1OOPB 4JDNA 1CN1A 1EV11 4N90A 5JDBA 3DXTA 4HOOA 5A32A 1QJX2 4CDUA 2E31A 1DQ5A 1AR73 1OHFA 3LOIA 1UPSA 4PQ9A 2DU1A 3DUIA 4COWA 5DZGA 4XVHA 2K0GA 4CEYB 4E4ZA 3M1HA 3LOBA 4FAGA 3LSDA 4QPGA 1XU1A 3VD3A 4I2OA 4O9GA 2CHHA 3WP5A 1FOD1 1ZA7A 1HW5A 2DDUA 2WYSA 2YGMA 4XUQA 4QX0A 2ZOEB 3KGZA 3VHOA 2VJXA 3FE5A 1LTEA 5D8AB 3AL6A 2V5YA 4JHZA 4JX0A 5FZGA 5C8CA 5F37A 1AXZA 2ZMLA 4WVMB 2XMLA 5EP9A 3IWZA 2ARBA 2VVDA 1GFF2 4CP0A 5FJHA 2DBIA 1W8OA 4Q26A 3JQWA 3MO4A 2VNOA 3J8F3 4G4FA 2HBTA 4CU9A 4NOTA 4RGAA 1MQTA 4E27A 5LEJA 5J7MA 4QGMA 3AP4A 3URFA 1UWWA 3I2HA 2BDRA 4ZXKA 2QKDA 4NIAA 1J58A 1ZBA2 3WINE 3T0DA 4FP3A 4FOYA 4ZZ5A 1POV3 1WMEA 1SFPA 1XNDA 3EB7A 1OA4A 2MEV2 1PVC2 2XLGA 1Q8SA 1BLZA 1Y43B 4IW3A 3D6EA 4Y20A 3ZR6A 4MX3A 3KHBA 5FLHA 3IN9A 1H6XA 4P08A 1QJX1 2WSVA 5K9YA 3JZVA 1URXA 5CIRA 1UZWA 3BPZA 1HQNA 4NUBA 4JDOA 1G9CA 5IK5A 5FJKA 2JJ6A 2ARAA 2GNTA 3MPPG 4PI2A 3DECA 4COYA 1XXNA 2ZABA 1NY71 1V6OA 3A22A 3OPTA 2BNMA 5J09A 2FDIA 4Q4X2 2ZHMA 1WA4A 1O3QA 1UQXA 3NWKA 1D4M2 1OPMA 1CIYA 2F4LA 2KD7A 4RGKA 1N1SA 4Y1XA 2HBUA 1F4AA 5BNOB 5A3PA 2X05A 5F3EA 1Q8PA 1MZFA 1S0BA 3ZFFC 1S0CA 2BWCA 1W39A 2LTNA 2QZ2A 1F8VA 5FQ0A 2PA7A 2HWB1 4AFMA 3B9CA 3VBOB 4W50A 1G7YA 2HLEA 3ILNA 4NN0A 3HAGA 1ZBE2 4LPLA 1FNYA 3PVNA 1ND3A 1XYPA 1VPHA 5A7WA 4AVSA 3IKWA 1W06A 3CJIC 3AKTA 2ZS6B 1KDKA 3GALA 4UW5A 2D6MA 4KU8A 1KJRA 3KSCA 3ZN6A 3LPFA 5CU1A 4XTMA 2QJVA 2LALA 4PHZA 2GC3A 4XQDA 3N9NA 3VBSC 2DF7A 1SG3A 1YI7A 5DG2A 2IXKA 2JG8C 1RUD3 2WN3A 3I2GA 3AMQA 4LORA 4YW6A 1HRV2 4Q4V2 1PVXA 3AP5A 2FMDA 2ES3A 4LK7A 2VW1A 4D6SA 1NAEA 1AX1A 1W8ZA 3ZSKA 1S0GA 4B8EA 3WF1A 1SBFA 4IXLA 1IZ3A 1OH3A 4KBZA 4Q4X1 4YW1A 2D6OX 1V00A 2ZACA 2YBPA 4FFIA 3VD4A 1Z0HA 2WFF2 2GC0A 3B69A 4XMIA 1AL23 4Y1YA 1JOJA 5LRRA 1H2MA 2CGNA 4A44A 4JVAA 2Y33A 5FLJA 1RMU2 1IKPA 3KV5A 3LA3A 4QHZA 3RI9A 4UF0A 5C4WC 5CG8A 4ZZ8A 2CYFA 1W6OB 3AVSA 4QKDA 3ORJA 1SLTA 1BHGA 4DEVA 3C7OA 1W9FA 3VBFA 1RXFA 2XVLA 4Z2AA 5LK7B 1S2BA 1PK6B 3F2ZA 3VL9A 4Q0PA 3VZJA 4EN0A 5A7OA 1R093 4CCCA 1NE4A 5IVYA 1WZXA 2OPWA 1LOGA 2DFCA 5JR7B 1SFYA 5L19A 2JKXA 4B4RA 3POGA 1DQ1A 4LBQD 2RDNA 3MGUA 3TBDA 3VDDC 2P5BA 4MV2A 3BALA 2Y34A 2Z4FA 1VALA 4XHXA 1DG6A 5F8PA 4BLIA 1XJAA 1XNAA 4C90A 1GP5A 3W21A 3R4DB 2AR6A 1Q8VA 5A3OA 5BUVA 4BLJA 3UNPA 3WF2A 1ENSA 5ERLA 5IFPA 4CUBA 3NL1A 3KWVA 1NT0A 3ST7A 3M3CA 1TME2 3AKRA 3LSEA 1RUF3 3GXUA 2D3RA 4KU7A 3J7MA 5JXJA 2A6ZA 1W9TA 2QQUA 3N7KA 3AC0A 1RUOA 4AHWA 4GH4C 3U14A 1UY3A 4UW6A 5C3SA 2A3XA 1L7QA 3E5XA 1HB3A 2BEOA 4GWIA 4CU6A 5A3NA 2WFF1 1BEV2 4XJAA 1JZ7A 5IHRA 5LB6A 1ASJ3 4QHBA 2FZ2A 2W91A 4KI5M 4CDUC 3H8OA 3ZDSA 5H9QA 3ZYRA 3T3YA 1RMU1 5CVRA 4Q8LA 1W90A 2PHWA 3I3DA 3MIFA 4RQPC 1F35A 1VLNA 4QPGC 4NAMA 4DPNA 1AR62 4KG0A 1SLBA 4A6SA 3X29B 5LBFA 3UESA 1WMDA 4AG4A 3NW4A 4OYUA 5BV6A 2FHRA 3R05A 1W3XA 5ABJA 1JZ5A 3A4UA 1KXGA 1O5UA 2HWF2 4XFFA 5JI7A 5CG9A 5FYZA 1LODA 1SACA 2H0VA 2RR13 5CA6A 1T6GC 1UX7A 1VBC2 3CKHA 4BIFA 1NQDA 4KWJA 1JU3A 4ITCA 1VRH1 1YI9A 2RV9A 5F9TA 5IVEA 1ULFA 2GMPA 1QH7A 5F5AA 4W6YA 2ORZA 1ZA4A 3PU8A 4GWJA 4LULA 1C5HA 2WLPA 4OHVA 1W9SA 2JDNA 5IJRA 1CZSA 1MQTC 1UU5A 5EQUA 3O1UA 3E6DA 1LRHA 3FWEA 5F5IA 1AR72 1WUVA 2IVIB 5HPOA 2O1QA 4QMAA 3RZHA 3M8LA 4IE4A 1UD1A 2WNUA 3M4FA 4FTEA 2WA3A 1HB1A 3DYOA 1HN1A 3FHQA 4KWUA 4IE6A 1H1MA 1BCXA 4CUGA 4ZXEA 5E16A 2QQPA 2X5IA 4AE2A 3KCCA 2OKXA 1JN2P 1HQWA 1AUYA 4TLFA 3RJRA 3K77A 3FBYA 3PJQA 2VCCA 1AR61 1OUXA 2VH9A 1UU4A 4KMQA 5B4XA 3VDCA 3ZFGA 3VKFC 3VDBA 2VZVA 1COV3 3D5OA 1OLQA 2WT0A 4KGQA 3ZPOA 2VVFA 2GP5A 1RB8G 2BGOA 3J8F2 3UKVA 2C0ZA 4GQ7A 2A6YA 5H9RA 2FQPA 2WRAA 1LNSA 2ZX0A 2XR4A 3WF0A 3SCHA 1XSQA 5KXDA 2IXJA 1V6JA 1NCQC 4UFHA 4LR4A 1CAXB 2DVFA 2R063 5HXVA 4R9AA 5K4LA 3TEXA 3TN91 5HV0A 4UT5A 3CMGA 4AGGA 5ACA3 5AFEA 4AL9A 1NCRA 3LCPA 1RVF3 1PZ8A 4QU1A 1T6BX 2XONA 1POV0 3ENRA 4M00A 1DZTA 5EYXA 3H8RA 2ZGUA 5LA0A 1ODNA 1AR71 1C1LA 1WD4A 2ZEZA 3H8UA 3MLKA 5FO7B 3V64A 1DQ0A 1RINA 4BH9A 4XF9A 1RUI2 2X09A 1JXNA 1NA1C 3U4SA 2ZGSA 3T09A 4K21A 3MIDA 2UURA 2R073 3INAA 3SITA 3WHUA 2XBO3 4XDPA 3NNLA 4ET7A 5KXBA 2BUKA 3ZR5A 4A6OA 1ZZ9A 3THTA 1U12A 2FMYA 4JC1A 1PX4A 5JSOA 2TEPA 3NNFA 4ASKA 3DF0A 2Q1MA 3BODA 1L7RA 4FFHA 5FY5A 3FBMA 5A1FA 4XAAA 1G8WA 4JKKA 3UGGA 1U5YA 1FNZA 4M01A 5LZ6A 2XLAA 3PDQA 4WM7A 3T08A 1NXD1 4IEXA 1S4CA 3WNOA 2P34A 4PLNA 2PLV1 1AF9A 1WLDA 3PUIA 2WNEA 4FFGA 2RJKA 5J3UA 4MG2A 4BQ4A 3D82A 3W20A 1X50A 3FFZA 3AJZA 3NJXA 1VBD2 1C4RA 4YNIA 5I8TA 4OUEA 2DUOA 2P2KA 1AR91 4UBHA 3E1F1 3T2PA 1ENQA 2AC1A 4AHXA 4YW5A 3R6SA 4BU2A 4BXSV 1V9U1 3UV9A 1N3PA 4LXLA 1VBE1 2WFPA 1LEDA 1D0GA 1ODMA 2E6VA 3MICA 4LO8A 1RUD2 1MS3A 2HKXA 4Q0QA 2BBVA 1W6NA 2Q8DA 1UCXA 5JIAA 3CJIB 4E4HA 3FLTA 3MIBA 3K48A 1RUI1 1IKQA 4Q0UA 1LB2A 2Q1ZB 1EV13 4ISQA 2ADEA 3OYWA 5IT6A 2V09A 4BM8A 3UJOA 4COUA 1GMMA 2QE3A 5T52A 3LZZA 4XIOA 2P17A 2JIGA 2B8MA 3VBSB 4AFBA 4GKXA 4NIGA 2JG8B 2VUJA 3KS7A 1PGSA 5EJZB 5EYYA 1MZEA 1FOD3 3N9MA 3ETPA 2YROA 2V5DA 5F6LB 2A1XA 4QPWA 1QIQA 4K9SA 1SDDB 3DCQA 1AL22 4ZPIA 2VMEA 3Q8AA 4QDSA 4S2HA 1JZ3A 5FZKA 1B35C 2Y6JA 3UJQA 5I0RA 4UW3A 5JR2A 2AEZA 4FP2A 4ZY9A 4FPLA 4DINB 3GZAA 4Y22A 2F4PA 4A7ZA 4Y24A 3POFA 3EO6A 4CXYA 4WZFA 1DGRA 3ZSEA 1DU3D 3ITQA 3POYA 3HIFA 1R1ZA 4FXKB 1BYHA 4UYBA 3SH5A 2CY6A 4LKSA 2UWCA 1R092 1PO13 2WO3A 1O91A 2FDHA 1VBD1 3P3PA 2GN7A 2EF6A 1QHDA 1UY1A 3MW3A 3OY8A 4KQ7A 5C4WB 4EE2A 2CGOA 3R0RA 2YG0A 1DIWA 2I07B 1PMHX 4CVUA 3LQCA 4NIHA 3SNMA 1VMFA 2J7MA 4YVWC 4QU2A 5ABJC 4DRRA 1JZ6A 2BTVC 4DY3A 2OIIA 2XG3A 4A7KA 2WT1A 3PL0A 1JYXA 3PIJA 4CCMA 4E2SA 1V70A 5JSPA 2B9VA 1YWKA 1RUF2 1YJLA 1QJX3 1Y9MA 2W9XA 2WZR1 4PBPA 5FZ3A 4UBGA 4YM1A 3VDDB 2OZ6A 3USSA 1XYOA 3VV1A 1UZ0A 3DYMA 1H9WA 3V0BA 4QKBA 3AK0A 4OULA 4XXAA 5CFDA 1QXPA 4OHWA 4Q27A 4N9HA 3MIHA 2SBAA 3ILRA 5DN2A 3OEAA 5FPXA 2FDJA 1AJKA 4P9GA 3BKZA 3C3VA 4LKFA 1ASJ2 2WNOA 3GJAA 3SEEA 1L3JA 5A6QA 4RS5C 1QNWA 2J1UA 4IE0A 1TZOA 2KXLA 2WNUC 1WGPA 4GH4B 4BE3A 1OQ1A 1W0PA 1WW4A 3WP4A 1ZYBA 2HWB3 2ZMKA 2ADDA 1PGW2 4K20A 2RM21 4PQQA 4GIQA 3ZSJA 2HEVF 4CDUB 2ARXA 2W08A 2RR12 3AYAA 4OUMA 5KHHA 3HMYA 4RQPB 2JICA 1UYPA 1NXMA 4QPGB 3ZFGC 4RR3C 4AEJA 3VBUC 4HZFA 5JPMB 2QFEA 5BYNA 1EUTA 3HOBA 1LHOA 4QX7A 4WVWA 4BA6A 1LU1A 2LROA 4XF0A 1RL3A 5GLWA 3HT2A 4X8NA 3VDAA 4FPEA 3P5BA 1J83A 4FOVA 2OVUA 3HPNA 5C8CB 4Q1PA 1H4HA 2ZZJA 2KA3A 5FCCA 4O61A 1HRI2 4N43C 5FXVA 5BXXA 2EA7A 5F7UA 1SEFA 1VB2A 3B02A 1GZTA 4NWWA 4JQRA 4GMP3 2UWAA 2VNVA 1MACA 1RXGA 4LLFA 2EXJA 4XBQA 1YQ8A 3W9AA 5L9RA 2XKOA 3JCIA 3HT1A 3M3QA 1ASJ1 1MQTB 4Q4X3 4QGLA 1WKYA 3HNMA 5FPBA 2A70A 5SV5A 3C2UA 5FUNA 3RZZA 3WHTA 4A42A 5DMYA 2WWJA 3BYWA 4JGYC 2QVSB 3MPBA 2W2IA 1YQ2A 4TSVA 3K3NA 3AFGA 2P4EA 2C5DA 2SLIA 3GNEA 5T3NA 2B46X 3ACGA 3DPRA 1COV2 4Y20B 2AZ5A 1PGW1 4AQ6A 3V0AA 3OD0A 1S1AA 4IERA 4QDQA 5J48A 4FPYA 4MADA 1OSGA 4IEVA 1CONA 4LBJA 2QTWB 2Y6KA 4PIZA 4XUPA 4CDQA 5F32A 2D98A 4PLOA 1OT5A 1E5SA 2VOTA 5LA2A 1OLRA 2EICA 1RUJ3 4FPJA 2R062 4RFT0 1GZWB 1OI6A 1PIV1 1U5IA 1LHVA 3KQRA 1H8TA 2DV9A 4N8MA 1DDLA 1VB4A 2ZAAA 2AH2A 1RVF2 3H9AA 5GLZA 3FHIB 1W0NA 2AYHA 3WW1A 1TVGA 1HRI1 3BTXA 1U5XA 1ENXA 4CCOA 3VD5A 5FQ0B 2P37A 4TWTA 1NCQB 4MGTA 2YFZA 3E5QA 3ECQA 3NAPA 4PI0A 2R072 1RUE1 3I2FA 4PIXA 5BNNA 4XBLA 1VRBA 2JE7A 2XBO2 3POEA 2GNDA 4LEJA 1NKGA 5FBZA 4C8DA 1RGSA 1CAVB 1F9KA 3UGHA 4IESA 4QB2A 4CUAA 1NOVA 1RYYA 3H0OA 3K46A 5A7WB 1H2KA 2O14A 1CQ9A 4OQ9A 1JS9A 3N9LA 4XILA 3T2OA 3ZYGA 4XFAA 5FXXA 1WA6X 1AYM2 3JD71 3W5MA 2Y6GA 1NA1B 1H2NA 3ZN6B 3TWIA 3FJSA 4YG3A 4A3ZA 5BNPC 1G9BA 3E6BA 4NHXA 3AKSA 4CDWA 4L0PA 5FZ4A 4D94A 4HXCA 2PAKA 5LEKA 4HPKB 4XJ9A 5DDJ1 4CDXC 4MHUA 3BIWE 1W2OA 2VUCA 2V72A 1ZNPA 5E6HA 1NX9A 2YC2A 3QLQA 4BQ3A 2GH8A 2R6QA 2V4AA 3ALQA 3WUCA 1HN0A 3IAPA 3WG1A 2R061 2ZBJA 5C9AC 5IVCA 4XW3A 1DQ2A 3OF1A 1VRH3 1TE1B 1RVF1 4IV3C 2BVBA 3RYRA 3ZXGA 1DLLA 4B4PA 4P9XA 5FMCA 1Q43A 2D44A 2VD7A 1EUUA 5GLVA 2JG9C 2H0BA 3SKVA 4RFRB 1ND2C 4R52A 2JD9A 1W05A 4OI2A 2VMFA 2RDSA 2A71A 4HKWA 4QQPA 1DZRA 2R071 3M3OA 2XBO1 4XF1A 4NE9A 2EVXA 4N53A 4LBMA 3MZHA 3WNXA 1I5PA 3B7MA 2P3IA 2Z69A 4RD7A 4AGRA 5LRSA 4UW4A 1FOD2 2YDEA 4GULA 1AYM1 5A3MA 5FP4A 3ZSLA 1YIFA 1W6MA 3TYJA 3PVEA 3R4SA 4BQ2A 4XUNA 4A41A 4LUMA 1ULEA 3HJRA 3KVBA 2ZHNA 1KFXL 3MFCA 2Y8KA 1H1IA 3FUQA 3GZTB 4QKFA 5CFDC 1XSRA 3LFMA 3U4XA 4TTGA 1JTZX 4F8AA 1ZZBA 4BDVB 1Q8QA 1YO8A 1SQ4A 2JDMA 3ZN5A 2OQ6A 1YFXA 5ISLA 2Y64A 4YW2A 3IDAA 3VD7A 2WINB 1PO12 5EWSA 3ZXJA 2VCMA 1IQAA 2AACA 4XJ8A 4I01A 3TAYA 2VOXA 3FFQA 1GOHA 2RE9A 2JDKA 2J1EA 3OGGA 3M3IA 5I0DA 5FYSA 5C5UA 4ATFA 1FI2A 2RS32 3BU7A 3DEMA 3ZO0B 1UF2C 4NRPA 3LEMA 1RITA 3TN93 2Q4SA 4NIDA 4L8QA 1LGBA 2QQVA 1UZYA 1O3RA 3D3AA 5BY5A 4LBKA 3C8XA 1J3QA 1DCSA 4BQWA 1ZZ6A 3AKPA 2WKKA 4Y1VA 2Q1FA 1LU2A 1UPIA 3GBGA 3POWA 4YVWB 3WY6A 5A3LA 1D0HA 2VNGA 5ABJB 2E32A 3B9IA 4NRQA 1SMVA 3GBWA 1NY72 1FX5A 5JOWA 1V0AA 2G9GA 3FMGA 2YU1A 4EWEA 1LGNA 1GYKA 2B42B 5FP3A 3GF6A 5IW0A 2BWAA 3IDCB 1MPXA 1JUIA 3ZLIA 3OUIA 1FPN3 2PFWA 2DVGA 2VMGA 2ZGOA 3DL3A 3MF6A 2XJTA 5DUWA 3ZMOA 3H7YA 5C6CA 4YVSC 2PAEA 4JKMA 4LA2A 1O6UA 2HWB2 2BBAA 2VY0A 2VW2A 4SLIA 2ZMNA 2G4IA 5FZBA 3AVRA 1RC6A 4AVBA 4BXFA 4CYDA 1OF3A 5FZ7A 1DYPA 1PO11 3ZYJB 3A7QA 2PLV3 1KS5A 4RS5B 5B2GB 1QOSA 3O1OA 4LMFA 4DIQA 4INDA 2WNUB 3NQHA 4CE8A 3VB9A 2VBBA 4M3CF 2RS31 3OGRA 1G9FA 4FO9A 3W5NA 1CAWA 1AR93 3NJZA 1SZBA 3O0WA 4BHPA 1G6NA 4QDRA 4YLZA 4OUSA 1I5ZA 5CKNA 2FDGA 1QJY3 5FV3A 5FKBA 4CXXA 1V9U3 3VBHA 1OURA 1XE7A 4LBQA 2BZDA 4CDQC 1VBE3 4Y33A 4CP2A 5L36A 3LE0A 3N9PA 3NV1A 3MW4A 3ZFGB 4RR3B 2VE1A 3VBUB 4FOQA 4KWLA 5ANQA 1UX6A 5T5OA 3VBRC 3AMNA 1RUI3 2CAUA 1J84A 2ZA9A 5KXEA 1W28A 2EXIA 1H8TC 3WQ1A 3AMHA 4AVCA 3WX5A 1EYBA 2RS53 1TQ5A 5LY2A 2P3KA 1X8MA 1JYTA 2P6CA 4BQYA 2WYFA 4WVVA 5ANNA 5G04L 4N43B 4AVAA 2WSUA 5CAZA 1ULGA 1GQHA 1REFA 1LEMA 3MIGA 2J42A 5EJ3A 3T2QA 2XJUA 1W99A 3NAPC 4PDWA 3USUB 3AM2A 1QY4A 2WL1A 2ZX1A 2VGDA 5T55A 3LEIA 3RZKA 2EAAA 3OUJA 1NCRB 4ATEA 5A6XA 2Q8OA 1DYKA 1K3IA 3OBRA 1QF3A 2PHTA 4IE7A 3TRSB 3VHPA 2XLFA 3U1XA 2GP3A 4PF5A 4MXWB 3POSA 4CCJA 1CAUB 4L97A 4OZXA 5M0TA 2YFUA 4NMIA 4JGYB 2BYVE 2ATFA 2D93A 2WWSA 3KT7A 4KG8A 4V2VA 3PMEA 3E97A 3WG4A 1UYXA 1VBD3 5JMOA 1FV3A 4OMCA 3I2KA 1RUJ2 4YZ4A 5J98B 2DURA 1IGOA 2GDFA 4Q0VA 4AK3A 4OMDA 1LESA 3IIAA 1C28A 4OLLA 1LR5A 2E7AA 2P1BA 2P3JA 4OHXA 2OT7A 2YPJA 1XNKA 5FP7A 3Q8EA 3D0JA 1UY4A 5K0UC 5BPXA 3CU7A 3SH3A 4C0HA 3AZWA 4GMP1 4ARXA 3HEIA 4XCBA 5FO8B 1P8JA 2WZR3 4NO4A 4HVOA 3VKMA 5L7OC 3RI8A 2VMHA 1YIPA 4P9WA 4AI9A 4AXOA 3C7FA 2ZEYA 3SKJE 5L9VA 2JDPA 4WM8C 4YW3A 2VQAA 1CPNA 4C1WA 1O8SA 2VNRA 2VBPA 1KGYA 3EBRA 1OKQA 4YFZA 2J1AA 1TG7A 2JXAA 3LA2A 5LK5A 3NNJA 2DCKA 2EXKA 3GYDA 4JGZC 2XUEA 4UWDA 3IPVB 4YGEA 2WNVA 4XFHA 4YW7A 2BGCA 4ZS3A 1IPJA 4Q2FA 1F31A 1UOJA 2R0FA 3G6JB 1K5MA 4QM8A 3ZFEA 1WLWA 3J7LA 5E89A 2RM23 5A7NA 2D43A 3OYWB 2YY1A 1CX4A 1NYWA 2BQPA 1UN1A 2B4KA 2E7TA 5BNPB 5EPAA 1RUJ1 4XAEA 4LK6A 3M2MA 4O9EA 4TXWA 3T0BA 1VRH2 3ZOIA 3LIHA 5FZEA 2Q8EA 4C0BA 4CDXB 3L9JT 4E8CA 2HEYF 1MS8A 1OQDA 2VO5A 3U0ZA 1BK1A 4Y1ZA 3HNBM 4TZDA 3O1MA 3KV9A 1G86A 4XETA 2ZEXA 5F2SA 1H2LA 1KDMA 4Q4W1 4MO3M 2NQYA 3ZXFA 5C9AB 5A7QA 4KNCA 3JBG3 4Q1RA 1QJFA 1UY0A 1V6MA 5FOJB 3K4AA 4IV3B 1H8VA 4KH9A 5L9BA 1OMIA 2D3SA 3KHCA 4AEDA 2JG9B 1G9DA 4H14A 1ND2B 3MV01 3A0KA 4P5HA 5FZCA 2WWUA 5FZ8A 3KV4A 3GZUC 5A33A 3UETA 3H7JA 1YYNA 4I3PA 1VAVA 1CJDA 3B00A 4IQPA 5A3TA 2FCTA 3MFAA 3OEBA 4I3GA 2RDRA 4M3CB 3NV2A 2GN3A 4UFIA 3A21A 5JPNB 5FKCA 4EN6B 1IHMA 3O1RA 5D2AA 4QXKA 1N3OA 1APNA 1O7FA 1OVPA 3PU3A 4N7UA 5FFOC 5FZ1A 2CV6A 4Z82A 5FP9A 1WCUA 4LO6B 2X10A 2ZX2A 2WQ8A 1MEC1 1W3VA 5G05L 2PHUA 1UMZA 3JXSA 4FXGB 5FMBA 5C8CC 3V0BB 2QBXA 2JWPA 1W2UA 4LITA 5CFDB 5JAXA 4MGYE 5FWJA 1S0FA 2GNMA 4OZOA 2WQZC 3A23A 3AYEA 3TN92 1WWYA 1YJKA 1OOPA 1PIV3 4MHRA 4U36A 3KVAA 4PBOA 4FQZA 2VL4A 5GLUA 2UYBA 4NROA 2BOJA 4CUCA 1HQLA 3IIIA 1YRZA 1XRUA 1SHWB 2G19A 3FHAA 4OQ8A 4CEYA 1HRI3 1U0AA 3J26N 1H9PA 2A6XA 4ZU7A 4ZHNA 1LAJA 2QDNA 5F2WA 4C1XA 3HR9A 1N1YA 2E7QA 3BCWA 5FZMA 5FAXA 4D6QA 2VXJA 4J1XA 4HFSA 4RN5A 3S57A 1RUE3 1JH5A 3VBHC 3H1YA 3ROUA 1LOEA 5IK7A 1OUSA 5I0SA 1UOBA 5D8AA 2Y6FA 4CPBA 2XQXA 2CU5A 5FXWA 5A1AA 2X53S 3RQ0A 5DAWA 1ZRIA 4WVMA 1HB4A 2WN2A 4PLMA 1FPN2 1YFYA 3JD73 2ZX4A 3UKTA 2OA2A 3T1MA 2A6WA 3T0AA 4CEWA 5LATA 1IS4A 2ENRA 2C6SA 2BGPA 4AFCA 3GBFA 1ULCA 5FZFA 3VLBB 2C26A 5DDJ3 1QH6A 1UMHA 1MS4A 3OPWA 1W9WA 1TMF1 2PLV2 3VHRA 3I3QA 4JZRA 5CADA 3KZ4C 5FZDA 4DO0A 3QD6A 4N9IA 3KT1A 3WDXA 1SCSA 4YZ2A 1CD3G 1W0OA 2OUHA 4YVSB 1PO23 3AZZA 3NJVA 3AXDA 5EZWA 1BKZA 1AR92 5JVVA 4AI1A 3ZVXA 2ZGNA 3WXPA 3J7NA 1QJY2 4CU7A 1KJLA 1V9U2 4D69A 5T5PA 3RZGA 3RFRA 1ND3C 1VBE2 1QNYA 2R0HA 1JZ2A 3NNMA 1YCIA 5HI0A 1UIKA 1AYN3 1VIWB 1QWRA 4FFFA 2VTFA 1PNGA 5FTTC 4AI0A 4ASMB 4ES8A 3UKNA 3U07A 3WQ7A 3TEYA 2Z5WA 4YGDA 3S6PA 1Q3EA 4GWMA 4AAPA 1IQDC 2CWMA 4G3YC 4P9JA 1XE8A 2RS52 3ZDVA 3PLQA 5K7PA 5F3CA 1NE6A 1ONAA 4CDQB 2OW4A 1F5JA 4Q5OA 3I4IA 1IPKA 5BNOA 2GSYA 3OGVA 1REEA 2IXHA 2X29A 1DYOA 1OLME 3QOPA 3ACIA 4S2GA 5FZ6A 3Q8BA 1AYM3 3VBRB 2HWC3 1SLLA 1FPN1 5T5LA 3VBOA 4XDOA 2LS6A 5A1LA 1H8TB 1QEXA 2BU9A 3JQXA 1W8FA 4GALA 2NM1A 3ZPYA 3ZXDA 4B1LA 1KQRA 1U5ZA 4V1PA 2D7FA 3GDBA 4JDMA 4UAPA 1PM7A 2VBDA 4YARA 2YV8A 1N1VA 3MDPA 2I45A 5A3UA 3RDIA 2VC9A 3KT4A 3NAPB 2QZ3A 3CL1A 3PUSA 4XFGA 1GP4A 5FZHA 5LBCA 3RRDA 5KWRA 2G9FA 4JRAA 1WW6A 3Q8FA 4E2QA 3NSTA 3WDUA 2WZPP 4YG0A 1GQPA 1ZZ8A 2YBSA 3POBA 3T30A 1QJY1 1K5MC 3VBFC 2H6CA 3ZFEC 5HBAA 3JUUA 3OBZA 4HETA 5DUVA 3S30A 1GR3A 2FCVA 3OOXA 4LJHA 1WLTA 1X82A 3SQOA 4AEKA 1R1A1 1DQ4A 4GJZA 4QPYA 4HMZA 5JSRA 1LECA 1O8PA 4TN7A 1R081 1SLCA 2WZR2 4ORFA 2RS51 3H3LA 3ZYBA 3I59A 2GZWA 4BB3A 5IYYA 3CIHA 1OH4A 3ZYPA 2NP0A 4M4RA 1XOYA 5FRAA 1ZVFA 2ZEWA 3K4ZA 2J1RA 2LRPA 1W6PB 4W4ZA 5IAXA 5GJ6A 5K0UB 4OHYA 1OA3A 4LOSA 1LCLA 2J1VA 3TEZA 4XE9A 1W6OA 4D7YA 1GZ9A 5L7OB 4FQ4A 3RZJA 4HONA 5JOXA 4LHSA 5DQ0A 1VAKA 2RVAA 2QNKA 4RGGA 5FYMA 1FT9A 3N36A 4YWAA 2LUWA 4Q0SA 4WM8B 1XBFA 3NJYA 3ES1A 3WDVA 5IATA 4UI9L 2A73B 4HVRA 4XDQA 1DGWX 1ZRDA 1QXRA 2RM22 2HWD2 1Y3TA 4IV1A 5J37A 3J7HA 4QM9A 3TB0A 4GA9A 5JLVA 3SMHA 2GMEA 4MSVA 3ZMNA 4JGZB 2IXLA 2Z2SB 4J6GA 1JU4A 1YUDA 1A8MA 4CCNA 3KV6A 3JB8A 4DXRA 1UNBA 4ZONA 4EN8B 2RS33 4P9YA 4IUGA 3VKNA 1GU3A 4XFIA 1WCQA 3OSDA 3NRUA 1IOAA 1ZREA 4LO4B 2DFBA 3OTFA 1E5RA 3QACA 1KITA 1RTVA 3IDEA 3I3MA 2W68A 1JYIA 4LBLA 3ABZA 2VOKA 1SDWA 4E4SA 4QB6A 3JBG2 4XC9A 3ILFA 2D5FA 4DUXA 5EXOA 1J3RA 2VM9A 4JKLA 1BXHA 4K8RB 1JYCA 2Q8CA 2HJIA 1NLSA 3UGFA 1OXCA 3IB3A 2Z79A 2EAKA 3U78A 3W58A 3WCRA 1SPPB 4Z8BA 3HQXA 1SCRA 2PHXA 3TOJA 5KC5A 3IMMA 3I2IA 4HT1T 2WS91 3ME2A 2Y38A 1UXXX 2VUDA 2XGXA 3OGJA 3WDTA 1X33A 4K40A 3AMPA 5AC91 2G1MA 1OPOA 2XHNA 4J25A 1IPSA 2CGPA 2XOMA 2RMU2 4YYOA 4XUTA 4A2UA 3PVOA 3U37A 5IWFA 1KFUL 3BI3A 4HK9A 2HWD1 3CNAA 3P1IA 3CBNA 5A32B 2X5IC 1CX1A 2QCSB 1NZIA 4HLTA 1QMJA 4W6WA 4G9SB 3TNPB 4CEWC 5IK8A 2R043 2PMWB 4IEZA 4UFJA 3W59A 4MGZE 1PIV2 2R49A 1SFNA
chains in the Genus database with same CATH topology
5JXIA 3WF1A 4MOAA 3MV11 2Y64A 3IDAA 3WNNA 3VD7A 3LEKA 3VD4A 4QAWA 2CDOA 1GOHA 5C7GA 2J1EA 4A44A 5I0DA 2VZTA 1H6YA 2WUHA 3P6BA 2WZ8A 3I3EA 4ZZ8A 2QQKA 1BHGA 4DEVA 2WO2A 3C7OA 3D3AA 1XPWA 3C8XA 3SEPA 4Z2AA 1PMJX 3F2ZA 4P02B 2JKXA 1XC6A 2E32A 2E26A 2Z4FA 2ORXA 4DXTA 1XNAA 3UNPA 1ULOA 2R7EB 3WF2A 5IFPA 4CUBA 3WNKA 1MPXA 5JXHA 1JYWA 3GXUA 3IAQA 5JXJA 3OB8A 1W8NA 3NNGA 4PT6A 4JKMA 1W9TA 2BBAA 3AC0A 1UY3A 1L7QA 1OF3A 4GWIA 4CU6A 1JZ7A 2ZXQA 5IHRA 3A7QA 3C7HA 3CZJA 2W91A 4KI5M 3HNYM 3NQHA 2VZSA 5B4NA 3OGRA 3W5NA 3LPGA 3I3DA 4XURA 1JHJA 4QDRA 4PF1A 3BGAA 3UESA 4AG4A 2BZDA 1NUKA 4OYUA 4MGSA 1JZ5A 3LE0A 4XZUG 1UX7A 1US2A 3CKHA 4P5YA 1J84A 2VZ1A 5IFTA 3K4DA 5HXMA 1JU3A 5DPNA 2RV9A 3OBAA 1DP0A 4E8DA 3CDZB 2ORZA 4GWJA 5G04L 2QQIA 2V4VA 2WZEA 4W8JA 1W9SA 5IJRA 1CZSA 3T2QA 2C4XA 1W99A 2QQLA 5LCWL 5FUIA 3WQBA 5HPOA 3OGSA 3LEIA 4AAXA 1K3IA 3DYOA 3THDA 1JYVA 1HN1A 3FHQA 4KWUA 2JDAA 2VCBA 2W47A 1UMIA 2YFUA 4ZXEA 2OKXA 3GM8A 3K77A 1UYXA 4P00B 5JMOA 4OMCA 2VCCA 3I2KA 5B4XA 4KMQA 1GOFA 3VDCA 3ZM8A 3VDBA 4OMDA 2VZVA 3HN3A 4D8MA 4A45A 3MBWA 1JI6A 2BGOA 1T2XA 1UY4A 2WBKA 4BJ0A 2ID4A 3WNPA 1LNSA 2BERA 3WF0A 3HEIA 4ARXA 1P8JA 4BK5A 4GZ9A 3C7FA 2ZEYA 3CMGA 3SKJE 4DEQA 2QQOA 3PUHA 1O8SA 4XUOA 2XONA 1KGYA 2EIDA 2J1AA 5LA0A 1TG7A 1K42A 2YC4A 2ZEZA 4BK4A 2DCKA 2X09A 4M4PA 3T09A 3K75B 2QQJA 5LA1A 4ET7A 4A6OA 1GUIA 2WO1A 1D7PM 1PX4A 2B4KA 2JE8A 1UXZA 1L7RA 3WF3A 3MUZ1 4TXWA 4JKKA 2Y6LA 5EJ1B 3LEGA 3T0BA 3WSOA 5EIYB 3T08A 2QQNA 4E8CA 2VO5A 3WNOA 3HNBM 2VQUA 3PUIA 1DLCA 2QQMA 2WAAA 2ZEXA 4QX2A 3GGLA 4MO3M 3NJXA 2L9LA 1JZ4A 4OUEA 1ULPA 1UY0A 3T2PA 3E1F1 3K4AA 2DCJA 4BXSV 1GNYA 2LW8A 3MV01 3UETA 2WABA 3I3BA 1OD3A 4MGQA 4QX3A 4DUWA 5JUVA 3OEBA 3DYPA 2W92A 2W95A 3I2JA 3A21A 4QX1A 1GMMA 3MUY1 2X10A 3ACFA 5EJZB 2WQ8A 3ETPA 5G05L 2VZ3A 2V5DA 3JXSA 4QPWA 2QBXA 1SDDB 1JYNA 2VMEA 1XNTA 4QDSA 1JZ3A 4FI9A 4OZOA 2Y6JA 3A23A 5JR2A 2WDBA 4ZY9A 4CU8A 2W1WA 4YPJA 2VL4A 3EYPA 2W1QA 4CUCA 3IIIA 1SHWB 3FHAA 4LKSA 2WO3A 3OG2A 4UOJA 1UY1A 4D0QA 5JXGA 2YG0A 4CVUA 3FL7A 1PMHX 2YB7A 3LQCA 2VMDA 4RN5A 2J7MA 2J1TA 1F4HA 1JZ6A 2XQXA 5A1AA 1JYXA 2E33A 1UYYA 2EIEA 2WN2A 2B9VA 4QB1A 2W9XA 2VZUA 5CZKA 3T0AA 5J1XA 3I97A 1R64A 1UZ0A 2VR4A 3DYMA 4DUVA 2BGPA 5DN2A 1CZVA 3OEAA 2C26A 1UMHA 2EIBA 1W9WA 4LQRA 2VQTA 3SEEA 3C7EA 1K12A 2J1UA 3NJVA 4CU7A 2WAOA 1JZ2A 4PQQA 1K45A 2VTFA 5C71A 4A4AA 1UY2A 1IQDC 1EUTA 3HOBA 1GOGA 4RYDA 3VDAA 3OGVA 2W5FA 1J83A 1DYOA 5C70A 2RJ2A 3ACIA 3HPNA 2VZPA 3CQOA 2CDPA 3WNMA 1US3A 2LS6A 2W1UA 1JZ8A 5F7UA 2VZRA 2W87A 2HYXA 3GDBA 4UAPA 2Y6HA 1O59A 2VC9A 4DXSA 1WKYA 3HNMA 5DMYA 4A42A 3WEZA 3VD9A 1YQ2A 2PQSA 2E31A 1GQPA 3ACGA 4XVHA 3VD3A 4QDQA 2VCAA 3ACHA 2DDUA 2WYSA 4MADA 4XUQA 4QX0A 2Y6KA 4XUPA 1UYZA 1O8PA 1OT5A 2VJXA 2VOTA 4HG6B 5LA2A 4JHZA 1PX3A 2EICA 2W1SA 4JX0A 2J1SA 5IYYA 3CIHA 1OH4A 1KEXA 4M4RA 3WF4A 2ZEWA 3K4ZA 2J1RA 1W0NA 4W4ZA 3THCA 1TVGA 1W8OA 3MO4A 2J1VA 3VD5A 4CU9A 2YFZA 3ECQA 4LHSA 1UWWA 2VZOA 3I2HA 5DQ0A 3FN9A 2RVAA 2W46A 3I2FA 3T0DA 4ZZ5A 1NKGA 4CUAA 4UI9L 4QB2A 3EB7A 1RYYA 3K46A 3T2OA 3J7HA 3W5MA 1H6XA 2Y6GA 4P08A 1JU4A 4DXRA 4A3ZA 2VZQA 4IUGA 1GU3A 4L0PA 1WCQA 3NRUA 1OF4A 3DECA 3A22A 2J22A 2C9KA 1CZTA 3ABZA 2V72A 1CIYA 2KD7A 1NX9A 2YC2A 1F4AA 4QB6A 2X05A 4DUXA 3IAPA 2VM9A 4JKLA 3C7GA 3IB3A 4W50A 2HLEA 3I2IA 1EUUA 1UXXX 4LPLA 3SKVA 2JD9A 2VMCA 2VMFA 2W3JA 2XHNA 2XOMA 4XUTA 3U37A 4ARYA 1I5PA 3LPFA 3P1IA 2W94A 3WNLA 1SG3A 1CX1A 3CZUA 2WN3A 3I2GA 5CYYA 4XUNA 4A41A 3HJRA 3BN6A 2Y8KA 1NAEA 4TTGA 4BDVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXI A;  3WF1 A;  4MOA A;  3MV1 1;  2Y64 A;  3IDA A;  3WNN A;  3VD7 A;  3LEK A;  3VD4 A;  4QAW A;  2CDO A;  1GOH A;  5C7G A;  2J1E A;  4A44 A;  5I0D A;  2VZT A;  1H6Y A;  2WUH A;  3P6B A;  2WZ8 A;  3I3E A;  4ZZ8 A;  2QQK A;  1BHG A;  4DEV A;  2WO2 A;  3C7O A;  3D3A A;  1XPW A;  3C8X A;  3SEP A;  4Z2A A;  1PMJ X;  3F2Z A;  4P02 B;  2JKX A;  1XC6 A;  2E32 A;  2E26 A;  2Z4F A;  2ORX A;  4DXT A;  1XNA A;  3UNP A;  1ULO A;  2R7E B;  3WF2 A;  5IFP A;  4CUB A;  3WNK A;  1MPX A;  5JXH A;  1JYW A;  3GXU A;  3IAQ A;  5JXJ A;  3OB8 A;  1W8N A;  3NNG A;  4PT6 A;  4JKM A;  1W9T A;  2BBA A;  3AC0 A;  1UY3 A;  1L7Q A;  1OF3 A;  4GWI A;  4CU6 A;  1JZ7 A;  2ZXQ A;  5IHR A;  3A7Q A;  3C7H A;  3CZJ A;  2W91 A;  4KI5 M;  3HNY M;  3NQH A;  2VZS A;  5B4N A;  3OGR A;  3W5N A;  3LPG A;  3I3D A;  4XUR A;  1JHJ A;  4QDR A;  4PF1 A;  3BGA A;  3UES A;  4AG4 A;  2BZD A;  1NUK A;  4OYU A;  4MGS A;  1JZ5 A;  3LE0 A;  4XZU G;  1UX7 A;  1US2 A;  3CKH A;  4P5Y A;  1J84 A;  2VZ1 A;  5IFT A;  3K4D A;  5HXM A;  1JU3 A;  5DPN A;  2RV9 A;  3OBA A;  1DP0 A;  4E8D A;  3CDZ B;  2ORZ A;  4GWJ A;  5G04 L;  2QQI A;  2V4V A;  2WZE A;  4W8J A;  1W9S A;  5IJR A;  1CZS A;  3T2Q A;  2C4X A;  1W99 A;  2QQL A;  5LCW L;  5FUI A;  3WQB A;  5HPO A;  3OGS A;  3LEI A;  4AAX A;  1K3I A;  3DYO A;  3THD A;  1JYV A;  1HN1 A;  3FHQ A;  4KWU A;  2JDA A;  2VCB A;  2W47 A;  1UMI A;  2YFU A;  4ZXE A;  2OKX A;  3GM8 A;  3K77 A;  1UYX A;  4P00 B;  5JMO A;  4OMC A;  2VCC A;  3I2K A;  5B4X A;  4KMQ A;  1GOF A;  3VDC A;  3ZM8 A;  3VDB A;  4OMD A;  2VZV A;  3HN3 A;  4D8M A;  4A45 A;  3MBW A;  1JI6 A;  2BGO A;  1T2X A;  1UY4 A;  2WBK A;  4BJ0 A;  2ID4 A;  3WNP A;  1LNS A;  2BER A;  3WF0 A;  3HEI A;  4ARX A;  1P8J A;  4BK5 A;  4GZ9 A;  3C7F A;  2ZEY A;  3CMG A;  3SKJ E;  4DEQ A;  2QQO A;  3PUH A;  1O8S A;  4XUO A;  2XON A;  1KGY A;  2EID A;  2J1A A;  5LA0 A;  1TG7 A;  1K42 A;  2YC4 A;  2ZEZ A;  4BK4 A;  2DCK A;  2X09 A;  4M4P A;  3T09 A;  3K75 B;  2QQJ A;  5LA1 A;  4ET7 A;  4A6O A;  1GUI A;  2WO1 A;  1D7P M;  1PX4 A;  2B4K A;  2JE8 A;  1UXZ A;  1L7R A;  3WF3 A;  3MUZ 1;  4TXW A;  4JKK A;  2Y6L A;  5EJ1 B;  3LEG A;  3T0B A;  3WSO A;  5EIY B;  3T08 A;  2QQN A;  4E8C A;  2VO5 A;  3WNO A;  3HNB M;  2VQU A;  3PUI A;  1DLC A;  2QQM A;  2WAA A;  2ZEX A;  4QX2 A;  3GGL A;  4MO3 M;  3NJX A;  2L9L A;  1JZ4 A;  4OUE A;  1ULP A;  1UY0 A;  3T2P A;  3E1F 1;  3K4A A;  2DCJ A;  4BXS V;  1GNY A;  2LW8 A;  3MV0 1;  3UET A;  2WAB A;  3I3B A;  1OD3 A;  4MGQ A;  4QX3 A;  4DUW A;  5JUV A;  3OEB A;  3DYP A;  2W92 A;  2W95 A;  3I2J A;  3A21 A;  4QX1 A;  1GMM A;  3MUY 1;  2X10 A;  3ACF A;  5EJZ B;  2WQ8 A;  3ETP A;  5G05 L;  2VZ3 A;  2V5D A;  3JXS A;  4QPW A;  2QBX A;  1SDD B;  1JYN A;  2VME A;  1XNT A;  4QDS A;  1JZ3 A;  4FI9 A;  4OZO A;  2Y6J A;  3A23 A;  5JR2 A;  2WDB A;  4ZY9 A;  4CU8 A;  2W1W A;  4YPJ A;  2VL4 A;  3EYP A;  2W1Q A;  4CUC A;  3III A;  1SHW B;  3FHA A;  4LKS A;  2WO3 A;  3OG2 A;  4UOJ A;  1UY1 A;  4D0Q A;  5JXG A;  2YG0 A;  4CVU A;  3FL7 A;  1PMH X;  2YB7 A;  3LQC A;  2VMD A;  4RN5 A;  2J7M A;  2J1T A;  1F4H A;  1JZ6 A;  2XQX A;  5A1A A;  1JYX A;  2E33 A;  1UYY A;  2EIE A;  2WN2 A;  2B9V A;  4QB1 A;  2W9X A;  2VZU A;  5CZK A;  3T0A A;  5J1X A;  3I97 A;  1R64 A;  1UZ0 A;  2VR4 A;  3DYM A;  4DUV A;  2BGP A;  5DN2 A;  1CZV A;  3OEA A;  2C26 A;  1UMH A;  2EIB A;  1W9W A;  4LQR A;  2VQT A;  3SEE A;  3C7E A;  1K12 A;  2J1U A;  3NJV A;  4CU7 A;  2WAO A;  1JZ2 A;  4PQQ A;  1K45 A;  2VTF A;  5C71 A;  4A4A A;  1UY2 A;  1IQD C;  1EUT A;  3HOB A;  1GOG A;  4RYD A;  3VDA A;  3OGV A;  2W5F A;  1J83 A;  1DYO A;  5C70 A;  2RJ2 A;  3ACI A;  3HPN A;  2VZP A;  3CQO A;  2CDP A;  3WNM A;  1US3 A;  2LS6 A;  2W1U A;  1JZ8 A;  5F7U A;  2VZR A;  2W87 A;  2HYX A;  3GDB A;  4UAP A;  2Y6H A;  1O59 A;  2VC9 A;  4DXS A;  1WKY A;  3HNM A;  5DMY A;  4A42 A;  3WEZ A;  3VD9 A;  1YQ2 A;  2PQS A;  2E31 A;  1GQP A;  3ACG A;  4XVH A;  3VD3 A;  4QDQ A;  2VCA A;  3ACH A;  2DDU A;  2WYS A;  4MAD A;  4XUQ A;  4QX0 A;  2Y6K A;  4XUP A;  1UYZ A;  1O8P A;  1OT5 A;  2VJX A;  2VOT A;  4HG6 B;  5LA2 A;  4JHZ A;  1PX3 A;  2EIC A;  2W1S A;  4JX0 A;  2J1S A;  5IYY A;  3CIH A;  1OH4 A;  1KEX A;  4M4R A;  3WF4 A;  2ZEW A;  3K4Z A;  2J1R A;  1W0N A;  4W4Z A;  3THC A;  1TVG A;  1W8O A;  3MO4 A;  2J1V A;  3VD5 A;  4CU9 A;  2YFZ A;  3ECQ A;  4LHS A;  1UWW A;  2VZO A;  3I2H A;  5DQ0 A;  3FN9 A;  2RVA A;  2W46 A;  3I2F A;  3T0D A;  4ZZ5 A;  1NKG A;  4CUA A;  4UI9 L;  4QB2 A;  3EB7 A;  1RYY A;  3K46 A;  3T2O A;  3J7H A;  3W5M A;  1H6X A;  2Y6G A;  4P08 A;  1JU4 A;  4DXR A;  4A3Z A;  2VZQ A;  4IUG A;  1GU3 A;  4L0P A;  1WCQ A;  3NRU A;  1OF4 A;  3DEC A;  3A22 A;  2J22 A;  2C9K A;  1CZT A;  3ABZ A;  2V72 A;  1CIY A;  2KD7 A;  1NX9 A;  2YC2 A;  1F4A A;  4QB6 A;  2X05 A;  4DUX A;  3IAP A;  2VM9 A;  4JKL A;  3C7G A;  3IB3 A;  4W50 A;  2HLE A;  3I2I A;  1EUU A;  1UXX X;  4LPL A;  3SKV A;  2JD9 A;  2VMC A;  2VMF A;  2W3J A;  2XHN A;  2XOM A;  4XUT A;  3U37 A;  4ARY A;  1I5P A;  3LPF A;  3P1I A;  2W94 A;  3WNL A;  1SG3 A;  1CX1 A;  3CZU A;  2WN3 A;  3I2G A;  5CYY A;  4XUN A;  4A41 A;  3HJR A;  3BN6 A;  2Y8K A;  1NAE A;  4TTG A;  4BDV B; 
#chains in the Genus database with same CATH topology
 4AQ2 A;  3KCY A;  1A78 A;  4AI2 A;  4IGO A;  2ZGT A;  1PM4 A;  3NMB A;  4QAW A;  3ZKU A;  4QXB A;  3JBG 1;  1OBN A;  2CDO A;  3AFK A;  2GH2 A;  5C7G A;  5GZD A;  1C57 A;  2PXJ A;  1TNF A;  3VZO A;  5I8Y A;  2PAM A;  2VZT A;  1RUE 2;  3BPS A;  1CPM A;  3P6B A;  2WZ8 A;  1NCR C;  4CA9 A;  3I3E A;  1VAM A;  2ZHL A;  4XHB A;  3S5A A;  1W2A X;  1Y7B A;  4K8F A;  2WO2 A;  1YNA A;  2WQ4 A;  3WD5 A;  2CL2 A;  3ZX7 A;  3SEP A;  3KQ4 B;  2B39 A;  2ZJC A;  3JD7 2;  3T4H B;  1W04 A;  2RG4 A;  3MF9 A;  4P02 B;  4GKY A;  2A6V A;  2RMU 1;  4XOG A;  4BQ1 A;  5AFB A;  2XJS A;  5IVB A;  2GAU A;  2NMO A;  4YZ1 A;  5A70 A;  3VBH B;  2DUP A;  3T2T A;  5FYI A;  1LOA A;  1XC6 A;  1E57 A;  1Y4W A;  2CTV A;  5FPZ A;  3ZIX A;  1YQ6 A;  4RSU A;  3QCW A;  5GZC A;  2E53 A;  4CCD A;  2ORX A;  1KRI A;  4BWO A;  4ASL A;  5DDJ 2;  5LBE A;  2A5Z A;  2IXI A;  2K2S A;  1ULO A;  3PMS A;  4AFA A;  4KGG A;  1RUC 2;  2OQ7 A;  3WW4 A;  4CSW A;  4YFW A;  3NKG A;  2XH6 A;  1VP6 A;  1ZRF A;  4IGP A;  3FC0 A;  1PO2 2;  4CTE A;  2CWS A;  2R30 A;  4WM7 C;  1JYW A;  1NQJ A;  5I0T A;  2C24 A;  3GCW A;  4PT6 A;  2Z42 A;  5DAV A;  1TEI A;  2NLR A;  1D4V B;  4S2D A;  4DY5 A;  1AL0 G;  3PTY A;  1AYN 2;  2ZXQ A;  5GM0 A;  2O8O A;  4COV A;  2FD8 A;  1GNZ A;  1VR3 A;  4FSJ A;  2ZHK A;  2VUL A;  4AQT A;  2PQQ A;  1AVB A;  5B4N A;  4Q4W 3;  1UL9 A;  3NKT A;  3LPG A;  2GC1 A;  1VBA 1;  2ET1 A;  4XUR A;  1ND3 B;  2JE9 A;  4F83 A;  1V6I A;  4FAH A;  4MGS A;  2IFW A;  4D6R A;  2HWC 2;  3WT3 A;  3AYD A;  2GAL A;  5IK4 A;  1RUG 1;  5FYH A;  4AR2 A;  4XZU G;  1US2 A;  2ZGM A;  3N35 A;  3R4U A;  5FPU A;  4IEP A;  2GMM A;  2VZ1 A;  3K4D A;  5HXM A;  5FIX A;  4DZG A;  4R4X A;  3ELN A;  4XAC A;  1FAT A;  3LKJ A;  3ZFF A;  3CDZ B;  4BYY A;  2OPK A;  4KWK A;  4CRQ A;  3MIE A;  3QH6 A;  4DOU A;  2V4V A;  1RUC 1;  3RG0 A;  4NHY A;  3RYK A;  1MEC 3;  2UYA A;  3VZK A;  2C4X A;  4MZU A;  1PO2 1;  2I2S A;  1FAY A;  2XL7 A;  2QQL A;  4HKL A;  5FK7 A;  2BNO A;  3AX4 A;  3RVH A;  3MEP A;  1VJ2 A;  2BW8 A;  3ZSM A;  2EAL A;  3AL5 A;  3J4U H;  5FR3 A;  3S0M A;  4YGC A;  3IDB B;  3WV6 A;  3CJI A;  4I02 A;  5APA A;  1XU2 A;  3K2O A;  1Z7S 1;  4IV1 C;  1AYN 1;  2W47 A;  1UMI A;  4OCT A;  1GWK A;  2HYK A;  4QX5 A;  2DVD A;  4Q4Y 1;  4M3C E;  1SBE A;  4UF0 B;  2JEM A;  3VBS A;  4H3W A;  4JRL A;  4DS0 A;  1DGL A;  5IUQ A;  1WLC A;  3KGL A;  2JG8 A;  1K5M B;  3VBF B;  3ZFE B;  3ZM8 A;  1F5F A;  1YLL A;  1PMI A;  1W2T A;  1QDC A;  3ZN4 A;  4E2G A;  1S0J A;  4XJZ A;  4JAA A;  1RUH 3;  3HN3 A;  3RGB A;  2XUM A;  2ZPX A;  2VG9 A;  2YZ4 A;  3I8T A;  4U2A A;  3S7I A;  3WW2 A;  4A45 A;  3Q8C A;  2HWC 1;  5FBJ A;  4NII A;  1T2X A;  2EXH A;  1QGL A;  1XNB A;  4Y5S A;  2ID4 A;  1C8M 3;  2BER A;  3QH7 A;  4ZU5 A;  5CFC A;  3SIS A;  1BZW A;  2W52 A;  1C8N A;  1X7N A;  1FYU A;  4GZ9 A;  1NG0 A;  1VMJ A;  5EV7 A;  4XQ4 A;  3PUH A;  1NLQ A;  2DBN A;  3ON7 A;  1TMF 3;  2XJR A;  2ZKL A;  1HLC A;  4LIV A;  3ZYF A;  4K3U A;  4BK4 A;  2D40 A;  3LAG A;  1W8W A;  4YM2 A;  1RHI 1;  3KMH A;  1OQE A;  4NAO A;  3K75 B;  4PJY A;  2YMZ A;  2QQJ A;  5A33 B;  2YU2 A;  4AOC A;  1JHN A;  3NO8 A;  4IDZ A;  4AVT A;  4K1Z A;  2DVB A;  3NVC A;  2XVK A;  3AXE A;  5KR7 A;  2WO1 A;  3APB A;  3OD4 A;  2AEY A;  1LOF A;  5C5T A;  3E6C C;  1UIJ A;  2NPI A;  4CP9 A;  3EQE A;  1W8T A;  3L2Y A;  5FZA A;  2ETE A;  1EAH 1;  1I3H A;  2XKP A;  3WF3 A;  2ZAH A;  4GB3 2;  1YFU A;  3LDK A;  3MUZ 1;  4AI3 A;  3M7A A;  3DKW A;  1ZZC A;  3LEG A;  5EIY B;  3N3H A;  3O1V A;  3S7E A;  1QOO A;  3AZY A;  2QQN A;  4QKN A;  5A7S A;  5A6Y A;  5C3P A;  2P6H A;  5SV8 A;  3H3U A;  3BUC A;  4WBB A;  3BOP A;  4GH4 A;  4I30 A;  1DLC A;  4NR1 A;  2QQM A;  4SBV A;  3LA7 A;  2BFU S;  3I2D A;  4QX2 A;  3GGL A;  3B01 A;  1SBD A;  2L9L A;  1JZ4 A;  1SLA A;  1ULP A;  4GAZ A;  3L2H A;  3A0N A;  1EP0 A;  1N3Q A;  2KR2 A;  3H1M A;  1C5I A;  4BQX A;  5JZG A;  2DCJ A;  3K3O A;  1DFQ A;  1GNY A;  2DYC A;  4RQP A;  5T50 A;  3HQR A;  2WAB A;  4OFG A;  1OD3 A;  4MGQ A;  2D5H A;  1BBT 1;  2VVE A;  4QX3 A;  4C91 A;  4H55 A;  4EWA A;  3O14 A;  4DUW A;  5JUV A;  2R04 2;  3HWJ A;  4R9D A;  2W95 A;  4FTS A;  3DPR C;  3RMY A;  5FYY A;  1JUH A;  2X8K A;  1XYN A;  5J36 A;  4QX1 A;  4HL0 A;  3H50 A;  4RHV 1;  4LKE A;  3MUY 1;  2X5I B;  1EPZ A;  4LBO A;  3DXU A;  3VZN A;  1OKO A;  4L11 A;  3GJB A;  3N9Q A;  4M0N A;  1R1A 3;  1YXW A;  5FY7 A;  4CEW B;  2D6P A;  2PEL A;  3RNS A;  4Z1V A;  1MS9 A;  3MHZ A;  3O7O A;  4A3X A;  4GB3 1;  2DU0 A;  1XNT A;  4IL7 A;  1R08 3;  4FI9 A;  1K5J A;  3DKQ A;  1UAI A;  2B5H A;  3ATG A;  4OI4 A;  5GLT A;  1RJ7 A;  4GMP 0;  4YPJ A;  1UOG A;  4LBN A;  4XAB A;  1W03 A;  2W1Q A;  4XPV A;  3ES4 A;  4CZS A;  1GNH A;  3RJ2 X;  2Y0O A;  1QKQ A;  2LM3 A;  4V2W A;  1QJU 1;  3RYP A;  2O0O A;  3D0S A;  2WO7 A;  5BNN C;  2F6B A;  5FYC A;  5KHG A;  4AFD A;  3RZL A;  1UKG A;  3M70 A;  4Y5Z 0;  4AVV A;  3FL7 A;  4XMA A;  2VMD A;  3O0X A;  2J1T A;  3S5Q A;  1F4H A;  4QPI A;  3AJY A;  2WLQ A;  3FX3 A;  2D6N A;  3VN4 A;  1LEN A;  4XTP A;  2JDZ A;  2XQR A;  3ZYI B;  4B29 A;  4Y3O A;  1GLH A;  2E33 A;  1GZW A;  1UYY A;  4X6Q B;  4Y26 A;  2R04 1;  2BOI A;  1V6N A;  5GZG A;  1H30 A;  5FZ9 A;  4QB1 A;  1I1E A;  4CDW C;  1HDK A;  2FBE A;  1AXY A;  3U11 A;  1ZRR A;  2VZU A;  5CZK A;  1H1A A;  1YHF A;  4XF3 A;  3I97 A;  5J1X A;  2VR4 A;  2VTX J;  3H42 B;  3SCF A;  4DUV A;  5FP8 A;  4GJY A;  4HSJ A;  1FXZ A;  3SXW A;  1NCQ A;  1W6Q A;  2ZCW A;  3GCX A;  2V73 A;  1BJQ A;  5DUX A;  5T5J A;  4BMB A;  1G9A A;  4EQV A;  1AR8 2;  1HJG A;  2EIB A;  4Z07 A;  2CAV A;  3KCX A;  3SCG A;  2VQT A;  4WM7 B;  4AYU A;  1CAV A;  2YPD A;  4Q4W 2;  1LHN A;  2AEN A;  1K12 A;  2H6B A;  1S0I A;  3KD4 A;  5FDB A;  5JIU A;  3AMM A;  1M4W A;  3RMX A;  1ZBA 1;  5KC6 A;  2VQ0 A;  1NA1 A;  1DQ6 A;  4MLO A;  3RPQ A;  2MEV 1;  1PVC 1;  2QUO A;  4ONU A;  5LWB A;  1QQP 3;  1K45 A;  2RS1 2;  2WS9 3;  1ZRC A;  4HAN A;  2YC0 A;  3IM0 A;  4HPK A;  1V6K A;  4N53 C;  4WVZ A;  4HVQ A;  5F1R A;  1XQN A;  3KM5 A;  5AC9 3;  3LD8 A;  2DVA A;  4A4A A;  1BVP 1;  1UY2 A;  2DCY A;  2WJS A;  2XJP A;  4NJ4 A;  1OLM A;  4NRM A;  1BMV 2;  4PCR A;  4Z92 B;  1W6N B;  3WR0 A;  1NZC A;  2VOW A;  1GOG A;  2MPF A;  1VE0 A;  4RYD A;  2VMI A;  5C33 A;  2HWD 3;  1MEC 2;  1QXJ A;  1D4M 1;  3OBT A;  4BQ5 A;  2R1D A;  3I59 B;  5IVF A;  2W0X A;  1OD5 A;  1EPW A;  1ZX5 A;  2CDP A;  3WNM A;  3G7D A;  5LY1 A;  2W1U A;  5CFC C;  3HN1 A;  5K8S A;  2W87 A;  2E63 A;  4XEZ A;  2HYX A;  2R32 A;  1GWL A;  3O0V A;  4YZ3 A;  1HB2 A;  3VZM A;  3O1P A;  2VU9 A;  4HN1 A;  2Y6H A;  3WOG A;  5FXZ A;  1O59 A;  2F17 A;  2CNA A;  1AR8 1;  4P9I A;  3WZ1 A;  3VL8 A;  1ZBE 1;  4DXS A;  2Q5T A;  3UYJ A;  3EMR A;  2BJS A;  3WG2 A;  4LT5 A;  3ZXK A;  4LE3 A;  2YXS A;  4YG6 A;  4AZZ A;  1HJF A;  4Y22 B;  3VD9 A;  2PQS A;  1BQP A;  1YQ5 A;  2JX9 A;  2VPV A;  3BOW A;  4L92 A;  3RSJ A;  4F3J A;  5FY8 A;  1HXS 3;  2ARE A;  1CGP A;  1UKR A;  3MI8 A;  1UZZ A;  5FY9 A;  4IV1 B;  1AXK A;  1RUH 2;  4XYX A;  3Q9O A;  5FZO A;  1LOF C;  2RS1 1;  2VCA A;  3ACH A;  1JOP A;  3LB9 A;  3AZV A;  1OC1 A;  3OY8 B;  5FYB A;  2WII B;  1X8E A;  2HEW F;  2QDR A;  4QD2 A;  1ZM1 A;  1UYZ A;  1HRV 1;  1C8M 2;  1S0E A;  2WT2 A;  2XJV A;  1AX2 A;  4Q4V 1;  4HG6 B;  4Y1U A;  3TNQ A;  1BMV 1;  2RMU 3;  2DTY A;  1PX3 A;  2W1S A;  2J1S A;  1V6L A;  1KEX A;  3WF4 A;  1B35 A;  4JTN A;  1EY2 A;  3HQU A;  3U10 A;  4B1M A;  3ACL A;  1HKD A;  4LHK A;  5EHD A;  1TMF 2;  1J1T A;  3THC A;  3I49 A;  1DHK B;  1JW6 A;  4P9L A;  1DZQ A;  1JOB A;  3N7M A;  1WBL A;  2PYT A;  4HSL A;  3DGT A;  4IEW A;  4AGV A;  4ZKT B;  2ZZQ A;  1BVV A;  2VZO A;  4COZ A;  4ERO A;  2OZJ A;  3FN9 A;  5JZG C;  2YYO A;  2BVV A;  2QQW A;  2W46 A;  4FCA A;  4XQW A;  4CP1 A;  1Q56 A;  2CSG A;  5JI9 A;  1DGR N;  4Y4Y A;  4I09 A;  4D3W A;  5FMO S;  4YVW A;  2GNB A;  3SLI A;  1UO9 A;  2JB4 A;  3VHN A;  1GWM A;  3NV4 A;  5CBL A;  4IEO A;  1HX6 A;  4DFS A;  1MVE A;  1O5L A;  2EIG A;  3AYC A;  1ENR A;  4FBF A;  3DV8 A;  3F95 A;  3PNA A;  5LW9 A;  5CB7 A;  1UW8 A;  1CIW A;  1PGL 2;  2VZQ A;  1RUH 1;  2Y0I A;  3FLR A;  4GD4 A;  4QWN A;  3IZO A;  4Y5T A;  1MVQ A;  1VBA 3;  4D7T A;  3WCS A;  1OF4 A;  4BOW A;  1UZV A;  4WZC A;  4Y4R A;  1ALY A;  1MZ5 A;  2J22 A;  4MGK E;  2C9K A;  4BZ4 A;  1CZT A;  5DAP A;  1AZD A;  1C8M 1;  2W39 A;  2RJL A;  2IUW A;  1RUG 3;  2O8Q A;  2FDK A;  1TME 1;  5JOY A;  4QX8 A;  3MW2 A;  1LKN A;  3C7G A;  3BU0 A;  3N7L A;  4RS5 A;  1J1L A;  1STM A;  3KB5 A;  3EJK A;  1Y9Q A;  1KD7 A;  4R4Z A;  2RDQ A;  5L73 A;  1GP6 A;  1OA2 A;  3SHR A;  2YUE A;  1BEV 1;  4PDW C;  1N47 A;  1RUC 3;  1PHM A;  3AP9 A;  1CJP A;  4LE4 A;  3WQ0 A;  1A8D A;  3FZ3 A;  2VMC A;  4I0W B;  1D2Q A;  1IS5 A;  2W3J A;  4HK8 A;  3HBZ A;  4BPZ A;  4X8P A;  5CIS A;  2D97 A;  1VBB 3;  4DXZ A;  4XFB A;  1OFN A;  3K51 A;  4QPI C;  5FY0 A;  3WVJ A;  4ARY A;  4GWN A;  2RHP A;  4FPH A;  4RR3 A;  2R1B A;  4IEU A;  3VBU A;  5C3Q A;  1O4Y A;  5H9S A;  4QQO A;  4GXL A;  5CEH A;  4Q29 A;  1W8U A;  2BNN A;  2W94 A;  1Z7S 3;  2HWE 3;  3PUR A;  4L9B A;  3SC7 X;  1D2S A;  1R1A 2;  4YW4 A;  1FV2 A;  3WNL A;  2YBK A;  2D6K A;  2HWF 1;  4CCK A;  3CZU A;  2WC2 A;  3N9O A;  3DPR B;  4RA0 A;  4Q4Y 3;  5CYY A;  1OFS A;  4YSF A;  1MZ6 A;  5BNQ A;  1VBC 1;  1R08 2;  3LGR A;  1C1F A;  1Y9G A;  3V0A B;  1PGL 1;  3BN6 A;  5GZF A;  3OUH A;  1LGC A;  2JEN A;  4N43 A;  4CCE A;  4EV0 A;  1AHS A;  2OYZ A;  4L2N A;  4DNY A;  3JB4 C;  3LIG A;  2UY9 A;  4AI8 A;  3USU A;  4XCA A;  1DF0 A;  4AWD A;  2K9Z A;  4MYE A;  4MOA A;  5JXI A;  1BK0 A;  3CHX A;  4P14 A;  3MV1 1;  2IVJ A;  2NYY A;  3WNN A;  3HD8 B;  3LEK A;  5F39 A;  1Z78 A;  5HCA A;  3BIE A;  1L7L A;  5FY1 A;  1F15 A;  4JV4 A;  3T4V A;  5FOB B;  4FPO B;  4FPK A;  5D21 A;  4MXW A;  5H9P A;  2NZ9 A;  1CAU A;  2OX0 A;  4D7S A;  2BP6 A;  1WCD J;  4JGY A;  3VKL A;  1H6Y A;  2VUA A;  2TUN A;  2WUH A;  2XB6 C;  2QQK A;  3ZKY A;  2IWG B;  4FOW A;  2ZGR A;  5DZF A;  2VOV A;  2ZGQ A;  1XPW A;  3BTA A;  3EHK A;  5KHJ A;  1QOT A;  3NV3 A;  4YGB A;  1GV9 A;  1LOC A;  2N7G A;  1JBC A;  3UK9 A;  4AEM A;  4EYU A;  1PMJ X;  1GAN A;  5F5C A;  5BNN B;  4MGI E;  3I54 A;  3J9S A;  5E1R A;  2WNV C;  4OHZ A;  4XBN A;  1E5I A;  3POJ A;  5FUP A;  1GBG A;  1RHI 3;  3B5L B;  3OCP A;  1MR5 A;  1QJE A;  2YGL A;  4HKO A;  5DXD A;  2E26 A;  3O12 A;  1AX0 A;  4LTA A;  5FZ0 A;  2XPJ A;  4DXT A;  1ZZ7 A;  4EJR A;  2DTW A;  3I2O A;  2R7E B;  3J8F 1;  4CDW B;  4K1Y A;  3M3E A;  3WNK A;  1UU6 A;  5JXH A;  1KS4 A;  3KLS A;  2JKB A;  3ZFF B;  4Z2W A;  1EAH 3;  3IAQ A;  5E8A A;  1YQC A;  1FMD 3;  3OB8 A;  1W8N A;  1S2K A;  3AKQ A;  3IBM A;  3NNG A;  1CES A;  1POV 1;  3AP6 A;  3N7J A;  4AQS A;  2OXB A;  3PVB B;  4YRD A;  1A34 A;  4KL1 A;  5A80 A;  5T54 A;  1QQP 2;  1WCS A;  4R9B A;  1NLR A;  2WS9 2;  1AJO A;  1ACC A;  3LDR A;  3IPV A;  5FZI A;  1W8H A;  3FLP A;  3VZL A;  4H2A A;  5AVP A;  3C7H A;  3CZJ A;  1E5H A;  2KM2 A;  3HNY M;  4UFM A;  4TYS A;  5AC9 2;  2VZS A;  1HV0 A;  2ET7 A;  2PHR A;  2DCZ A;  4AED C;  2A7A A;  1PK6 A;  2UWB A;  4FVV A;  1JHJ A;  2BFU L;  5GZE A;  4CPB D;  2PN5 A;  5BNP A;  2A75 A;  4I0A A;  4PF1 A;  3BGA A;  1NUK A;  4QGN A;  3E5U A;  5FYT A;  5LAS A;  4KBB A;  1WW7 A;  4N53 B;  1LUL A;  1BBT 3;  4AHY A;  1CVN A;  3UT0 A;  4CDX A;  2B7Y A;  5LBB A;  2OUJ A;  4A7Y A;  1B09 A;  4P5Y A;  1QU0 A;  1GSL A;  2ZKN A;  4W65 A;  2FZ1 A;  5IFT A;  3MLJ A;  1W6M B;  3OBA A;  2IC1 A;  1DP0 A;  3CJX A;  4N7I A;  4RHV 3;  5DPN A;  3ZXL A;  4E8D A;  1LOB A;  2ILM A;  2HH9 A;  4QXC A;  3WG3 A;  5C9A A;  5A3W A;  2QQI A;  2WZE A;  4W8J A;  4YZ5 A;  4IV3 A;  5CFC B;  5F5Q A;  2C9A A;  5HCB A;  4B7E A;  2JD4 A;  4ZU4 A;  5LCW L;  3PTR B;  2JG9 A;  5JWP A;  2DUQ A;  1ND2 A;  4GB3 3;  3EXU A;  1HXS 2;  4MUV A;  3OGS A;  1OOP C;  4FPG A;  4WV8 A;  5FUI A;  3WQB A;  4DMI A;  4JCK A;  3B93 A;  3CEW A;  2DCT A;  3H1W A;  3THP A;  4AAX A;  5JMC A;  1Q8O A;  1N1T A;  4E4D X;  4M3C A;  3THD A;  3WP3 A;  1JYV A;  1QQP 1;  3ETQ A;  4IGQ A;  4MVT A;  1J59 A;  2JDA A;  2VCB A;  4CEY C;  4EN9 B;  2XDV A;  1M06 G;  1RUD 1;  2MHF A;  3WDY A;  3SH4 A;  2D6L X;  4DB5 A;  1PZ9 A;  1QJU 3;  5EFU A;  2XJQ A;  1O3T A;  3GM8 A;  1WMF A;  2E9Q A;  4P00 B;  4R9C A;  4K7J A;  1WBF A;  3BB6 A;  2BPA 2;  5HCF A;  1GOF A;  5D8A C;  5A7P A;  4W6X A;  5JOZ A;  1WMX A;  4CP9 B;  4D8M A;  2TBV A;  1S2E A;  2JDY A;  5FO9 B;  1WD3 A;  3MBW A;  2Q30 A;  5GKA C;  3PIG A;  1YC6 1;  1JI6 A;  3FUO A;  4IET A;  3AZX A;  4LO7 A;  3V65 A;  1HV1 A;  2WBK A;  4NWV A;  4BJ0 A;  4FTB A;  2JIJ A;  1AL2 1;  2ZX3 A;  4M0H A;  1XB9 A;  5FY4 A;  1HIX A;  1UOF A;  3MLL A;  3WNP A;  5IVV A;  1YEW A;  4DQA A;  4QT6 A;  3P3N A;  2ERF A;  3ZYH A;  4HN0 A;  2JDU A;  4K6B A;  2XL9 A;  4MH0 E;  3BVC A;  5KXC A;  2VXR A;  1VMH A;  2PHD A;  4BK5 A;  1F2N A;  5FWE A;  4XZP A;  3D4K A;  3O5S A;  3JU9 A;  4NPR A;  1W9Y A;  4DEQ A;  2TNF A;  2WR9 A;  5FMD A;  4NPL A;  2FCU A;  2QQO A;  2UU8 A;  4LHN A;  4XUO A;  2OS2 A;  5KHI A;  1TNR A;  5AVA A;  1RJ8 A;  2EID A;  1R09 1;  3AB0 A;  5TSW A;  1WCK A;  1K42 A;  2YC4 A;  1HXS 1;  2P3Y A;  4BIO A;  5JZG B;  4MXV A;  3PUQ A;  2ZGK A;  4M4P A;  2DWR A;  4RL7 A;  4LOT A;  3O1T A;  1VBA 2;  1YFW A;  1ZBA 3;  2VEC A;  2BRT A;  2IZW A;  5FPA A;  4O7X A;  5LA1 A;  3LDB A;  2MEV 3;  3IT8 A;  4LIU A;  1PVC 3;  2E51 A;  1GUI A;  1CAW B;  4LO5 B;  5IVJ A;  3BTY A;  4NHL A;  3N4M A;  1MS0 A;  1D7P M;  2VTX A;  3T1L A;  1RUG 2;  4ZS2 A;  2JE8 A;  1A3K A;  3RZM A;  1RUF 1;  1UXZ A;  3UL2 A;  4LBQ B;  4I0B A;  4XIK A;  5BNO C;  1O4T A;  2Y6L A;  5EJ1 B;  3WSO A;  5F3G A;  4JQT A;  1DGW A;  3D8C A;  5KHK A;  1RUN A;  1CR7 A;  4BIS A;  4YVS A;  1O4Z A;  3VBO C;  1CAX A;  1GIC A;  2VQU A;  2ARC A;  1LHU A;  4IEY A;  2WAA A;  1D4M 3;  4NHM A;  1IS3 A;  4FT8 A;  5KBF A;  5GAL A;  5DUU A;  1Q5O A;  1VBB 2;  4UFK A;  2ZGL A;  3KF3 A;  3OJB A;  4F7Z A;  4OVE A;  1W2N A;  4J1W A;  3LFI A;  5HCH A;  4NHK A;  4QQH A;  3WLU A;  5F3I A;  4HBN A;  4PDW B;  4R8H A;  4X6R B;  5DAQ A;  4CCL A;  5FYV A;  2LW8 A;  1WW5 A;  1Z7S 2;  1ST8 A;  2HWE 2;  2Y26 A;  3I7D A;  4NPM A;  3RWK X;  1AR8 3;  3I3B A;  3QBQ A;  4NVP A;  1ZBE 3;  4Q4Y 2;  1X36 A;  2RR1 1;  1H0B A;  4AF9 A;  3WW3 A;  3DYP A;  2W92 A;  4ES9 A;  1XE0 A;  3VGI A;  4QPI B;  5E88 A;  4TLG A;  3I2J A;  2JEC A;  5C3O A;  2BV4 A;  4FPF A;  3VBR A;  3POI A;  4MET A;  3HVD A;  4LLO A;  1C3H A;  1S55 A;  3MYX A;  4S2F A;  2AUY A;  1IG0 A;  5ACA 2;  2B45 X;  2RS1 3;  1MS1 A;  3ACF A;  2PHL A;  5LA9 A;  2VZ3 A;  4EN7 B;  4QXH A;  2AGS A;  5DG1 A;  2B9U A;  1JYN A;  1HRV 3;  5DZE A;  4Q4V 3;  1X9T A;  1RIR A;  3CO2 A;  5I93 A;  2XXZ A;  4LUK A;  1W6Q B;  4H7M A;  3H3Z A;  3HBK A;  4LNV A;  4LA3 A;  2WDB A;  5FRE A;  5F6K A;  4CU8 A;  3WP6 A;  2G9Z A;  2W1W A;  4EZ4 A;  3EYP A;  2I74 A;  3B3Q E;  1IS6 A;  4OI0 A;  2K46 A;  3PJY A;  2GC2 A;  4O65 A;  2WFF 3;  3OG2 A;  5IAV A;  1VBB 1;  4Q8K A;  3GHN A;  4UOJ A;  1PK6 C;  4D0Q A;  5JXG A;  1RHI 2;  1JOD A;  2YB7 A;  2MNG A;  1COV 1;  1RMU 3;  4B3N A;  2HWE 1;  5I91 A;  5DAX A;  4OI1 A;  2JB8 A;  3ZXA C;  3PHM A;  3RWN A;  4B7K A;  2WNV B;  2EIE A;  1LHW A;  4H7L A;  4YM0 A;  4ISR A;  1J3P A;  5FK8 A;  4B4Q A;  5FMO L;  2A3Y A;  3WDW A;  1EAH 2;  2WA4 A;  1JMU B;  4URA A;  4JTO A;  1W6P A;  1FMD 2;  5K0U A;  2D3P A;  1R64 A;  3IMN A;  5D1I A;  3PUA A;  5JCT A;  5HV4 A;  1SLI A;  4UFL A;  4XF4 A;  5L7O A;  1GKB A;  5ACA 1;  1CZV A;  4QQL A;  2C1F A;  4PIY A;  2NMN A;  5FYU A;  1POQ A;  1S0D A;  1OVS A;  2JDH A;  4LQR A;  1H4G A;  3LWC A;  4WM8 A;  1IG3 A;  1QJZ A;  1PNF A;  1I9R A;  2XWB B;  3AP7 A;  3B94 A;  3GZE A;  3C7E A;  4JHT A;  4LKD A;  3WUD A;  2FDF A;  1EV1 2;  2Y60 A;  1TME 3;  2VW0 A;  4YM3 A;  1PZ7 A;  3ZIW A;  2VAU A;  4QQ2 A;  4E9K A;  5FPV A;  3GHM A;  3OPZ A;  5CKM A;  5FZL A;  4JGZ A;  3V56 A;  4IE5 A;  4BME A;  5C4W A;  3CLP A;  5I0U A;  1GQG A;  1O3S A;  2WAO A;  5I8S A;  5C3R A;  3DN7 A;  1BBT 2;  1BEV 3;  3ZXE A;  4FPC A;  2GU9 A;  2IFR A;  2PTM A;  4LHL A;  5FPL A;  5C71 A;  4AED B;  5FLI A;  5A6Z A;  2Q0A A;  4BCU A;  1ULD A;  5FZO B;  3LF7 A;  4XFC A;  2UY8 A;  4RHV 2;  1AR6 3;  3BTZ A;  4EWD A;  1MS5 A;  5CNA A;  3VDD A;  3KF5 A;  5C8W A;  2W5F A;  2XVG A;  4URT A;  5C70 A;  2ZGP A;  4AHZ A;  2XWJ B;  2A3W A;  2RJ2 A;  4UXA A;  4XJW A;  3VUO A;  2R16 A;  1QDO A;  2VZP A;  2HWF 3;  1LJ7 A;  1X9P A;  5CKQ A;  3TEW A;  3CQO A;  1SPP A;  1US3 A;  3VKO A;  2IXC A;  3RS6 A;  1JZ8 A;  1B35 B;  1FMD 1;  1VBC 3;  2VZR A;  2XHK A;  2YHJ A;  3ASI A;  3U75 A;  4DRV A;  4EZH A;  2PHF A;  3O1S A;  1I6X A;  1RED A;  3CF6 E;  1XNC A;  4XJU A;  1GZC A;  4XXP A;  1A6C A;  3H8X A;  4CXW A;  5J96 B;  4QHO A;  4L99 A;  2ZTN A;  5DAB A;  1DBN A;  4AW7 A;  2NN8 A;  1QJU 2;  4IEQ A;  3WEZ A;  1CWP A;  1OOP B;  4JDN A;  1CN1 A;  1EV1 1;  4N90 A;  5JDB A;  3DXT A;  4HOO A;  5A32 A;  1QJX 2;  4CDU A;  2E31 A;  1DQ5 A;  1AR7 3;  1OHF A;  3LOI A;  1UPS A;  4PQ9 A;  2DU1 A;  3DUI A;  4COW A;  5DZG A;  4XVH A;  2K0G A;  4CEY B;  4E4Z A;  3M1H A;  3LOB A;  4FAG A;  3LSD A;  4QPG A;  1XU1 A;  3VD3 A;  4I2O A;  4O9G A;  2CHH A;  3WP5 A;  1FOD 1;  1ZA7 A;  1HW5 A;  2DDU A;  2WYS A;  2YGM A;  4XUQ A;  4QX0 A;  2ZOE B;  3KGZ A;  3VHO A;  2VJX A;  3FE5 A;  1LTE A;  5D8A B;  3AL6 A;  2V5Y A;  4JHZ A;  4JX0 A;  5FZG A;  5C8C A;  5F37 A;  1AXZ A;  2ZML A;  4WVM B;  2XML A;  5EP9 A;  3IWZ A;  2ARB A;  2VVD A;  1GFF 2;  4CP0 A;  5FJH A;  2DBI A;  1W8O A;  4Q26 A;  3JQW A;  3MO4 A;  2VNO A;  3J8F 3;  4G4F A;  2HBT A;  4CU9 A;  4NOT A;  4RGA A;  1MQT A;  4E27 A;  5LEJ A;  5J7M A;  4QGM A;  3AP4 A;  3URF A;  1UWW A;  3I2H A;  2BDR A;  4ZXK A;  2QKD A;  4NIA A;  1J58 A;  1ZBA 2;  3WIN E;  3T0D A;  4FP3 A;  4FOY A;  4ZZ5 A;  1POV 3;  1WME A;  1SFP A;  1XND A;  3EB7 A;  1OA4 A;  2MEV 2;  1PVC 2;  2XLG A;  1Q8S A;  1BLZ A;  1Y43 B;  4IW3 A;  3D6E A;  4Y20 A;  3ZR6 A;  4MX3 A;  3KHB A;  5FLH A;  3IN9 A;  1H6X A;  4P08 A;  1QJX 1;  2WSV A;  5K9Y A;  3JZV A;  1URX A;  5CIR A;  1UZW A;  3BPZ A;  1HQN A;  4NUB A;  4JDO A;  1G9C A;  5IK5 A;  5FJK A;  2JJ6 A;  2ARA A;  2GNT A;  3MPP G;  4PI2 A;  3DEC A;  4COY A;  1XXN A;  2ZAB A;  1NY7 1;  1V6O A;  3A22 A;  3OPT A;  2BNM A;  5J09 A;  2FDI A;  4Q4X 2;  2ZHM A;  1WA4 A;  1O3Q A;  1UQX A;  3NWK A;  1D4M 2;  1OPM A;  1CIY A;  2F4L A;  2KD7 A;  4RGK A;  1N1S A;  4Y1X A;  2HBU A;  1F4A A;  5BNO B;  5A3P A;  2X05 A;  5F3E A;  1Q8P A;  1MZF A;  1S0B A;  3ZFF C;  1S0C A;  2BWC A;  1W39 A;  2LTN A;  2QZ2 A;  1F8V A;  5FQ0 A;  2PA7 A;  2HWB 1;  4AFM A;  3B9C A;  3VBO B;  4W50 A;  1G7Y A;  2HLE A;  3ILN A;  4NN0 A;  3HAG A;  1ZBE 2;  4LPL A;  1FNY A;  3PVN A;  1ND3 A;  1XYP A;  1VPH A;  5A7W A;  4AVS A;  3IKW A;  1W06 A;  3CJI C;  3AKT A;  2ZS6 B;  1KDK A;  3GAL A;  4UW5 A;  2D6M A;  4KU8 A;  1KJR A;  3KSC A;  3ZN6 A;  3LPF A;  5CU1 A;  4XTM A;  2QJV A;  2LAL A;  4PHZ A;  2GC3 A;  4XQD A;  3N9N A;  3VBS C;  2DF7 A;  1SG3 A;  1YI7 A;  5DG2 A;  2IXK A;  2JG8 C;  1RUD 3;  2WN3 A;  3I2G A;  3AMQ A;  4LOR A;  4YW6 A;  1HRV 2;  4Q4V 2;  1PVX A;  3AP5 A;  2FMD A;  2ES3 A;  4LK7 A;  2VW1 A;  4D6S A;  1NAE A;  1AX1 A;  1W8Z A;  3ZSK A;  1S0G A;  4B8E A;  3WF1 A;  1SBF A;  4IXL A;  1IZ3 A;  1OH3 A;  4KBZ A;  4Q4X 1;  4YW1 A;  2D6O X;  1V00 A;  2ZAC A;  2YBP A;  4FFI A;  3VD4 A;  1Z0H A;  2WFF 2;  2GC0 A;  3B69 A;  4XMI A;  1AL2 3;  4Y1Y A;  1JOJ A;  5LRR A;  1H2M A;  2CGN A;  4A44 A;  4JVA A;  2Y33 A;  5FLJ A;  1RMU 2;  1IKP A;  3KV5 A;  3LA3 A;  4QHZ A;  3RI9 A;  4UF0 A;  5C4W C;  5CG8 A;  4ZZ8 A;  2CYF A;  1W6O B;  3AVS A;  4QKD A;  3ORJ A;  1SLT A;  1BHG A;  4DEV A;  3C7O A;  1W9F A;  3VBF A;  1RXF A;  2XVL A;  4Z2A A;  5LK7 B;  1S2B A;  1PK6 B;  3F2Z A;  3VL9 A;  4Q0P A;  3VZJ A;  4EN0 A;  5A7O A;  1R09 3;  4CCC A;  1NE4 A;  5IVY A;  1WZX A;  2OPW A;  1LOG A;  2DFC A;  5JR7 B;  1SFY A;  5L19 A;  2JKX A;  4B4R A;  3POG A;  1DQ1 A;  4LBQ D;  2RDN A;  3MGU A;  3TBD A;  3VDD C;  2P5B A;  4MV2 A;  3BAL A;  2Y34 A;  2Z4F A;  1VAL A;  4XHX A;  1DG6 A;  5F8P A;  4BLI A;  1XJA A;  1XNA A;  4C90 A;  1GP5 A;  3W21 A;  3R4D B;  2AR6 A;  1Q8V A;  5A3O A;  5BUV A;  4BLJ A;  3UNP A;  3WF2 A;  1ENS A;  5ERL A;  5IFP A;  4CUB A;  3NL1 A;  3KWV A;  1NT0 A;  3ST7 A;  3M3C A;  1TME 2;  3AKR A;  3LSE A;  1RUF 3;  3GXU A;  2D3R A;  4KU7 A;  3J7M A;  5JXJ A;  2A6Z A;  1W9T A;  2QQU A;  3N7K A;  3AC0 A;  1RUO A;  4AHW A;  4GH4 C;  3U14 A;  1UY3 A;  4UW6 A;  5C3S A;  2A3X A;  1L7Q A;  3E5X A;  1HB3 A;  2BEO A;  4GWI A;  4CU6 A;  5A3N A;  2WFF 1;  1BEV 2;  4XJA A;  1JZ7 A;  5IHR A;  5LB6 A;  1ASJ 3;  4QHB A;  2FZ2 A;  2W91 A;  4KI5 M;  4CDU C;  3H8O A;  3ZDS A;  5H9Q A;  3ZYR A;  3T3Y A;  1RMU 1;  5CVR A;  4Q8L A;  1W90 A;  2PHW A;  3I3D A;  3MIF A;  4RQP C;  1F35 A;  1VLN A;  4QPG C;  4NAM A;  4DPN A;  1AR6 2;  4KG0 A;  1SLB A;  4A6S A;  3X29 B;  5LBF A;  3UES A;  1WMD A;  4AG4 A;  3NW4 A;  4OYU A;  5BV6 A;  2FHR A;  3R05 A;  1W3X A;  5ABJ A;  1JZ5 A;  3A4U A;  1KXG A;  1O5U A;  2HWF 2;  4XFF A;  5JI7 A;  5CG9 A;  5FYZ A;  1LOD A;  1SAC A;  2H0V A;  2RR1 3;  5CA6 A;  1T6G C;  1UX7 A;  1VBC 2;  3CKH A;  4BIF A;  1NQD A;  4KWJ A;  1JU3 A;  4ITC A;  1VRH 1;  1YI9 A;  2RV9 A;  5F9T A;  5IVE A;  1ULF A;  2GMP A;  1QH7 A;  5F5A A;  4W6Y A;  2ORZ A;  1ZA4 A;  3PU8 A;  4GWJ A;  4LUL A;  1C5H A;  2WLP A;  4OHV A;  1W9S A;  2JDN A;  5IJR A;  1CZS A;  1MQT C;  1UU5 A;  5EQU A;  3O1U A;  3E6D A;  1LRH A;  3FWE A;  5F5I A;  1AR7 2;  1WUV A;  2IVI B;  5HPO A;  2O1Q A;  4QMA A;  3RZH A;  3M8L A;  4IE4 A;  1UD1 A;  2WNU A;  3M4F A;  4FTE A;  2WA3 A;  1HB1 A;  3DYO A;  1HN1 A;  3FHQ A;  4KWU A;  4IE6 A;  1H1M A;  1BCX A;  4CUG A;  4ZXE A;  5E16 A;  2QQP A;  2X5I A;  4AE2 A;  3KCC A;  2OKX A;  1JN2 P;  1HQW A;  1AUY A;  4TLF A;  3RJR A;  3K77 A;  3FBY A;  3PJQ A;  2VCC A;  1AR6 1;  1OUX A;  2VH9 A;  1UU4 A;  4KMQ A;  5B4X A;  3VDC A;  3ZFG A;  3VKF C;  3VDB A;  2VZV A;  1COV 3;  3D5O A;  1OLQ A;  2WT0 A;  4KGQ A;  3ZPO A;  2VVF A;  2GP5 A;  1RB8 G;  2BGO A;  3J8F 2;  3UKV A;  2C0Z A;  4GQ7 A;  2A6Y A;  5H9R A;  2FQP A;  2WRA A;  1LNS A;  2ZX0 A;  2XR4 A;  3WF0 A;  3SCH A;  1XSQ A;  5KXD A;  2IXJ A;  1V6J A;  1NCQ C;  4UFH A;  4LR4 A;  1CAX B;  2DVF A;  2R06 3;  5HXV A;  4R9A A;  5K4L A;  3TEX A;  3TN9 1;  5HV0 A;  4UT5 A;  3CMG A;  4AGG A;  5ACA 3;  5AFE A;  4AL9 A;  1NCR A;  3LCP A;  1RVF 3;  1PZ8 A;  4QU1 A;  1T6B X;  2XON A;  1POV 0;  3ENR A;  4M00 A;  1DZT A;  5EYX A;  3H8R A;  2ZGU A;  5LA0 A;  1ODN A;  1AR7 1;  1C1L A;  1WD4 A;  2ZEZ A;  3H8U A;  3MLK A;  5FO7 B;  3V64 A;  1DQ0 A;  1RIN A;  4BH9 A;  4XF9 A;  1RUI 2;  2X09 A;  1JXN A;  1NA1 C;  3U4S A;  2ZGS A;  3T09 A;  4K21 A;  3MID A;  2UUR A;  2R07 3;  3INA A;  3SIT A;  3WHU A;  2XBO 3;  4XDP A;  3NNL A;  4ET7 A;  5KXB A;  2BUK A;  3ZR5 A;  4A6O A;  1ZZ9 A;  3THT A;  1U12 A;  2FMY A;  4JC1 A;  1PX4 A;  5JSO A;  2TEP A;  3NNF A;  4ASK A;  3DF0 A;  2Q1M A;  3BOD A;  1L7R A;  4FFH A;  5FY5 A;  3FBM A;  5A1F A;  4XAA A;  1G8W A;  4JKK A;  3UGG A;  1U5Y A;  1FNZ A;  4M01 A;  5LZ6 A;  2XLA A;  3PDQ A;  4WM7 A;  3T08 A;  1NXD 1;  4IEX A;  1S4C A;  3WNO A;  2P34 A;  4PLN A;  2PLV 1;  1AF9 A;  1WLD A;  3PUI A;  2WNE A;  4FFG A;  2RJK A;  5J3U A;  4MG2 A;  4BQ4 A;  3D82 A;  3W20 A;  1X50 A;  3FFZ A;  3AJZ A;  3NJX A;  1VBD 2;  1C4R A;  4YNI A;  5I8T A;  4OUE A;  2DUO A;  2P2K A;  1AR9 1;  4UBH A;  3E1F 1;  3T2P A;  1ENQ A;  2AC1 A;  4AHX A;  4YW5 A;  3R6S A;  4BU2 A;  4BXS V;  1V9U 1;  3UV9 A;  1N3P A;  4LXL A;  1VBE 1;  2WFP A;  1LED A;  1D0G A;  1ODM A;  2E6V A;  3MIC A;  4LO8 A;  1RUD 2;  1MS3 A;  2HKX A;  4Q0Q A;  2BBV A;  1W6N A;  2Q8D A;  1UCX A;  5JIA A;  3CJI B;  4E4H A;  3FLT A;  3MIB A;  3K48 A;  1RUI 1;  1IKQ A;  4Q0U A;  1LB2 A;  2Q1Z B;  1EV1 3;  4ISQ A;  2ADE A;  3OYW A;  5IT6 A;  2V09 A;  4BM8 A;  3UJO A;  4COU A;  1GMM A;  2QE3 A;  5T52 A;  3LZZ A;  4XIO A;  2P17 A;  2JIG A;  2B8M A;  3VBS B;  4AFB A;  4GKX A;  4NIG A;  2JG8 B;  2VUJ A;  3KS7 A;  1PGS A;  5EJZ B;  5EYY A;  1MZE A;  1FOD 3;  3N9M A;  3ETP A;  2YRO A;  2V5D A;  5F6L B;  2A1X A;  4QPW A;  1QIQ A;  4K9S A;  1SDD B;  3DCQ A;  1AL2 2;  4ZPI A;  2VME A;  3Q8A A;  4QDS A;  4S2H A;  1JZ3 A;  5FZK A;  1B35 C;  2Y6J A;  3UJQ A;  5I0R A;  4UW3 A;  5JR2 A;  2AEZ A;  4FP2 A;  4ZY9 A;  4FPL A;  4DIN B;  3GZA A;  4Y22 A;  2F4P A;  4A7Z A;  4Y24 A;  3POF A;  3EO6 A;  4CXY A;  4WZF A;  1DGR A;  3ZSE A;  1DU3 D;  3ITQ A;  3POY A;  3HIF A;  1R1Z A;  4FXK B;  1BYH A;  4UYB A;  3SH5 A;  2CY6 A;  4LKS A;  2UWC A;  1R09 2;  1PO1 3;  2WO3 A;  1O91 A;  2FDH A;  1VBD 1;  3P3P A;  2GN7 A;  2EF6 A;  1QHD A;  1UY1 A;  3MW3 A;  3OY8 A;  4KQ7 A;  5C4W B;  4EE2 A;  2CGO A;  3R0R A;  2YG0 A;  1DIW A;  2I07 B;  1PMH X;  4CVU A;  3LQC A;  4NIH A;  3SNM A;  1VMF A;  2J7M A;  4YVW C;  4QU2 A;  5ABJ C;  4DRR A;  1JZ6 A;  2BTV C;  4DY3 A;  2OII A;  2XG3 A;  4A7K A;  2WT1 A;  3PL0 A;  1JYX A;  3PIJ A;  4CCM A;  4E2S A;  1V70 A;  5JSP A;  2B9V A;  1YWK A;  1RUF 2;  1YJL A;  1QJX 3;  1Y9M A;  2W9X A;  2WZR 1;  4PBP A;  5FZ3 A;  4UBG A;  4YM1 A;  3VDD B;  2OZ6 A;  3USS A;  1XYO A;  3VV1 A;  1UZ0 A;  3DYM A;  1H9W A;  3V0B A;  4QKB A;  3AK0 A;  4OUL A;  4XXA A;  5CFD A;  1QXP A;  4OHW A;  4Q27 A;  4N9H A;  3MIH A;  2SBA A;  3ILR A;  5DN2 A;  3OEA A;  5FPX A;  2FDJ A;  1AJK A;  4P9G A;  3BKZ A;  3C3V A;  4LKF A;  1ASJ 2;  2WNO A;  3GJA A;  3SEE A;  1L3J A;  5A6Q A;  4RS5 C;  1QNW A;  2J1U A;  4IE0 A;  1TZO A;  2KXL A;  2WNU C;  1WGP A;  4GH4 B;  4BE3 A;  1OQ1 A;  1W0P A;  1WW4 A;  3WP4 A;  1ZYB A;  2HWB 3;  2ZMK A;  2ADD A;  1PGW 2;  4K20 A;  2RM2 1;  4PQQ A;  4GIQ A;  3ZSJ A;  2HEV F;  4CDU B;  2ARX A;  2W08 A;  2RR1 2;  3AYA A;  4OUM A;  5KHH A;  3HMY A;  4RQP B;  2JIC A;  1UYP A;  1NXM A;  4QPG B;  3ZFG C;  4RR3 C;  4AEJ A;  3VBU C;  4HZF A;  5JPM B;  2QFE A;  5BYN A;  1EUT A;  3HOB A;  1LHO A;  4QX7 A;  4WVW A;  4BA6 A;  1LU1 A;  2LRO A;  4XF0 A;  1RL3 A;  5GLW A;  3HT2 A;  4X8N A;  3VDA A;  4FPE A;  3P5B A;  1J83 A;  4FOV A;  2OVU A;  3HPN A;  5C8C B;  4Q1P A;  1H4H A;  2ZZJ A;  2KA3 A;  5FCC A;  4O61 A;  1HRI 2;  4N43 C;  5FXV A;  5BXX A;  2EA7 A;  5F7U A;  1SEF A;  1VB2 A;  3B02 A;  1GZT A;  4NWW A;  4JQR A;  4GMP 3;  2UWA A;  2VNV A;  1MAC A;  1RXG A;  4LLF A;  2EXJ A;  4XBQ A;  1YQ8 A;  3W9A A;  5L9R A;  2XKO A;  3JCI A;  3HT1 A;  3M3Q A;  1ASJ 1;  1MQT B;  4Q4X 3;  4QGL A;  1WKY A;  3HNM A;  5FPB A;  2A70 A;  5SV5 A;  3C2U A;  5FUN A;  3RZZ A;  3WHT A;  4A42 A;  5DMY A;  2WWJ A;  3BYW A;  4JGY C;  2QVS B;  3MPB A;  2W2I A;  1YQ2 A;  4TSV A;  3K3N A;  3AFG A;  2P4E A;  2C5D A;  2SLI A;  3GNE A;  5T3N A;  2B46 X;  3ACG A;  3DPR A;  1COV 2;  4Y20 B;  2AZ5 A;  1PGW 1;  4AQ6 A;  3V0A A;  3OD0 A;  1S1A A;  4IER A;  4QDQ A;  5J48 A;  4FPY A;  4MAD A;  1OSG A;  4IEV A;  1CON A;  4LBJ A;  2QTW B;  2Y6K A;  4PIZ A;  4XUP A;  4CDQ A;  5F32 A;  2D98 A;  4PLO A;  1OT5 A;  1E5S A;  2VOT A;  5LA2 A;  1OLR A;  2EIC A;  1RUJ 3;  4FPJ A;  2R06 2;  4RFT 0;  1GZW B;  1OI6 A;  1PIV 1;  1U5I A;  1LHV A;  3KQR A;  1H8T A;  2DV9 A;  4N8M A;  1DDL A;  1VB4 A;  2ZAA A;  2AH2 A;  1RVF 2;  3H9A A;  5GLZ A;  3FHI B;  1W0N A;  2AYH A;  3WW1 A;  1TVG A;  1HRI 1;  3BTX A;  1U5X A;  1ENX A;  4CCO A;  3VD5 A;  5FQ0 B;  2P37 A;  4TWT A;  1NCQ B;  4MGT A;  2YFZ A;  3E5Q A;  3ECQ A;  3NAP A;  4PI0 A;  2R07 2;  1RUE 1;  3I2F A;  4PIX A;  5BNN A;  4XBL A;  1VRB A;  2JE7 A;  2XBO 2;  3POE A;  2GND A;  4LEJ A;  1NKG A;  5FBZ A;  4C8D A;  1RGS A;  1CAV B;  1F9K A;  3UGH A;  4IES A;  4QB2 A;  4CUA A;  1NOV A;  1RYY A;  3H0O A;  3K46 A;  5A7W B;  1H2K A;  2O14 A;  1CQ9 A;  4OQ9 A;  1JS9 A;  3N9L A;  4XIL A;  3T2O A;  3ZYG A;  4XFA A;  5FXX A;  1WA6 X;  1AYM 2;  3JD7 1;  3W5M A;  2Y6G A;  1NA1 B;  1H2N A;  3ZN6 B;  3TWI A;  3FJS A;  4YG3 A;  4A3Z A;  5BNP C;  1G9B A;  3E6B A;  4NHX A;  3AKS A;  4CDW A;  4L0P A;  5FZ4 A;  4D94 A;  4HXC A;  2PAK A;  5LEK A;  4HPK B;  4XJ9 A;  5DDJ 1;  4CDX C;  4MHU A;  3BIW E;  1W2O A;  2VUC A;  2V72 A;  1ZNP A;  5E6H A;  1NX9 A;  2YC2 A;  3QLQ A;  4BQ3 A;  2GH8 A;  2R6Q A;  2V4A A;  3ALQ A;  3WUC A;  1HN0 A;  3IAP A;  3WG1 A;  2R06 1;  2ZBJ A;  5C9A C;  5IVC A;  4XW3 A;  1DQ2 A;  3OF1 A;  1VRH 3;  1TE1 B;  1RVF 1;  4IV3 C;  2BVB A;  3RYR A;  3ZXG A;  1DLL A;  4B4P A;  4P9X A;  5FMC A;  1Q43 A;  2D44 A;  2VD7 A;  1EUU A;  5GLV A;  2JG9 C;  2H0B A;  3SKV A;  4RFR B;  1ND2 C;  4R52 A;  2JD9 A;  1W05 A;  4OI2 A;  2VMF A;  2RDS A;  2A71 A;  4HKW A;  4QQP A;  1DZR A;  2R07 1;  3M3O A;  2XBO 1;  4XF1 A;  4NE9 A;  2EVX A;  4N53 A;  4LBM A;  3MZH A;  3WNX A;  1I5P A;  3B7M A;  2P3I A;  2Z69 A;  4RD7 A;  4AGR A;  5LRS A;  4UW4 A;  1FOD 2;  2YDE A;  4GUL A;  1AYM 1;  5A3M A;  5FP4 A;  3ZSL A;  1YIF A;  1W6M A;  3TYJ A;  3PVE A;  3R4S A;  4BQ2 A;  4XUN A;  4A41 A;  4LUM A;  1ULE A;  3HJR A;  3KVB A;  2ZHN A;  1KFX L;  3MFC A;  2Y8K A;  1H1I A;  3FUQ A;  3GZT B;  4QKF A;  5CFD C;  1XSR A;  3LFM A;  3U4X A;  4TTG A;  1JTZ X;  4F8A A;  1ZZB A;  4BDV B;  1Q8Q A;  1YO8 A;  1SQ4 A;  2JDM A;  3ZN5 A;  2OQ6 A;  1YFX A;  5ISL A;  2Y64 A;  4YW2 A;  3IDA A;  3VD7 A;  2WIN B;  1PO1 2;  5EWS A;  3ZXJ A;  2VCM A;  1IQA A;  2AAC A;  4XJ8 A;  4I01 A;  3TAY A;  2VOX A;  3FFQ A;  1GOH A;  2RE9 A;  2JDK A;  2J1E A;  3OGG A;  3M3I A;  5I0D A;  5FYS A;  5C5U A;  4ATF A;  1FI2 A;  2RS3 2;  3BU7 A;  3DEM A;  3ZO0 B;  1UF2 C;  4NRP A;  3LEM A;  1RIT A;  3TN9 3;  2Q4S A;  4NID A;  4L8Q A;  1LGB A;  2QQV A;  1UZY A;  1O3R A;  3D3A A;  5BY5 A;  4LBK A;  3C8X A;  1J3Q A;  1DCS A;  4BQW A;  1ZZ6 A;  3AKP A;  2WKK A;  4Y1V A;  2Q1F A;  1LU2 A;  1UPI A;  3GBG A;  3POW A;  4YVW B;  3WY6 A;  5A3L A;  1D0H A;  2VNG A;  5ABJ B;  2E32 A;  3B9I A;  4NRQ A;  1SMV A;  3GBW A;  1NY7 2;  1FX5 A;  5JOW A;  1V0A A;  2G9G A;  3FMG A;  2YU1 A;  4EWE A;  1LGN A;  1GYK A;  2B42 B;  5FP3 A;  3GF6 A;  5IW0 A;  2BWA A;  3IDC B;  1MPX A;  1JUI A;  3ZLI A;  3OUI A;  1FPN 3;  2PFW A;  2DVG A;  2VMG A;  2ZGO A;  3DL3 A;  3MF6 A;  2XJT A;  5DUW A;  3ZMO A;  3H7Y A;  5C6C A;  4YVS C;  2PAE A;  4JKM A;  4LA2 A;  1O6U A;  2HWB 2;  2BBA A;  2VY0 A;  2VW2 A;  4SLI A;  2ZMN A;  2G4I A;  5FZB A;  3AVR A;  1RC6 A;  4AVB A;  4BXF A;  4CYD A;  1OF3 A;  5FZ7 A;  1DYP A;  1PO1 1;  3ZYJ B;  3A7Q A;  2PLV 3;  1KS5 A;  4RS5 B;  5B2G B;  1QOS A;  3O1O A;  4LMF A;  4DIQ A;  4IND A;  2WNU B;  3NQH A;  4CE8 A;  3VB9 A;  2VBB A;  4M3C F;  2RS3 1;  3OGR A;  1G9F A;  4FO9 A;  3W5N A;  1CAW A;  1AR9 3;  3NJZ A;  1SZB A;  3O0W A;  4BHP A;  1G6N A;  4QDR A;  4YLZ A;  4OUS A;  1I5Z A;  5CKN A;  2FDG A;  1QJY 3;  5FV3 A;  5FKB A;  4CXX A;  1V9U 3;  3VBH A;  1OUR A;  1XE7 A;  4LBQ A;  2BZD A;  4CDQ C;  1VBE 3;  4Y33 A;  4CP2 A;  5L36 A;  3LE0 A;  3N9P A;  3NV1 A;  3MW4 A;  3ZFG B;  4RR3 B;  2VE1 A;  3VBU B;  4FOQ A;  4KWL A;  5ANQ A;  1UX6 A;  5T5O A;  3VBR C;  3AMN A;  1RUI 3;  2CAU A;  1J84 A;  2ZA9 A;  5KXE A;  1W28 A;  2EXI A;  1H8T C;  3WQ1 A;  3AMH A;  4AVC A;  3WX5 A;  1EYB A;  2RS5 3;  1TQ5 A;  5LY2 A;  2P3K A;  1X8M A;  1JYT A;  2P6C A;  4BQY A;  2WYF A;  4WVV A;  5ANN A;  5G04 L;  4N43 B;  4AVA A;  2WSU A;  5CAZ A;  1ULG A;  1GQH A;  1REF A;  1LEM A;  3MIG A;  2J42 A;  5EJ3 A;  3T2Q A;  2XJU A;  1W99 A;  3NAP C;  4PDW A;  3USU B;  3AM2 A;  1QY4 A;  2WL1 A;  2ZX1 A;  2VGD A;  5T55 A;  3LEI A;  3RZK A;  2EAA A;  3OUJ A;  1NCR B;  4ATE A;  5A6X A;  2Q8O A;  1DYK A;  1K3I A;  3OBR A;  1QF3 A;  2PHT A;  4IE7 A;  3TRS B;  3VHP A;  2XLF A;  3U1X A;  2GP3 A;  4PF5 A;  4MXW B;  3POS A;  4CCJ A;  1CAU B;  4L97 A;  4OZX A;  5M0T A;  2YFU A;  4NMI A;  4JGY B;  2BYV E;  2ATF A;  2D93 A;  2WWS A;  3KT7 A;  4KG8 A;  4V2V A;  3PME A;  3E97 A;  3WG4 A;  1UYX A;  1VBD 3;  5JMO A;  1FV3 A;  4OMC A;  3I2K A;  1RUJ 2;  4YZ4 A;  5J98 B;  2DUR A;  1IGO A;  2GDF A;  4Q0V A;  4AK3 A;  4OMD A;  1LES A;  3IIA A;  1C28 A;  4OLL A;  1LR5 A;  2E7A A;  2P1B A;  2P3J A;  4OHX A;  2OT7 A;  2YPJ A;  1XNK A;  5FP7 A;  3Q8E A;  3D0J A;  1UY4 A;  5K0U C;  5BPX A;  3CU7 A;  3SH3 A;  4C0H A;  3AZW A;  4GMP 1;  4ARX A;  3HEI A;  4XCB A;  5FO8 B;  1P8J A;  2WZR 3;  4NO4 A;  4HVO A;  3VKM A;  5L7O C;  3RI8 A;  2VMH A;  1YIP A;  4P9W A;  4AI9 A;  4AXO A;  3C7F A;  2ZEY A;  3SKJ E;  5L9V A;  2JDP A;  4WM8 C;  4YW3 A;  2VQA A;  1CPN A;  4C1W A;  1O8S A;  2VNR A;  2VBP A;  1KGY A;  3EBR A;  1OKQ A;  4YFZ A;  2J1A A;  1TG7 A;  2JXA A;  3LA2 A;  5LK5 A;  3NNJ A;  2DCK A;  2EXK A;  3GYD A;  4JGZ C;  2XUE A;  4UWD A;  3IPV B;  4YGE A;  2WNV A;  4XFH A;  4YW7 A;  2BGC A;  4ZS3 A;  1IPJ A;  4Q2F A;  1F31 A;  1UOJ A;  2R0F A;  3G6J B;  1K5M A;  4QM8 A;  3ZFE A;  1WLW A;  3J7L A;  5E89 A;  2RM2 3;  5A7N A;  2D43 A;  3OYW B;  2YY1 A;  1CX4 A;  1NYW A;  2BQP A;  1UN1 A;  2B4K A;  2E7T A;  5BNP B;  5EPA A;  1RUJ 1;  4XAE A;  4LK6 A;  3M2M A;  4O9E A;  4TXW A;  3T0B A;  1VRH 2;  3ZOI A;  3LIH A;  5FZE A;  2Q8E A;  4C0B A;  4CDX B;  3L9J T;  4E8C A;  2HEY F;  1MS8 A;  1OQD A;  2VO5 A;  3U0Z A;  1BK1 A;  4Y1Z A;  3HNB M;  4TZD A;  3O1M A;  3KV9 A;  1G86 A;  4XET A;  2ZEX A;  5F2S A;  1H2L A;  1KDM A;  4Q4W 1;  4MO3 M;  2NQY A;  3ZXF A;  5C9A B;  5A7Q A;  4KNC A;  3JBG 3;  4Q1R A;  1QJF A;  1UY0 A;  1V6M A;  5FOJ B;  3K4A A;  4IV3 B;  1H8V A;  4KH9 A;  5L9B A;  1OMI A;  2D3S A;  3KHC A;  4AED A;  2JG9 B;  1G9D A;  4H14 A;  1ND2 B;  3MV0 1;  3A0K A;  4P5H A;  5FZC A;  2WWU A;  5FZ8 A;  3KV4 A;  3GZU C;  5A33 A;  3UET A;  3H7J A;  1YYN A;  4I3P A;  1VAV A;  1CJD A;  3B00 A;  4IQP A;  5A3T A;  2FCT A;  3MFA A;  3OEB A;  4I3G A;  2RDR A;  4M3C B;  3NV2 A;  2GN3 A;  4UFI A;  3A21 A;  5JPN B;  5FKC A;  4EN6 B;  1IHM A;  3O1R A;  5D2A A;  4QXK A;  1N3O A;  1APN A;  1O7F A;  1OVP A;  3PU3 A;  4N7U A;  5FFO C;  5FZ1 A;  2CV6 A;  4Z82 A;  5FP9 A;  1WCU A;  4LO6 B;  2X10 A;  2ZX2 A;  2WQ8 A;  1MEC 1;  1W3V A;  5G05 L;  2PHU A;  1UMZ A;  3JXS A;  4FXG B;  5FMB A;  5C8C C;  3V0B B;  2QBX A;  2JWP A;  1W2U A;  4LIT A;  5CFD B;  5JAX A;  4MGY E;  5FWJ A;  1S0F A;  2GNM A;  4OZO A;  2WQZ C;  3A23 A;  3AYE A;  3TN9 2;  1WWY A;  1YJK A;  1OOP A;  1PIV 3;  4MHR A;  4U36 A;  3KVA A;  4PBO A;  4FQZ A;  2VL4 A;  5GLU A;  2UYB A;  4NRO A;  2BOJ A;  4CUC A;  1HQL A;  3III A;  1YRZ A;  1XRU A;  1SHW B;  2G19 A;  3FHA A;  4OQ8 A;  4CEY A;  1HRI 3;  1U0A A;  3J26 N;  1H9P A;  2A6X A;  4ZU7 A;  4ZHN A;  1LAJ A;  2QDN A;  5F2W A;  4C1X A;  3HR9 A;  1N1Y A;  2E7Q A;  3BCW A;  5FZM A;  5FAX A;  4D6Q A;  2VXJ A;  4J1X A;  4HFS A;  4RN5 A;  3S57 A;  1RUE 3;  1JH5 A;  3VBH C;  3H1Y A;  3ROU A;  1LOE A;  5IK7 A;  1OUS A;  5I0S A;  1UOB A;  5D8A A;  2Y6F A;  4CPB A;  2XQX A;  2CU5 A;  5FXW A;  5A1A A;  2X53 S;  3RQ0 A;  5DAW A;  1ZRI A;  4WVM A;  1HB4 A;  2WN2 A;  4PLM A;  1FPN 2;  1YFY A;  3JD7 3;  2ZX4 A;  3UKT A;  2OA2 A;  3T1M A;  2A6W A;  3T0A A;  4CEW A;  5LAT A;  1IS4 A;  2ENR A;  2C6S A;  2BGP A;  4AFC A;  3GBF A;  1ULC A;  5FZF A;  3VLB B;  2C26 A;  5DDJ 3;  1QH6 A;  1UMH A;  1MS4 A;  3OPW A;  1W9W A;  1TMF 1;  2PLV 2;  3VHR A;  3I3Q A;  4JZR A;  5CAD A;  3KZ4 C;  5FZD A;  4DO0 A;  3QD6 A;  4N9I A;  3KT1 A;  3WDX A;  1SCS A;  4YZ2 A;  1CD3 G;  1W0O A;  2OUH A;  4YVS B;  1PO2 3;  3AZZ A;  3NJV A;  3AXD A;  5EZW A;  1BKZ A;  1AR9 2;  5JVV A;  4AI1 A;  3ZVX A;  2ZGN A;  3WXP A;  3J7N A;  1QJY 2;  4CU7 A;  1KJL A;  1V9U 2;  4D69 A;  5T5P A;  3RZG A;  3RFR A;  1ND3 C;  1VBE 2;  1QNY A;  2R0H A;  1JZ2 A;  3NNM A;  1YCI A;  5HI0 A;  1UIK A;  1AYN 3;  1VIW B;  1QWR A;  4FFF A;  2VTF A;  1PNG A;  5FTT C;  4AI0 A;  4ASM B;  4ES8 A;  3UKN A;  3U07 A;  3WQ7 A;  3TEY A;  2Z5W A;  4YGD A;  3S6P A;  1Q3E A;  4GWM A;  4AAP A;  1IQD C;  2CWM A;  4G3Y C;  4P9J A;  1XE8 A;  2RS5 2;  3ZDV A;  3PLQ A;  5K7P A;  5F3C A;  1NE6 A;  1ONA A;  4CDQ B;  2OW4 A;  1F5J A;  4Q5O A;  3I4I A;  1IPK A;  5BNO A;  2GSY A;  3OGV A;  1REE A;  2IXH A;  2X29 A;  1DYO A;  1OLM E;  3QOP A;  3ACI A;  4S2G A;  5FZ6 A;  3Q8B A;  1AYM 3;  3VBR B;  2HWC 3;  1SLL A;  1FPN 1;  5T5L A;  3VBO A;  4XDO A;  2LS6 A;  5A1L A;  1H8T B;  1QEX A;  2BU9 A;  3JQX A;  1W8F A;  4GAL A;  2NM1 A;  3ZPY A;  3ZXD A;  4B1L A;  1KQR A;  1U5Z A;  4V1P A;  2D7F A;  3GDB A;  4JDM A;  4UAP A;  1PM7 A;  2VBD A;  4YAR A;  2YV8 A;  1N1V A;  3MDP A;  2I45 A;  5A3U A;  3RDI A;  2VC9 A;  3KT4 A;  3NAP B;  2QZ3 A;  3CL1 A;  3PUS A;  4XFG A;  1GP4 A;  5FZH A;  5LBC A;  3RRD A;  5KWR A;  2G9F A;  4JRA A;  1WW6 A;  3Q8F A;  4E2Q A;  3NST A;  3WDU A;  2WZP P;  4YG0 A;  1GQP A;  1ZZ8 A;  2YBS A;  3POB A;  3T30 A;  1QJY 1;  1K5M C;  3VBF C;  2H6C A;  3ZFE C;  5HBA A;  3JUU A;  3OBZ A;  4HET A;  5DUV A;  3S30 A;  1GR3 A;  2FCV A;  3OOX A;  4LJH A;  1WLT A;  1X82 A;  3SQO A;  4AEK A;  1R1A 1;  1DQ4 A;  4GJZ A;  4QPY A;  4HMZ A;  5JSR A;  1LEC A;  1O8P A;  4TN7 A;  1R08 1;  1SLC A;  2WZR 2;  4ORF A;  2RS5 1;  3H3L A;  3ZYB A;  3I59 A;  2GZW A;  4BB3 A;  5IYY A;  3CIH A;  1OH4 A;  3ZYP A;  2NP0 A;  4M4R A;  1XOY A;  5FRA A;  1ZVF A;  2ZEW A;  3K4Z A;  2J1R A;  2LRP A;  1W6P B;  4W4Z A;  5IAX A;  5GJ6 A;  5K0U B;  4OHY A;  1OA3 A;  4LOS A;  1LCL A;  2J1V A;  3TEZ A;  4XE9 A;  1W6O A;  4D7Y A;  1GZ9 A;  5L7O B;  4FQ4 A;  3RZJ A;  4HON A;  5JOX A;  4LHS A;  5DQ0 A;  1VAK A;  2RVA A;  2QNK A;  4RGG A;  5FYM A;  1FT9 A;  3N36 A;  4YWA A;  2LUW A;  4Q0S A;  4WM8 B;  1XBF A;  3NJY A;  3ES1 A;  3WDV A;  5IAT A;  4UI9 L;  2A73 B;  4HVR A;  4XDQ A;  1DGW X;  1ZRD A;  1QXR A;  2RM2 2;  2HWD 2;  1Y3T A;  4IV1 A;  5J37 A;  3J7H A;  4QM9 A;  3TB0 A;  4GA9 A;  5JLV A;  3SMH A;  2GME A;  4MSV A;  3ZMN A;  4JGZ B;  2IXL A;  2Z2S B;  4J6G A;  1JU4 A;  1YUD A;  1A8M A;  4CCN A;  3KV6 A;  3JB8 A;  4DXR A;  1UNB A;  4ZON A;  4EN8 B;  2RS3 3;  4P9Y A;  4IUG A;  3VKN A;  1GU3 A;  4XFI A;  1WCQ A;  3OSD A;  3NRU A;  1IOA A;  1ZRE A;  4LO4 B;  2DFB A;  3OTF A;  1E5R A;  3QAC A;  1KIT A;  1RTV A;  3IDE A;  3I3M A;  2W68 A;  1JYI A;  4LBL A;  3ABZ A;  2VOK A;  1SDW A;  4E4S A;  4QB6 A;  3JBG 2;  4XC9 A;  3ILF A;  2D5F A;  4DUX A;  5EXO A;  1J3R A;  2VM9 A;  4JKL A;  1BXH A;  4K8R B;  1JYC A;  2Q8C A;  2HJI A;  1NLS A;  3UGF A;  1OXC A;  3IB3 A;  2Z79 A;  2EAK A;  3U78 A;  3W58 A;  3WCR A;  1SPP B;  4Z8B A;  3HQX A;  1SCR A;  2PHX A;  3TOJ A;  5KC5 A;  3IMM A;  3I2I A;  4HT1 T;  2WS9 1;  3ME2 A;  2Y38 A;  1UXX X;  2VUD A;  2XGX A;  3OGJ A;  3WDT A;  1X33 A;  4K40 A;  3AMP A;  5AC9 1;  2G1M A;  1OPO A;  2XHN A;  4J25 A;  1IPS A;  2CGP A;  2XOM A;  2RMU 2;  4YYO A;  4XUT A;  4A2U A;  3PVO A;  3U37 A;  5IWF A;  1KFU L;  3BI3 A;  4HK9 A;  2HWD 1;  3CNA A;  3P1I A;  3CBN A;  5A32 B;  2X5I C;  1CX1 A;  2QCS B;  1NZI A;  4HLT A;  1QMJ A;  4W6W A;  4G9S B;  3TNP B;  4CEW C;  5IK8 A;  2R04 3;  2PMW B;  4IEZ A;  4UFJ A;  3W59 A;  4MGZ E;  1PIV 2;  2R49 A;  1SFN A; 
#chains in the Genus database with same CATH homology
 5JXI A;  3WF1 A;  4MOA A;  3MV1 1;  2Y64 A;  3IDA A;  3WNN A;  3VD7 A;  3LEK A;  3VD4 A;  4QAW A;  2CDO A;  1GOH A;  5C7G A;  2J1E A;  4A44 A;  5I0D A;  2VZT A;  1H6Y A;  2WUH A;  3P6B A;  2WZ8 A;  3I3E A;  4ZZ8 A;  2QQK A;  1BHG A;  4DEV A;  2WO2 A;  3C7O A;  3D3A A;  1XPW A;  3C8X A;  3SEP A;  4Z2A A;  1PMJ X;  3F2Z A;  4P02 B;  2JKX A;  1XC6 A;  2E32 A;  2E26 A;  2Z4F A;  2ORX A;  4DXT A;  1XNA A;  3UNP A;  1ULO A;  2R7E B;  3WF2 A;  5IFP A;  4CUB A;  3WNK A;  1MPX A;  5JXH A;  1JYW A;  3GXU A;  3IAQ A;  5JXJ A;  3OB8 A;  1W8N A;  3NNG A;  4PT6 A;  4JKM A;  1W9T A;  2BBA A;  3AC0 A;  1UY3 A;  1L7Q A;  1OF3 A;  4GWI A;  4CU6 A;  1JZ7 A;  2ZXQ A;  5IHR A;  3A7Q A;  3C7H A;  3CZJ A;  2W91 A;  4KI5 M;  3HNY M;  3NQH A;  2VZS A;  5B4N A;  3OGR A;  3W5N A;  3LPG A;  3I3D A;  4XUR A;  1JHJ A;  4QDR A;  4PF1 A;  3BGA A;  3UES A;  4AG4 A;  2BZD A;  1NUK A;  4OYU A;  4MGS A;  1JZ5 A;  3LE0 A;  4XZU G;  1UX7 A;  1US2 A;  3CKH A;  4P5Y A;  1J84 A;  2VZ1 A;  5IFT A;  3K4D A;  5HXM A;  1JU3 A;  5DPN A;  2RV9 A;  3OBA A;  1DP0 A;  4E8D A;  3CDZ B;  2ORZ A;  4GWJ A;  5G04 L;  2QQI A;  2V4V A;  2WZE A;  4W8J A;  1W9S A;  5IJR A;  1CZS A;  3T2Q A;  2C4X A;  1W99 A;  2QQL A;  5LCW L;  5FUI A;  3WQB A;  5HPO A;  3OGS A;  3LEI A;  4AAX A;  1K3I A;  3DYO A;  3THD A;  1JYV A;  1HN1 A;  3FHQ A;  4KWU A;  2JDA A;  2VCB A;  2W47 A;  1UMI A;  2YFU A;  4ZXE A;  2OKX A;  3GM8 A;  3K77 A;  1UYX A;  4P00 B;  5JMO A;  4OMC A;  2VCC A;  3I2K A;  5B4X A;  4KMQ A;  1GOF A;  3VDC A;  3ZM8 A;  3VDB A;  4OMD A;  2VZV A;  3HN3 A;  4D8M A;  4A45 A;  3MBW A;  1JI6 A;  2BGO A;  1T2X A;  1UY4 A;  2WBK A;  4BJ0 A;  2ID4 A;  3WNP A;  1LNS A;  2BER A;  3WF0 A;  3HEI A;  4ARX A;  1P8J A;  4BK5 A;  4GZ9 A;  3C7F A;  2ZEY A;  3CMG A;  3SKJ E;  4DEQ A;  2QQO A;  3PUH A;  1O8S A;  4XUO A;  2XON A;  1KGY A;  2EID A;  2J1A A;  5LA0 A;  1TG7 A;  1K42 A;  2YC4 A;  2ZEZ A;  4BK4 A;  2DCK A;  2X09 A;  4M4P A;  3T09 A;  3K75 B;  2QQJ A;  5LA1 A;  4ET7 A;  4A6O A;  1GUI A;  2WO1 A;  1D7P M;  1PX4 A;  2B4K A;  2JE8 A;  1UXZ A;  1L7R A;  3WF3 A;  3MUZ 1;  4TXW A;  4JKK A;  2Y6L A;  5EJ1 B;  3LEG A;  3T0B A;  3WSO A;  5EIY B;  3T08 A;  2QQN A;  4E8C A;  2VO5 A;  3WNO A;  3HNB M;  2VQU A;  3PUI A;  1DLC A;  2QQM A;  2WAA A;  2ZEX A;  4QX2 A;  3GGL A;  4MO3 M;  3NJX A;  2L9L A;  1JZ4 A;  4OUE A;  1ULP A;  1UY0 A;  3T2P A;  3E1F 1;  3K4A A;  2DCJ A;  4BXS V;  1GNY A;  2LW8 A;  3MV0 1;  3UET A;  2WAB A;  3I3B A;  1OD3 A;  4MGQ A;  4QX3 A;  4DUW A;  5JUV A;  3OEB A;  3DYP A;  2W92 A;  2W95 A;  3I2J A;  3A21 A;  4QX1 A;  1GMM A;  3MUY 1;  2X10 A;  3ACF A;  5EJZ B;  2WQ8 A;  3ETP A;  5G05 L;  2VZ3 A;  2V5D A;  3JXS A;  4QPW A;  2QBX A;  1SDD B;  1JYN A;  2VME A;  1XNT A;  4QDS A;  1JZ3 A;  4FI9 A;  4OZO A;  2Y6J A;  3A23 A;  5JR2 A;  2WDB A;  4ZY9 A;  4CU8 A;  2W1W A;  4YPJ A;  2VL4 A;  3EYP A;  2W1Q A;  4CUC A;  3III A;  1SHW B;  3FHA A;  4LKS A;  2WO3 A;  3OG2 A;  4UOJ A;  1UY1 A;  4D0Q A;  5JXG A;  2YG0 A;  4CVU A;  3FL7 A;  1PMH X;  2YB7 A;  3LQC A;  2VMD A;  4RN5 A;  2J7M A;  2J1T A;  1F4H A;  1JZ6 A;  2XQX A;  5A1A A;  1JYX A;  2E33 A;  1UYY A;  2EIE A;  2WN2 A;  2B9V A;  4QB1 A;  2W9X A;  2VZU A;  5CZK A;  3T0A A;  5J1X A;  3I97 A;  1R64 A;  1UZ0 A;  2VR4 A;  3DYM A;  4DUV A;  2BGP A;  5DN2 A;  1CZV A;  3OEA A;  2C26 A;  1UMH A;  2EIB A;  1W9W A;  4LQR A;  2VQT A;  3SEE A;  3C7E A;  1K12 A;  2J1U A;  3NJV A;  4CU7 A;  2WAO A;  1JZ2 A;  4PQQ A;  1K45 A;  2VTF A;  5C71 A;  4A4A A;  1UY2 A;  1IQD C;  1EUT A;  3HOB A;  1GOG A;  4RYD A;  3VDA A;  3OGV A;  2W5F A;  1J83 A;  1DYO A;  5C70 A;  2RJ2 A;  3ACI A;  3HPN A;  2VZP A;  3CQO A;  2CDP A;  3WNM A;  1US3 A;  2LS6 A;  2W1U A;  1JZ8 A;  5F7U A;  2VZR A;  2W87 A;  2HYX A;  3GDB A;  4UAP A;  2Y6H A;  1O59 A;  2VC9 A;  4DXS A;  1WKY A;  3HNM A;  5DMY A;  4A42 A;  3WEZ A;  3VD9 A;  1YQ2 A;  2PQS A;  2E31 A;  1GQP A;  3ACG A;  4XVH A;  3VD3 A;  4QDQ A;  2VCA A;  3ACH A;  2DDU A;  2WYS A;  4MAD A;  4XUQ A;  4QX0 A;  2Y6K A;  4XUP A;  1UYZ A;  1O8P A;  1OT5 A;  2VJX A;  2VOT A;  4HG6 B;  5LA2 A;  4JHZ A;  1PX3 A;  2EIC A;  2W1S A;  4JX0 A;  2J1S A;  5IYY A;  3CIH A;  1OH4 A;  1KEX A;  4M4R A;  3WF4 A;  2ZEW A;  3K4Z A;  2J1R A;  1W0N A;  4W4Z A;  3THC A;  1TVG A;  1W8O A;  3MO4 A;  2J1V A;  3VD5 A;  4CU9 A;  2YFZ A;  3ECQ A;  4LHS A;  1UWW A;  2VZO A;  3I2H A;  5DQ0 A;  3FN9 A;  2RVA A;  2W46 A;  3I2F A;  3T0D A;  4ZZ5 A;  1NKG A;  4CUA A;  4UI9 L;  4QB2 A;  3EB7 A;  1RYY A;  3K46 A;  3T2O A;  3J7H A;  3W5M A;  1H6X A;  2Y6G A;  4P08 A;  1JU4 A;  4DXR A;  4A3Z A;  2VZQ A;  4IUG A;  1GU3 A;  4L0P A;  1WCQ A;  3NRU A;  1OF4 A;  3DEC A;  3A22 A;  2J22 A;  2C9K A;  1CZT A;  3ABZ A;  2V72 A;  1CIY A;  2KD7 A;  1NX9 A;  2YC2 A;  1F4A A;  4QB6 A;  2X05 A;  4DUX A;  3IAP A;  2VM9 A;  4JKL A;  3C7G A;  3IB3 A;  4W50 A;  2HLE A;  3I2I A;  1EUU A;  1UXX X;  4LPL A;  3SKV A;  2JD9 A;  2VMC A;  2VMF A;  2W3J A;  2XHN A;  2XOM A;  4XUT A;  3U37 A;  4ARY A;  1I5P A;  3LPF A;  3P1I A;  2W94 A;  3WNL A;  1SG3 A;  1CX1 A;  3CZU A;  2WN3 A;  3I2G A;  5CYY A;  4XUN A;  4A41 A;  3HJR A;  3BN6 A;  2Y8K A;  1NAE A;  4TTG A;  4BDV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...