1D7PM

Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
b'LNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNCLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAGULATION FACTOR VIII PRECURSOR
publication title Structure of the C2 domain of human factor VIII at 1.5 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1d7pM00
2W95A 2X10A 2VZOA 5C70A 2W92A 2YB7A 2BGPA 1W9TA 3IIIA 4E8CA 4KI5M 3C7EA 1CX1A 4D8MA 4CU8A 3LEGA 1JZ8A 3WNNA 4W8JA 2HYXA 2WO2A 1O8SA 2WZ8A 5G05L 1EUUA 1D7PM 1O8PA 2WQ8A 4CU9A 3I97A 3T2QA 5EIYB 3I2IA 3VDBA 2DDUA 2BZDA 2QQIA 4ET7A 3W5MA 4RN5A 1JZ2A 3LEIA 3GM8A 4ZXEA 5CYYA 2RV9A 1JI6A 1GOHA 2VM9A 2W1WA 3ECQA 4W4ZA 1GQPA 4JX0A 4XUPA 2J1RA 2RVAA 3MUZ1 2WBKA 4OYUA 3WNOA 3C8XA 3F2ZA 1NUKA 4MGQA 4OMDA 1F4AA 4RYDA 2E32A 4GZ9A 2ZEZA 1H6XA 2C9KA 2VZRA 3OG2A 1DP0A 2ID4A 4W50A 4XURA 4LKSA 2V5DA 3NJVA 2B4KA 3T2PA 4JKKA 3ACGA 3PUHA 1W8NA 2Y6LA 1UYXA 3I2JA 3VD5A 3VDCA 3IB3A 4M4PA 3NRUA 3THDA 4P00B 5IFTA 4KWUA 4QPWA 2WUHA 2YFUA 5F7UA 2DCKA 3IDAA 2EIDA 4BK5A 3DYPA 2PQSA 1TG7A 2JKXA 3VD3A 2VZPA 3I2HA 4CVUA 3WF4A 1SHWB 2JE8A 2CDOA 3K75B 3OEBA 4UAPA 2X05A 2DCJA 4ARYA 1ULOA 4CUAA 3WF3A 4KMQA 1SDDB 1NX9A 1CIYA 2W87A 3HNMA 4P02B 1KGYA 1XNTA 1WCQA 4XZUG 3T08A 5LCWL 3ACFA 3CQOA 2W1UA 2J1AA 3LEKA 3P1IA 1JU3A 3C7GA 3WNKA 4XUNA 1UY0A 4ZZ8A 3LE0A 3OGRA 4DEVA 2W1QA 2J22A 3UESA 4DEQA 5C7GA 5J1XA 1GUIA 1UZ0A 4BDVB 5JR2A 2VOTA 1GNYA 3PUIA 4DXTA 2W94A 3EB7A 4BK4A 1NAEA 5LA1A 1NKGA 3EYPA 2XOMA 4PT6A 5JXJA 2V72A 4A42A 1XC6A 3ZM8A 1UWWA 3MO4A 1JYVA 3HJRA 4XVHA 3DYMA 3SKJE 2XQXA 1YQ2A 2E26A 1JU4A 1O59A 3I2KA 2ZEYA 2VR4A 1UMIA 2EIBA 3AC0A 2HLEA 1K45A 1UX7A 3FHQA 2Z4FA 3K77A 2QBXA 3D3AA 4YPJA 4A45A 3T0DA 3VD4A 1W9SA 1UYZA 3BGAA 1JHJA 3OGSA 1SG3A 4CUCA 1TVGA 1K3IA 4A41A 3CKHA 2W9XA 2EIEA 4FI9A 4LHSA 2WAOA 2WDBA 5FUIA 2CDPA 2RJ2A 3WSOA 2VC9A 3HN3A 1CZSA 2B9VA 5B4NA 4QB1A 3THCA 4GWJA 2QQJA 2Y6GA 1MPXA 2XHNA 3LQCA 3I3DA 5JXIA 2W5FA 3GXUA 3I2FA 2WN3A 3FHAA 1LNSA 1K12A 4GWIA 4UI9L 4DUXA 2VCBA 4DUVA 1EUTA 5A1AA 3WNPA 2WZEA 1H6YA 1JZ6A 3ACIA 3T2OA 3OEAA 1P8JA 2VQUA 2JDAA 4HG6B 1OF3A 3IAPA 1UMHA 2ORZA 4UOJA 1OH4A 2VZVA 1W8OA 2Y64A 2ZXQA 2KD7A 3WF0A 1J83A 3BN6A 2W91A 1JZ4A 1F4HA 4LPLA 4QX3A 2Y6HA 5IHRA 1UY2A 4QDRA 3T09A 2X09A 2W47A 1DYOA 3K4ZA 3P6BA 3WF2A 3UETA 3K4DA 3ABZA 3UNPA 1GMMA 2ORXA 2VMCA 2VMFA 4JHZA 5EJ1B 4CU7A 3MBWA 2VJXA 2YFZA 4Z2AA 3HPNA 3CZJA 3NNGA 3C7HA 2VO5A 4AAXA 3HNBM 1JZ7A 3OB8A 3WEZA 5DPNA 2W3JA 2Y8KA 1RYYA 2VZQA 4XUTA 5JXGA 1L7QA 1W99A 4XUQA 1US3A 3T0AA 4D0QA 2W1SA 3HEIA 2L9LA 5IYYA 1UXXX 4XUOA 1OT5A 1HN1A 4TXWA 2BGOA 1WKYA 3MV11 1UY4A 3OBAA 2WO3A 3W5NA 2J1VA 3NQHA 4MGSA 4QDSA 2WN2A 2WO1A 1PMHX 2WABA 3MV01 1L7RA 3WNLA 3I3EA 3VDAA 2OKXA 4BJ0A 4AG4A 1GOFA 2VZUA 4A6OA 3I3BA 2QQOA 3CDZB 2XONA 2YC2A 1CZTA 1W9WA 4ZY9A 3K4AA 2WAAA 1K42A 3C7FA 4E8DA 2J1TA 5HXMA 3JXSA 1I5PA 2R7EB 3T0BA 4JKLA 3A23A 1PMJX 2WYSA 3ETPA 4P08A 2E31A 2Y6KA 2VCCA 2YG0A 3A21A 4CUBA 3WQBA 2J7MA 5EJZB 1PX4A 2ZEXA 4P5YA 2ZEWA 3VD9A 2BBAA 2VZSA 3HOBA 5HPOA 2Y6JA 4QX1A 1JYXA 2VZTA 3NJXA 4QAWA 4M4RA 2W46A 2YC4A 3E1F1 5DN2A 4BXSV 5LA0A 4MOAA 4L0PA 4OMCA 5B4XA 4A44A 1JYWA 5JXHA 4IUGA 3MUY1 2JD9A 5JUVA 3A22A 2VQTA 1US2A 2QQKA 3K46A 1T2XA 3FN9A 4MO3M 4LQRA 5IJRA 1IQDC 1UY3A 4QB6A 5G04L 5JMOA 3LPGA 1JZ5A 3FL7A 1DLCA 3DYOA 5LA2A 2EICA 5C71A 1CZVA 1BHGA 3WF1A 3OGVA 1XPWA 1UXZA 1OD3A 2VTFA 3WNMA 1KEXA 1JYNA 4DXRA 1OF4A 1GU3A 5DQ0A 2C26A 4OZOA 3SKVA 2E33A 3GGLA 3SEPA 2VMEA 4TTGA 3CZUA 3DECA 4CU6A 2V4VA 3LPFA 2QQMA 5CZKA 2VL4A 2J1EA 5I0DA 2VMDA 4QX2A 4DXSA 4ARXA 1XNAA 5IFPA 4A3ZA 3IAQA 1GOGA 3CIHA 4QX0A 2LW8A 1W0NA 4MADA 4ZZ5A 3GDBA 2VCAA 3I2GA 3U37A 3ACHA 5DMYA 2J1SA 3C7OA 4PQQA 2QQLA 4QB2A 1ULPA 4PF1A 2QQNA 4OUEA 3HNYM 4QDQA 3VD7A 1PX3A 4DUWA 2LS6A 2J1UA 3J7HA 1UY1A 1J84A 1R64A 3SEEA 2BERA 4A4AA 2VZ1A 4JKMA 3CMGA 1JZ3A 2C4XA 3A7QA 1UYYA 2VZ3A
chains in the Genus database with same CATH superfamily
2W95A 1TQ5A 4XIOA 5C70A 2P5BA 2W92A 1HDKA 1LOBA 4LIUA 4Y5Z0 1A6CA 1KJLA 4BHPA 2A3XA 1AJKA 4XCAA 1R1A3 4LBQB 3AMPA 4X6RB 1AL21 2OXBA 4NIAA 2ZMKA 5FYTA 2UY8A 1F15A 4CEYB 5F1RA 3CJIA 5T5PA 1CVNA 2MEV2 2OA2A 3POEA 2GH2A 3JCIA 2JB8A 2WL1A 4Q4Y2 2A6YA 3VBUA 1ZVFA 1O8SA 2ZKNA 2UWBA 5G05L 1OBNA 2TEPA 2RM22 1C8M3 3SH5A 1EUUA 3THTA 3I59A 2D97A 2ZAHA 4O9EA 1WBFA 3ZPYA 1NY71 3NV3A 4GALA 4QQPA 5ABJC 5EIYB 2FD8A 2DBIA 2PLV3 2VUAA 1IOAA 2ZGQA 1ENRA 4KWLA 4LLOA 4JCKA 4LO8A 2D3RA 4QQLA 4TLFA 5IVCA 5CG8A 1UZWA 5LZ6A 5BNQA 4X8NA 1J1LA 2BTVC 2R072 3VZJA 2IXKA 5FZCA 4OHXA 4AFCA 4YNIA 2R062 1DLLA 4N7IA 1J59A 3ZR5A 2B5HA 1JI6A 1GOHA 3PLQA 2PMWB 4W4ZA 1GQPA 1I9RA 4ATEA 1BEV2 3D5OA 1HXS3 1K5MA 1FMD3 1IHMA 1RUG1 3KMHA 5FAXA 3VBFC 4OHYA 5AC92 5LASA 2OPWA 5ISLA 1JOPA 1ST8A 5T3NA 4AVSA 4RR3C 1GWMA 1F4AA 3LDBA 4OUMA 2RJKA 2QQUA 1R092 4GH4B 1H2MA 4K1ZA 5EZWA 3KGLA 3ZMOA 1UCXA 4GZ9A 4XAEA 1KFUL 2Y0IA 4NHLA 3PUQA 3ZSJA 5A3WA 1DP0A 3FUOA 2RS33 1HKDA 2V5DA 3NJVA 4YFZA 3T2PA 3NWKA 5FQ0A 1OQ1A 3ACGA 5FZ8A 1AX2A 2FMYA 2HEYF 3BCWA 4H2AA 4MSVA 4RD7A 1UYXA 5FP4A 3KS7A 3IIAA 1BCXA 3UJQA 1MEC2 5BNOC 3VBHC 1PZ9A 2F6BA 5IVJA 4I0BA 1BMV2 4EN7B 3MFCA 3RVHA 1RIRA 1W03A 2ZGSA 4QPWA 4QHOA 5EXOA 2YFUA 1OHFA 3T2TA 4B29A 4CCJA 4CCDA 2EIDA 3HQRA 3USSA 4QM8A 1TG7A 2Y33A 5HCAA 3LA7A 4SLIA 2ZGLA 4IL7A 1ND2C 4QT6A 1H1MA 4CVUA 3WF4A 4HXCA 3K75B 3LWCA 1WZXA 3POSA 3MZHA 2BW8A 3PTRB 2DCJA 2WZR2 1ULOA 4BIOA 1RHI2 1H9PA 1X33A 4LNVA 3VBUB 2YYOA 3ZYJB 1OUXA 2EXHA 1NX9A 1TME2 2YXSA 4P5HA 3V56A 1OLMA 1X9PA 2C24A 4C90A 2W87A 4P02B 5FZ9A 4N9IA 3O0VA 4FPGA 4AK3A 1AHSA 1VBB2 4NIIA 3V0BA 5HBAA 1FPN1 3MLLA 2YBKA 1UZYA 3BTXA 1COV3 1FT9A 1W2OA 1AJOA 3JBG3 4XZUG 4FFHA 3KT1A 2DTWA 3CQOA 2J1AA 5L9VA 3ACLA 3LEKA 2ADDA 3C7GA 3P1IA 3WNKA 1NLQA 5DUUA 4CP9A 3RZLA 4C1WA 2VVDA 3LE0A 4DEVA 2W1QA 3POIA 2WFPA 2A75A 4UFKA 2Z42A 4XF0A 1NG0A 4BDVB 4D69A 3IMNA 2VOTA 1GNYA 3PUIA 2W94A 5DDJ1 1S2KA 4FPLA 4IGQA 1JXNA 2AREA 1DQ2A 1NAEA 4BK4A 4Y5SA 4URAA 4LK7A 1H2NA 1DGRN 3EQEA 5LBCA 1PK6A 2UY9A 4XHBA 5F6KA 3ZXLA 4O9GA 3SCGA 4PT6A 4DY3A 5FP9A 1OLQA 2GH8A 2VW1A 3P3PA 5JXJA 2VE1A 3ZFEC 1F8VA 3U14A 4A42A 4FFGA 3QACA 5GZGA 2Y26A 1PVC3 1FOD3 2WC2A 1W2NA 3KVAA 3LFIA 1V9U1 2HWF2 5GALA 1Q8QA 1XE0A 3B94A 3IT8A 4CZSA 4PIYA 4ZU7A 5LK7B 1MS9A 1W0PA 4L99A 3NNFA 2P3KA 3SKJE 3PDQA 5A3LA 1PZ7A 3ZYBA 3J7LA 4K9SA 3R6SA 3I2KA 4LA2A 2ZEYA 1F31A 3MICA 1GNHA 2RG4A 1HV0A 3AC0A 5EHDA 4CP1A 3SISA 3GBFA 3TAYA 2AYHA 3WHTA 2IXIA 3LGRA 4NWWA 1CR7A 4XTMA 5JLVA 5EYXA 1VBD3 2EALA 2WFF1 5FPXA 4XUPA 3ILFA 4IEPA 1DG6A 3VD4A 5FY1A 1W9SA 1UYZA 2BNNA 1JHJA 2E6VA 3I2OA 1J1TA 2YUEA 5A7NA 2WNVC 1QDOA 3MIGA 4DFSA 1ZRIA 5FY5A 4H55A 1XYPA 2JDYA 3IDBB 4A7YA 2ZX2A 3RZJA 2BFUS 4YRDA 1URXA 3ZXGA 5FUIA 4QGLA 2CDPA 1OUSA 4QXHA 3WSOA 1QJU1 2WSVA 2VC9A 4RFRB 4BB3A 1BLZA 3TN91 1A8DA 1H4GA 2GZWA 3A0NA 1GZWB 1STMA 2VXRA 2NM1A 2BNOA 4CP9B 4GWJA 1SDWA 3NJZA 1EV11 2B42B 1SFYA 4JRLA 3L9JT 1MQTB 4UFMA 3AVRA 4XTPA 2OS2A 3H0OA 4OCTA 4MG2A 3OGJA 3FHIB 4TLGA 2YMZA 2Q4SA 5JXIA 1Y9MA 2JDZA 1Q8OA 5CIRA 1S0BA 1C3HA 1KS4A 1QGLA 3J4UH 4LUKA 1AYN3 4F3JA 3D8CA 1LNSA 1ACCA 3K2OA 1UPSA 4UI9L 1S0IA 5FZAA 5A7OA 1DIWA 2VCBA 3VHPA 1BMV1 5JOZA 4EWDA 2P34A 1YQCA 3KHCA 1YYNA 3T2OA 4NHKA 3U4SA 1NE6A 1FV3A 2W52A 4Y1XA 1OF3A 1UZZA 3NW4A 1W8FA 2UWAA 4JRAA 2ORZA 2ZX0A 4UOJA 5IVVA 1W8OA 5KR7A 5IUQA 2ZXQA 2KD7A 5T5OA 5C9AA 1J83A 3B69A 5JAXA 1F4HA 4XQWA 3ZSMA 5FYIA 3PMSA 2HJIA 4BMEA 5A33A 4N43B 1UY2A 4QDRA 3T09A 1H0BA 2B45X 5BUVA 1LOFC 2XUEA 4UW4A 2D6NA 2BU9A 4JV4A 3AZYA 4XILA 1N47A 1FAYA 1W8ZA 2VW0A 5A80A 3VB9A 1WGPA 1JN2P 4MVTA 1SMVA 3ABZA 3UETA 2VD7A 3UT0A 5HV4A 3UNPA 2BPA2 1LESA 2VMCA 4K6BA 3POFA 5EJ1B 2ZABA 1O6UA 3MBWA 4Q0UA 2YY1A 5LY2A 4WVVA 4YW3A 4K1YA 3NL1A 3ZDVA 2YFZA 4BISA 3HPNA 1CAXA 3E97A 3ZXJA 1UU5A 3CZJA 1U5ZA 2LRPA 4MGIE 4KL1A 3SMHA 4GJZA 2UYAA 4AAXA 5IW0A 4FPHA 3HNBM 2GC1A 4Q4X3 2O14A 2ZX3A 2D6KA 4WVMA 5KHKA 3RZHA 1V0AA 2H6BA 1QJY1 2HWC3 2FDFA 5IK7A 2QVSB 5FY4A 2W3JA 2R0FA 4IESA 3WDUA 2B7YA 3MLKA 4O7XA 1L7QA 1NQJA 1W99A 4S2FA 4XUQA 2WZPP 3TEXA 1OC1A 1AYM2 1RUF3 3DGTA 2HWB3 2RR13 3THPA 5CA6A 2L9LA 1W9FA 4AEKA 1S0FA 5IYYA 1UXXX 1LENA 4YW6A 1SFPA 3VGIA 2BGOA 3AZWA 4ZS2A 2R32A 5LBFA 3MV11 3OBAA 4CDWB 4M0NA 4B1LA 2WO3A 2XJTA 3KV6A 3GHNA 3CJIC 4BQ4A 1GWLA 4AQ6A 2J1VA 4QDSA 1UF2C 5A6ZA 2FCTA 2WABA 1CONA 2WO1A 1OPMA 1VBE2 3QH6A 4KU8A 3WCSA 4IEQA 3VHNA 1NQDA 3AMHA 1M4WA 4EN9B 4TYSA 4WM7C 1N1SA 2VZUA 4A6OA 1RMU1 4AGGA 3H7JA 3QBQA 1BJQA 1OLRA 1VALA 2QQOA 4RS5A 1GANA 3WP5A 1CGPA 2HWE3 2ARBA 2XONA 3AZVA 1AR71 2YC2A 3ZFGC 5CG9A 3K4AA 4JGZC 2R49A 3C7FA 5C9AB 1HRI3 4EE2A 2IC1A 3RPQA 4CEWA 1WMFA 4B1MA 4E9KA 1V6LA 3PUAA 4RHV3 3RJ2X 2HWD1 4EN6B 1NCRA 5JPNB 3A23A 2WYSA 2JENA 3ETPA 4F8AA 3K3NA 1K5MC 3APBA 5GZCA 3Q8FA 2J7MA 1RUJ3 2FCUA 2ZTNA 4K21A 4UFJA 1CPMA 3JB4C 4Y20A 2ZEXA 5IWFA 1Z7S3 5C3PA 3WW4A 4CDQC 2XLFA 3QOPA 2JJ6A 5JI7A 2BBAA 5FY7A 4IEXA 3HOBA 1YCIA 2GNMA 3FZ3A 3S57A 4AFBA 3HAGA 1Q3EA 3H1MA 3AVSA 2RMU3 4DS0A 4XABA 5FMOS 4AEJA 2PHXA 2XJVA 3LOIA 4META 4R8HA 4DNYA 2QDRA 3NJXA 4QAWA 5ABJA 3E1F1 2YC4A 5DN2A 1PO21 1B35A 1XB9A 2VY0A 2YPDA 4UXAA 3TYJA 2RJLA 5LA0A 1AL0G 1VAMA 4L0PA 5KXCA 4GULA 1RUD3 1D4M1 1RUE3 4PLMA 3RWKX 5A3PA 2FZ2A 5FY9A 2D40A 4Y26A 3CF6E 3O14A 3H9AA 2JG9B 4AAPA 4AI1A 4EQVA 2XG3A 1N3OA 1AR83 3CL1A 2OVUA 3A22A 3VKOA 5KXEA 2VQTA 1US2A 4MX3A 5C8CC 3C3VA 3HIFA 5GZEA 4OFGA 4MGTA 1POV3 5FUPA 4QPGC 3GJBA 5CU1A 2P4EA 3VBFA 5IJRA 1NYWA 3NNMA 1QJFA 2BRTA 4LOSA 1W6PA 2JKBA 4RR3A 5J09A 2KR2A 1FI2A 2QJVA 4JVAA 3VV1A 1W28A 1VMFA 3DYOA 1AL23 5LA2A 2D98A 3VBRA 5ACA2 3GALA 5C3RA 1CZVA 4FT8A 1Y3TA 2D5HA 2DUOA 5A3NA 2AH2A 1BHGA 4IE4A 1ZRCA 1XPWA 2JE7A 5KHGA 2R1BA 2XBO2 2RS11 3KT7A 3L2HA 3UJOA 2D3PA 4EJRA 4NO4A 3SEPA 1ZNPA 3VZLA 4RS5B 5BNOA 4UBHA 1BVVA 3VBHA 3WP4A 2DFCA 1N1TA 3AM2A 2DFBA 4DOUA 5GZFA 1RUI3 4I30A 3HT1A 4BQYA 1ZZBA 4Z2WA 5CZKA 1AR91 1JUIA 2J1EA 3B9IA 5FPUA 5JI9A 2XVGA 4I0AA 1QJZA 1VBC1 1DZTA 5HXVA 4JHTA 4EN0A 3G7DA 1AXZA 1LODA 2EVXA 1VAKA 3DXUA 4COZA 5GLZA 3TOJA 5IAVA 4FFFA 4ZU4A 4QKDA 2RDSA 3ORJA 1RUG3 1W6MB 2GALA 3CIHA 2GN3A 4P9XA 4Y20B 3UV9A 4XDPA 3WDXA 1WA6X 4B4PA 1PK6C 1QNWA 4HK9A 5L73A 1V6KA 1QJX1 3U37A 1DGLA 4P9LA 4QHZA 2UU8A 4N53C 3JD71 1LECA 4COWA 1DQ6A 1QIQA 5DMYA 4YM3A 5FZBA 4LEJA 5ABJB 4Y1YA 4AL9A 1LR5A 5FPVA 1ZBE2 2A3WA 3POYA 5FZHA 3MIHA 3R05A 3ZSKA 2CSGA 3RJRA 5JOXA 1PGW1 2QQNA 2XGXA 4GA9A 5FBJA 2WA4A 4NPLA 4QDQA 4P9GA 3VD7A 1SLBA 2LS6A 1GP5A 2RDRA 1RUH1 5KWRA 1UY1A 2A6XA 2JXAA 3I3QA 2CGPA 4BIFA 1GQHA 1JOBA 2CU5A 2DU0A 1UU6A 4V1PA 3ZR6A 5C3SA 3VBFB 5CFCC 4JKMA 4QXCA 5FREA 2BFUL 1W6PB 1J58A 1W90A 2H0VA 3BTYA 2OZJA 4GKXA 5DZFA 2X10A 4HSJA 4FTBA 5GLWA 4EROA 2LM3A 3ZFEA 3H1YA 3ZYPA 4QPYA 3BKZA 4HN1A 4AHXA 4LHKA 4XBLA 4XFBA 1AUYA 2LUWA 2QUOA 4CE8A 4E8CA 3C7EA 4D8MA 2V4AA 2XJQA 3PVEA 4IV3C 4JTNA 3V0AA 3N9QA 1ENXA 1PIV1 1RJ7A 1XE8A 1F35A 2WS91 3UYJA 4W8JA 2HYXA 3OYWB 1FPN3 1XXNA 2WO2A 3RDIA 1G9CA 1JMUB 1O3RA 1VB2A 2XR4A 3VBHB 5F8PA 5BNOB 2NYYA 1ULFA 4Q4W1 3OBZA 3H3UA 4UW3A 1FV2A 3WUCA 4AI9A 1ZBA1 4XZPA 4YW2A 3I2IA 2GP3A 1VJ2A 1PO12 4NHYA 2DDUA 1V6NA 4EZHA 4NE9A 5FP8A 1ND2B 3BTAA 1JZ2A 3LEIA 5EWSA 3LCPA 4ZXEA 2PHLA 4CPBD 1MS8A 3KM5A 5DDJ3 3BOPA 4WM8A 3N35A 5FMCA 4INDA 1ZZCA 2ZGNA 1PZ8A 4R52A 5FO8B 4LLFA 3IDCB 3T1LA 3RZGA 5A3TA 3C8XA 1F2NA 4UW5A 5FO9B 5FP7A 1G9AA 4HZFA 2YPJA 4MGQA 4P14A 4Q8KA 1EAH1 3D82A 1R081 2ZHNA 4J6GA 1OMIA 2GMMA 1IG3A 4J1XA 2E32A 4L11A 4OMDA 4RYDA 4CCKA 1QQP2 1BQPA 3AKTA 5AFEA 4BXFA 2C9KA 1V9U3 3E6BA 5LBEA 3RYRA 2VZRA 3ZIXA 2R30A 3OG2A 2Q30A 4YW1A 4D3WA 4LKSA 1LRHA 1OURA 1W3XA 1XYNA 2R1DA 4GMP1 4R9CA 1C5IA 5J48A 4BQ1A 1MS3A 1NLRA 1WLCA 4ZU5A 1LHVA 4BQWA 3I2JA 4BU2A 3VD5A 3HBZA 1YHFA 4COUA 1DZRA 2GC2A 1O4TA 3GHMA 5F5AA 5FUNA 2IXJA 2YV8A 3IDEA 5FXZA 5F7UA 2WFF3 2LALA 4PCRA 4ZXKA 5FR3A 3ENRA 4ASKA 3KWVA 2JECA 3WV6A 4DQAA 1WLWA 2O1QA 3VD3A 2IVJA 3ZFEB 1GLHA 4Y22B 1UOJA 3PIJA 5FFOC 3O1RA 2ZBJA 3SH3A 2GC3A 1GZTA 1XYOA 5DUWA 3KHBA 2CDOA 1H8VA 1S0DA 2NMOA 2K2SA 2XMLA 3J8F2 4NPMA 2AUYA 1CPNA 5FJHA 3ES1A 1QJU3 2HBUA 5FZ0A 3TN93 3ZYGA 1IQAA 2OPKA 2DYCA 5CB7A 1CIYA 1LB2A 1DDLA 3HNMA 1KGYA 1YLLA 2QFEA 3IN9A 1HRV1 1ULDA 2C9AA 1D4VB 4XF9A 1WCQA 3H8OA 1V6MA 4H3WA 1QKQA 1EV13 1LOFA 1PGSA 5IVFA 4YW5A 1VRH1 2NMNA 3S5QA 3ACFA 3FLTA 5CFDC 4CDUC 3S6PA 5EJ3A 3DKQA 4LO5B 1X82A 2VECA 1UY0A 4XUNA 3CHXA 4N8MA 4QU1A 3OGRA 3UESA 3T1MA 4GB32 5J1XA 3O1SA 1HQNA 1Q8VA 2B46X 1UZ0A 2DCZA 2WNVB 4AFMA 2W68A 1BBT1 4DXTA 2A71A 3T3YA 3ATGA 4IEWA 3LSEA 1PVXA 4RGKA 3C2UA 1AR61 3AK0A 4YZ1A 4P9YA 4YFWA 2HH9A 1ZYBA 4IE6A 2QE3A 5JIAA 3ILNA 2WO7A 1D2QA 1GZ9A 4BOWA 2R042 1T6BX 3D6EA 3Q9OA 4CEWC 1WMEA 1LGNA 1UWWA 4GIQA 1VE0A 4NMIA 3VBSC 4AVBA 5C5UA 2DU1A 3LSDA 4E2SA 1NCRC 4HK8A 3A0KA 3L2YA 3AYDA 4HETA 3LF7A 5FMOL 1OVSA 4XVHA 1W39A 4HVRA 3WHUA 2RS52 3VDDC 1YIPA 3WOGA 1UIKA 1V70A 2CAUA 2DVDA 3N36A 4IE5A 1UMIA 1R1A2 2EIBA 2GN7A 2XJRA 4OVEA 5HV0A 5A7SA 1M06G 2VU9A 3BIWE 1JW6A 4WM7A 5DAQA 3MW3A 1U5IA 1ASJ1 2HYKA 2WR9A 3HBKA 4URTA 2JDUA 1YFWA 4NAOA 4O61A 5FKCA 3W9AA 1B35C 3O1UA 3T0DA 4DXZA 2VUJA 3ZFGA 1N1VA 1C8M2 4JGZA 4RA0A 4AHWA 3BGAA 4F7ZA 1VBA3 5IVYA 1BK0A 1SG3A 2WINB 3OGSA 4Q4V1 4A6SA 1TVGA 5I91A 2P3IA 5I8SA 4XF4A 3N3HA 3WNXA 1QJY3 3CKHA 2PLV2 1GV9A 1TMF1 3U78A 4OUSA 3ZN4A 3ZN6B 1U5XA 1VBA2 1XSRA 3J26N 2RJ2A 4OI1A 4AVCA 1DQ4A 3KV5A 3KT4A 1YFUA 1U12A 4C8DA 4NOTA 3WX5A 2WLQA 4YZ3A 1YEWA 4EZ4A 4CDQA 2C6SA 2ZGPA 2B9VA 2PA7A 3M1HA 4U36A 5FMDA 1HXS2 1VP6A 1FMD2 2D6OX 3VBRC 4G9SB 1QOOA 3UKTA 2VOWA 1NA1A 1KDMA 2Y6GA 4L8QA 1RGSA 5FLHA 3VZKA 1EP0A 1IPJA 4YZ5A 4I0WB 1KDKA 4B7EA 1HV1A 1ZA4A 3KD4A 5BNPB 5AVAA 1IS6A 3AP6A 3O12A 4YW7A 5C6CA 2IVIB 2QNKA 1XNCA 4OQ8A 4S2GA 4UW6A 4QX5A 5HI0A 1RMU3 2H6CA 2RS32 3FHAA 3OJBA 2P6HA 1K12A 4YZ4A 1QNYA 1MZ6A 1ZA7A 2AC1A 4DUXA 2GU9A 4DUVA 1G9BA 1EUTA 5A1AA 1AR73 3R4UA 2MPFA 2WZEA 4XYXA 5C8CA 1UMZA 2PAMA 2WQZC 4QPGA 1W9YA 2AEZA 2VQUA 3MHZA 1W2TA 5LATA 3RQ0A 3B9CA 4KWKA 3TWIA 1S0JA 2HWD3 1UMHA 3ELNA 1RC6A 2E53A 3VL9A 4BZ4A 4DRRA 5I0RA 1POV0 1OPOA 4D6QA 5FPLA 1WMXA 2ZOEB 5T50A 2EXKA 4ASLA 2XJUA 3CJIB 3BTZA 1SLTA 4XMIA 3O5SA 5IHRA 1APNA 4ITCA 2KA3A 2XDVA 3R4DB 1RJ8A 1GZCA 4QKFA 3ZDSA 2X09A 3AL5A 2DUPA 2W47A 4WM7B 3ZO0B 3I59B 5KBFA 1ZRDA 2XXZA 2VUCA 3K4DA 1PO23 2OQ6A 4LTAA 3E5UA 2WNUC 3ZFGB 4JGZB 2IUWA 5EPAA 3KSCA 3ZOIA 2X8KA 5F5CA 1D4M3 2ES3A 2VTXJ 3D0SA 4Z2AA 1COV2 2ZHKA 3JB8A 4N90A 3JBG2 3NSTA 3RYKA 4Q8LA 4YGBA 1GSLA 1POQA 1XU1A 1IKQA 3Q8CA 3UK9A 1SPPA 1K5MB 4M00A 5K8SA 3OF1A 1JZ7A 5BYNA 1PGL1 4XAAA 3WEZA 4AE2A 2Y8KA 5FOBB 5GLUA 4AOCA 4CSWA 4CDQB 1MVEA 1US3A 2Q8CA 4LO7A 3FBMA 1RUC1 4R9BA 1OQDA 2ZZQA 4N53A 4HVQA 3CLPA 3N7KA 3B3QE 4XUOA 1OT5A 1HN1A 2CGNA 2Y60A 5ERLA 1SLIA 5FQ0B 3H8UA 5J98B 3UKNA 2RS13 3NQHA 4E4ZA 2WN2A 4FAHA 4J25A 5CBLA 4C91A 1L7RA 1PVC2 2CNAA 4QWNA 1FOD2 4AI3A 4M0HA 3AKPA 4LBOA 1UO9A 1GOFA 1YQ5A 2NP0A 4JQRA 4JAAA 5C8CB 4CYDA 4PIZA 3WP6A 4QPGB 5JWPA 1TNFA 2P2KA 1X8MA 5I8YA 2P17A 1AR93 5LK5A 2E7AA 5FYHA 1V6IA 3PHMA 1VBC3 4W6XA 3CJXA 4XJAA 2Q8DA 5FZIA 4A7KA 4KGGA 1IGOA 5A32A 1GWKA 3MPPG 1ULGA 2J1TA 2XLAA 3WW2A 3JXSA 5HXMA 4WM8C 4BLJA 4CUGA 3T0BA 4IERA 4JKLA 4YVWC 1PMJX 1VBD2 1QXPA 4BQ2A 2E31A 1QJX3 4DMIA 4CUBA 1JTZX 5JSRA 3NMBA 3BU7A 4QGMA 3JD73 4IV3A 1RVF1 4P5YA 3V0BB 2VZSA 1IPSA 2XQRA 2ZJCA 3VHOA 3I49A 1ZRRA 2G9GA 2Y6JA 4NHMA 3AZZA 4SBVA 4DINB 1X9TA 4GQ7A 2VOXA 3VKLA 2VZTA 4IGPA 2PAEA 4M4RA 2PN5A 4YSFA 5CEHA 5A3UA 3POBA 1RUH3 4V2WA 4UWDA 2CHHA 4I02A 2V73A 3NAPC 2TNFA 1OKQA 2GNDA 4Q29A 2KXLA 4ISRA 1AXYA 4I09A 4IUGA 4AVAA 2QQKA 3WR0A 3K46A 5C5TA 1PK6B 4M3CA 1NZCA 2V09A 4A3XA 3FN9A 2FZ1A 5JVVA 3NV1A 4MO3M 4NIDA 3WD5A 1AYN2 1UY3A 1G9FA 3N7LA 5A7PA 1Z78A 1SQ4A 4N53B 5T5JA 4AFDA 4EYUA 5FWJA 1PHMA 3F95A 3UKVA 3EXUA 1DLCA 2Z79A 5L9BA 4LKFA 3LZZA 3PTYA 5DZEA 1PIV3 2WS93 2DV9A 1UKRA 3OGVA 5ANQA 1UXZA 3RZZA 3Q8AA 1JYNA 1FX5A 3M3OA 4Q4W3 4FQZA 1UX6A 1GU3A 2SBAA 1H1IA 1MS1A 5FKBA 4OHZA 5DQ0A 4D6SA 3O1PA 5BXXA 3ZYIB 2D93A 4IE7A 1ZBA3 4HMZA 3I7DA 3KQ4B 4LORA 3HVDA 4TTGA 3GBGA 3DECA 2OUJA 5L19A 3AJZA 5FYYA 4BPZA 2VULA 5DG1A 3A4UA 2VBBA 1O3QA 5JSOA 2WT1A 2VL4A 5FYUA 2YROA 4XFCA 2CGOA 1K5JA 4LITA 3ILRA 5A32B 1S0EA 3TEYA 3BU0A 4P9WA 2VMDA 1QF3A 4DXSA 3P3NA 3QLQA 4RGGA 2MEV1 4LXLA 5FMBA 3SC7X 4OI0A 4Q4Y1 4IQPA 4WZCA 1GOGA 4FXKB 3ZKUA 2LW8A 4GD4A 4V2VA 1W0NA 4MADA 1CAVA 1VMJA 1EAH3 2RM21 3IWZA 4IV3B 3AL6A 1R083 4CXYA 3BIEA 4FPCA 3GJAA 3I2GA 4NAMA 1LHUA 3CO2A 3D4KA 2WWSA 4Q4X2 3S0MA 3KZ4C 4K20A 2D3SA 3RRDA 5A6XA 2WKKA 2R071 1RUNA 5IATA 2HWC2 3KV4A 1AX0A 4GMP3 3PMEA 2R061 1OFNA 1VIWB 1VPHA 3BPZA 1QMJA 4PF1A 5CFDA 1GNZA 4OUEA 4QKBA 4N9HA 4LUMA 2H0BA 4CDUA 1BEV1 1RUF2 2XJSA 1O5UA 2HWB2 1PX3A 2RR12 3HNYM 4NVPA 4AXOA 1LJ7A 4PDWA 4XMAA 3LIHA 4HL0A 4OZXA 5AC91 2QCSB 1WLTA 3K48A 1J84A 2NPIA 3RS6A 5H9PA 4FO9A 4FOQA 4M3CB 2VAUA 3AJYA 1W04A 1PNGA 2KM2A 1R091 2TUNA 4E4SA 1YNAA 3HWJA 4KNCA 5EFUA 1YIFA 2AZ5A 4FPYA 4O65A 4YG3A 2WIIB 3CMGA 1G7YA 3WZ1A 2G9FA 4BWOA 1VMHA 3A7QA 3WVJA 3OD0A 1UYYA 5FZ4A 2VZ3A 5KXBA 2PFWA 4UFIA 1C1FA 1H2LA 4XBQA 5A1FA 5F32A 5EQUA 4NPRA 2BWCA 4FQ4A 4FPOB 2YB7A 2BGPA 3MDPA 1G6NA 4XXAA 3DKWA 1W9TA 3VBSA 2HWE2 2DCYA 3MPBA 2O8QA 1MEC1 1PMIA 5JZGC 2NZ9A 4CU8A 5CVRA 4MLOA 1VR3A 2Y34A 5A33B 3AP7A 1ZX5A 1HRI2 3WNNA 1HRV3 1OLME 3M2MA 4D7YA 2WZ8A 4UFLA 4RHV2 2VNVA 5F3EA 3VDDA 2JX9A 3K51A 4DO0A 5LRSA 4XHXA 1VRH3 1D7PM 1O8PA 5FZMA 3WCRA 5FYCA 1RUJ2 4JDNA 1H9WA 2ZKLA 1NA1C 3T2QA 5GZDA 5FY0A 1T6GC 1Z7S2 4YM2A 1CJDA 1FNYA 2BZDA 3VDBA 2QQIA 3OY8A 4AW7A 4R4ZA 1YI7A 3WQ0A 1Q5OA 3EMRA 3PIGA 5FXWA 4RN5A 1H4HA 2WZR1 1CAXB 4HN0A 3GM8A 1RHI1 4K40A 1JYIA 4BCUA 1QOSA 2PHFA 1BBT3 5C4WC 2RMU2 4IEOA 4JZRA 2RV9A 5F39A 1TME1 2ZGRA 1YQ6A 4FOWA 1SCSA 1MZFA 2LTNA 2AGSA 2VM9A 1CIWA 1DFQA 2W1WA 3ECQA 3IKWA 3LEMA 4WVMB 1AR63 1J3QA 1VBB1 3Q8BA 1HB1A 3TNQA 3WNOA 3F2ZA 1CN1A 4ZHNA 2Q8OA 1YI9A 2AEYA 4RSUA 1W2UA 4BM8A 1RUD2 3VBOC 1RUE2 1GR3A 4ONUA 2YC0A 2IXHA 1AF9A 4KGQA 2ATFA 4I01A 4NUBA 3U1XA 2ZEZA 5I93A 1AR82 2FCVA 2OT7A 2UWCA 3I54A 3M7AA 5HCFA 4CDXC 4ZKTB 5KC6A 5IK5A 5CFDB 2ID4A 3RZKA 2B4KA 1XQNA 3N7JA 1A8MA 1F5JA 4LBKA 1O4ZA 5C3OA 2AENA 1REDA 4JC1A 2JG8C 3O1TA 3PVBB 1PM4A 1BK1A 1W8TA 1W8NA 1I1EA 1GICA 1SCRA 2Y6LA 3E6CC 1REEA 1SZBA 3VDCA 2FBEA 5LEKA 4KU7A 1AL22 3NRUA 2D6LX 3NNLA 4IGOA 3THDA 1VLNA 3GZAA 2ZS6B 4KWUA 2WUHA 3IMMA 1ASJ3 2DCKA 3IDAA 1W6QA 1H8TA 4PIXA 4BK5A 2JIJA 2WRAA 2XWJB 3DYPA 4IEUA 3ZIWA 5T55A 2VXJA 2WQ4A 3DXTA 2HWF1 1LOAA 4Q4V3 2VZPA 3HQXA 3S7IA 1NY72 4CEWB 4ES9A 3I4IA 3VBSB 2JE8A 4YGEA 4UBGA 1TMF3 4D7SA 1NCRB 3OEBA 3ST7A 2ET1A 1OXCA 2X05A 1RUI2 5FIXA 4AF9A 4MGYE 3PU8A 3B00A 5J3UA 4ARYA 3UL2A 2R6QA 2X5IA 3IBMA 4H7LA 5FZLA 1HJFA 3U07A 3WF3A 4KG0A 4RFT0 5T5LA 5E1RA 3VDDB 5F3CA 1CX4A 3JQWA 3LDRA 5KHIA 5FZ6A 1CAWA 5FZDA 2R16A 3SNMA 5DAVA 1NOVA 1XNTA 1RUG2 3J9SA 5CNAA 1MR5A 2P3JA 2R0HA 3TRSB 5E6HA 1B09A 2BNMA 4Q1RA 1X8EA 3TBDA 2GAUA 4YGDA 3SH4A 4BQXA 2JDNA 3H3LA 2TBVA 1B35B 1XSQA 2VNGA 4FPFA 3AFGA 1TNRA 4AQTA 2WNUA 2DVBA 4IE0A 2ET7A 4PF5A 2XL7A 2J22A 1MS0A 5C7GA 2WSUA 1GUIA 1DYKA 1UL9A 2IWGB 4Z1VA 5GM0A 3DPRC 1OH3A 3JU9A 2VOKA 1GP6A 5JOWA 3SCFA 1C5HA 4XEZA 5LA1A 1H2KA 5FTTC 4HFSA 1NKGA 1W8HA 3EYPA 2XOMA 2A70A 4GJYA 5FK7A 4GXLA 1U5YA 3RYPA 1OOPC 3U10A 4RR3B 3W21A 5LEJA 2V72A 2JE9A 4HBNA 3I2DA 1O7FA 4MHRA 1QY4A 4UF0A 2K46A 2UURA 5H9RA 2W0XA 3MO4A 1ND3C 4HVOA 3VBRB 1RL3A 3ETQA 1C28A 4AVVA 1JYVA 3S5AA 3BVCA 2YGMA 4PI2A 5F5IA 3HJRA 3DYMA 3AKQA 4XXPA 2B9UA 1JU4A 2G1MA 4FP2A 3DN7A 3FBYA 3OSDA 4XE9A 4YG6A 3O7OA 5LB6A 4RQPC 2OIIA 4UT5A 4M3CF 1W6QB 3VKNA 4QM9A 1QJEA 1K45A 1UX7A 3ZXAC 3FHQA 1E5IA 3ME2A 3BOWA 5L7OA 3MIBA 2MNGA 3D3AA 1NXMA 1FPN2 3AYAA 3UGFA 3ZPOA 1OD5A 4K8FA 5E88A 1X36A 3E5XA 5GLVA 1TE1B 1W8WA 3FX3A 4ISQA 5K0UC 1LEDA 2W08A 1UW8A 2BUKA 2OQ7A 4KG8A 4A41A 2CY6A 1YXWA 4FI9A 2ZZJA 4R9AA 4YVWA 5FYZA 3WXPA 3GCXA 5FDBA 1YC61 4KH9A 4COYA 2BWAA 4IV1A 2VNOA 1CAWB 4Z92B 1DGRA 3X29B 1RUC3 4LHLA 4S2HA 5FPAA 5DDJ2 4OHWA 1JUHA 3HN3A 5FK8A 2F17A 3RG0A 4BQ5A 1XOYA 4NR1A 1A3KA 2ZPXA 5B4NA 5EV7A 1HB4A 3THCA 5C33A 3MYXA 3ZKYA 2WNUB 2XHNA 2CV6A 4CCOA 3VN4A 3LQCA 1HB2A 3I3DA 1WW4A 4JDMA 3S7EA 5CISA 1DCSA 5IK8A 2EA7A 5APAA 1YRZA 4JQTA 1V6OA 1V9U2 4J1WA 4PHZA 1JBCA 4BLIA 1DGWX 3NAPA 3OUJA 1AYM1 4AFAA 4LBMA 3M8LA 2WNOA 4HKWA 4MXWA 1O4YA 1H6YA 2VNRA 3MW4A 4H14A 4LBNA 1ZZ6A 3U4XA 2D7FA 3GNEA 4Z07A 3ACIA 3ZYHA 4CTEA 1P8JA 2XJPA 4UF0B 4CCNA 2JDAA 4HG6B 4EWAA 1WMDA 3ZVXA 3O0XA 1OH4A 4XDOA 5ANNA 3VHRA 4E2QA 2WFF2 2DCTA 1O3TA 1VBE1 3BN6A 2W91A 4LBQA 3DV8A 1JZ4A 1DHKB 5IT6A 2YDEA 3GZTB 1YO8A 5K9YA 3V0AB 4C0BA 1RVF3 2A3YA 2ZX1A 4AHZA 5A3MA 1WBLA 3KF3A 5FYBA 2HEWF 2ZACA 3WDYA 3ASIA 5DUXA 4FAGA 1N3QA 2CWMA 1GQGA 2HKXA 3WF2A 2ZGTA 3T4VA 1QJU2 1WCUA 4FXGB 3TN92 1RXFA 1GMMA 4JHZA 3MIDA 4CCMA 3VZNA 4CU7A 3USUA 2A1XA 4FPKA 1ULCA 5DABA 1I3HA 5A6YA 2VJXA 1LU2A 3O0WA 4LA3A 4PDWC 3W20A 3ZXDA 1EV12 4WM8B 2RDQA 1ONAA 1UPIA 4OLLA 4Z8BA 4YVWB 1BZWA 1LHOA 3OBTA 3POWA 5JCTA 4YVSC 2E51A 4FBFA 2PELA 5T54A 1LCLA 1RYYA 4XUTA 2DVGA 5JXGA 2HBTA 4NROA 5D2AA 5C3QA 3EO6A 4RGAA 4AEDC 3T0AA 1QH7A 3BUCA 2IXLA 2Q1ZB 2SLIA 2W1SA 4C0HA 2P37A 3PUSA 4QX7A 4FTSA 1SBEA 4K7JA 1TEIA 4WVWA 3QD6A 4TXWA 4QQ2A 3N9OA 3NKTA 2ERFA 1WKYA 3ZN5A 1UY4A 4XACA 2D6MA 4UFHA 1F9KA 3IZOA 2WLPA 3U11A 4XDQA 3W5NA 4MGSA 2BVVA 5JOYA 3MV01 3FUQA 2VOVA 3NAPB 1QDCA 3VDAA 1XNKA 2OKXA 3J7NA 4BJ0A 2BOJA 3BPSA 2VH9A 4FOVA 2PHRA 1YFYA 2EF6A 4MXWB 3ZSEA 2VMHA 5D8AC 1EY2A 5M0TA 5L36A 3UGGA 1WCDJ 3CDZB 4ES8A 4MYEA 1IPKA 5ACA1 1W9WA 4ZY9A 1HIXA 1DU3D 2WAAA 3HMYA 4QQOA 3ZMNA 4XBNA 2MEV3 2E63A 4Y1UA 3H8RA 4Q4Y3 4E8DA 3N9MA 2UYBA 4Y3OA 3T4HB 2BJSA 2R7EB 2FQPA 2Z69A 2A6VA 4FFIA 4Y4RA 5KHJA 1KJRA 2XBO1 1NZIA 4QMAA 2RM23 3TEWA 3KQRA 1CJPA 3N9LA 4P08A 1UIJA 5F2SA 5BY5A 2Y6KA 4TN7A 2YG0A 3A21A 2X29A 3NV4A 2ADEA 4X6QB 2DVFA 5EJZB 5JZGA 1LOEA 3O1VA 5FRAA 1Z0HA 2FDJA 4QHBA 2A5ZA 2DUQA 3MI8A 4PBPA 3VD9A 2R073 4XOGA 1QJY2 4G3YC 1ENQA 2R063 2I2SA 4L9BA 5HPOA 2A6ZA 2WYFA 4QX1A 3MEPA 3USUB 4YZ2A 2VG9A 4YARA 1O91A 1RUI1 1BEV3 3LD8A 2IFRA 1FNZA 2W46A 4XFHA 4BXSV 1NCQC 4LKDA 1S2BA 3N7MA 3LFMA 5J37A 3GZUC 4AQ2A 3AP4A 4JGYC 2JIGA 4IW3A 4LULA 2RE9A 5AC93 1GP4A 4W6YA 5AVPA 3RI9A 4YYOA 4A44A 4L97A 1LOGA 1XNDA 1R093 5JXHA 5C4WA 5FZ1A 1ZM1A 3AB0A 1SLAA 4K8RB 5I0TA 1JH5A 3ON7A 2EXIA 1H8TC 3GZEA 5FYVA 3NKGA 1XU2A 4LQRA 5E16A 3ITQA 1ZBE1 2OX0A 3VL8A 4Y33A 2O0OA 1RMU2 3RWNA 1QHDA 3VBOA 5BV6A 3OTFA 5BNNC 4Q26A 5FY8A 1XNBA 2EICA 1AR72 1MEC3 2DBNA 4WV8A 4QPIC 4CDXA 5DAWA 3U75A 3WF1A 3U0ZA 4NWVA 2X5IC 4Q0SA 5FWEA 2PHUA 1OD3A 3EBRA 2HWD2 2JG8A 3AMQA 4D94A 4AGRA 4DXRA 1OF4A 3EJKA 4AVTA 4AI8A 3SKVA 4OZOA 3DCQA 2E33A 3GGLA 3URFA 1RINA 2WA3A 2ZGKA 2VMEA 4W65A 4I2OA 2EAAA 1XRUA 4HT1T 1RUOA 1CAUA 3ALQA 3BODA 4CU6A 1UOBA 2Y0OA 2V4VA 4XJ8A 3LPFA 3ZFFC 2WZR3 2D6PA 5LW9A 1RHI3 2YU1A 1OFSA 4EN8B 2VBDA 5I0DA 4LO6B 1IKPA 1L7LA 1TME3 1ZZ8A 3OPWA 4ARXA 1AXKA 5IAXA 3WLUA 4PQ9A 1WCKA 2MHFA 2ZAAA 4Q2FA 1O3SA 5IFPA 1VBB3 1PO22 4A3ZA 2IFWA 5CKMA 3IAQA 4QX0A 1OI6A 5JZGB 2PXJA 4LT5A 1D4M2 1X50A 2A7AA 4PJYA 3TB0A 2QKDA 3RI8A 5A70A 5FBZA 3NNJA 3E5QA 1PO11 1Y7BA 3VZMA 4QU2A 1RXGA 2YBSA 1GZWA 5FPBA 1S1AA 4NRQA 3WG3A 3QH7A 1GYKA 2EIGA 3MIEA 1GFF2 4LK6A 4LIVA 5D21A 5FZFA 3I8TA 5BPXA 3S30A 1NA1B 4QB2A 4FPEA 2XB6C 1MQTA 4HKOA 5J7MA 5I8TA 3AMMA 4B4QA 3POJA 2GMEA 2RDNA 4L92A 1UZVA 5C4WB 4LOTA 1A34A 2VW2A 4MGZE 5GLTA 1E5HA 5H9SA 3INAA 5JMCA 4DB5A 3N4MA 3EHKA 4NN0A 3GBWA 1NE4A 4XPVA 1N1YA 5FLIA 3DPRA 1W0OA 3LA3A 5JR7B 1REFA 3ZYFA 1QQP1 2BERA 2GP5A 3B5LB 1S4CA 2RS12 5A1LA 1V00A 2QQVA 2VZ1A 3FJSA 3NVCA 3RGBA 5L7OC 1KD7A 2HWF3 1JZ3A 4QXKA 3BYWA 3VBOB 1UN1A 3TNPB 5EP9A 5FLJA 1S0GA 2C4XA 2WNEA 1MS4A 1IS3A 3WDTA 4F83A 1S2EA 1JS9A 1OOPA 2DVAA 2P1BA 2NN8A 2OW4A 2VZOA 3J7MA 3MF6A 4QD2A 5KXDA 4CDXB 4HKLA 4L2NA 2FDKA 5F3IA 2Y6FA 4W6WA 1AR92 3IIIA 1ND3A 4KI5M 1HW5A 1CX1A 4QXBA 4CXXA 1VBC2 5AFBA 4XIKA 4NJ4A 3E6DA 2JG8B 5E89A 4XFAA 3LEGA 3V64A 3M4FA 1HJGA 4IV1C 5F37A 4KQ7A 1JZ8A 4QX8A 4M01A 3IPVA 4N43A 4BYYA 1WUVA 2A6WA 1CAUB 2WQ8A 3HQUA 4RQPA 3H7YA 1LGCA 4ORFA 1QJX2 2O8OA 3PJYA 4ZPIA 4CU9A 3I97A 2ENRA 3ROUA 3OBRA 2WWJA 5IK4A 3JD72 5KHHA 4BE3A 1KFXL 4ET7A 2D5FA 1NXD1 3W5MA 3J8F1 2Q8EA 1LU1A 2VQAA 3ZLIA 1RB8G 3RSJA 4PQQA 1FATA 5CYYA 4N7UA 2P6CA 1PGW2 4FOYA 1D2SA 1WLDA 3H50A 4JX0A 5F5QA 1SPPB 1JYCA 5K0UA 1HQWA 2J1RA 2PHDA 2RVAA 2BV4A 3MUZ1 2WBKA 2PQQA 2HEVF 4OYUA 5IVEA 4OI2A 3KCXA 1NUKA 1RUH2 5SV5A 5I0SA 1ZREA 4A7ZA 3CBNA 2ARAA 1LOCA 2ZMLA 1S0CA 1Y9GA 1RTVA 1H6XA 3JZVA 5F2WA 3OPTA 5FZOA 3R0RA 4Y5TA 4W50A 4XURA 2JB4A 4GB31 4NIGA 1Q43A 4TSVA 5HCHA 3PVOA 4CDWA 4JKKA 4CEYC 1DZQA 3PUHA 4B7KA 4Z82A 5FZ7A 2VQ0A 3KVBA 1MVQA 3IB3A 1E5SA 4M4PA 1SBDA 3DPRB 4U2AA 4FP3A 4LJHA 4DRVA 4P00B 4AI2A 4D6RA 3H8XA 3NO8A 5IFTA 2GDFA 1PIV2 2WS92 2ZA9A 3FWEA 3DF0A 1KITA 2R041 3VUOA 2VVFA 1V6JA 3RMYA 2PQSA 4Q4W2 1OOPB 4KBZA 1S55A 4S2DA 3OUIA 1R1ZA 2JKXA 2OZ6A 3N9NA 3JQXA 4E4DX 2XWBB 3R4SA 3I2HA 4Q0QA 1ZBA2 5FZGA 1SHWB 2PYTA 4LO4B 1ND3B 2RS51 1HQLA 4AI0A 4Q27A 5DAXA 3MIFA 4UAPA 3OD4A 1Q8PA 2DURA 3KGZA 1IS4A 2BOIA 1R1A1 3IPVB 4NHXA 3ZXEA 2VMGA 4CUAA 5H9QA 3B7MA 4LE4A 1XE7A 4FSJA 4KMQA 1SDDB 3M3QA 4TWTA 1W6NA 2VGDA 3ZX7A 4HPKA 4GH4C 4RQPB 4MHUA 1G9DA 3ZSLA 2WWUA 4AHYA 2WT2A 2YZ4A 3T08A 1EAH2 1C8NA 1C8M1 1MZ5A 3KLSA 1R082 2NQYA 2ZX4A 5LCWL 3G6JB 2W1UA 3FFZA 1QOTA 4AYUA 1JU3A 5BNPC 4YG0A 2FMDA 1W06A 2XLGA 2BQPA 3AMNA 2JD4A 2PLV1 4XJWA 5A7WA 2JDHA 2C5DA 3FC0A 4LBLA 4ZZ8A 2PTMA 4DEQA 5C8WA 3FLPA 2I74A 3LAGA 1DQ5A 4LBJA 1VBA1 4CCEA 1WD3A 2P3YA 5I0UA 3DUIA 5K0UB 4I3GA 1AYM3 3WG4A 1EYBA 1OQEA 3WT3A 3WY6A 5JR2A 3EB7A 2JG9A 3PU3A 2D44A 5LA9A 4Y1ZA 4YVSA 3CNAA 2BEOA 3M3IA 1HXS1 1FMD1 3MF9A 1Y43B 4BH9A 2IXCA 1LEMA 4AR2A 4NRMA 1SLCA 2VVEA 4Q0VA 5FZOB 4AEDA 4LE3A 4G4FA 1VBE3 1XC6A 3ZM8A 3RFRA 1QH6A 1OA4A 1ODMA 4OQ9A 4WZFA 3JUUA 4XQ4A 3SITA 1UU4A 3HR9A 5DUVA 4IEZA 2RS31 5FYSA 1W6OA 4NRPA 2GNTA 4IEVA 3VBUC 1RITA 2XQXA 1YQ2A 2E26A 1U0AA 5CAZA 1UNBA 4PLNA 1E57A 1O59A 3KCYA 5FV3A 4CA9A 4I3PA 2XVKA 2VR4A 4WVZA 2ZHLA 2W39A 3LA2A 3K3OA 1VAVA 1WA4A 2HLEA 2JEMA 3WDVA 4YGCA 4RL7A 2Z4FA 3K77A 2RHPA 3RMXA 1LHNA 2YBPA 2GSYA 3OCPA 2QBXA 4MUVA 5D8AA 3O1MA 4ATFA 4YPJA 1HRV2 3RNSA 2VTXA 4A45A 1YWKA 3B93A 1DF0A 4MH0E 4XF3A 2GMPA 1QU0A 3DL3A 1VRH2 3AX4A 4PBOA 1C1LA 4GKYA 5T52A 3M3EA 4CUCA 1K3IA 3PL0A 4YLZA 1GKBA 1SEFA 3SLIA 2W9XA 4XJZA 2W2IA 1W6MA 1CAVB 3BB6A 4OULA 2EIEA 5CKQA 3HD8B 5LY1A 4LHSA 1UYPA 4ZS3A 2WAOA 1W6NB 2WDBA 3VKMA 3OUHA 3WP3A 4NIHA 4HPKB 3B02A 4DPNA 5K7PA 1DBNA 2E7TA 1BBT2 5D1IA 4XFIA 1CZSA 1SLLA 5F3GA 1LGBA 3OOXA 1AR62 4QB1A 1LAJA 1COV1 2PHTA 1SBFA 2CL2A 1DQ1A 2QQJA 1A78A 3AP5A 1BKZA 1MPXA 3JBG1 5L9RA 5A7WB 5IVBA 2JICA 4GAZA 3H42B 1YJKA 5FXVA 5JSPA 3WQ1A 4CDUB 3RZMA 1N3PA 1NCQA 1Y4WA 2W5FA 4PDWB 1GBGA 2ETEA 3GXUA 3I2FA 2WN3A 3MGUA 4JGYA 5GKAC 4QKNA 5FP3A 4FVVA 4Y24A 3MLJA 4YVSB 4GWIA 4XCBA 4X8PA 3NV2A 2AACA 3ZYRA 5ACA3 4IDZA 5FJKA 4JDOA 3WNPA 1BXHA 3H3ZA 5LWBA 4AEDB 1JZ6A 2DWRA 3DEMA 3OEAA 2F4LA 5FO7B 2JDKA 3PNAA 1LKNA 1MZEA 1X7NA 3IAPA 3WW1A 3SCHA 2CWSA 2XBO3 1HB3A 2VZVA 2Y64A 1ASJ2 1TZOA 2BYVE 3GYDA 5SV8A 5BNNA 1L3JA 3WF0A 1W6OB 1PVC1 3LKJA 1FOD1 3AFKA 3I3MA 4GWNA 4YM0A 4QPIA 4LPLA 4QX3A 3WUDA 4Q4V2 2Y6HA 4XF1A 4Y4YA 3WINE 5J36A 3TEZA 3LOBA 4HANA 2QZ2A 2WT0A 4HLTA 3WW3A 4B4RA 1HLCA 3OYWA 4Q5OA 1TMF2 3POGA 2ILMA 2Y38A 1WW7A 1PM7A 5KC5A 4FPJA 4BMBA 4XFFA 1DYOA 3AYCA 1UOGA 3K4ZA 4KWJA 5D8AB 3P6BA 5FPZA 5HCBA 1IS5A 2QQPA 4FTEA 3KCCA 4JTOA 2ORXA 2VMFA 3OY8B 1MQTC 4K3UA 3ZFFA 1VBD1 1ND2A 1W8UA 1YUDA 2QZ3A 1OSGA 4XQDA 4BQ3A 5TSWA 2Z2SB 4CCLA 3NNGA 3C7HA 3GF6A 1UOFA 1IG0A 1G86A 2VO5A 3LB9A 3N9PA 2X53S 5FZKA 2VUDA 4Y1VA 1HN0A 4DZGA 2NLRA 3OB8A 4M3CE 2BBVA 5DPNA 2VCMA 4CCCA 1Q56A 1ZBE3 2B39A 2VZQA 3LIGA 5CADA 1ODNA 3SXWA 1D0HA 1WD4A 4IETA 2CYFA 2A73B 4D0QA 2I07B 3AYEA 3HEIA 2N7GA 2G9ZA 4XC9A 5FYMA 3FLRA 1I5ZA 2BDRA 1QXRA 5JDBA 1JODA 1UD1A 4PI0A 4LHNA 2K0GA 1WW5A 1NCQB 3NJYA 5FOJB 2YHJA 2JDPA 4LKEA 3W58A 3T30A 4ASMB 1JHNA 2ZGMA 3ES4A 2V5YA 4JGYB 4YW4A 3AP9A 1PMHX 2Q1MA 4N43C 3WNLA 3I3EA 4CPBA 4AWDA 3CU7A 2YGLA 4MXVA 4AG4A 3FFQA 1AYN1 1Y9QA 3GCWA 5DZGA 4PLOA 3AXEA 3AKRA 3AZXA 3I3BA 3W59A 1H8TB 2F4PA 4H7MA 1AZDA 5CFCA 1FYUA 3O1OA 1H1AA 1PNFA 4LR4A 1CZTA 3WQ7A 1H30A 1O5LA 5JUVA 1K42A 1OVPA 1WW6A 3KV9A 4DY5A 3Q8EA 4Y22A 3VLBB 5BNNB 2YU2A 2C1FA 4D7TA 1MS5A 4B8EA 1AVBA 2XH6A 2Q1FA 5CKNA 1I5PA 3VKFC 4QPIB 5DXDA 1D0GA 2J42A 3B01A 2FHRA 1KXGA 2X5IB 1I6XA 2VCCA 4R9DA 3IM0A 3WQBA 3PJQA 1WWYA 4XJ9A 2ZMNA 1PX4A 1PO13 1YJLA 1LULA 5FCCA 5FZ3A 2AR6A 2CAVA 2ZEWA 4MZUA 4LMFA 4XJUA 2G4IA 1PGL2 2JWPA 1JOJA 1HX6A 5FZEA 4AGVA 1AX1A 4B3NA 1ZZ7A 2XKOA 1LHWA 1DGWA 1JYXA 1ZZ9A 3WG1A 1G8WA 3ZXKA 5A6QA 4AQSA 3ZFFB 2K9ZA 1RUC2 1XJAA 3KB5A 4CDWC 4TZDA 2E9QA 4HSLA 5GJ6A 5LBBA 3H1WA 2FDIA 4MOAA 3PURA 1QEXA 2OYZA 3OGGA 4OMCA 4CP0A 2G19A 2VBPA 5B4XA 4MV2A 1ENSA 1JYWA 2WNVA 1BVP1 4YWAA 1QQP3 1MACA 3AKSA 3MUY1 2JD9A 1KQRA 1J3PA 4Q4X1 4IXLA 1T2XA 3FE5A 1OA2A 1YQ8A 2C0ZA 2XKPA 3BI3A 1OA3A 2HWC1 1CD3G 1IQDC 4Q0PA 4QB6A 5J96B 2XUMA 2EXJA 1W3VA 5G04L 3SQOA 4ZONA 3ZXFA 2OUHA 1E5RA 2JDMA 5JPMB 3M70A 5C9AC 3LPGA 2VMIA 3FL7A 5JMOA 1JZ5A 1RUF1 1LTEA 2HWB1 2RR11 4OI4A 1FXZA 5C71A 4QQHA 3AXDA 2Q5TA 2QDNA 1C57A 4XETA 5EYYA 2QQWA 1DQ0A 1CESA 3WG2A 5F9TA 1EPWA 2VTFA 3WNMA 2BVBA 1KEXA 1NT0A 3BALA 3VZOA 2ARCA 4CEYA 2FDGA 4CP2A 3OPZA 2XVLA 2C26A 2Z5WA 4R4XA 4AZZA 4HOOA 4XFGA 5CFCB 2Q0AA 2VPVA 5L7OB 3CZUA 4FCAA 4CRQA 1RVF2 4YM1A 4MGKE 4QGNA 1XBFA 3J8F3 1WCSA 1C4RA 3D0JA 2QQMA 1UKGA 5K4LA 2B8MA 1VRBA 2WJSA 2HWE1 5F6LB 4UYBA 4GWMA 3UGHA 1KS5A 4QX2A 2EAKA 2XPJA 1F5FA 1XNAA 4EV0A 4E4HA 1HRI1 2LROA 1J3RA 2ZGUA 4P9IA 2BP6A 4C1XA 2JG9C 4RHV1 5E8AA 1UQXA 4ZZ5A 3GDBA 2DF7A 4IV1B 4EWEA 4XW3A 2QTWB 2BGCA 2VCAA 3ZN6A 4COVA 3HT2A 1VB4A 2GNBA 4AEMA 4HONA 1KRIA 1RUJ1 1DYPA 1CWPA 1ZRFA 3ACHA 1Z7S1 2E7QA 1NLSA 1QXJA 1SFNA 1W05A 2J1SA 2ZHMA 4GH4A 3WDWA 4GB33 2XL9A 3C7OA 2CTVA 1W2AX 2DTYA 1UAIA 2IZWA 2PHWA 2QQLA 1ULPA 2RMU1 3HN1A 4LBQD 5A7QA 4E2GA 2ZCWA 1CQ9A 4P9JA 2ZGOA 1IZ3A 1SACA 1EPZA 5LRRA 5BNPA 4DUWA 1JYTA 2ARXA 2XHKA 4E27A 1ULEA 3MFAA 2J1UA 5FXXA 1Q8SA 3J7HA 4WBBA 4BA6A 3LDKA 2FDHA 3MW2A 5B2GB 1RUD1 1R64A 1RUE1 4GMP0 3M3CA 1QWRA 2R043 1BYHA 3SEEA 4IEYA 4RS5C 4A2UA 3V65A 2I45A 4A4AA 1YFXA 3FMGA 3PVNA 3P5BA 1AR81 3SHRA 4CXWA 5DAPA 3CEWA 5JIUA 1ALYA 3QCWA 5A3OA 2D43A 2GC0A 2PAKA 1POV1 4OHVA 4Q1PA 4KBBA 4DIQA 5DG2A 2RS53 1OKOA 3KF5A
chains in the Genus database with same CATH topology
2W95A 2X10A 2VZOA 5C70A 2W92A 2YB7A 2BGPA 1W9TA 3IIIA 4E8CA 4KI5M 3C7EA 1CX1A 4D8MA 4CU8A 3LEGA 1JZ8A 3WNNA 4W8JA 2HYXA 2WO2A 1O8SA 2WZ8A 5G05L 1EUUA 1D7PM 1O8PA 2WQ8A 4CU9A 3I97A 3T2QA 5EIYB 3I2IA 3VDBA 2DDUA 2BZDA 2QQIA 4ET7A 3W5MA 4RN5A 1JZ2A 3LEIA 3GM8A 4ZXEA 5CYYA 2RV9A 1JI6A 1GOHA 2VM9A 2W1WA 3ECQA 4W4ZA 1GQPA 4JX0A 4XUPA 2J1RA 2RVAA 3MUZ1 2WBKA 4OYUA 3WNOA 3C8XA 3F2ZA 1NUKA 4MGQA 4OMDA 1F4AA 4RYDA 2E32A 4GZ9A 2ZEZA 1H6XA 2C9KA 2VZRA 3OG2A 1DP0A 2ID4A 4W50A 4XURA 4LKSA 2V5DA 3NJVA 2B4KA 3T2PA 4JKKA 3ACGA 3PUHA 1W8NA 2Y6LA 1UYXA 3I2JA 3VD5A 3VDCA 3IB3A 4M4PA 3NRUA 3THDA 4P00B 5IFTA 4KWUA 4QPWA 2WUHA 2YFUA 5F7UA 2DCKA 3IDAA 2EIDA 4BK5A 3DYPA 2PQSA 1TG7A 2JKXA 3VD3A 2VZPA 3I2HA 4CVUA 3WF4A 1SHWB 2JE8A 2CDOA 3K75B 3OEBA 4UAPA 2X05A 2DCJA 4ARYA 1ULOA 4CUAA 3WF3A 4KMQA 1SDDB 1NX9A 1CIYA 2W87A 3HNMA 4P02B 1KGYA 1XNTA 1WCQA 4XZUG 3T08A 5LCWL 3ACFA 3CQOA 2W1UA 2J1AA 3LEKA 3P1IA 1JU3A 3C7GA 3WNKA 4XUNA 1UY0A 4ZZ8A 3LE0A 3OGRA 4DEVA 2W1QA 2J22A 3UESA 4DEQA 5C7GA 5J1XA 1GUIA 1UZ0A 4BDVB 5JR2A 2VOTA 1GNYA 3PUIA 4DXTA 2W94A 3EB7A 4BK4A 1NAEA 5LA1A 1NKGA 3EYPA 2XOMA 4PT6A 5JXJA 2V72A 4A42A 1XC6A 3ZM8A 1UWWA 3MO4A 1JYVA 3HJRA 4XVHA 3DYMA 3SKJE 2XQXA 1YQ2A 2E26A 1JU4A 1O59A 3I2KA 2ZEYA 2VR4A 1UMIA 2EIBA 3AC0A 2HLEA 1K45A 1UX7A 3FHQA 2Z4FA 3K77A 2QBXA 3D3AA 4YPJA 4A45A 3T0DA 3VD4A 1W9SA 1UYZA 3BGAA 1JHJA 3OGSA 1SG3A 4CUCA 1TVGA 1K3IA 4A41A 3CKHA 2W9XA 2EIEA 4FI9A 4LHSA 2WAOA 2WDBA 5FUIA 2CDPA 2RJ2A 3WSOA 2VC9A 3HN3A 1CZSA 2B9VA 5B4NA 4QB1A 3THCA 4GWJA 2QQJA 2Y6GA 1MPXA 2XHNA 3LQCA 3I3DA 5JXIA 2W5FA 3GXUA 3I2FA 2WN3A 3FHAA 1LNSA 1K12A 4GWIA 4UI9L 4DUXA 2VCBA 4DUVA 1EUTA 5A1AA 3WNPA 2WZEA 1H6YA 1JZ6A 3ACIA 3T2OA 3OEAA 1P8JA 2VQUA 2JDAA 4HG6B 1OF3A 3IAPA 1UMHA 2ORZA 4UOJA 1OH4A 2VZVA 1W8OA 2Y64A 2ZXQA 2KD7A 3WF0A 1J83A 3BN6A 2W91A 1JZ4A 1F4HA 4LPLA 4QX3A 2Y6HA 5IHRA 1UY2A 4QDRA 3T09A 2X09A 2W47A 1DYOA 3K4ZA 3P6BA 3WF2A 3UETA 3K4DA 3ABZA 3UNPA 1GMMA 2ORXA 2VMCA 2VMFA 4JHZA 5EJ1B 4CU7A 3MBWA 2VJXA 2YFZA 4Z2AA 3HPNA 3CZJA 3NNGA 3C7HA 2VO5A 4AAXA 3HNBM 1JZ7A 3OB8A 3WEZA 5DPNA 2W3JA 2Y8KA 1RYYA 2VZQA 4XUTA 5JXGA 1L7QA 1W99A 4XUQA 1US3A 3T0AA 4D0QA 2W1SA 3HEIA 2L9LA 5IYYA 1UXXX 4XUOA 1OT5A 1HN1A 4TXWA 2BGOA 1WKYA 3MV11 1UY4A 3OBAA 2WO3A 3W5NA 2J1VA 3NQHA 4MGSA 4QDSA 2WN2A 2WO1A 1PMHX 2WABA 3MV01 1L7RA 3WNLA 3I3EA 3VDAA 2OKXA 4BJ0A 4AG4A 1GOFA 2VZUA 4A6OA 3I3BA 2QQOA 3CDZB 2XONA 2YC2A 1CZTA 1W9WA 4ZY9A 3K4AA 2WAAA 1K42A 3C7FA 4E8DA 2J1TA 5HXMA 3JXSA 1I5PA 2R7EB 3T0BA 4JKLA 3A23A 1PMJX 2WYSA 3ETPA 4P08A 2E31A 2Y6KA 2VCCA 2YG0A 3A21A 4CUBA 3WQBA 2J7MA 5EJZB 1PX4A 2ZEXA 4P5YA 2ZEWA 3VD9A 2BBAA 2VZSA 3HOBA 5HPOA 2Y6JA 4QX1A 1JYXA 2VZTA 3NJXA 4QAWA 4M4RA 2W46A 2YC4A 3E1F1 5DN2A 4BXSV 5LA0A 4MOAA 4L0PA 4OMCA 5B4XA 4A44A 1JYWA 5JXHA 4IUGA 3MUY1 2JD9A 5JUVA 3A22A 2VQTA 1US2A 2QQKA 3K46A 1T2XA 3FN9A 4MO3M 4LQRA 5IJRA 1IQDC 1UY3A 4QB6A 5G04L 5JMOA 3LPGA 1JZ5A 3FL7A 1DLCA 3DYOA 5LA2A 2EICA 5C71A 1CZVA 1BHGA 3WF1A 3OGVA 1XPWA 1UXZA 1OD3A 2VTFA 3WNMA 1KEXA 1JYNA 4DXRA 1OF4A 1GU3A 5DQ0A 2C26A 4OZOA 3SKVA 2E33A 3GGLA 3SEPA 2VMEA 4TTGA 3CZUA 3DECA 4CU6A 2V4VA 3LPFA 2QQMA 5CZKA 2VL4A 2J1EA 5I0DA 2VMDA 4QX2A 4DXSA 4ARXA 1XNAA 5IFPA 4A3ZA 3IAQA 1GOGA 3CIHA 4QX0A 2LW8A 1W0NA 4MADA 4ZZ5A 3GDBA 2VCAA 3I2GA 3U37A 3ACHA 5DMYA 2J1SA 3C7OA 4PQQA 2QQLA 4QB2A 1ULPA 4PF1A 2QQNA 4OUEA 3HNYM 4QDQA 3VD7A 1PX3A 4DUWA 2LS6A 2J1UA 3J7HA 1UY1A 1J84A 1R64A 3SEEA 2BERA 4A4AA 2VZ1A 4JKMA 3CMGA 1JZ3A 2C4XA 3A7QA 1UYYA 2VZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W95 A;  2X10 A;  2VZO A;  5C70 A;  2W92 A;  2YB7 A;  2BGP A;  1W9T A;  3III A;  4E8C A;  4KI5 M;  3C7E A;  1CX1 A;  4D8M A;  4CU8 A;  3LEG A;  1JZ8 A;  3WNN A;  4W8J A;  2HYX A;  2WO2 A;  1O8S A;  2WZ8 A;  5G05 L;  1EUU A;  1D7P M;  1O8P A;  2WQ8 A;  4CU9 A;  3I97 A;  3T2Q A;  5EIY B;  3I2I A;  3VDB A;  2DDU A;  2BZD A;  2QQI A;  4ET7 A;  3W5M A;  4RN5 A;  1JZ2 A;  3LEI A;  3GM8 A;  4ZXE A;  5CYY A;  2RV9 A;  1JI6 A;  1GOH A;  2VM9 A;  2W1W A;  3ECQ A;  4W4Z A;  1GQP A;  4JX0 A;  4XUP A;  2J1R A;  2RVA A;  3MUZ 1;  2WBK A;  4OYU A;  3WNO A;  3C8X A;  3F2Z A;  1NUK A;  4MGQ A;  4OMD A;  1F4A A;  4RYD A;  2E32 A;  4GZ9 A;  2ZEZ A;  1H6X A;  2C9K A;  2VZR A;  3OG2 A;  1DP0 A;  2ID4 A;  4W50 A;  4XUR A;  4LKS A;  2V5D A;  3NJV A;  2B4K A;  3T2P A;  4JKK A;  3ACG A;  3PUH A;  1W8N A;  2Y6L A;  1UYX A;  3I2J A;  3VD5 A;  3VDC A;  3IB3 A;  4M4P A;  3NRU A;  3THD A;  4P00 B;  5IFT A;  4KWU A;  4QPW A;  2WUH A;  2YFU A;  5F7U A;  2DCK A;  3IDA A;  2EID A;  4BK5 A;  3DYP A;  2PQS A;  1TG7 A;  2JKX A;  3VD3 A;  2VZP A;  3I2H A;  4CVU A;  3WF4 A;  1SHW B;  2JE8 A;  2CDO A;  3K75 B;  3OEB A;  4UAP A;  2X05 A;  2DCJ A;  4ARY A;  1ULO A;  4CUA A;  3WF3 A;  4KMQ A;  1SDD B;  1NX9 A;  1CIY A;  2W87 A;  3HNM A;  4P02 B;  1KGY A;  1XNT A;  1WCQ A;  4XZU G;  3T08 A;  5LCW L;  3ACF A;  3CQO A;  2W1U A;  2J1A A;  3LEK A;  3P1I A;  1JU3 A;  3C7G A;  3WNK A;  4XUN A;  1UY0 A;  4ZZ8 A;  3LE0 A;  3OGR A;  4DEV A;  2W1Q A;  2J22 A;  3UES A;  4DEQ A;  5C7G A;  5J1X A;  1GUI A;  1UZ0 A;  4BDV B;  5JR2 A;  2VOT A;  1GNY A;  3PUI A;  4DXT A;  2W94 A;  3EB7 A;  4BK4 A;  1NAE A;  5LA1 A;  1NKG A;  3EYP A;  2XOM A;  4PT6 A;  5JXJ A;  2V72 A;  4A42 A;  1XC6 A;  3ZM8 A;  1UWW A;  3MO4 A;  1JYV A;  3HJR A;  4XVH A;  3DYM A;  3SKJ E;  2XQX A;  1YQ2 A;  2E26 A;  1JU4 A;  1O59 A;  3I2K A;  2ZEY A;  2VR4 A;  1UMI A;  2EIB A;  3AC0 A;  2HLE A;  1K45 A;  1UX7 A;  3FHQ A;  2Z4F A;  3K77 A;  2QBX A;  3D3A A;  4YPJ A;  4A45 A;  3T0D A;  3VD4 A;  1W9S A;  1UYZ A;  3BGA A;  1JHJ A;  3OGS A;  1SG3 A;  4CUC A;  1TVG A;  1K3I A;  4A41 A;  3CKH A;  2W9X A;  2EIE A;  4FI9 A;  4LHS A;  2WAO A;  2WDB A;  5FUI A;  2CDP A;  2RJ2 A;  3WSO A;  2VC9 A;  3HN3 A;  1CZS A;  2B9V A;  5B4N A;  4QB1 A;  3THC A;  4GWJ A;  2QQJ A;  2Y6G A;  1MPX A;  2XHN A;  3LQC A;  3I3D A;  5JXI A;  2W5F A;  3GXU A;  3I2F A;  2WN3 A;  3FHA A;  1LNS A;  1K12 A;  4GWI A;  4UI9 L;  4DUX A;  2VCB A;  4DUV A;  1EUT A;  5A1A A;  3WNP A;  2WZE A;  1H6Y A;  1JZ6 A;  3ACI A;  3T2O A;  3OEA A;  1P8J A;  2VQU A;  2JDA A;  4HG6 B;  1OF3 A;  3IAP A;  1UMH A;  2ORZ A;  4UOJ A;  1OH4 A;  2VZV A;  1W8O A;  2Y64 A;  2ZXQ A;  2KD7 A;  3WF0 A;  1J83 A;  3BN6 A;  2W91 A;  1JZ4 A;  1F4H A;  4LPL A;  4QX3 A;  2Y6H A;  5IHR A;  1UY2 A;  4QDR A;  3T09 A;  2X09 A;  2W47 A;  1DYO A;  3K4Z A;  3P6B A;  3WF2 A;  3UET A;  3K4D A;  3ABZ A;  3UNP A;  1GMM A;  2ORX A;  2VMC A;  2VMF A;  4JHZ A;  5EJ1 B;  4CU7 A;  3MBW A;  2VJX A;  2YFZ A;  4Z2A A;  3HPN A;  3CZJ A;  3NNG A;  3C7H A;  2VO5 A;  4AAX A;  3HNB M;  1JZ7 A;  3OB8 A;  3WEZ A;  5DPN A;  2W3J A;  2Y8K A;  1RYY A;  2VZQ A;  4XUT A;  5JXG A;  1L7Q A;  1W99 A;  4XUQ A;  1US3 A;  3T0A A;  4D0Q A;  2W1S A;  3HEI A;  2L9L A;  5IYY A;  1UXX X;  4XUO A;  1OT5 A;  1HN1 A;  4TXW A;  2BGO A;  1WKY A;  3MV1 1;  1UY4 A;  3OBA A;  2WO3 A;  3W5N A;  2J1V A;  3NQH A;  4MGS A;  4QDS A;  2WN2 A;  2WO1 A;  1PMH X;  2WAB A;  3MV0 1;  1L7R A;  3WNL A;  3I3E A;  3VDA A;  2OKX A;  4BJ0 A;  4AG4 A;  1GOF A;  2VZU A;  4A6O A;  3I3B A;  2QQO A;  3CDZ B;  2XON A;  2YC2 A;  1CZT A;  1W9W A;  4ZY9 A;  3K4A A;  2WAA A;  1K42 A;  3C7F A;  4E8D A;  2J1T A;  5HXM A;  3JXS A;  1I5P A;  2R7E B;  3T0B A;  4JKL A;  3A23 A;  1PMJ X;  2WYS A;  3ETP A;  4P08 A;  2E31 A;  2Y6K A;  2VCC A;  2YG0 A;  3A21 A;  4CUB A;  3WQB A;  2J7M A;  5EJZ B;  1PX4 A;  2ZEX A;  4P5Y A;  2ZEW A;  3VD9 A;  2BBA A;  2VZS A;  3HOB A;  5HPO A;  2Y6J A;  4QX1 A;  1JYX A;  2VZT A;  3NJX A;  4QAW A;  4M4R A;  2W46 A;  2YC4 A;  3E1F 1;  5DN2 A;  4BXS V;  5LA0 A;  4MOA A;  4L0P A;  4OMC A;  5B4X A;  4A44 A;  1JYW A;  5JXH A;  4IUG A;  3MUY 1;  2JD9 A;  5JUV A;  3A22 A;  2VQT A;  1US2 A;  2QQK A;  3K46 A;  1T2X A;  3FN9 A;  4MO3 M;  4LQR A;  5IJR A;  1IQD C;  1UY3 A;  4QB6 A;  5G04 L;  5JMO A;  3LPG A;  1JZ5 A;  3FL7 A;  1DLC A;  3DYO A;  5LA2 A;  2EIC A;  5C71 A;  1CZV A;  1BHG A;  3WF1 A;  3OGV A;  1XPW A;  1UXZ A;  1OD3 A;  2VTF A;  3WNM A;  1KEX A;  1JYN A;  4DXR A;  1OF4 A;  1GU3 A;  5DQ0 A;  2C26 A;  4OZO A;  3SKV A;  2E33 A;  3GGL A;  3SEP A;  2VME A;  4TTG A;  3CZU A;  3DEC A;  4CU6 A;  2V4V A;  3LPF A;  2QQM A;  5CZK A;  2VL4 A;  2J1E A;  5I0D A;  2VMD A;  4QX2 A;  4DXS A;  4ARX A;  1XNA A;  5IFP A;  4A3Z A;  3IAQ A;  1GOG A;  3CIH A;  4QX0 A;  2LW8 A;  1W0N A;  4MAD A;  4ZZ5 A;  3GDB A;  2VCA A;  3I2G A;  3U37 A;  3ACH A;  5DMY A;  2J1S A;  3C7O A;  4PQQ A;  2QQL A;  4QB2 A;  1ULP A;  4PF1 A;  2QQN A;  4OUE A;  3HNY M;  4QDQ A;  3VD7 A;  1PX3 A;  4DUW A;  2LS6 A;  2J1U A;  3J7H A;  1UY1 A;  1J84 A;  1R64 A;  3SEE A;  2BER A;  4A4A A;  2VZ1 A;  4JKM A;  3CMG A;  1JZ3 A;  2C4X A;  3A7Q A;  1UYY A;  2VZ3 A; 
#chains in the Genus database with same CATH topology
 2W95 A;  1TQ5 A;  4XIO A;  5C70 A;  2P5B A;  2W92 A;  1HDK A;  1LOB A;  4LIU A;  4Y5Z 0;  1A6C A;  1KJL A;  4BHP A;  2A3X A;  1AJK A;  4XCA A;  1R1A 3;  4LBQ B;  3AMP A;  4X6R B;  1AL2 1;  2OXB A;  4NIA A;  2ZMK A;  5FYT A;  2UY8 A;  1F15 A;  4CEY B;  5F1R A;  3CJI A;  5T5P A;  1CVN A;  2MEV 2;  2OA2 A;  3POE A;  2GH2 A;  3JCI A;  2JB8 A;  2WL1 A;  4Q4Y 2;  2A6Y A;  3VBU A;  1ZVF A;  1O8S A;  2ZKN A;  2UWB A;  5G05 L;  1OBN A;  2TEP A;  2RM2 2;  1C8M 3;  3SH5 A;  1EUU A;  3THT A;  3I59 A;  2D97 A;  2ZAH A;  4O9E A;  1WBF A;  3ZPY A;  1NY7 1;  3NV3 A;  4GAL A;  4QQP A;  5ABJ C;  5EIY B;  2FD8 A;  2DBI A;  2PLV 3;  2VUA A;  1IOA A;  2ZGQ A;  1ENR A;  4KWL A;  4LLO A;  4JCK A;  4LO8 A;  2D3R A;  4QQL A;  4TLF A;  5IVC A;  5CG8 A;  1UZW A;  5LZ6 A;  5BNQ A;  4X8N A;  1J1L A;  2BTV C;  2R07 2;  3VZJ A;  2IXK A;  5FZC A;  4OHX A;  4AFC A;  4YNI A;  2R06 2;  1DLL A;  4N7I A;  1J59 A;  3ZR5 A;  2B5H A;  1JI6 A;  1GOH A;  3PLQ A;  2PMW B;  4W4Z A;  1GQP A;  1I9R A;  4ATE A;  1BEV 2;  3D5O A;  1HXS 3;  1K5M A;  1FMD 3;  1IHM A;  1RUG 1;  3KMH A;  5FAX A;  3VBF C;  4OHY A;  5AC9 2;  5LAS A;  2OPW A;  5ISL A;  1JOP A;  1ST8 A;  5T3N A;  4AVS A;  4RR3 C;  1GWM A;  1F4A A;  3LDB A;  4OUM A;  2RJK A;  2QQU A;  1R09 2;  4GH4 B;  1H2M A;  4K1Z A;  5EZW A;  3KGL A;  3ZMO A;  1UCX A;  4GZ9 A;  4XAE A;  1KFU L;  2Y0I A;  4NHL A;  3PUQ A;  3ZSJ A;  5A3W A;  1DP0 A;  3FUO A;  2RS3 3;  1HKD A;  2V5D A;  3NJV A;  4YFZ A;  3T2P A;  3NWK A;  5FQ0 A;  1OQ1 A;  3ACG A;  5FZ8 A;  1AX2 A;  2FMY A;  2HEY F;  3BCW A;  4H2A A;  4MSV A;  4RD7 A;  1UYX A;  5FP4 A;  3KS7 A;  3IIA A;  1BCX A;  3UJQ A;  1MEC 2;  5BNO C;  3VBH C;  1PZ9 A;  2F6B A;  5IVJ A;  4I0B A;  1BMV 2;  4EN7 B;  3MFC A;  3RVH A;  1RIR A;  1W03 A;  2ZGS A;  4QPW A;  4QHO A;  5EXO A;  2YFU A;  1OHF A;  3T2T A;  4B29 A;  4CCJ A;  4CCD A;  2EID A;  3HQR A;  3USS A;  4QM8 A;  1TG7 A;  2Y33 A;  5HCA A;  3LA7 A;  4SLI A;  2ZGL A;  4IL7 A;  1ND2 C;  4QT6 A;  1H1M A;  4CVU A;  3WF4 A;  4HXC A;  3K75 B;  3LWC A;  1WZX A;  3POS A;  3MZH A;  2BW8 A;  3PTR B;  2DCJ A;  2WZR 2;  1ULO A;  4BIO A;  1RHI 2;  1H9P A;  1X33 A;  4LNV A;  3VBU B;  2YYO A;  3ZYJ B;  1OUX A;  2EXH A;  1NX9 A;  1TME 2;  2YXS A;  4P5H A;  3V56 A;  1OLM A;  1X9P A;  2C24 A;  4C90 A;  2W87 A;  4P02 B;  5FZ9 A;  4N9I A;  3O0V A;  4FPG A;  4AK3 A;  1AHS A;  1VBB 2;  4NII A;  3V0B A;  5HBA A;  1FPN 1;  3MLL A;  2YBK A;  1UZY A;  3BTX A;  1COV 3;  1FT9 A;  1W2O A;  1AJO A;  3JBG 3;  4XZU G;  4FFH A;  3KT1 A;  2DTW A;  3CQO A;  2J1A A;  5L9V A;  3ACL A;  3LEK A;  2ADD A;  3C7G A;  3P1I A;  3WNK A;  1NLQ A;  5DUU A;  4CP9 A;  3RZL A;  4C1W A;  2VVD A;  3LE0 A;  4DEV A;  2W1Q A;  3POI A;  2WFP A;  2A75 A;  4UFK A;  2Z42 A;  4XF0 A;  1NG0 A;  4BDV B;  4D69 A;  3IMN A;  2VOT A;  1GNY A;  3PUI A;  2W94 A;  5DDJ 1;  1S2K A;  4FPL A;  4IGQ A;  1JXN A;  2ARE A;  1DQ2 A;  1NAE A;  4BK4 A;  4Y5S A;  4URA A;  4LK7 A;  1H2N A;  1DGR N;  3EQE A;  5LBC A;  1PK6 A;  2UY9 A;  4XHB A;  5F6K A;  3ZXL A;  4O9G A;  3SCG A;  4PT6 A;  4DY3 A;  5FP9 A;  1OLQ A;  2GH8 A;  2VW1 A;  3P3P A;  5JXJ A;  2VE1 A;  3ZFE C;  1F8V A;  3U14 A;  4A42 A;  4FFG A;  3QAC A;  5GZG A;  2Y26 A;  1PVC 3;  1FOD 3;  2WC2 A;  1W2N A;  3KVA A;  3LFI A;  1V9U 1;  2HWF 2;  5GAL A;  1Q8Q A;  1XE0 A;  3B94 A;  3IT8 A;  4CZS A;  4PIY A;  4ZU7 A;  5LK7 B;  1MS9 A;  1W0P A;  4L99 A;  3NNF A;  2P3K A;  3SKJ E;  3PDQ A;  5A3L A;  1PZ7 A;  3ZYB A;  3J7L A;  4K9S A;  3R6S A;  3I2K A;  4LA2 A;  2ZEY A;  1F31 A;  3MIC A;  1GNH A;  2RG4 A;  1HV0 A;  3AC0 A;  5EHD A;  4CP1 A;  3SIS A;  3GBF A;  3TAY A;  2AYH A;  3WHT A;  2IXI A;  3LGR A;  4NWW A;  1CR7 A;  4XTM A;  5JLV A;  5EYX A;  1VBD 3;  2EAL A;  2WFF 1;  5FPX A;  4XUP A;  3ILF A;  4IEP A;  1DG6 A;  3VD4 A;  5FY1 A;  1W9S A;  1UYZ A;  2BNN A;  1JHJ A;  2E6V A;  3I2O A;  1J1T A;  2YUE A;  5A7N A;  2WNV C;  1QDO A;  3MIG A;  4DFS A;  1ZRI A;  5FY5 A;  4H55 A;  1XYP A;  2JDY A;  3IDB B;  4A7Y A;  2ZX2 A;  3RZJ A;  2BFU S;  4YRD A;  1URX A;  3ZXG A;  5FUI A;  4QGL A;  2CDP A;  1OUS A;  4QXH A;  3WSO A;  1QJU 1;  2WSV A;  2VC9 A;  4RFR B;  4BB3 A;  1BLZ A;  3TN9 1;  1A8D A;  1H4G A;  2GZW A;  3A0N A;  1GZW B;  1STM A;  2VXR A;  2NM1 A;  2BNO A;  4CP9 B;  4GWJ A;  1SDW A;  3NJZ A;  1EV1 1;  2B42 B;  1SFY A;  4JRL A;  3L9J T;  1MQT B;  4UFM A;  3AVR A;  4XTP A;  2OS2 A;  3H0O A;  4OCT A;  4MG2 A;  3OGJ A;  3FHI B;  4TLG A;  2YMZ A;  2Q4S A;  5JXI A;  1Y9M A;  2JDZ A;  1Q8O A;  5CIR A;  1S0B A;  1C3H A;  1KS4 A;  1QGL A;  3J4U H;  4LUK A;  1AYN 3;  4F3J A;  3D8C A;  1LNS A;  1ACC A;  3K2O A;  1UPS A;  4UI9 L;  1S0I A;  5FZA A;  5A7O A;  1DIW A;  2VCB A;  3VHP A;  1BMV 1;  5JOZ A;  4EWD A;  2P34 A;  1YQC A;  3KHC A;  1YYN A;  3T2O A;  4NHK A;  3U4S A;  1NE6 A;  1FV3 A;  2W52 A;  4Y1X A;  1OF3 A;  1UZZ A;  3NW4 A;  1W8F A;  2UWA A;  4JRA A;  2ORZ A;  2ZX0 A;  4UOJ A;  5IVV A;  1W8O A;  5KR7 A;  5IUQ A;  2ZXQ A;  2KD7 A;  5T5O A;  5C9A A;  1J83 A;  3B69 A;  5JAX A;  1F4H A;  4XQW A;  3ZSM A;  5FYI A;  3PMS A;  2HJI A;  4BME A;  5A33 A;  4N43 B;  1UY2 A;  4QDR A;  3T09 A;  1H0B A;  2B45 X;  5BUV A;  1LOF C;  2XUE A;  4UW4 A;  2D6N A;  2BU9 A;  4JV4 A;  3AZY A;  4XIL A;  1N47 A;  1FAY A;  1W8Z A;  2VW0 A;  5A80 A;  3VB9 A;  1WGP A;  1JN2 P;  4MVT A;  1SMV A;  3ABZ A;  3UET A;  2VD7 A;  3UT0 A;  5HV4 A;  3UNP A;  2BPA 2;  1LES A;  2VMC A;  4K6B A;  3POF A;  5EJ1 B;  2ZAB A;  1O6U A;  3MBW A;  4Q0U A;  2YY1 A;  5LY2 A;  4WVV A;  4YW3 A;  4K1Y A;  3NL1 A;  3ZDV A;  2YFZ A;  4BIS A;  3HPN A;  1CAX A;  3E97 A;  3ZXJ A;  1UU5 A;  3CZJ A;  1U5Z A;  2LRP A;  4MGI E;  4KL1 A;  3SMH A;  4GJZ A;  2UYA A;  4AAX A;  5IW0 A;  4FPH A;  3HNB M;  2GC1 A;  4Q4X 3;  2O14 A;  2ZX3 A;  2D6K A;  4WVM A;  5KHK A;  3RZH A;  1V0A A;  2H6B A;  1QJY 1;  2HWC 3;  2FDF A;  5IK7 A;  2QVS B;  5FY4 A;  2W3J A;  2R0F A;  4IES A;  3WDU A;  2B7Y A;  3MLK A;  4O7X A;  1L7Q A;  1NQJ A;  1W99 A;  4S2F A;  4XUQ A;  2WZP P;  3TEX A;  1OC1 A;  1AYM 2;  1RUF 3;  3DGT A;  2HWB 3;  2RR1 3;  3THP A;  5CA6 A;  2L9L A;  1W9F A;  4AEK A;  1S0F A;  5IYY A;  1UXX X;  1LEN A;  4YW6 A;  1SFP A;  3VGI A;  2BGO A;  3AZW A;  4ZS2 A;  2R32 A;  5LBF A;  3MV1 1;  3OBA A;  4CDW B;  4M0N A;  4B1L A;  2WO3 A;  2XJT A;  3KV6 A;  3GHN A;  3CJI C;  4BQ4 A;  1GWL A;  4AQ6 A;  2J1V A;  4QDS A;  1UF2 C;  5A6Z A;  2FCT A;  2WAB A;  1CON A;  2WO1 A;  1OPM A;  1VBE 2;  3QH6 A;  4KU8 A;  3WCS A;  4IEQ A;  3VHN A;  1NQD A;  3AMH A;  1M4W A;  4EN9 B;  4TYS A;  4WM7 C;  1N1S A;  2VZU A;  4A6O A;  1RMU 1;  4AGG A;  3H7J A;  3QBQ A;  1BJQ A;  1OLR A;  1VAL A;  2QQO A;  4RS5 A;  1GAN A;  3WP5 A;  1CGP A;  2HWE 3;  2ARB A;  2XON A;  3AZV A;  1AR7 1;  2YC2 A;  3ZFG C;  5CG9 A;  3K4A A;  4JGZ C;  2R49 A;  3C7F A;  5C9A B;  1HRI 3;  4EE2 A;  2IC1 A;  3RPQ A;  4CEW A;  1WMF A;  4B1M A;  4E9K A;  1V6L A;  3PUA A;  4RHV 3;  3RJ2 X;  2HWD 1;  4EN6 B;  1NCR A;  5JPN B;  3A23 A;  2WYS A;  2JEN A;  3ETP A;  4F8A A;  3K3N A;  1K5M C;  3APB A;  5GZC A;  3Q8F A;  2J7M A;  1RUJ 3;  2FCU A;  2ZTN A;  4K21 A;  4UFJ A;  1CPM A;  3JB4 C;  4Y20 A;  2ZEX A;  5IWF A;  1Z7S 3;  5C3P A;  3WW4 A;  4CDQ C;  2XLF A;  3QOP A;  2JJ6 A;  5JI7 A;  2BBA A;  5FY7 A;  4IEX A;  3HOB A;  1YCI A;  2GNM A;  3FZ3 A;  3S57 A;  4AFB A;  3HAG A;  1Q3E A;  3H1M A;  3AVS A;  2RMU 3;  4DS0 A;  4XAB A;  5FMO S;  4AEJ A;  2PHX A;  2XJV A;  3LOI A;  4MET A;  4R8H A;  4DNY A;  2QDR A;  3NJX A;  4QAW A;  5ABJ A;  3E1F 1;  2YC4 A;  5DN2 A;  1PO2 1;  1B35 A;  1XB9 A;  2VY0 A;  2YPD A;  4UXA A;  3TYJ A;  2RJL A;  5LA0 A;  1AL0 G;  1VAM A;  4L0P A;  5KXC A;  4GUL A;  1RUD 3;  1D4M 1;  1RUE 3;  4PLM A;  3RWK X;  5A3P A;  2FZ2 A;  5FY9 A;  2D40 A;  4Y26 A;  3CF6 E;  3O14 A;  3H9A A;  2JG9 B;  4AAP A;  4AI1 A;  4EQV A;  2XG3 A;  1N3O A;  1AR8 3;  3CL1 A;  2OVU A;  3A22 A;  3VKO A;  5KXE A;  2VQT A;  1US2 A;  4MX3 A;  5C8C C;  3C3V A;  3HIF A;  5GZE A;  4OFG A;  4MGT A;  1POV 3;  5FUP A;  4QPG C;  3GJB A;  5CU1 A;  2P4E A;  3VBF A;  5IJR A;  1NYW A;  3NNM A;  1QJF A;  2BRT A;  4LOS A;  1W6P A;  2JKB A;  4RR3 A;  5J09 A;  2KR2 A;  1FI2 A;  2QJV A;  4JVA A;  3VV1 A;  1W28 A;  1VMF A;  3DYO A;  1AL2 3;  5LA2 A;  2D98 A;  3VBR A;  5ACA 2;  3GAL A;  5C3R A;  1CZV A;  4FT8 A;  1Y3T A;  2D5H A;  2DUO A;  5A3N A;  2AH2 A;  1BHG A;  4IE4 A;  1ZRC A;  1XPW A;  2JE7 A;  5KHG A;  2R1B A;  2XBO 2;  2RS1 1;  3KT7 A;  3L2H A;  3UJO A;  2D3P A;  4EJR A;  4NO4 A;  3SEP A;  1ZNP A;  3VZL A;  4RS5 B;  5BNO A;  4UBH A;  1BVV A;  3VBH A;  3WP4 A;  2DFC A;  1N1T A;  3AM2 A;  2DFB A;  4DOU A;  5GZF A;  1RUI 3;  4I30 A;  3HT1 A;  4BQY A;  1ZZB A;  4Z2W A;  5CZK A;  1AR9 1;  1JUI A;  2J1E A;  3B9I A;  5FPU A;  5JI9 A;  2XVG A;  4I0A A;  1QJZ A;  1VBC 1;  1DZT A;  5HXV A;  4JHT A;  4EN0 A;  3G7D A;  1AXZ A;  1LOD A;  2EVX A;  1VAK A;  3DXU A;  4COZ A;  5GLZ A;  3TOJ A;  5IAV A;  4FFF A;  4ZU4 A;  4QKD A;  2RDS A;  3ORJ A;  1RUG 3;  1W6M B;  2GAL A;  3CIH A;  2GN3 A;  4P9X A;  4Y20 B;  3UV9 A;  4XDP A;  3WDX A;  1WA6 X;  4B4P A;  1PK6 C;  1QNW A;  4HK9 A;  5L73 A;  1V6K A;  1QJX 1;  3U37 A;  1DGL A;  4P9L A;  4QHZ A;  2UU8 A;  4N53 C;  3JD7 1;  1LEC A;  4COW A;  1DQ6 A;  1QIQ A;  5DMY A;  4YM3 A;  5FZB A;  4LEJ A;  5ABJ B;  4Y1Y A;  4AL9 A;  1LR5 A;  5FPV A;  1ZBE 2;  2A3W A;  3POY A;  5FZH A;  3MIH A;  3R05 A;  3ZSK A;  2CSG A;  3RJR A;  5JOX A;  1PGW 1;  2QQN A;  2XGX A;  4GA9 A;  5FBJ A;  2WA4 A;  4NPL A;  4QDQ A;  4P9G A;  3VD7 A;  1SLB A;  2LS6 A;  1GP5 A;  2RDR A;  1RUH 1;  5KWR A;  1UY1 A;  2A6X A;  2JXA A;  3I3Q A;  2CGP A;  4BIF A;  1GQH A;  1JOB A;  2CU5 A;  2DU0 A;  1UU6 A;  4V1P A;  3ZR6 A;  5C3S A;  3VBF B;  5CFC C;  4JKM A;  4QXC A;  5FRE A;  2BFU L;  1W6P B;  1J58 A;  1W90 A;  2H0V A;  3BTY A;  2OZJ A;  4GKX A;  5DZF A;  2X10 A;  4HSJ A;  4FTB A;  5GLW A;  4ERO A;  2LM3 A;  3ZFE A;  3H1Y A;  3ZYP A;  4QPY A;  3BKZ A;  4HN1 A;  4AHX A;  4LHK A;  4XBL A;  4XFB A;  1AUY A;  2LUW A;  2QUO A;  4CE8 A;  4E8C A;  3C7E A;  4D8M A;  2V4A A;  2XJQ A;  3PVE A;  4IV3 C;  4JTN A;  3V0A A;  3N9Q A;  1ENX A;  1PIV 1;  1RJ7 A;  1XE8 A;  1F35 A;  2WS9 1;  3UYJ A;  4W8J A;  2HYX A;  3OYW B;  1FPN 3;  1XXN A;  2WO2 A;  3RDI A;  1G9C A;  1JMU B;  1O3R A;  1VB2 A;  2XR4 A;  3VBH B;  5F8P A;  5BNO B;  2NYY A;  1ULF A;  4Q4W 1;  3OBZ A;  3H3U A;  4UW3 A;  1FV2 A;  3WUC A;  4AI9 A;  1ZBA 1;  4XZP A;  4YW2 A;  3I2I A;  2GP3 A;  1VJ2 A;  1PO1 2;  4NHY A;  2DDU A;  1V6N A;  4EZH A;  4NE9 A;  5FP8 A;  1ND2 B;  3BTA A;  1JZ2 A;  3LEI A;  5EWS A;  3LCP A;  4ZXE A;  2PHL A;  4CPB D;  1MS8 A;  3KM5 A;  5DDJ 3;  3BOP A;  4WM8 A;  3N35 A;  5FMC A;  4IND A;  1ZZC A;  2ZGN A;  1PZ8 A;  4R52 A;  5FO8 B;  4LLF A;  3IDC B;  3T1L A;  3RZG A;  5A3T A;  3C8X A;  1F2N A;  4UW5 A;  5FO9 B;  5FP7 A;  1G9A A;  4HZF A;  2YPJ A;  4MGQ A;  4P14 A;  4Q8K A;  1EAH 1;  3D82 A;  1R08 1;  2ZHN A;  4J6G A;  1OMI A;  2GMM A;  1IG3 A;  4J1X A;  2E32 A;  4L11 A;  4OMD A;  4RYD A;  4CCK A;  1QQP 2;  1BQP A;  3AKT A;  5AFE A;  4BXF A;  2C9K A;  1V9U 3;  3E6B A;  5LBE A;  3RYR A;  2VZR A;  3ZIX A;  2R30 A;  3OG2 A;  2Q30 A;  4YW1 A;  4D3W A;  4LKS A;  1LRH A;  1OUR A;  1W3X A;  1XYN A;  2R1D A;  4GMP 1;  4R9C A;  1C5I A;  5J48 A;  4BQ1 A;  1MS3 A;  1NLR A;  1WLC A;  4ZU5 A;  1LHV A;  4BQW A;  3I2J A;  4BU2 A;  3VD5 A;  3HBZ A;  1YHF A;  4COU A;  1DZR A;  2GC2 A;  1O4T A;  3GHM A;  5F5A A;  5FUN A;  2IXJ A;  2YV8 A;  3IDE A;  5FXZ A;  5F7U A;  2WFF 3;  2LAL A;  4PCR A;  4ZXK A;  5FR3 A;  3ENR A;  4ASK A;  3KWV A;  2JEC A;  3WV6 A;  4DQA A;  1WLW A;  2O1Q A;  3VD3 A;  2IVJ A;  3ZFE B;  1GLH A;  4Y22 B;  1UOJ A;  3PIJ A;  5FFO C;  3O1R A;  2ZBJ A;  3SH3 A;  2GC3 A;  1GZT A;  1XYO A;  5DUW A;  3KHB A;  2CDO A;  1H8V A;  1S0D A;  2NMO A;  2K2S A;  2XML A;  3J8F 2;  4NPM A;  2AUY A;  1CPN A;  5FJH A;  3ES1 A;  1QJU 3;  2HBU A;  5FZ0 A;  3TN9 3;  3ZYG A;  1IQA A;  2OPK A;  2DYC A;  5CB7 A;  1CIY A;  1LB2 A;  1DDL A;  3HNM A;  1KGY A;  1YLL A;  2QFE A;  3IN9 A;  1HRV 1;  1ULD A;  2C9A A;  1D4V B;  4XF9 A;  1WCQ A;  3H8O A;  1V6M A;  4H3W A;  1QKQ A;  1EV1 3;  1LOF A;  1PGS A;  5IVF A;  4YW5 A;  1VRH 1;  2NMN A;  3S5Q A;  3ACF A;  3FLT A;  5CFD C;  4CDU C;  3S6P A;  5EJ3 A;  3DKQ A;  4LO5 B;  1X82 A;  2VEC A;  1UY0 A;  4XUN A;  3CHX A;  4N8M A;  4QU1 A;  3OGR A;  3UES A;  3T1M A;  4GB3 2;  5J1X A;  3O1S A;  1HQN A;  1Q8V A;  2B46 X;  1UZ0 A;  2DCZ A;  2WNV B;  4AFM A;  2W68 A;  1BBT 1;  4DXT A;  2A71 A;  3T3Y A;  3ATG A;  4IEW A;  3LSE A;  1PVX A;  4RGK A;  3C2U A;  1AR6 1;  3AK0 A;  4YZ1 A;  4P9Y A;  4YFW A;  2HH9 A;  1ZYB A;  4IE6 A;  2QE3 A;  5JIA A;  3ILN A;  2WO7 A;  1D2Q A;  1GZ9 A;  4BOW A;  2R04 2;  1T6B X;  3D6E A;  3Q9O A;  4CEW C;  1WME A;  1LGN A;  1UWW A;  4GIQ A;  1VE0 A;  4NMI A;  3VBS C;  4AVB A;  5C5U A;  2DU1 A;  3LSD A;  4E2S A;  1NCR C;  4HK8 A;  3A0K A;  3L2Y A;  3AYD A;  4HET A;  3LF7 A;  5FMO L;  1OVS A;  4XVH A;  1W39 A;  4HVR A;  3WHU A;  2RS5 2;  3VDD C;  1YIP A;  3WOG A;  1UIK A;  1V70 A;  2CAU A;  2DVD A;  3N36 A;  4IE5 A;  1UMI A;  1R1A 2;  2EIB A;  2GN7 A;  2XJR A;  4OVE A;  5HV0 A;  5A7S A;  1M06 G;  2VU9 A;  3BIW E;  1JW6 A;  4WM7 A;  5DAQ A;  3MW3 A;  1U5I A;  1ASJ 1;  2HYK A;  2WR9 A;  3HBK A;  4URT A;  2JDU A;  1YFW A;  4NAO A;  4O61 A;  5FKC A;  3W9A A;  1B35 C;  3O1U A;  3T0D A;  4DXZ A;  2VUJ A;  3ZFG A;  1N1V A;  1C8M 2;  4JGZ A;  4RA0 A;  4AHW A;  3BGA A;  4F7Z A;  1VBA 3;  5IVY A;  1BK0 A;  1SG3 A;  2WIN B;  3OGS A;  4Q4V 1;  4A6S A;  1TVG A;  5I91 A;  2P3I A;  5I8S A;  4XF4 A;  3N3H A;  3WNX A;  1QJY 3;  3CKH A;  2PLV 2;  1GV9 A;  1TMF 1;  3U78 A;  4OUS A;  3ZN4 A;  3ZN6 B;  1U5X A;  1VBA 2;  1XSR A;  3J26 N;  2RJ2 A;  4OI1 A;  4AVC A;  1DQ4 A;  3KV5 A;  3KT4 A;  1YFU A;  1U12 A;  4C8D A;  4NOT A;  3WX5 A;  2WLQ A;  4YZ3 A;  1YEW A;  4EZ4 A;  4CDQ A;  2C6S A;  2ZGP A;  2B9V A;  2PA7 A;  3M1H A;  4U36 A;  5FMD A;  1HXS 2;  1VP6 A;  1FMD 2;  2D6O X;  3VBR C;  4G9S B;  1QOO A;  3UKT A;  2VOW A;  1NA1 A;  1KDM A;  2Y6G A;  4L8Q A;  1RGS A;  5FLH A;  3VZK A;  1EP0 A;  1IPJ A;  4YZ5 A;  4I0W B;  1KDK A;  4B7E A;  1HV1 A;  1ZA4 A;  3KD4 A;  5BNP B;  5AVA A;  1IS6 A;  3AP6 A;  3O12 A;  4YW7 A;  5C6C A;  2IVI B;  2QNK A;  1XNC A;  4OQ8 A;  4S2G A;  4UW6 A;  4QX5 A;  5HI0 A;  1RMU 3;  2H6C A;  2RS3 2;  3FHA A;  3OJB A;  2P6H A;  1K12 A;  4YZ4 A;  1QNY A;  1MZ6 A;  1ZA7 A;  2AC1 A;  4DUX A;  2GU9 A;  4DUV A;  1G9B A;  1EUT A;  5A1A A;  1AR7 3;  3R4U A;  2MPF A;  2WZE A;  4XYX A;  5C8C A;  1UMZ A;  2PAM A;  2WQZ C;  4QPG A;  1W9Y A;  2AEZ A;  2VQU A;  3MHZ A;  1W2T A;  5LAT A;  3RQ0 A;  3B9C A;  4KWK A;  3TWI A;  1S0J A;  2HWD 3;  1UMH A;  3ELN A;  1RC6 A;  2E53 A;  3VL9 A;  4BZ4 A;  4DRR A;  5I0R A;  1POV 0;  1OPO A;  4D6Q A;  5FPL A;  1WMX A;  2ZOE B;  5T50 A;  2EXK A;  4ASL A;  2XJU A;  3CJI B;  3BTZ A;  1SLT A;  4XMI A;  3O5S A;  5IHR A;  1APN A;  4ITC A;  2KA3 A;  2XDV A;  3R4D B;  1RJ8 A;  1GZC A;  4QKF A;  3ZDS A;  2X09 A;  3AL5 A;  2DUP A;  2W47 A;  4WM7 B;  3ZO0 B;  3I59 B;  5KBF A;  1ZRD A;  2XXZ A;  2VUC A;  3K4D A;  1PO2 3;  2OQ6 A;  4LTA A;  3E5U A;  2WNU C;  3ZFG B;  4JGZ B;  2IUW A;  5EPA A;  3KSC A;  3ZOI A;  2X8K A;  5F5C A;  1D4M 3;  2ES3 A;  2VTX J;  3D0S A;  4Z2A A;  1COV 2;  2ZHK A;  3JB8 A;  4N90 A;  3JBG 2;  3NST A;  3RYK A;  4Q8L A;  4YGB A;  1GSL A;  1POQ A;  1XU1 A;  1IKQ A;  3Q8C A;  3UK9 A;  1SPP A;  1K5M B;  4M00 A;  5K8S A;  3OF1 A;  1JZ7 A;  5BYN A;  1PGL 1;  4XAA A;  3WEZ A;  4AE2 A;  2Y8K A;  5FOB B;  5GLU A;  4AOC A;  4CSW A;  4CDQ B;  1MVE A;  1US3 A;  2Q8C A;  4LO7 A;  3FBM A;  1RUC 1;  4R9B A;  1OQD A;  2ZZQ A;  4N53 A;  4HVQ A;  3CLP A;  3N7K A;  3B3Q E;  4XUO A;  1OT5 A;  1HN1 A;  2CGN A;  2Y60 A;  5ERL A;  1SLI A;  5FQ0 B;  3H8U A;  5J98 B;  3UKN A;  2RS1 3;  3NQH A;  4E4Z A;  2WN2 A;  4FAH A;  4J25 A;  5CBL A;  4C91 A;  1L7R A;  1PVC 2;  2CNA A;  4QWN A;  1FOD 2;  4AI3 A;  4M0H A;  3AKP A;  4LBO A;  1UO9 A;  1GOF A;  1YQ5 A;  2NP0 A;  4JQR A;  4JAA A;  5C8C B;  4CYD A;  4PIZ A;  3WP6 A;  4QPG B;  5JWP A;  1TNF A;  2P2K A;  1X8M A;  5I8Y A;  2P17 A;  1AR9 3;  5LK5 A;  2E7A A;  5FYH A;  1V6I A;  3PHM A;  1VBC 3;  4W6X A;  3CJX A;  4XJA A;  2Q8D A;  5FZI A;  4A7K A;  4KGG A;  1IGO A;  5A32 A;  1GWK A;  3MPP G;  1ULG A;  2J1T A;  2XLA A;  3WW2 A;  3JXS A;  5HXM A;  4WM8 C;  4BLJ A;  4CUG A;  3T0B A;  4IER A;  4JKL A;  4YVW C;  1PMJ X;  1VBD 2;  1QXP A;  4BQ2 A;  2E31 A;  1QJX 3;  4DMI A;  4CUB A;  1JTZ X;  5JSR A;  3NMB A;  3BU7 A;  4QGM A;  3JD7 3;  4IV3 A;  1RVF 1;  4P5Y A;  3V0B B;  2VZS A;  1IPS A;  2XQR A;  2ZJC A;  3VHO A;  3I49 A;  1ZRR A;  2G9G A;  2Y6J A;  4NHM A;  3AZZ A;  4SBV A;  4DIN B;  1X9T A;  4GQ7 A;  2VOX A;  3VKL A;  2VZT A;  4IGP A;  2PAE A;  4M4R A;  2PN5 A;  4YSF A;  5CEH A;  5A3U A;  3POB A;  1RUH 3;  4V2W A;  4UWD A;  2CHH A;  4I02 A;  2V73 A;  3NAP C;  2TNF A;  1OKQ A;  2GND A;  4Q29 A;  2KXL A;  4ISR A;  1AXY A;  4I09 A;  4IUG A;  4AVA A;  2QQK A;  3WR0 A;  3K46 A;  5C5T A;  1PK6 B;  4M3C A;  1NZC A;  2V09 A;  4A3X A;  3FN9 A;  2FZ1 A;  5JVV A;  3NV1 A;  4MO3 M;  4NID A;  3WD5 A;  1AYN 2;  1UY3 A;  1G9F A;  3N7L A;  5A7P A;  1Z78 A;  1SQ4 A;  4N53 B;  5T5J A;  4AFD A;  4EYU A;  5FWJ A;  1PHM A;  3F95 A;  3UKV A;  3EXU A;  1DLC A;  2Z79 A;  5L9B A;  4LKF A;  3LZZ A;  3PTY A;  5DZE A;  1PIV 3;  2WS9 3;  2DV9 A;  1UKR A;  3OGV A;  5ANQ A;  1UXZ A;  3RZZ A;  3Q8A A;  1JYN A;  1FX5 A;  3M3O A;  4Q4W 3;  4FQZ A;  1UX6 A;  1GU3 A;  2SBA A;  1H1I A;  1MS1 A;  5FKB A;  4OHZ A;  5DQ0 A;  4D6S A;  3O1P A;  5BXX A;  3ZYI B;  2D93 A;  4IE7 A;  1ZBA 3;  4HMZ A;  3I7D A;  3KQ4 B;  4LOR A;  3HVD A;  4TTG A;  3GBG A;  3DEC A;  2OUJ A;  5L19 A;  3AJZ A;  5FYY A;  4BPZ A;  2VUL A;  5DG1 A;  3A4U A;  2VBB A;  1O3Q A;  5JSO A;  2WT1 A;  2VL4 A;  5FYU A;  2YRO A;  4XFC A;  2CGO A;  1K5J A;  4LIT A;  3ILR A;  5A32 B;  1S0E A;  3TEY A;  3BU0 A;  4P9W A;  2VMD A;  1QF3 A;  4DXS A;  3P3N A;  3QLQ A;  4RGG A;  2MEV 1;  4LXL A;  5FMB A;  3SC7 X;  4OI0 A;  4Q4Y 1;  4IQP A;  4WZC A;  1GOG A;  4FXK B;  3ZKU A;  2LW8 A;  4GD4 A;  4V2V A;  1W0N A;  4MAD A;  1CAV A;  1VMJ A;  1EAH 3;  2RM2 1;  3IWZ A;  4IV3 B;  3AL6 A;  1R08 3;  4CXY A;  3BIE A;  4FPC A;  3GJA A;  3I2G A;  4NAM A;  1LHU A;  3CO2 A;  3D4K A;  2WWS A;  4Q4X 2;  3S0M A;  3KZ4 C;  4K20 A;  2D3S A;  3RRD A;  5A6X A;  2WKK A;  2R07 1;  1RUN A;  5IAT A;  2HWC 2;  3KV4 A;  1AX0 A;  4GMP 3;  3PME A;  2R06 1;  1OFN A;  1VIW B;  1VPH A;  3BPZ A;  1QMJ A;  4PF1 A;  5CFD A;  1GNZ A;  4OUE A;  4QKB A;  4N9H A;  4LUM A;  2H0B A;  4CDU A;  1BEV 1;  1RUF 2;  2XJS A;  1O5U A;  2HWB 2;  1PX3 A;  2RR1 2;  3HNY M;  4NVP A;  4AXO A;  1LJ7 A;  4PDW A;  4XMA A;  3LIH A;  4HL0 A;  4OZX A;  5AC9 1;  2QCS B;  1WLT A;  3K48 A;  1J84 A;  2NPI A;  3RS6 A;  5H9P A;  4FO9 A;  4FOQ A;  4M3C B;  2VAU A;  3AJY A;  1W04 A;  1PNG A;  2KM2 A;  1R09 1;  2TUN A;  4E4S A;  1YNA A;  3HWJ A;  4KNC A;  5EFU A;  1YIF A;  2AZ5 A;  4FPY A;  4O65 A;  4YG3 A;  2WII B;  3CMG A;  1G7Y A;  3WZ1 A;  2G9F A;  4BWO A;  1VMH A;  3A7Q A;  3WVJ A;  3OD0 A;  1UYY A;  5FZ4 A;  2VZ3 A;  5KXB A;  2PFW A;  4UFI A;  1C1F A;  1H2L A;  4XBQ A;  5A1F A;  5F32 A;  5EQU A;  4NPR A;  2BWC A;  4FQ4 A;  4FPO B;  2YB7 A;  2BGP A;  3MDP A;  1G6N A;  4XXA A;  3DKW A;  1W9T A;  3VBS A;  2HWE 2;  2DCY A;  3MPB A;  2O8Q A;  1MEC 1;  1PMI A;  5JZG C;  2NZ9 A;  4CU8 A;  5CVR A;  4MLO A;  1VR3 A;  2Y34 A;  5A33 B;  3AP7 A;  1ZX5 A;  1HRI 2;  3WNN A;  1HRV 3;  1OLM E;  3M2M A;  4D7Y A;  2WZ8 A;  4UFL A;  4RHV 2;  2VNV A;  5F3E A;  3VDD A;  2JX9 A;  3K51 A;  4DO0 A;  5LRS A;  4XHX A;  1VRH 3;  1D7P M;  1O8P A;  5FZM A;  3WCR A;  5FYC A;  1RUJ 2;  4JDN A;  1H9W A;  2ZKL A;  1NA1 C;  3T2Q A;  5GZD A;  5FY0 A;  1T6G C;  1Z7S 2;  4YM2 A;  1CJD A;  1FNY A;  2BZD A;  3VDB A;  2QQI A;  3OY8 A;  4AW7 A;  4R4Z A;  1YI7 A;  3WQ0 A;  1Q5O A;  3EMR A;  3PIG A;  5FXW A;  4RN5 A;  1H4H A;  2WZR 1;  1CAX B;  4HN0 A;  3GM8 A;  1RHI 1;  4K40 A;  1JYI A;  4BCU A;  1QOS A;  2PHF A;  1BBT 3;  5C4W C;  2RMU 2;  4IEO A;  4JZR A;  2RV9 A;  5F39 A;  1TME 1;  2ZGR A;  1YQ6 A;  4FOW A;  1SCS A;  1MZF A;  2LTN A;  2AGS A;  2VM9 A;  1CIW A;  1DFQ A;  2W1W A;  3ECQ A;  3IKW A;  3LEM A;  4WVM B;  1AR6 3;  1J3Q A;  1VBB 1;  3Q8B A;  1HB1 A;  3TNQ A;  3WNO A;  3F2Z A;  1CN1 A;  4ZHN A;  2Q8O A;  1YI9 A;  2AEY A;  4RSU A;  1W2U A;  4BM8 A;  1RUD 2;  3VBO C;  1RUE 2;  1GR3 A;  4ONU A;  2YC0 A;  2IXH A;  1AF9 A;  4KGQ A;  2ATF A;  4I01 A;  4NUB A;  3U1X A;  2ZEZ A;  5I93 A;  1AR8 2;  2FCV A;  2OT7 A;  2UWC A;  3I54 A;  3M7A A;  5HCF A;  4CDX C;  4ZKT B;  5KC6 A;  5IK5 A;  5CFD B;  2ID4 A;  3RZK A;  2B4K A;  1XQN A;  3N7J A;  1A8M A;  1F5J A;  4LBK A;  1O4Z A;  5C3O A;  2AEN A;  1RED A;  4JC1 A;  2JG8 C;  3O1T A;  3PVB B;  1PM4 A;  1BK1 A;  1W8T A;  1W8N A;  1I1E A;  1GIC A;  1SCR A;  2Y6L A;  3E6C C;  1REE A;  1SZB A;  3VDC A;  2FBE A;  5LEK A;  4KU7 A;  1AL2 2;  3NRU A;  2D6L X;  3NNL A;  4IGO A;  3THD A;  1VLN A;  3GZA A;  2ZS6 B;  4KWU A;  2WUH A;  3IMM A;  1ASJ 3;  2DCK A;  3IDA A;  1W6Q A;  1H8T A;  4PIX A;  4BK5 A;  2JIJ A;  2WRA A;  2XWJ B;  3DYP A;  4IEU A;  3ZIW A;  5T55 A;  2VXJ A;  2WQ4 A;  3DXT A;  2HWF 1;  1LOA A;  4Q4V 3;  2VZP A;  3HQX A;  3S7I A;  1NY7 2;  4CEW B;  4ES9 A;  3I4I A;  3VBS B;  2JE8 A;  4YGE A;  4UBG A;  1TMF 3;  4D7S A;  1NCR B;  3OEB A;  3ST7 A;  2ET1 A;  1OXC A;  2X05 A;  1RUI 2;  5FIX A;  4AF9 A;  4MGY E;  3PU8 A;  3B00 A;  5J3U A;  4ARY A;  3UL2 A;  2R6Q A;  2X5I A;  3IBM A;  4H7L A;  5FZL A;  1HJF A;  3U07 A;  3WF3 A;  4KG0 A;  4RFT 0;  5T5L A;  5E1R A;  3VDD B;  5F3C A;  1CX4 A;  3JQW A;  3LDR A;  5KHI A;  5FZ6 A;  1CAW A;  5FZD A;  2R16 A;  3SNM A;  5DAV A;  1NOV A;  1XNT A;  1RUG 2;  3J9S A;  5CNA A;  1MR5 A;  2P3J A;  2R0H A;  3TRS B;  5E6H A;  1B09 A;  2BNM A;  4Q1R A;  1X8E A;  3TBD A;  2GAU A;  4YGD A;  3SH4 A;  4BQX A;  2JDN A;  3H3L A;  2TBV A;  1B35 B;  1XSQ A;  2VNG A;  4FPF A;  3AFG A;  1TNR A;  4AQT A;  2WNU A;  2DVB A;  4IE0 A;  2ET7 A;  4PF5 A;  2XL7 A;  2J22 A;  1MS0 A;  5C7G A;  2WSU A;  1GUI A;  1DYK A;  1UL9 A;  2IWG B;  4Z1V A;  5GM0 A;  3DPR C;  1OH3 A;  3JU9 A;  2VOK A;  1GP6 A;  5JOW A;  3SCF A;  1C5H A;  4XEZ A;  5LA1 A;  1H2K A;  5FTT C;  4HFS A;  1NKG A;  1W8H A;  3EYP A;  2XOM A;  2A70 A;  4GJY A;  5FK7 A;  4GXL A;  1U5Y A;  3RYP A;  1OOP C;  3U10 A;  4RR3 B;  3W21 A;  5LEJ A;  2V72 A;  2JE9 A;  4HBN A;  3I2D A;  1O7F A;  4MHR A;  1QY4 A;  4UF0 A;  2K46 A;  2UUR A;  5H9R A;  2W0X A;  3MO4 A;  1ND3 C;  4HVO A;  3VBR B;  1RL3 A;  3ETQ A;  1C28 A;  4AVV A;  1JYV A;  3S5A A;  3BVC A;  2YGM A;  4PI2 A;  5F5I A;  3HJR A;  3DYM A;  3AKQ A;  4XXP A;  2B9U A;  1JU4 A;  2G1M A;  4FP2 A;  3DN7 A;  3FBY A;  3OSD A;  4XE9 A;  4YG6 A;  3O7O A;  5LB6 A;  4RQP C;  2OII A;  4UT5 A;  4M3C F;  1W6Q B;  3VKN A;  4QM9 A;  1QJE A;  1K45 A;  1UX7 A;  3ZXA C;  3FHQ A;  1E5I A;  3ME2 A;  3BOW A;  5L7O A;  3MIB A;  2MNG A;  3D3A A;  1NXM A;  1FPN 2;  3AYA A;  3UGF A;  3ZPO A;  1OD5 A;  4K8F A;  5E88 A;  1X36 A;  3E5X A;  5GLV A;  1TE1 B;  1W8W A;  3FX3 A;  4ISQ A;  5K0U C;  1LED A;  2W08 A;  1UW8 A;  2BUK A;  2OQ7 A;  4KG8 A;  4A41 A;  2CY6 A;  1YXW A;  4FI9 A;  2ZZJ A;  4R9A A;  4YVW A;  5FYZ A;  3WXP A;  3GCX A;  5FDB A;  1YC6 1;  4KH9 A;  4COY A;  2BWA A;  4IV1 A;  2VNO A;  1CAW B;  4Z92 B;  1DGR A;  3X29 B;  1RUC 3;  4LHL A;  4S2H A;  5FPA A;  5DDJ 2;  4OHW A;  1JUH A;  3HN3 A;  5FK8 A;  2F17 A;  3RG0 A;  4BQ5 A;  1XOY A;  4NR1 A;  1A3K A;  2ZPX A;  5B4N A;  5EV7 A;  1HB4 A;  3THC A;  5C33 A;  3MYX A;  3ZKY A;  2WNU B;  2XHN A;  2CV6 A;  4CCO A;  3VN4 A;  3LQC A;  1HB2 A;  3I3D A;  1WW4 A;  4JDM A;  3S7E A;  5CIS A;  1DCS A;  5IK8 A;  2EA7 A;  5APA A;  1YRZ A;  4JQT A;  1V6O A;  1V9U 2;  4J1W A;  4PHZ A;  1JBC A;  4BLI A;  1DGW X;  3NAP A;  3OUJ A;  1AYM 1;  4AFA A;  4LBM A;  3M8L A;  2WNO A;  4HKW A;  4MXW A;  1O4Y A;  1H6Y A;  2VNR A;  3MW4 A;  4H14 A;  4LBN A;  1ZZ6 A;  3U4X A;  2D7F A;  3GNE A;  4Z07 A;  3ACI A;  3ZYH A;  4CTE A;  1P8J A;  2XJP A;  4UF0 B;  4CCN A;  2JDA A;  4HG6 B;  4EWA A;  1WMD A;  3ZVX A;  3O0X A;  1OH4 A;  4XDO A;  5ANN A;  3VHR A;  4E2Q A;  2WFF 2;  2DCT A;  1O3T A;  1VBE 1;  3BN6 A;  2W91 A;  4LBQ A;  3DV8 A;  1JZ4 A;  1DHK B;  5IT6 A;  2YDE A;  3GZT B;  1YO8 A;  5K9Y A;  3V0A B;  4C0B A;  1RVF 3;  2A3Y A;  2ZX1 A;  4AHZ A;  5A3M A;  1WBL A;  3KF3 A;  5FYB A;  2HEW F;  2ZAC A;  3WDY A;  3ASI A;  5DUX A;  4FAG A;  1N3Q A;  2CWM A;  1GQG A;  2HKX A;  3WF2 A;  2ZGT A;  3T4V A;  1QJU 2;  1WCU A;  4FXG B;  3TN9 2;  1RXF A;  1GMM A;  4JHZ A;  3MID A;  4CCM A;  3VZN A;  4CU7 A;  3USU A;  2A1X A;  4FPK A;  1ULC A;  5DAB A;  1I3H A;  5A6Y A;  2VJX A;  1LU2 A;  3O0W A;  4LA3 A;  4PDW C;  3W20 A;  3ZXD A;  1EV1 2;  4WM8 B;  2RDQ A;  1ONA A;  1UPI A;  4OLL A;  4Z8B A;  4YVW B;  1BZW A;  1LHO A;  3OBT A;  3POW A;  5JCT A;  4YVS C;  2E51 A;  4FBF A;  2PEL A;  5T54 A;  1LCL A;  1RYY A;  4XUT A;  2DVG A;  5JXG A;  2HBT A;  4NRO A;  5D2A A;  5C3Q A;  3EO6 A;  4RGA A;  4AED C;  3T0A A;  1QH7 A;  3BUC A;  2IXL A;  2Q1Z B;  2SLI A;  2W1S A;  4C0H A;  2P37 A;  3PUS A;  4QX7 A;  4FTS A;  1SBE A;  4K7J A;  1TEI A;  4WVW A;  3QD6 A;  4TXW A;  4QQ2 A;  3N9O A;  3NKT A;  2ERF A;  1WKY A;  3ZN5 A;  1UY4 A;  4XAC A;  2D6M A;  4UFH A;  1F9K A;  3IZO A;  2WLP A;  3U11 A;  4XDQ A;  3W5N A;  4MGS A;  2BVV A;  5JOY A;  3MV0 1;  3FUQ A;  2VOV A;  3NAP B;  1QDC A;  3VDA A;  1XNK A;  2OKX A;  3J7N A;  4BJ0 A;  2BOJ A;  3BPS A;  2VH9 A;  4FOV A;  2PHR A;  1YFY A;  2EF6 A;  4MXW B;  3ZSE A;  2VMH A;  5D8A C;  1EY2 A;  5M0T A;  5L36 A;  3UGG A;  1WCD J;  3CDZ B;  4ES8 A;  4MYE A;  1IPK A;  5ACA 1;  1W9W A;  4ZY9 A;  1HIX A;  1DU3 D;  2WAA A;  3HMY A;  4QQO A;  3ZMN A;  4XBN A;  2MEV 3;  2E63 A;  4Y1U A;  3H8R A;  4Q4Y 3;  4E8D A;  3N9M A;  2UYB A;  4Y3O A;  3T4H B;  2BJS A;  2R7E B;  2FQP A;  2Z69 A;  2A6V A;  4FFI A;  4Y4R A;  5KHJ A;  1KJR A;  2XBO 1;  1NZI A;  4QMA A;  2RM2 3;  3TEW A;  3KQR A;  1CJP A;  3N9L A;  4P08 A;  1UIJ A;  5F2S A;  5BY5 A;  2Y6K A;  4TN7 A;  2YG0 A;  3A21 A;  2X29 A;  3NV4 A;  2ADE A;  4X6Q B;  2DVF A;  5EJZ B;  5JZG A;  1LOE A;  3O1V A;  5FRA A;  1Z0H A;  2FDJ A;  4QHB A;  2A5Z A;  2DUQ A;  3MI8 A;  4PBP A;  3VD9 A;  2R07 3;  4XOG A;  1QJY 2;  4G3Y C;  1ENQ A;  2R06 3;  2I2S A;  4L9B A;  5HPO A;  2A6Z A;  2WYF A;  4QX1 A;  3MEP A;  3USU B;  4YZ2 A;  2VG9 A;  4YAR A;  1O91 A;  1RUI 1;  1BEV 3;  3LD8 A;  2IFR A;  1FNZ A;  2W46 A;  4XFH A;  4BXS V;  1NCQ C;  4LKD A;  1S2B A;  3N7M A;  3LFM A;  5J37 A;  3GZU C;  4AQ2 A;  3AP4 A;  4JGY C;  2JIG A;  4IW3 A;  4LUL A;  2RE9 A;  5AC9 3;  1GP4 A;  4W6Y A;  5AVP A;  3RI9 A;  4YYO A;  4A44 A;  4L97 A;  1LOG A;  1XND A;  1R09 3;  5JXH A;  5C4W A;  5FZ1 A;  1ZM1 A;  3AB0 A;  1SLA A;  4K8R B;  5I0T A;  1JH5 A;  3ON7 A;  2EXI A;  1H8T C;  3GZE A;  5FYV A;  3NKG A;  1XU2 A;  4LQR A;  5E16 A;  3ITQ A;  1ZBE 1;  2OX0 A;  3VL8 A;  4Y33 A;  2O0O A;  1RMU 2;  3RWN A;  1QHD A;  3VBO A;  5BV6 A;  3OTF A;  5BNN C;  4Q26 A;  5FY8 A;  1XNB A;  2EIC A;  1AR7 2;  1MEC 3;  2DBN A;  4WV8 A;  4QPI C;  4CDX A;  5DAW A;  3U75 A;  3WF1 A;  3U0Z A;  4NWV A;  2X5I C;  4Q0S A;  5FWE A;  2PHU A;  1OD3 A;  3EBR A;  2HWD 2;  2JG8 A;  3AMQ A;  4D94 A;  4AGR A;  4DXR A;  1OF4 A;  3EJK A;  4AVT A;  4AI8 A;  3SKV A;  4OZO A;  3DCQ A;  2E33 A;  3GGL A;  3URF A;  1RIN A;  2WA3 A;  2ZGK A;  2VME A;  4W65 A;  4I2O A;  2EAA A;  1XRU A;  4HT1 T;  1RUO A;  1CAU A;  3ALQ A;  3BOD A;  4CU6 A;  1UOB A;  2Y0O A;  2V4V A;  4XJ8 A;  3LPF A;  3ZFF C;  2WZR 3;  2D6P A;  5LW9 A;  1RHI 3;  2YU1 A;  1OFS A;  4EN8 B;  2VBD A;  5I0D A;  4LO6 B;  1IKP A;  1L7L A;  1TME 3;  1ZZ8 A;  3OPW A;  4ARX A;  1AXK A;  5IAX A;  3WLU A;  4PQ9 A;  1WCK A;  2MHF A;  2ZAA A;  4Q2F A;  1O3S A;  5IFP A;  1VBB 3;  1PO2 2;  4A3Z A;  2IFW A;  5CKM A;  3IAQ A;  4QX0 A;  1OI6 A;  5JZG B;  2PXJ A;  4LT5 A;  1D4M 2;  1X50 A;  2A7A A;  4PJY A;  3TB0 A;  2QKD A;  3RI8 A;  5A70 A;  5FBZ A;  3NNJ A;  3E5Q A;  1PO1 1;  1Y7B A;  3VZM A;  4QU2 A;  1RXG A;  2YBS A;  1GZW A;  5FPB A;  1S1A A;  4NRQ A;  3WG3 A;  3QH7 A;  1GYK A;  2EIG A;  3MIE A;  1GFF 2;  4LK6 A;  4LIV A;  5D21 A;  5FZF A;  3I8T A;  5BPX A;  3S30 A;  1NA1 B;  4QB2 A;  4FPE A;  2XB6 C;  1MQT A;  4HKO A;  5J7M A;  5I8T A;  3AMM A;  4B4Q A;  3POJ A;  2GME A;  2RDN A;  4L92 A;  1UZV A;  5C4W B;  4LOT A;  1A34 A;  2VW2 A;  4MGZ E;  5GLT A;  1E5H A;  5H9S A;  3INA A;  5JMC A;  4DB5 A;  3N4M A;  3EHK A;  4NN0 A;  3GBW A;  1NE4 A;  4XPV A;  1N1Y A;  5FLI A;  3DPR A;  1W0O A;  3LA3 A;  5JR7 B;  1REF A;  3ZYF A;  1QQP 1;  2BER A;  2GP5 A;  3B5L B;  1S4C A;  2RS1 2;  5A1L A;  1V00 A;  2QQV A;  2VZ1 A;  3FJS A;  3NVC A;  3RGB A;  5L7O C;  1KD7 A;  2HWF 3;  1JZ3 A;  4QXK A;  3BYW A;  3VBO B;  1UN1 A;  3TNP B;  5EP9 A;  5FLJ A;  1S0G A;  2C4X A;  2WNE A;  1MS4 A;  1IS3 A;  3WDT A;  4F83 A;  1S2E A;  1JS9 A;  1OOP A;  2DVA A;  2P1B A;  2NN8 A;  2OW4 A;  2VZO A;  3J7M A;  3MF6 A;  4QD2 A;  5KXD A;  4CDX B;  4HKL A;  4L2N A;  2FDK A;  5F3I A;  2Y6F A;  4W6W A;  1AR9 2;  3III A;  1ND3 A;  4KI5 M;  1HW5 A;  1CX1 A;  4QXB A;  4CXX A;  1VBC 2;  5AFB A;  4XIK A;  4NJ4 A;  3E6D A;  2JG8 B;  5E89 A;  4XFA A;  3LEG A;  3V64 A;  3M4F A;  1HJG A;  4IV1 C;  5F37 A;  4KQ7 A;  1JZ8 A;  4QX8 A;  4M01 A;  3IPV A;  4N43 A;  4BYY A;  1WUV A;  2A6W A;  1CAU B;  2WQ8 A;  3HQU A;  4RQP A;  3H7Y A;  1LGC A;  4ORF A;  1QJX 2;  2O8O A;  3PJY A;  4ZPI A;  4CU9 A;  3I97 A;  2ENR A;  3ROU A;  3OBR A;  2WWJ A;  5IK4 A;  3JD7 2;  5KHH A;  4BE3 A;  1KFX L;  4ET7 A;  2D5F A;  1NXD 1;  3W5M A;  3J8F 1;  2Q8E A;  1LU1 A;  2VQA A;  3ZLI A;  1RB8 G;  3RSJ A;  4PQQ A;  1FAT A;  5CYY A;  4N7U A;  2P6C A;  1PGW 2;  4FOY A;  1D2S A;  1WLD A;  3H50 A;  4JX0 A;  5F5Q A;  1SPP B;  1JYC A;  5K0U A;  1HQW A;  2J1R A;  2PHD A;  2RVA A;  2BV4 A;  3MUZ 1;  2WBK A;  2PQQ A;  2HEV F;  4OYU A;  5IVE A;  4OI2 A;  3KCX A;  1NUK A;  1RUH 2;  5SV5 A;  5I0S A;  1ZRE A;  4A7Z A;  3CBN A;  2ARA A;  1LOC A;  2ZML A;  1S0C A;  1Y9G A;  1RTV A;  1H6X A;  3JZV A;  5F2W A;  3OPT A;  5FZO A;  3R0R A;  4Y5T A;  4W50 A;  4XUR A;  2JB4 A;  4GB3 1;  4NIG A;  1Q43 A;  4TSV A;  5HCH A;  3PVO A;  4CDW A;  4JKK A;  4CEY C;  1DZQ A;  3PUH A;  4B7K A;  4Z82 A;  5FZ7 A;  2VQ0 A;  3KVB A;  1MVQ A;  3IB3 A;  1E5S A;  4M4P A;  1SBD A;  3DPR B;  4U2A A;  4FP3 A;  4LJH A;  4DRV A;  4P00 B;  4AI2 A;  4D6R A;  3H8X A;  3NO8 A;  5IFT A;  2GDF A;  1PIV 2;  2WS9 2;  2ZA9 A;  3FWE A;  3DF0 A;  1KIT A;  2R04 1;  3VUO A;  2VVF A;  1V6J A;  3RMY A;  2PQS A;  4Q4W 2;  1OOP B;  4KBZ A;  1S55 A;  4S2D A;  3OUI A;  1R1Z A;  2JKX A;  2OZ6 A;  3N9N A;  3JQX A;  4E4D X;  2XWB B;  3R4S A;  3I2H A;  4Q0Q A;  1ZBA 2;  5FZG A;  1SHW B;  2PYT A;  4LO4 B;  1ND3 B;  2RS5 1;  1HQL A;  4AI0 A;  4Q27 A;  5DAX A;  3MIF A;  4UAP A;  3OD4 A;  1Q8P A;  2DUR A;  3KGZ A;  1IS4 A;  2BOI A;  1R1A 1;  3IPV B;  4NHX A;  3ZXE A;  2VMG A;  4CUA A;  5H9Q A;  3B7M A;  4LE4 A;  1XE7 A;  4FSJ A;  4KMQ A;  1SDD B;  3M3Q A;  4TWT A;  1W6N A;  2VGD A;  3ZX7 A;  4HPK A;  4GH4 C;  4RQP B;  4MHU A;  1G9D A;  3ZSL A;  2WWU A;  4AHY A;  2WT2 A;  2YZ4 A;  3T08 A;  1EAH 2;  1C8N A;  1C8M 1;  1MZ5 A;  3KLS A;  1R08 2;  2NQY A;  2ZX4 A;  5LCW L;  3G6J B;  2W1U A;  3FFZ A;  1QOT A;  4AYU A;  1JU3 A;  5BNP C;  4YG0 A;  2FMD A;  1W06 A;  2XLG A;  2BQP A;  3AMN A;  2JD4 A;  2PLV 1;  4XJW A;  5A7W A;  2JDH A;  2C5D A;  3FC0 A;  4LBL A;  4ZZ8 A;  2PTM A;  4DEQ A;  5C8W A;  3FLP A;  2I74 A;  3LAG A;  1DQ5 A;  4LBJ A;  1VBA 1;  4CCE A;  1WD3 A;  2P3Y A;  5I0U A;  3DUI A;  5K0U B;  4I3G A;  1AYM 3;  3WG4 A;  1EYB A;  1OQE A;  3WT3 A;  3WY6 A;  5JR2 A;  3EB7 A;  2JG9 A;  3PU3 A;  2D44 A;  5LA9 A;  4Y1Z A;  4YVS A;  3CNA A;  2BEO A;  3M3I A;  1HXS 1;  1FMD 1;  3MF9 A;  1Y43 B;  4BH9 A;  2IXC A;  1LEM A;  4AR2 A;  4NRM A;  1SLC A;  2VVE A;  4Q0V A;  5FZO B;  4AED A;  4LE3 A;  4G4F A;  1VBE 3;  1XC6 A;  3ZM8 A;  3RFR A;  1QH6 A;  1OA4 A;  1ODM A;  4OQ9 A;  4WZF A;  3JUU A;  4XQ4 A;  3SIT A;  1UU4 A;  3HR9 A;  5DUV A;  4IEZ A;  2RS3 1;  5FYS A;  1W6O A;  4NRP A;  2GNT A;  4IEV A;  3VBU C;  1RIT A;  2XQX A;  1YQ2 A;  2E26 A;  1U0A A;  5CAZ A;  1UNB A;  4PLN A;  1E57 A;  1O59 A;  3KCY A;  5FV3 A;  4CA9 A;  4I3P A;  2XVK A;  2VR4 A;  4WVZ A;  2ZHL A;  2W39 A;  3LA2 A;  3K3O A;  1VAV A;  1WA4 A;  2HLE A;  2JEM A;  3WDV A;  4YGC A;  4RL7 A;  2Z4F A;  3K77 A;  2RHP A;  3RMX A;  1LHN A;  2YBP A;  2GSY A;  3OCP A;  2QBX A;  4MUV A;  5D8A A;  3O1M A;  4ATF A;  4YPJ A;  1HRV 2;  3RNS A;  2VTX A;  4A45 A;  1YWK A;  3B93 A;  1DF0 A;  4MH0 E;  4XF3 A;  2GMP A;  1QU0 A;  3DL3 A;  1VRH 2;  3AX4 A;  4PBO A;  1C1L A;  4GKY A;  5T52 A;  3M3E A;  4CUC A;  1K3I A;  3PL0 A;  4YLZ A;  1GKB A;  1SEF A;  3SLI A;  2W9X A;  4XJZ A;  2W2I A;  1W6M A;  1CAV B;  3BB6 A;  4OUL A;  2EIE A;  5CKQ A;  3HD8 B;  5LY1 A;  4LHS A;  1UYP A;  4ZS3 A;  2WAO A;  1W6N B;  2WDB A;  3VKM A;  3OUH A;  3WP3 A;  4NIH A;  4HPK B;  3B02 A;  4DPN A;  5K7P A;  1DBN A;  2E7T A;  1BBT 2;  5D1I A;  4XFI A;  1CZS A;  1SLL A;  5F3G A;  1LGB A;  3OOX A;  1AR6 2;  4QB1 A;  1LAJ A;  1COV 1;  2PHT A;  1SBF A;  2CL2 A;  1DQ1 A;  2QQJ A;  1A78 A;  3AP5 A;  1BKZ A;  1MPX A;  3JBG 1;  5L9R A;  5A7W B;  5IVB A;  2JIC A;  4GAZ A;  3H42 B;  1YJK A;  5FXV A;  5JSP A;  3WQ1 A;  4CDU B;  3RZM A;  1N3P A;  1NCQ A;  1Y4W A;  2W5F A;  4PDW B;  1GBG A;  2ETE A;  3GXU A;  3I2F A;  2WN3 A;  3MGU A;  4JGY A;  5GKA C;  4QKN A;  5FP3 A;  4FVV A;  4Y24 A;  3MLJ A;  4YVS B;  4GWI A;  4XCB A;  4X8P A;  3NV2 A;  2AAC A;  3ZYR A;  5ACA 3;  4IDZ A;  5FJK A;  4JDO A;  3WNP A;  1BXH A;  3H3Z A;  5LWB A;  4AED B;  1JZ6 A;  2DWR A;  3DEM A;  3OEA A;  2F4L A;  5FO7 B;  2JDK A;  3PNA A;  1LKN A;  1MZE A;  1X7N A;  3IAP A;  3WW1 A;  3SCH A;  2CWS A;  2XBO 3;  1HB3 A;  2VZV A;  2Y64 A;  1ASJ 2;  1TZO A;  2BYV E;  3GYD A;  5SV8 A;  5BNN A;  1L3J A;  3WF0 A;  1W6O B;  1PVC 1;  3LKJ A;  1FOD 1;  3AFK A;  3I3M A;  4GWN A;  4YM0 A;  4QPI A;  4LPL A;  4QX3 A;  3WUD A;  4Q4V 2;  2Y6H A;  4XF1 A;  4Y4Y A;  3WIN E;  5J36 A;  3TEZ A;  3LOB A;  4HAN A;  2QZ2 A;  2WT0 A;  4HLT A;  3WW3 A;  4B4R A;  1HLC A;  3OYW A;  4Q5O A;  1TMF 2;  3POG A;  2ILM A;  2Y38 A;  1WW7 A;  1PM7 A;  5KC5 A;  4FPJ A;  4BMB A;  4XFF A;  1DYO A;  3AYC A;  1UOG A;  3K4Z A;  4KWJ A;  5D8A B;  3P6B A;  5FPZ A;  5HCB A;  1IS5 A;  2QQP A;  4FTE A;  3KCC A;  4JTO A;  2ORX A;  2VMF A;  3OY8 B;  1MQT C;  4K3U A;  3ZFF A;  1VBD 1;  1ND2 A;  1W8U A;  1YUD A;  2QZ3 A;  1OSG A;  4XQD A;  4BQ3 A;  5TSW A;  2Z2S B;  4CCL A;  3NNG A;  3C7H A;  3GF6 A;  1UOF A;  1IG0 A;  1G86 A;  2VO5 A;  3LB9 A;  3N9P A;  2X53 S;  5FZK A;  2VUD A;  4Y1V A;  1HN0 A;  4DZG A;  2NLR A;  3OB8 A;  4M3C E;  2BBV A;  5DPN A;  2VCM A;  4CCC A;  1Q56 A;  1ZBE 3;  2B39 A;  2VZQ A;  3LIG A;  5CAD A;  1ODN A;  3SXW A;  1D0H A;  1WD4 A;  4IET A;  2CYF A;  2A73 B;  4D0Q A;  2I07 B;  3AYE A;  3HEI A;  2N7G A;  2G9Z A;  4XC9 A;  5FYM A;  3FLR A;  1I5Z A;  2BDR A;  1QXR A;  5JDB A;  1JOD A;  1UD1 A;  4PI0 A;  4LHN A;  2K0G A;  1WW5 A;  1NCQ B;  3NJY A;  5FOJ B;  2YHJ A;  2JDP A;  4LKE A;  3W58 A;  3T30 A;  4ASM B;  1JHN A;  2ZGM A;  3ES4 A;  2V5Y A;  4JGY B;  4YW4 A;  3AP9 A;  1PMH X;  2Q1M A;  4N43 C;  3WNL A;  3I3E A;  4CPB A;  4AWD A;  3CU7 A;  2YGL A;  4MXV A;  4AG4 A;  3FFQ A;  1AYN 1;  1Y9Q A;  3GCW A;  5DZG A;  4PLO A;  3AXE A;  3AKR A;  3AZX A;  3I3B A;  3W59 A;  1H8T B;  2F4P A;  4H7M A;  1AZD A;  5CFC A;  1FYU A;  3O1O A;  1H1A A;  1PNF A;  4LR4 A;  1CZT A;  3WQ7 A;  1H30 A;  1O5L A;  5JUV A;  1K42 A;  1OVP A;  1WW6 A;  3KV9 A;  4DY5 A;  3Q8E A;  4Y22 A;  3VLB B;  5BNN B;  2YU2 A;  2C1F A;  4D7T A;  1MS5 A;  4B8E A;  1AVB A;  2XH6 A;  2Q1F A;  5CKN A;  1I5P A;  3VKF C;  4QPI B;  5DXD A;  1D0G A;  2J42 A;  3B01 A;  2FHR A;  1KXG A;  2X5I B;  1I6X A;  2VCC A;  4R9D A;  3IM0 A;  3WQB A;  3PJQ A;  1WWY A;  4XJ9 A;  2ZMN A;  1PX4 A;  1PO1 3;  1YJL A;  1LUL A;  5FCC A;  5FZ3 A;  2AR6 A;  2CAV A;  2ZEW A;  4MZU A;  4LMF A;  4XJU A;  2G4I A;  1PGL 2;  2JWP A;  1JOJ A;  1HX6 A;  5FZE A;  4AGV A;  1AX1 A;  4B3N A;  1ZZ7 A;  2XKO A;  1LHW A;  1DGW A;  1JYX A;  1ZZ9 A;  3WG1 A;  1G8W A;  3ZXK A;  5A6Q A;  4AQS A;  3ZFF B;  2K9Z A;  1RUC 2;  1XJA A;  3KB5 A;  4CDW C;  4TZD A;  2E9Q A;  4HSL A;  5GJ6 A;  5LBB A;  3H1W A;  2FDI A;  4MOA A;  3PUR A;  1QEX A;  2OYZ A;  3OGG A;  4OMC A;  4CP0 A;  2G19 A;  2VBP A;  5B4X A;  4MV2 A;  1ENS A;  1JYW A;  2WNV A;  1BVP 1;  4YWA A;  1QQP 3;  1MAC A;  3AKS A;  3MUY 1;  2JD9 A;  1KQR A;  1J3P A;  4Q4X 1;  4IXL A;  1T2X A;  3FE5 A;  1OA2 A;  1YQ8 A;  2C0Z A;  2XKP A;  3BI3 A;  1OA3 A;  2HWC 1;  1CD3 G;  1IQD C;  4Q0P A;  4QB6 A;  5J96 B;  2XUM A;  2EXJ A;  1W3V A;  5G04 L;  3SQO A;  4ZON A;  3ZXF A;  2OUH A;  1E5R A;  2JDM A;  5JPM B;  3M70 A;  5C9A C;  3LPG A;  2VMI A;  3FL7 A;  5JMO A;  1JZ5 A;  1RUF 1;  1LTE A;  2HWB 1;  2RR1 1;  4OI4 A;  1FXZ A;  5C71 A;  4QQH A;  3AXD A;  2Q5T A;  2QDN A;  1C57 A;  4XET A;  5EYY A;  2QQW A;  1DQ0 A;  1CES A;  3WG2 A;  5F9T A;  1EPW A;  2VTF A;  3WNM A;  2BVB A;  1KEX A;  1NT0 A;  3BAL A;  3VZO A;  2ARC A;  4CEY A;  2FDG A;  4CP2 A;  3OPZ A;  2XVL A;  2C26 A;  2Z5W A;  4R4X A;  4AZZ A;  4HOO A;  4XFG A;  5CFC B;  2Q0A A;  2VPV A;  5L7O B;  3CZU A;  4FCA A;  4CRQ A;  1RVF 2;  4YM1 A;  4MGK E;  4QGN A;  1XBF A;  3J8F 3;  1WCS A;  1C4R A;  3D0J A;  2QQM A;  1UKG A;  5K4L A;  2B8M A;  1VRB A;  2WJS A;  2HWE 1;  5F6L B;  4UYB A;  4GWM A;  3UGH A;  1KS5 A;  4QX2 A;  2EAK A;  2XPJ A;  1F5F A;  1XNA A;  4EV0 A;  4E4H A;  1HRI 1;  2LRO A;  1J3R A;  2ZGU A;  4P9I A;  2BP6 A;  4C1X A;  2JG9 C;  4RHV 1;  5E8A A;  1UQX A;  4ZZ5 A;  3GDB A;  2DF7 A;  4IV1 B;  4EWE A;  4XW3 A;  2QTW B;  2BGC A;  2VCA A;  3ZN6 A;  4COV A;  3HT2 A;  1VB4 A;  2GNB A;  4AEM A;  4HON A;  1KRI A;  1RUJ 1;  1DYP A;  1CWP A;  1ZRF A;  3ACH A;  1Z7S 1;  2E7Q A;  1NLS A;  1QXJ A;  1SFN A;  1W05 A;  2J1S A;  2ZHM A;  4GH4 A;  3WDW A;  4GB3 3;  2XL9 A;  3C7O A;  2CTV A;  1W2A X;  2DTY A;  1UAI A;  2IZW A;  2PHW A;  2QQL A;  1ULP A;  2RMU 1;  3HN1 A;  4LBQ D;  5A7Q A;  4E2G A;  2ZCW A;  1CQ9 A;  4P9J A;  2ZGO A;  1IZ3 A;  1SAC A;  1EPZ A;  5LRR A;  5BNP A;  4DUW A;  1JYT A;  2ARX A;  2XHK A;  4E27 A;  1ULE A;  3MFA A;  2J1U A;  5FXX A;  1Q8S A;  3J7H A;  4WBB A;  4BA6 A;  3LDK A;  2FDH A;  3MW2 A;  5B2G B;  1RUD 1;  1R64 A;  1RUE 1;  4GMP 0;  3M3C A;  1QWR A;  2R04 3;  1BYH A;  3SEE A;  4IEY A;  4RS5 C;  4A2U A;  3V65 A;  2I45 A;  4A4A A;  1YFX A;  3FMG A;  3PVN A;  3P5B A;  1AR8 1;  3SHR A;  4CXW A;  5DAP A;  3CEW A;  5JIU A;  1ALY A;  3QCW A;  5A3O A;  2D43 A;  2GC0 A;  2PAK A;  1POV 1;  4OHV A;  4Q1P A;  4KBB A;  4DIQ A;  5DG2 A;  2RS5 3;  1OKO A;  3KF5 A; 
#chains in the Genus database with same CATH homology
 2W95 A;  2X10 A;  2VZO A;  5C70 A;  2W92 A;  2YB7 A;  2BGP A;  1W9T A;  3III A;  4E8C A;  4KI5 M;  3C7E A;  1CX1 A;  4D8M A;  4CU8 A;  3LEG A;  1JZ8 A;  3WNN A;  4W8J A;  2HYX A;  2WO2 A;  1O8S A;  2WZ8 A;  5G05 L;  1EUU A;  1D7P M;  1O8P A;  2WQ8 A;  4CU9 A;  3I97 A;  3T2Q A;  5EIY B;  3I2I A;  3VDB A;  2DDU A;  2BZD A;  2QQI A;  4ET7 A;  3W5M A;  4RN5 A;  1JZ2 A;  3LEI A;  3GM8 A;  4ZXE A;  5CYY A;  2RV9 A;  1JI6 A;  1GOH A;  2VM9 A;  2W1W A;  3ECQ A;  4W4Z A;  1GQP A;  4JX0 A;  4XUP A;  2J1R A;  2RVA A;  3MUZ 1;  2WBK A;  4OYU A;  3WNO A;  3C8X A;  3F2Z A;  1NUK A;  4MGQ A;  4OMD A;  1F4A A;  4RYD A;  2E32 A;  4GZ9 A;  2ZEZ A;  1H6X A;  2C9K A;  2VZR A;  3OG2 A;  1DP0 A;  2ID4 A;  4W50 A;  4XUR A;  4LKS A;  2V5D A;  3NJV A;  2B4K A;  3T2P A;  4JKK A;  3ACG A;  3PUH A;  1W8N A;  2Y6L A;  1UYX A;  3I2J A;  3VD5 A;  3VDC A;  3IB3 A;  4M4P A;  3NRU A;  3THD A;  4P00 B;  5IFT A;  4KWU A;  4QPW A;  2WUH A;  2YFU A;  5F7U A;  2DCK A;  3IDA A;  2EID A;  4BK5 A;  3DYP A;  2PQS A;  1TG7 A;  2JKX A;  3VD3 A;  2VZP A;  3I2H A;  4CVU A;  3WF4 A;  1SHW B;  2JE8 A;  2CDO A;  3K75 B;  3OEB A;  4UAP A;  2X05 A;  2DCJ A;  4ARY A;  1ULO A;  4CUA A;  3WF3 A;  4KMQ A;  1SDD B;  1NX9 A;  1CIY A;  2W87 A;  3HNM A;  4P02 B;  1KGY A;  1XNT A;  1WCQ A;  4XZU G;  3T08 A;  5LCW L;  3ACF A;  3CQO A;  2W1U A;  2J1A A;  3LEK A;  3P1I A;  1JU3 A;  3C7G A;  3WNK A;  4XUN A;  1UY0 A;  4ZZ8 A;  3LE0 A;  3OGR A;  4DEV A;  2W1Q A;  2J22 A;  3UES A;  4DEQ A;  5C7G A;  5J1X A;  1GUI A;  1UZ0 A;  4BDV B;  5JR2 A;  2VOT A;  1GNY A;  3PUI A;  4DXT A;  2W94 A;  3EB7 A;  4BK4 A;  1NAE A;  5LA1 A;  1NKG A;  3EYP A;  2XOM A;  4PT6 A;  5JXJ A;  2V72 A;  4A42 A;  1XC6 A;  3ZM8 A;  1UWW A;  3MO4 A;  1JYV A;  3HJR A;  4XVH A;  3DYM A;  3SKJ E;  2XQX A;  1YQ2 A;  2E26 A;  1JU4 A;  1O59 A;  3I2K A;  2ZEY A;  2VR4 A;  1UMI A;  2EIB A;  3AC0 A;  2HLE A;  1K45 A;  1UX7 A;  3FHQ A;  2Z4F A;  3K77 A;  2QBX A;  3D3A A;  4YPJ A;  4A45 A;  3T0D A;  3VD4 A;  1W9S A;  1UYZ A;  3BGA A;  1JHJ A;  3OGS A;  1SG3 A;  4CUC A;  1TVG A;  1K3I A;  4A41 A;  3CKH A;  2W9X A;  2EIE A;  4FI9 A;  4LHS A;  2WAO A;  2WDB A;  5FUI A;  2CDP A;  2RJ2 A;  3WSO A;  2VC9 A;  3HN3 A;  1CZS A;  2B9V A;  5B4N A;  4QB1 A;  3THC A;  4GWJ A;  2QQJ A;  2Y6G A;  1MPX A;  2XHN A;  3LQC A;  3I3D A;  5JXI A;  2W5F A;  3GXU A;  3I2F A;  2WN3 A;  3FHA A;  1LNS A;  1K12 A;  4GWI A;  4UI9 L;  4DUX A;  2VCB A;  4DUV A;  1EUT A;  5A1A A;  3WNP A;  2WZE A;  1H6Y A;  1JZ6 A;  3ACI A;  3T2O A;  3OEA A;  1P8J A;  2VQU A;  2JDA A;  4HG6 B;  1OF3 A;  3IAP A;  1UMH A;  2ORZ A;  4UOJ A;  1OH4 A;  2VZV A;  1W8O A;  2Y64 A;  2ZXQ A;  2KD7 A;  3WF0 A;  1J83 A;  3BN6 A;  2W91 A;  1JZ4 A;  1F4H A;  4LPL A;  4QX3 A;  2Y6H A;  5IHR A;  1UY2 A;  4QDR A;  3T09 A;  2X09 A;  2W47 A;  1DYO A;  3K4Z A;  3P6B A;  3WF2 A;  3UET A;  3K4D A;  3ABZ A;  3UNP A;  1GMM A;  2ORX A;  2VMC A;  2VMF A;  4JHZ A;  5EJ1 B;  4CU7 A;  3MBW A;  2VJX A;  2YFZ A;  4Z2A A;  3HPN A;  3CZJ A;  3NNG A;  3C7H A;  2VO5 A;  4AAX A;  3HNB M;  1JZ7 A;  3OB8 A;  3WEZ A;  5DPN A;  2W3J A;  2Y8K A;  1RYY A;  2VZQ A;  4XUT A;  5JXG A;  1L7Q A;  1W99 A;  4XUQ A;  1US3 A;  3T0A A;  4D0Q A;  2W1S A;  3HEI A;  2L9L A;  5IYY A;  1UXX X;  4XUO A;  1OT5 A;  1HN1 A;  4TXW A;  2BGO A;  1WKY A;  3MV1 1;  1UY4 A;  3OBA A;  2WO3 A;  3W5N A;  2J1V A;  3NQH A;  4MGS A;  4QDS A;  2WN2 A;  2WO1 A;  1PMH X;  2WAB A;  3MV0 1;  1L7R A;  3WNL A;  3I3E A;  3VDA A;  2OKX A;  4BJ0 A;  4AG4 A;  1GOF A;  2VZU A;  4A6O A;  3I3B A;  2QQO A;  3CDZ B;  2XON A;  2YC2 A;  1CZT A;  1W9W A;  4ZY9 A;  3K4A A;  2WAA A;  1K42 A;  3C7F A;  4E8D A;  2J1T A;  5HXM A;  3JXS A;  1I5P A;  2R7E B;  3T0B A;  4JKL A;  3A23 A;  1PMJ X;  2WYS A;  3ETP A;  4P08 A;  2E31 A;  2Y6K A;  2VCC A;  2YG0 A;  3A21 A;  4CUB A;  3WQB A;  2J7M A;  5EJZ B;  1PX4 A;  2ZEX A;  4P5Y A;  2ZEW A;  3VD9 A;  2BBA A;  2VZS A;  3HOB A;  5HPO A;  2Y6J A;  4QX1 A;  1JYX A;  2VZT A;  3NJX A;  4QAW A;  4M4R A;  2W46 A;  2YC4 A;  3E1F 1;  5DN2 A;  4BXS V;  5LA0 A;  4MOA A;  4L0P A;  4OMC A;  5B4X A;  4A44 A;  1JYW A;  5JXH A;  4IUG A;  3MUY 1;  2JD9 A;  5JUV A;  3A22 A;  2VQT A;  1US2 A;  2QQK A;  3K46 A;  1T2X A;  3FN9 A;  4MO3 M;  4LQR A;  5IJR A;  1IQD C;  1UY3 A;  4QB6 A;  5G04 L;  5JMO A;  3LPG A;  1JZ5 A;  3FL7 A;  1DLC A;  3DYO A;  5LA2 A;  2EIC A;  5C71 A;  1CZV A;  1BHG A;  3WF1 A;  3OGV A;  1XPW A;  1UXZ A;  1OD3 A;  2VTF A;  3WNM A;  1KEX A;  1JYN A;  4DXR A;  1OF4 A;  1GU3 A;  5DQ0 A;  2C26 A;  4OZO A;  3SKV A;  2E33 A;  3GGL A;  3SEP A;  2VME A;  4TTG A;  3CZU A;  3DEC A;  4CU6 A;  2V4V A;  3LPF A;  2QQM A;  5CZK A;  2VL4 A;  2J1E A;  5I0D A;  2VMD A;  4QX2 A;  4DXS A;  4ARX A;  1XNA A;  5IFP A;  4A3Z A;  3IAQ A;  1GOG A;  3CIH A;  4QX0 A;  2LW8 A;  1W0N A;  4MAD A;  4ZZ5 A;  3GDB A;  2VCA A;  3I2G A;  3U37 A;  3ACH A;  5DMY A;  2J1S A;  3C7O A;  4PQQ A;  2QQL A;  4QB2 A;  1ULP A;  4PF1 A;  2QQN A;  4OUE A;  3HNY M;  4QDQ A;  3VD7 A;  1PX3 A;  4DUW A;  2LS6 A;  2J1U A;  3J7H A;  1UY1 A;  1J84 A;  1R64 A;  3SEE A;  2BER A;  4A4A A;  2VZ1 A;  4JKM A;  3CMG A;  1JZ3 A;  2C4X A;  3A7Q A;  1UYY A;  2VZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...