1D7PM

Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
LNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNCLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAGULATION FACTOR VIII PRECURSOR
publication title Structure of the C2 domain of human factor VIII at 1.5 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1d7pM00
4UAPA 2W91A 2E26A 3HNBM 5A1AA 1R64A 2VCCA 4M4RA 5JXHA 3PUHA 2J1EA 4QPWA 1O59A 3VD7A 4CUBA 3VD4A 2Y6LA 1IQDC 2WUHA 1XC6A 4QB6A 3WNKA 4UOJA 3I3DA 3IAPA 1UYXA 1GMMA 3UESA 2VC9A 1UYZA 3CZUA 2XHNA 1W9TA 4QB2A 2DCJA 3WSOA 2HLEA 3OBAA 3T2PA 4MOAA 2C9KA 1UXZA 3ACGA 2ZXQA 4DXSA 3W5NA 3A22A 3T0BA 3GDBA 2BBAA 4JX0A 2J1AA 1GOGA 4XUOA 4XUTA 3WNNA 1JZ2A 3IDAA 1W0NA 3CIHA 3I2IA 2ZEYA 3GM8A 5CYYA 5CZKA 2EICA 1GQPA 2LS6A 4LQRA 1W8OA 2RVAA 2WO1A 4CU6A 3OB8A 3JXSA 2V5DA 2BGPA 3U37A 2VOTA 3I97A 4OMDA 4W4ZA 1KGYA 2JE8A 2QQLA 4TTGA 1UX7A 3K4DA 5DMYA 3CMGA 2JD9A 4A41A 5IHRA 1GUIA 1ULPA 3CDZB 3THCA 4KMQA 3VD3A 2QQIA 2EIBA 3VD9A 1PX4A 5DQ0A 3SKVA 4D0QA 2R7EB 1JYXA 4IUGA 4OMCA 1RYYA 2CDPA 1SG3A 4CUCA 5G05L 2W1WA 3OGVA 2Y8KA 4UI9L 5J1XA 1CZVA 2W95A 3MUZ1 2C4XA 3A23A 4JKKA 2LW8A 4CUAA 4RN5A 3I2FA 1JZ8A 2VMEA 3LEIA 2XQXA 3BGAA 3GGLA 4GWIA 2VR4A 1JYNA 2VJXA 2VMDA 2XOMA 2JKXA 4P08A 4XUPA 1CIYA 1UY4A 2W5FA 3OG2A 2YG0A 2X10A 3THDA 1JZ3A 1JU4A 3LE0A 2VZ1A 5HXMA 1YQ2A 3WNLA 5LA0A 3P6BA 3UETA 2YC4A 5B4NA 2WO3A 5IFTA 2ZEZA 1UYYA 4DUVA 5C70A 4QAWA 3MV01 2HYXA 1JHJA 1JU3A 2QQKA 3ACHA 2YB7A 4XVHA 3OEAA 2EIEA 2WAAA 4JKLA 4MGSA 4ZY9A 5G04L 3ECQA 4BK4A 4P5YA 3I3BA 3MBWA 4QX1A 4ZZ5A 3CKHA 2ZEWA 4JKMA 3I2JA 4LKSA 2WN2A 3I2KA 3IIIA 1TVGA 1UMHA 1JZ4A 4JHZA 4KWUA 2WAOA 2WO2A 1NX9A 2VQTA 1OF4A 3MO4A 1CZSA 1UY3A 2VTFA 1XPWA 1P8JA 2E31A 2Z4FA 3C7EA 3I2GA 2W94A 4QX2A 3WQBA 5LA1A 3WF1A 2WABA 3NQHA 3K46A 4OZOA 5DPNA 2OKXA 2J1SA 1H6YA 1OF3A 2X05A 5JXJA 5FUIA 1W8NA 4ZZ8A 2QQJA 4CU7A 3OGRA 3MV11 3FHQA 4CU8A 3ETPA 2J22A 1F4HA 2VZPA 2J1UA 4DUWA 3I3EA 2B9VA 2V4VA 3DYPA 4BK5A 1UY0A 3BN6A 2VZSA 1PMJX 3VDBA 3WF2A 4XURA 1BHGA 3K4ZA 4DEQA 4MADA 1DYOA 1CZTA 2WDBA 2J1VA 3T08A 1J83A 2W46A 4L0PA 3AC0A 4PQQA 2W3JA 3A7QA 2VZUA 3VDCA 4P00B 2Y6GA 3J7HA 1CX1A 2YC2A 3P1IA 3IB3A 4ARYA 3EB7A 3OGSA 5C7GA 3WF4A 1SDDB 2J1RA 3T0AA 2J1TA 5IYYA 2WZEA 4AG4A 1H6XA 2YFZA 2BZDA 3DECA 4CVUA 3FL7A 5EIYB 4OYUA 5JUVA 1HN1A 2ZEXA 3LPFA 3WNPA 4BDVB 4FI9A 4M4PA 4TXWA 5IJRA 1T2XA 1EUTA 3MUY1 3C7GA 2L9LA 3HEIA 1UMIA 1GOFA 4QDRA 1OT5A 3WNMA 3EYPA 4ET7A 1O8PA 2DDUA 4XZUG 2QQOA 4ARXA 1GU3A 5HPOA 3C7FA 1EUUA 3LEKA 2ID4A 3HJRA 3W5MA 2WQ8A 1NUKA 5C71A 4MGQA 2V72A 1JZ5A 2VZRA 2VQUA 3DYMA 3HN3A 3ABZA 4LHSA 3OEBA 5JMOA 1UWWA 3GXUA 1US3A 3T0DA 1DLCA 4MO3M 4PT6A 5LA2A 2KD7A 3WEZA 2EIDA 1SHWB 4QDSA 4DXTA 4HG6B 1UXXX 1JZ6A 2VMCA 4RYDA 3C7HA 4Z2AA 1TG7A 4XUNA 2W87A 4A44A 3SEEA 1LNSA 4A42A 2DCKA 1W9WA 4KI5M 4BXSV 2VZTA 3C7OA 1XNTA 4E8CA 3LEGA 2QBXA 1L7QA 5EJZB 1K42A 4QX0A 4YPJA 3HNYM 1K12A 3T2OA 2Y6HA 2VO5A 1JI6A 5EJ1B 1K45A 1NKGA 2C26A 1I5PA 4BJ0A 1O8SA 2Y6JA 4DUXA 3CQOA 2VCBA 3E1F1 4CU9A 3T2QA 2ORZA 3SKJE 5JXIA 3FHAA 2VM9A 4DEVA 5B4XA 2VZ3A 3ACIA 2WN3A 1L7RA 2RJ2A 1GNYA 1PMHX 2W1UA 4QX3A 3C8XA 3NJXA 3HPNA 4E8DA 2BGOA 5JR2A 4QB1A 4A3ZA 5I0DA 3LPGA 2QQNA 2Y64A 2B4KA 5JXGA 2W1QA 2XONA 3ACFA 3A21A 2Y6KA 1W99A 2E32A 3WNOA 5F7UA 3NRUA 2WBKA 3D3AA 2W92A 2W1SA 1WKYA 3K75B 2JDAA 2W47A 4W8JA 2YFUA 1DP0A 2ORXA 5LCWL 2RV9A 2CDOA 3PUIA 1PX3A 1MPXA 2VCAA 3T09A 4A6OA 1KEXA 1JZ7A 5DN2A 4GWJA 4PF1A 1WCQA 3FN9A 1US2A 3WF0A 2E33A 1F4AA 2QQMA 3I2HA 3NNGA 4D8MA 4DXRA 4QDQA 2VZVA 1J84A 2WYSA 1NAEA 2VL4A 3IAQA 1UZ0A 4A45A 1OD3A 2VMFA 3DYOA 2BERA 4ZXEA 2WZ8A 2X09A 2VZOA 3HNMA 3UNPA 4OUEA 5IFPA 3SEPA 1UY1A 3WF3A 1JYVA 1W9SA 3VDAA 3LQCA 4W50A 2J7MA 3ZM8A 3K77A 1GOHA 1UY2A 4P02B 3NJVA 4GZ9A 2W9XA 3CZJA 4AAXA 2VZQA 1JYWA 4A4AA 1XNAA 4XUQA 3VD5A 4LPLA 1OH4A 3K4AA 3F2ZA 1ULOA 2PQSA 1K3IA 1D7PM 3HOBA
chains in the Genus database with same CATH superfamily
4MLOA 1JH5A 4UAPA 4ZU4A 2CU5A 5JOZA 3BVCA 5A1AA 2XKPA 1H8VA 3KVAA 3D82A 5GLVA 3P3NA 2FHRA 4AYUA 2DUPA 3PUHA 4K6BA 4NWVA 4OHZA 5BNOB 2RJLA 2J1EA 2WFF1 1O59A 4QPWA 4CUBA 5BNPA 5FY9A 3VD4A 2E7QA 1C5HA 1IQDC 2WUHA 4Q0VA 3WDUA 3ZFGC 2ETEA 1PNGA 5CVRA 3UGHA 3V0BB 4V1PA 4ZU5A 1QJY2 1FOD3 1AR73 2W2IA 3EJKA 3IAPA 3LFMA 4UOJA 4HKWA 2VC9A 4AEDA 3IPVA 4IV3C 4Q2FA 1UYZA 4QB2A 2ZGNA 3WT3A 2GMMA 1VALA 3KGZA 1URXA 4JGZA 4BHPA 4MOAA 1UXZA 2ZXQA 5LBBA 4IDZA 1IHMA 1OUSA 4RA0A 3T0BA 1HXS1 1Q3EA 1HRI2 4R4XA 3PNAA 2C5DA 4JGYA 2GMPA 4B7KA 3UT0A 3I2OA 4Q4V1 2I07B 2MHFA 4META 1VMFA 2R1DA 3ZKYA 1JZ2A 5C3RA 2EAAA 5FY8A 5FZKA 3W9AA 5A3OA 3AYEA 2UURA 1QWRA 3I2IA 4M0HA 5FJHA 2CY6A 2B9UA 3TEXA 5FZ6A 4AAPA 3PIJA 4DS0A 3JZVA 1LKNA 3E97A 1GQPA 1TNRA 1RVF2 2JDNA 1FYUA 2YBKA 1KFXL 2WO1A 3PU3A 1ZNPA 2HH9A 3ZFFB 4N7IA 4XF9A 4FPLA 5K0UC 4LBJA 1V70A 1AXYA 5C33A 1RUNA 2V5DA 2ZGMA 3TBDA 1VMHA 5DAPA 5FZDA 2VXRA 3SQOA 4ZHNA 4GWMA 4Y33A 1WMDA 2VVDA 5M0TA 4COZA 3CJIB 2QQLA 1K5JA 4W4ZA 1G9BA 1JUHA 5JDBA 3K4DA 3CMGA 2FDFA 4XPVA 4A41A 1WCDJ 3UYJA 3JQWA 5C8CA 3O0XA 1NOVA 5IHRA 5IVYA 2FQPA 1YLLA 4GMP3 4CEWA 1WLTA 2JE7A 3VZKA 5BNQA 2ZKNA 2QQIA 2DCZA 5F8PA 1PO11 2NPIA 3C2UA 3M8LA 1O6UA 4KWLA 1PMIA 5FZ1A 1JYXA 3ZXFA 4ZS2A 3NVCA 4NIIA 4OMCA 1R1ZA 1ALYA 1OOPA 4OHWA 1LU2A 2R071 3BTAA 4GULA 1SG3A 4QKFA 5ACA2 3OGVA 4IEPA 2RE9A 1DGWA 1Q8SA 1IQAA 1BEV1 3ZXEA 3IMMA 2XJTA 3K2OA 4QQOA 4NIDA 4UBGA 1R082 5I8SA 2BUKA 1VIWB 4XTPA 2PHWA 5JVVA 1UPSA 2LW8A 1CJDA 2PAEA 3PURA 4CUAA 1RUH2 3AZWA 2H6CA 3DXUA 4NE9A 1W6PA 5A7OA 4WM8A 2VMEA 4QMAA 1WW6A 4YNIA 1HJFA 1QJU3 1RUF2 3ENRA 4KBBA 5K7PA 1PIV3 3GGLA 3OYWA 1NZCA 4KGGA 2D44A 2ZX4A 5IVJA 2VBDA 1ZA7A 3FJSA 4I3PA 5BY5A 2VJXA 2I45A 2Y38A 1JBCA 2YU1A 2JG9A 1O4YA 4W6WA 3H8OA 3FBYA 2W5FA 4ZONA 2D6NA 4PLNA 3RSJA 4XETA 1RJ7A 4HETA 3RZKA 3H1YA 2ET7A 1HRV3 4FBFA 5IAVA 3ROUA 1H1MA 4FAHA 2VW2A 4D6SA 3DPRB 4N53A 1ND2B 1ENQA 3LE0A 4LA3A 3VN4A 3TN93 3UGFA 1BCXA 1WMXA 1HKDA 2HWF1 3ILNA 4YFWA 3PTYA 3WW3A 5LA0A 2IC1A 3P6BA 4IEZA 1S0GA 2D40A 1V9U1 2R16A 2WO3A 3ZSJA 2WFPA 3B9IA 3Q8BA 4LITA 5IFTA 4LO5B 3SITA 4LLFA 5IK7A 5C8WA 4LT5A 3LDKA 1N3OA 1G9DA 3HN1A 5D1IA 4YVSB 3WW4A 1GZ9A 1VBA3 3PVBB 4A7ZA 4EJRA 4XZPA 3RVHA 3KLSA 3RJ2X 3WX5A 3ZX7A 3ZYGA 4MXVA 2QVSB 2GNDA 2BV4A 4GWNA 2WAAA 4CEYA 2DU1A 2D6OX 2VW0A 4MGSA 4QX7A 3VBUA 2H6BA 1YC61 1VRH1 3W21A 2V4AA 1WMFA 5EP9A 5FYTA 3E5QA 3V65A 2K2SA 2OZJA 5FZIA 3CKHA 4IV1B 3VDDA 1UF2C 2ZEWA 4XQWA 3I2JA 2WQ4A 2E9QA 1FXZA 5LZ6A 3I2KA 2Q8DA 3IIIA 3BB6A 3AJYA 4CDUC 2MEV2 2WR9A 2XVGA 1I3HA 1JXNA 2GNBA 1ONAA 3IZOA 1X9TA 4H14A 1JZ4A 2Y34A 4QQLA 4JHZA 4KWUA 2D5HA 4HLTA 1ULCA 4BM8A 1TMF3 5BNNA 3FLPA 2XG3A 1JW6A 1VBD3 3D0JA 4FFIA 1RUD2 2RM22 3NNJA 4QQ2A 4HT1T 4OFGA 3GZUC 4YW1A 2HWC1 1P8JA 3WP5A 2JG8C 2Z4FA 2ZAHA 4XMIA 4HN0A 1VB4A 1GNZA 4DY5A 4QX2A 3U1XA 1NQDA 2BJSA 3N35A 4M00A 3SHRA 3VZMA 3J7NA 3OGJA 2J1SA 1H6YA 1NG0A 1DQ5A 1OF3A 2VE1A 2AGSA 2WC2A 2WS93 4K20A 2X05A 5JXJA 3WOGA 4XMAA 1CAWB 4BQ5A 4UW3A 2D93A 3ETPA 4Z07A 3FLRA 2XDVA 1Q5OA 4LKDA 2D97A 5CFDA 3AKSA 2J1UA 2RR12 1S0FA 1LHNA 3MFCA 1DLLA 1LHUA 2V4VA 1FAYA 4EV0A 1LOFA 3I7DA 2JX9A 3H1MA 1TQ5A 2PQQA 3MYXA 2WYFA 2OX0A 1DYKA 4IEXA 4CDWA 4TWTA 3KHCA 3BPSA 3K4ZA 3JCIA 2A6YA 3MW3A 4MADA 3O7OA 3SISA 1G9AA 3T08A 4WBBA 1D2SA 1E5IA 1W3XA 4L0PA 4PQQA 3H50A 2WZR3 3AZVA 4JQTA 4WVWA 2VZUA 4M3CA 2ZX0A 2DVGA 4LA2A 3WG1A 3RZJA 3OD0A 1E5HA 1GP5A 1ZZ6A 2WWJA 4CE8A 3L9JT 1ZRRA 3P1IA 4RS5A 5D8AA 1FX5A 2RS31 3IB3A 3GZEA 5BXXA 3NNMA 3EB7A 3OGSA 5C7GA 1WCUA 1WLDA 1VBE3 4S2DA 3WF4A 2VOWA 2YZ4A 1U0AA 2P34A 2WFF2 3JQXA 4GH4C 2RMU2 3VKOA 3EMRA 2CWSA 2RR13 2VNOA 5F3IA 4C1WA 4IXLA 3GJAA 3BTZA 1XU1A 4AI3A 4MX3A 3MIFA 4QPGA 2BZDA 4AI2A 5C5UA 2BQPA 4CVUA 1CAUA 3AP6A 3FL7A 3MF9A 4XE9A 4Z82A 4HVQA 1HV0A 3BOPA 3GCXA 4N43B 4DINB 4O9GA 3ES1A 4J6GA 4OYUA 4B3NA 2C24A 5T5OA 3H8XA 1GWLA 3W58A 1ZZ7A 3AB0A 3BYWA 4YFZA 4F7ZA 4FI9A 5FPUA 4TXWA 1Z78A 3M3IA 5A33A 1T2XA 2WSUA 5FLHA 3WD5A 1CONA 1EUTA 4QU2A 3VBOC 4GJYA 4Q4V2 3KVBA 3J4UH 1PK6C 5LB6A 1ZBE1 3KCYA 3WG2A 1GOFA 3D0SA 4ET7A 3WNMA 1O3QA 1ZBA2 1PO22 4U36A 4AEMA 4Q0QA 4PIYA 1WW4A 5LEKA 3MZHA 3UJOA 4ISRA 4NIAA 4H55A 3VHNA 3E5UA 4MGQA 3U11A 2BU9A 1RUC1 2VQUA 5C4WC 1NZIA 1W28A 3IKWA 3JBG3 1IPJA 1LHOA 1HLCA 1XYOA 3FFZA 2X5IC 3ABZA 4DNYA 4WVMB 3OEBA 4XFBA 4UWDA 3J8F1 1CQ9A 1XNKA 1J1LA 1ULEA 5FZCA 2ZA9A 2XJVA 2GNTA 1QMJA 3ZDSA 4RFT0 3RWNA 2KD7A 3URFA 5LRRA 1YQ5A 1YFYA 3DV8A 1X9PA 3IPVB 3MDPA 3O1UA 1ODNA 1BKZA 1SHWB 3VBFB 4DXTA 4IEQA 3VD9A 2VG9A 2YBPA 4HG6B 3ZXLA 1AYN1 1HXS3 3HD8B 1MVEA 4D6QA 5K8SA 3H42B 1S1AA 4ZPIA 3C7HA 3KF3A 3WUCA 3ZYJB 1QOTA 2W87A 1W8HA 5FZOB 3RG0A 2R072 3O14A 2DCKA 1W9WA 4C91A 1RXGA 3KSCA 2ZZQA 4JGYB 2VZTA 3C7OA 5JI7A 1XNTA 3NV3A 3B9CA 4O7XA 2Y0OA 4EWEA 2D5FA 1L7QA 5LBCA 4EN8B 1IPKA 4YPJA 2VH9A 2NM1A 3HNYM 4I30A 3O1VA 1LU1A 3GALA 1K12A 1S2EA 4FFHA 4FPHA 3U75A 3I3MA 4YVWC 3K51A 4QXBA 4QU1A 3SNMA 1YYNA 1XXNA 4Q0UA 2C26A 1CPNA 4RR3A 1DGRA 1O8SA 1BJQA 4CDUB 1H9PA 5T5PA 4CXWA 1UZZA 4DUXA 3HT1A 4S2FA 2VGDA 3LA2A 4X6QB 3N9QA 5CU1A 4CU9A 3WQ7A 4PHZA 1SLLA 5FMOL 5FP4A 1KD7A 3SKJE 5FZ4A 1GWMA 4Y20A 1NLQA 1G7YA 1NXMA 1PO13 3LOIA 2PHXA 3J9SA 4CXXA 4N43C 2GN3A 5B4XA 2VZ3A 3ACIA 4CEWB 1L7RA 1GNYA 3POEA 2RS51 3OPTA 5JOYA 4QX3A 5FWJA 1H9WA 5FP3A 1BEV3 1LOAA 4E8DA 1Q56A 2AYHA 3NMBA 1D0GA 2HWE1 2VUDA 1YQCA 1SEFA 4XFIA 1MS0A 3UV9A 4EN0A 1PM7A 2YHJA 1RUE1 3FC0A 4BE3A 4I09A 2Y64A 1W6OA 2B4KA 1QIQA 3QH6A 4CDQA 3OUIA 1NCQA 5JXGA 1Z7S1 4DY3A 2P1BA 3MW4A 5FZEA 3O1SA 1W99A 3WNOA 5FMBA 1D4M1 3NRUA 4IE4A 4Q4Y1 4Y1ZA 4BLIA 3QOPA 1R1A3 1COV2 1K5MC 1OQ1A 1WKYA 3N3HA 1AR82 5FBJA 2JDAA 4M0NA 5IW0A 1WW7A 3BCWA 5TSWA 1VRH2 2K9ZA 2YFUA 3AMQA 5I0TA 1T6GC 5F6KA 2E63A 2XJPA 2HWD2 4HL0A 3N7JA 1MQTB 4AQSA 4XILA 5IVFA 4AOCA 2CV6A 4LHKA 1FT9A 5JWPA 5FJKA 2HYKA 4MHUA 4PF1A 2Q1FA 1WCQA 3TNPB 1H2NA 1DG6A 2HWF3 2D3SA 3AKPA 4YGBA 2QUOA 1ZX5A 1L3JA 3NNGA 5JOXA 1V9U3 1QDCA 2WA4A 2XH6A 3O1MA 2ZGQA 2VZVA 1J84A 2WYSA 3S0MA 3USUA 3ELNA 3V0AB 5CFCA 4TN7A 3POJA 4A45A 5D2AA 5FP8A 3I2DA 3O5SA 4Q5OA 2HWC2 3OPZA 5F9TA 2RDSA 5A7SA 4RQPC 4QXHA 4NHXA 2ZABA 4AHWA 3LDBA 4CYDA 2X09A 1JYIA 1M06G 3LEMA 2I2SA 4ES8A 1QJU1 3H0OA 2OPWA 1PIV1 3LSEA 4FSJA 3VV1A 3AZZA 4XYXA 3VBSA 3WF3A 3LIHA 1O3TA 1W9SA 1WCKA 1OA2A 1JHNA 1RUI1 3G6JB 3IT8A 1Y9MA 4Z1VA 3H9AA 1UY2A 1VRH3 1W8UA 2MPFA 3D5OA 1ZZBA 3ORJA 5K4LA 5CG8A 4KBZA 2JE9A 1AX1A 4UF0B 5FBZA 3AXEA 4GXLA 1EV11 2HKXA 4INDA 4QGLA 3KV4A 3Q8AA 3VBUB 3GZTB 3WLUA 2ADEA 4KNCA 4LPLA 3BU0A 4AHZA 2P17A 3VBOB 3VDDB 2WKKA 1ND3A 2CGNA 2R1BA 4JRLA 3T1MA 3F2ZA 2W08A 3NO8A 1V6LA 1H1IA 2GZWA 2PQSA 3I49A 4YW4A 5LW9A 1D7PM 1W6MB 2W91A 3MFAA 4I0AA 2QQPA 1ZRIA 1R64A 5L73A 4M4RA 2XJSA 1AXZA 4CCMA 3L2YA 5JXHA 1VBA1 2QZ3A 1V6OA 1Q8VA 3T4VA 5BNNB 1EAH2 2O14A 5C4WB 5GZCA 2Y0IA 3VD7A 3WUDA 3QBQA 1OKQA 1AL21 2Y6LA 1YJKA 2DUOA 4IEYA 2IXCA 1XC6A 2RDRA 4QB6A 3S7IA 2X5IB 1QQP3 5FYMA 1YO8A 3RRDA 4K1ZA 4QKDA 2AACA 3UESA 3H3UA 5H9PA 2RS32 1WLWA 1W9TA 2XHNA 1OA4A 2Z42A 4Q4X3 1BLZA 2HLEA 2EVXA 4UFLA 5E1RA 4LUMA 3OBAA 4PJYA 1O4TA 3PTRB 4H3WA 2QFEA 1AR63 4NMIA 2TBVA 4O9EA 3ACGA 3WG4A 3GBWA 2FCUA 1HB4A 4XF4A 4LTAA 4DXSA 3W5NA 1W8WA 5IVVA 2BGCA 2ZHLA 2IXHA 1VMJA 1DGWX 4JX0A 5JI9A 4XUOA 1ENRA 4XUTA 4AI0A 2QQWA 2BWAA 2JD4A 5CFDB 2ZMLA 1UU5A 4LBNA 1EPZA 3IDAA 1W0NA 1KQRA 1CGPA 1VBD1 4LIUA 2ZEYA 4LR4A 4CP2A 4LJHA 2YUEA 3LIGA 5CYYA 1LOGA 4AHXA 4XHXA 2EICA 1LENA 1QXPA 2LS6A 3I59A 3K3OA 1UOGA 1W8OA 3KHBA 4CCDA 2RVAA 1MEC1 3HVDA 1FI2A 2DU0A 1GZCA 4YVWB 2DV9A 3OB8A 4IE7A 1ZBE2 4XXPA 2DFCA 4F8AA 4Y22A 2RJKA 3MIHA 1H8TC 4E4HA 2BGPA 3U37A 1C4RA 4M3CB 3WHTA 4JRAA 2VQAA 3FFQA 2P4EA 2JE8A 4LBQB 2DWRA 4TTGA 4B7EA 1Y3TA 2IXLA 4RS5B 3KQ4B 5D8AB 4AVBA 4RFRB 1WWYA 5FZMA 4UYBA 1OQEA 2QJVA 3M3OA 1RC6A 2WNUA 4MVTA 3SKVA 4FFFA 2FDJA 4J1WA 4JVAA 4XJWA 2R7EB 5DAVA 1KITA 4BU2A 2WJSA 1XJAA 4OULA 2CDPA 4YZ4A 4BISA 4CUCA 4EE2A 1YIPA 2Z2SB 4HSLA 1AXKA 2W1WA 4IERA 3ZFEA 3ZSLA 4DRVA 2GMEA 2Y8KA 2VOVA 2XQRA 2HEYF 2UY9A 3KT4A 3LSDA 4KWJA 4QGMA 1W0PA 4UI9L 1TME1 1CZVA 1NLSA 3AMMA 3EQEA 2C4XA 3MUZ1 3RFRA 3HR9A 2RS11 1ND2C 1MS1A 2Q8EA 5FQ0A 2AREA 1C28A 2LM3A 2ZGPA 3WW2A 4DPNA 3PUQA 2WNVA 3OTFA 4RN5A 5KC5A 3MLKA 3I2FA 4MXWA 3OY8B 3LDRA 1JZ8A 2HBUA 2OS2A 5KXBA 2PA7A 3K48A 5L7OC 4PLOA 2P6CA 4IW3A 1WLCA 5IAXA 4PDWA 3JB8A 4YVSC 1MACA 4HPKA 2YDEA 2JKXA 3OUHA 1LEDA 4GB31 1CIYA 1RUC3 1LGCA 1G9CA 1UY4A 2LALA 3H3LA 1IG3A 5K0UA 3RMYA 1CAXA 2CNAA 4AK3A 5KBFA 3OG2A 4E4ZA 3AP9A 3R0RA 1A8DA 2YG0A 3MLLA 2JDUA 4XDOA 5E88A 2X10A 4BCUA 2ERFA 1H2KA 3JD71 1V00A 3R05A 2ET1A 1FOD2 1AR72 4P9LA 3TAYA 1QEXA 1GLHA 1QJX1 3J8F3 3PDQA 4NO4A 4AI1A 1SZBA 4UW4A 1UCXA 3S5AA 2VZ1A 5HXMA 4BOWA 5KWRA 2R32A 2XLFA 2CAVA 4BQYA 4HZFA 5L9VA 4K9SA 2XLGA 2A6ZA 4Y3OA 1CX4A 2BRTA 3UK9A 4LO4B 4YYOA 4NR1A 1GNHA 1YUDA 1AYN3 1XB9A 4YW6A 3NV1A 3NV4A 2A70A 1W2OA 5E6HA 5FMOS 4TZDA 2WLQA 5EV7A 5IVEA 3AKTA 1QXRA 1UOBA 4FPYA 5C70A 1WZXA 4QAWA 3MV01 1JHJA 2G1MA 1KJLA 3NAPA 4Q0PA 3WDWA 1IG0A 4XVHA 1XE7A 5FO9B 1KS5A 4QKBA 3D4KA 5H9SA 5IWFA 5SV5A 2TNFA 1Y9QA 1O3RA 1NCRA 1L7LA 1RUE2 1UMZA 2ARCA 3MBWA 3JBG1 3WP4A 5A1FA 1N1TA 4ZZ5A 4JKMA 5KXCA 2C6SA 1ZA4A 4YLZA 5FKCA 4AFCA 4EWAA 2WN2A 4QPIA 3Q8FA 2GALA 3GHNA 2WL1A 3VZOA 1PGW1 1AHSA 1NX9A 4A7YA 4URAA 5FUNA 2AUYA 4XFCA 3MO4A 2LRPA 1JS9A 2DYCA 3AL6A 4RSUA 1UU6A 3KT7A 1AVBA 2HJIA 3NKGA 2VCMA 4Q8KA 4F83A 5J37A 4PBPA 1F15A 1DYPA 1OKOA 2X29A 3WY6A 5GZGA 1O4ZA 2RS53 4AEKA 4FAGA 3MHZA 5DUUA 3KF5A 4IGQA 2GU9A 2HWE3 2HWB1 4XAEA 1JOJA 3BIWE 1MS8A 4ZZ8A 4WVZA 5GJ6A 3N9LA 2GH8A 1RUE3 4P5HA 5J09A 2VW1A 3KV6A 5F3CA 1Z7S3 1QHDA 4O65A 4M3CF 4L97A 2VZPA 1QJU2 4HONA 1PIV2 3ATGA 1D4M3 4Q4Y3 1W05A 3AKQA 4P9GA 1VBC3 2B9VA 5BYNA 1NCQB 4OLLA 4PF5A 4LE4A 1YNAA 2XJQA 3ZYBA 3N36A 4BK5A 3BN6A 4R9DA 3T1LA 3RJRA 3ZN5A 1RUJ1 4LUKA 4ISQA 4ZXKA 3VL9A 2IFWA 4XURA 1RL3A 2IVIB 4OQ8A 1APNA 1HRV2 5A6YA 1BHGA 4DEQA 1RUG3 1MS4A 1YHFA 1W8ZA 1UOFA 2J1VA 2WDBA 1J83A 4GJZA 3ZYIB 4DXZA 2XVLA 5H9RA 1OVPA 1U5YA 3AC0A 3B00A 3KZ4C 2KXLA 3NKTA 2PHUA 2W3JA 3NL1A 2GH2A 4LE3A 1PVC1 3I4IA 2Q1ZB 3VDCA 4HFSA 4FPGA 3KCXA 3I8TA 1WCSA 4FT8A 1H8TB 3J7HA 5DAWA 5FOJB 2ZACA 5KHHA 2EA7A 1ZZ9A 3R4DB 1GZWB 1YI7A 4XW3A 4YZ5A 1GSLA 5CAZA 2ZKLA 2FDKA 2FMDA 2PHLA 1VBA2 4AI9A 1H4HA 1SLCA 1NY71 5GZDA 5CFCB 5CKNA 5A3MA 2KM2A 4DZGA 4MHRA 3N4MA 5LK5A 1U5ZA 2VBBA 1RUI3 1R1A1 2YFZA 4JTOA 2E7AA 1F5JA 3EHKA 3UKNA 4XQDA 4SLIA 4Q1PA 2DCTA 4NRMA 4R9AA 5EIYB 2WWUA 1E5RA 1GP4A 2CAUA 3ME2A 2NYYA 4XQ4A 3P3PA 4UT5A 3DF0A 1HN1A 2ZEXA 2JKBA 1EV13 2A6VA 5FPZA 5FREA 3ZN4A 3POIA 1OSGA 5FKBA 3T30A 4YZ1A 5BNPC 5JSRA 3GJBA 1C3HA 4M4PA 1U5XA 5IJRA 3ZVXA 2P3JA 4AQ2A 1N1VA 1WBFA 2WT1A 2G9GA 3RYPA 3LD8A 4CP0A 1Q8OA 5JZGC 2VVFA 4WM7A 3Q9OA 4AEDC 3HEIA 1TMF2 5L7OB 4QDRA 3RZGA 3VBFC 5HXVA 1VBD2 3AP4A 3ZYPA 4S2GA 2K0GA 2QQOA 1POV0 3FZ3A 2PTMA 3C7FA 4OUSA 4XZUG 1HB3A 2W68A 2B7YA 4D7SA 5I0SA 3CEWA 1A3KA 1AJOA 2ID4A 4JGZC 3VKLA 5LATA 5A6XA 4GD4A 2A6XA 2V72A 2EAKA 2VZRA 4HK8A 4NPLA 3BOWA 1AL23 1BQPA 3HN3A 4TSVA 3ZIWA 3ZXJA 1BBT3 4YWAA 4LKFA 4JGYC 1VRBA 2DBNA 4PIXA 2WS92 3VBHA 2XKOA 5BUVA 1US3A 1B35A 3T0DA 4CCNA 1AYM3 2IXKA 4GH4A 4MO3M 4YM3A 3OBRA 4AEJA 5LA2A 2EIDA 3PHMA 5FRAA 5CB7A 4ONUA 1OPOA 3GYDA 1QJFA 4OZXA 2E6VA 4Z8BA 1GICA 4MYEA 4YM1A 3ST7A 3TRSB 2VMCA 1QH7A 4RYDA 5FDBA 3Q8CA 5FP9A 1TG7A 1KDMA 4XAAA 2IVJA 3WCRA 4CDXA 4XF0A 3I54A 3ZMOA 1DIWA 3N7MA 3SCFA 4NAOA 2NLRA 2FCTA 5FPLA 1ZRFA 3AYCA 3TEWA 1HV1A 2VY0A 4E8CA 5C8CC 3LEGA 3M3CA 4K40A 2QBXA 3HBZA 1RTVA 5EJZB 5LY2A 3ZSMA 4BQWA 5C6CA 1XRUA 4CEWC 4GQ7A 2J42A 2WZR2 1MEC3 4CXYA 3ZXDA 4EYUA 5ISLA 4AQ6A 1FV3A 5DUXA 4CCJA 5EJ1B 2HEWF 2I74A 4EQVA 1QQP1 1NXD1 3RMXA 1OOPC 4QHZA 1SDWA 2G9FA 1CD3G 1VJ2A 5T3NA 4NIHA 1PHMA 1R091 3MPBA 3GBFA 4Q4X1 4G9SB 5FZ7A 1AF9A 1VBE2 4Y22B 3PMSA 4IE6A 1AR61 1CIWA 4A3XA 5A3NA 2ORZA 5JXIA 3FHAA 4CP9B 1IS5A 1QXJA 3JU9A 4M3CE 1RHI1 3C3VA 4QWNA 4WM8C 4K1YA 1POV3 2DCYA 1FNYA 2W1UA 5JCTA 3ZDVA 4LMFA 1DF0A 1UOJA 1MQTC 1TME3 3LA7A 3NJXA 3HPNA 2JG9C 2RS13 1OUXA 2XL7A 4QB1A 3M4FA 3ZFEB 4BQ3A 3N7LA 2QQNA 1PZ7A 3USSA 3WINE 2Q8CA 3HWJA 4BQ2A 3O1OA 4N53C 4OI2A 5DUWA 4LK7A 1CAVA 1ZRCA 3ITQA 3M2MA 2P5BA 4MZUA 1ZZ8A 2WBKA 4XIKA 2E7TA 3WR0A 4Z92B 3D3AA 3KB5A 4GB33 4NHMA 2W1SA 3POGA 5EHDA 4QQHA 1S0DA 2GC1A 1DU3D 4W8JA 1QH6A 5LCWL 2RV9A 2CDOA 3JBG2 3EBRA 4PDWB 3JD73 4KL1A 1MPXA 4XBLA 4BA6A 5KHKA 1QJX3 1OURA 3FX3A 1UZWA 4NPRA 2Y33A 5FZFA 1CAXB 1KEXA 2V09A 3JUUA 2QNKA 5DN2A 1AR93 1QOSA 5FZ3A 2RDNA 1PGL1 1US2A 1XYPA 3MIDA 2E33A 3CHXA 2XJRA 3LWCA 4YG6A 4CEYC 1KXGA 3I2HA 3RPQA 4W6YA 4D8MA 2BDRA 2VMIA 5FXWA 2CTVA 3WDYA 5ANQA 3VBUC 2BBVA 1HXS2 2C0ZA 4M01A 2ZX2A 2VL4A 3IAQA 1OXCA 1UZ0A 4NHLA 2JEMA 2VMFA 1LEMA 3ZXAC 3VDDC 5FPAA 4ZXEA 4FOYA 1IGOA 1LHVA 5KC6A 2VZOA 1U5IA 3LCPA 1W6QA 3HNMA 1YFXA 2XBO1 1BXHA 4CP1A 4HSJA 5IFPA 5CA6A 1RB8G 1S0IA 1UY1A 1ENXA 1DQ4A 1W2TA 4LNVA 2H0VA 3ZM8A 3K77A 5BNNC 1STMA 3KGLA 4RL7A 4YRDA 5C9AA 4P02B 2R041 1KS4A 3ES4A 1IS4A 1DGRN 3S57A 1W03A 2W9XA 3AXDA 3CZJA 3KD4A 4FPKA 4AAXA 3M70A 4FTEA 5BNPB 4FOWA 3SH3A 4XJ8A 1NCRB 1FPN3 3OJBA 2OT7A 1IS6A 2KA3A 3CL1A 2YU2A 5JZGB 4Q4W1 1OH4A 3QACA 4AEDB 2G19A 3U4SA 1J3RA 2FBEA 2PELA 4QPIB 1ULOA 4JC1A 1WGPA 1QKQA 3HOBA 3ILRA 2VXJA 1PO12 4JGZB 4D94A 3MIBA 3HNBM 4XCBA 4RGKA 2VECA 2VCCA 3QCWA 3U14A 5CFDC 1I6XA 2ADDA 4FPEA 1DQ6A 5EFUA 2D6MA 2VTXJ 4HANA 3ZKUA 4AI8A 3PUAA 4MGKE 1PNFA 3E6CC 1BEV2 1LOFC 4FQZA 3WNKA 5EYYA 5FZBA 2HWB3 2GP3A 2ZS6B 2FZ1A 2IWGB 3E5XA 3GF6A 3AFKA 2D98A 5E16A 1O3SA 3HBKA 1Z0HA 2BWCA 4CDWC 1BMV1 5GLZA 4EZ4A 3VHOA 4B4RA 4DO0A 2ZMNA 4FPOB 1NY72 4Q8LA 1XE0A 2PMWB 2VOKA 1ZVFA 2C9KA 3T2PA 1G86A 1LESA 1FV2A 3J26N 2ZX1A 3IMNA 4CTEA 2ZGTA 1XNCA 2W39A 3A22A 5BNOA 4GALA 3GDBA 1NA1A 1R1A2 2PLV3 4I02A 3BTYA 4OCTA 4RHV1 3WNNA 5DDJ1 3V0BA 4RS5C 5D8AC 4LEJA 1RUJ3 4CSWA 3J7LA 4UBHA 3BI3A 3CIHA 4UFHA 1KFUL 4D7YA 3LF7A 4IESA 5C8CB 2R061 1IPSA 4FVVA 4C90A 4K3UA 5GZEA 2BNNA 3SH5A 4OHXA 2NQYA 4LQRA 1W04A 4IQPA 3CJXA 1PVC3 2HWF2 2BFUL 5I8YA 4QPGC 1A6CA 3RYRA 4P14A 1V9U2 1OOPB 2CSGA 4OUMA 2ARBA 4AVCA 2IUWA 5C3SA 2VOTA 3I97A 2EALA 1W8TA 1KGYA 4C0HA 4C8DA 2UYAA 4QX8A 4XDQA 5DMYA 2JD9A 2YGLA 2E51A 3PJQA 1GUIA 4ZS3A 5FZ8A 2Q0AA 4Q1RA 4LHLA 4ASLA 3THCA 2ZAAA 2RHPA 4KMQA 4PLMA 3SLIA 1Y43B 1VBC1 5JSPA 4KH9A 1W6PB 4WM8B 2P2KA 4YARA 1ASJ3 5FYBA 4TLFA 3AK0A 4P9JA 4QQPA 3I3QA 3D8CA 5A7QA 3THPA 4PCRA 4IUGA 3U10A 3OYWB 3ZFFA 3MEPA 1RYYA 2YV8A 2NMOA 1C1LA 1G8WA 2YY1A 3M3EA 2JG9B 1RUG1 2W95A 4R9CA 1JOBA 3CJIA 4CCEA 4JKKA 1QJY1 5CNAA 3ZXGA 2FZ2A 1QJEA 4H7LA 3UGGA 1OLRA 4K8RB 1F9KA 3WG3A 4Z2WA 4N53B 3NV2A 1H2MA 3D6EA 3AVRA 3LEIA 2XQXA 4WZFA 2XPJA 3MIGA 2BVBA 2XXZA 4DB5A 5F37A 4FTBA 3H7JA 5FYZA 1E57A 4IGOA 4BQ4A 5JOWA 4JDNA 5CIRA 4WM7B 1LGNA 2KR2A 1OH3A 2VMDA 2ZGOA 1HRI1 4V2VA 4P08A 5JMCA 4BYYA 1UW8A 5A7WA 1GFF2 1Q8QA 2Y6FA 1S55A 2D6PA 3ACLA 3ZMNA 5FPVA 1X36A 5FYVA 1QQP2 2VMGA 1RINA 1JZ3A 4IETA 1ODMA 1JU4A 1CN1A 1R092 5DZGA 1YQ2A 4Q4X2 3WNLA 3VBRA 2EXHA 2V73A 4WZCA 3RDIA 4CEYB 3VBHB 3NNLA 1ENSA 1AR62 1S2KA 2XL9A 3UETA 2YC4A 5AVAA 1B35B 5ABJA 3AKRA 2ZCWA 2ZEZA 2FDIA 4ATEA 3A0KA 2DBIA 1V6JA 3ZN6A 5CBLA 1OLME 1S0BA 2A71A 4BXFA 4ITCA 4DUVA 2DVBA 4E2QA 4Q27A 4RR3C 1XYNA 2HBTA 3DPRA 2QQKA 3ACHA 4RGGA 2YB7A 1MZ6A 2EIEA 1TE1B 5C5TA 5AC93 5A6QA 4CDXB 3QH7A 1HQNA 4JKLA 4ES9A 3VGIA 4JDMA 4BIFA 1RUOA 2WWSA 4AGVA 4ZY9A 3DCQA 4BK4A 5B2GB 4P5YA 4FPCA 3I3BA 4J25A 4Y24A 1BBT1 5FK7A 4QX1A 2ENRA 1MS5A 4MGYE 4MUVA 4EZHA 1S4CA 2G9ZA 5A6ZA 1R093 4V2WA 1AYM1 2YXSA 3ZPYA 1UMHA 4JDOA 1CJPA 2OQ7A 1J1TA 1HW5A 1RUH1 1Y9GA 2WAOA 4R52A 2WO2A 4MH0E 4XCAA 4FXKB 3WVJA 3X29B 3BTXA 4X8PA 1CR7A 4UFKA 3O0WA 1RUF1 1MVQA 3ZYRA 4CDQC 5EQUA 1LOBA 1NCQC 1RHI3 1X7NA 4S2HA 4EN6B 5HCBA 3GCWA 4IL7A 4FXGB 5IUQA 5FYCA 1A78A 2QDNA 4P9YA 4IV1A 2O8QA 2XHKA 3LB9A 3I2GA 2W94A 3WQBA 3RZLA 1VLNA 5LA1A 3WF1A 2JDPA 3Q8EA 3NQHA 4LBLA 3SCHA 5DPNA 1RXFA 2OKXA 4LOSA 4B29A 1S2BA 2PYTA 4XF3A 4D6RA 3ZIXA 4LK6A 1W8NA 4CDWB 2SLIA 3MGUA 1UD1A 3OGRA 3MV11 2WZPP 2EXIA 3HT2A 5AFBA 3WP6A 3H3ZA 4AGGA 1QF3A 2A3XA 3POSA 3ZYHA 3I3EA 4JQRA 1Q43A 4AQTA 1SFPA 5FK8A 5JAXA 5CKQA 3ZFGA 3DYPA 1RUC2 4GKYA 5EXOA 3RS6A 1PMJX 1IS3A 5CFCC 1VAVA 3VDBA 3VKMA 3IBMA 4W65A 4IV3A 4QX5A 4W6XA 1QDOA 4XBQA 5I91A 4Y1XA 1CAWA 1YXWA 3VKFC 5CKMA 5EPAA 3J8F2 3VB9A 4B1MA 1VBB3 1UNBA 5KR7A 5KHJA 1VAMA 2JDYA 3KQRA 2W46A 5JIUA 2UWCA 1JUIA 1SFYA 1LGBA 4Q29A 1POV1 5HBAA 4QPGB 3VBSC 4Q4W2 3FUOA 4XJAA 1CAUB 1DGLA 3N7KA 4P00B 5GLUA 1CX1A 2YC2A 1AYN2 4TLGA 2UYBA 5A3WA 3LFIA 2ZGRA 5FZ0A 2P37A 1J58A 1OI6A 3VL8A 1TZOA 1W8FA 4FFGA 1UKGA 4G4FA 4I0WB 2DTWA 1SPPA 2MEV1 1V6MA 4DQAA 1V0AA 2J1RA 1SCRA 5A80A 2Q30A 4NN0A 5FY7A 3T0AA 2J1TA 5FAXA 3ZR5A 5A33B 2XBO3 5IYYA 4X6RB 1H6XA 2B42B 2JJ6A 5JZGA 1A34A 5AFEA 5A7NA 2WRAA 2YBSA 1ND3C 2Z79A 3O1RA 1H30A 4UFMA 5LEJA 1W6QB 2SBAA 1VAKA 2R043 4WVVA 1BMV2 4CRQA 1BZWA 3WDTA 1ULFA 1I9RA 2P6HA 3IDBB 3AVSA 3PMEA 3HQXA 1EP0A 3LPFA 5FLIA 1PZ9A 2RG4A 4I0BA 4H7MA 2B5HA 4L99A 1AR91 3POBA 4Q4W3 2DF7A 3G7DA 1S0CA 2R30A 1O7FA 1YCIA 3U4XA 4N7UA 1MZ5A 1O8PA 2DDUA 2VUAA 5HPOA 1C1FA 1GU3A 4ARXA 5J7MA 1EUUA 2OYZA 4E4SA 3HJRA 3W5MA 5LY1A 1C57A 2WQ8A 5J98B 1NUKA 5KHGA 4YGCA 1GKBA 1OFNA 4HBNA 3AP5A 5DG1A 1BK1A 2RS52 2GDFA 3DYMA 2VU9A 1XU2A 3VUOA 1Q8PA 4MV2A 3SXWA 4B4PA 2ZHNA 4G3YC 1EPWA 5GKAC 1CVNA 4YW2A 2HWE2 2BFUS 2ZGUA 1UWWA 2ILMA 5JMOA 3GXUA 3RQ0A 4MGZE 3UKTA 4GMP0 1RMU1 4PT6A 4XFAA 5EJ3A 4JTNA 1AUYA 1Z7S2 5A7PA 3WEZA 4IE0A 2G4IA 3ZO0B 4A6SA 4LO7A 4QDSA 4BQ1A 1FPN1 1GP6A 5FZLA 1D4M2 1UAIA 2VD7A 3F95A 4Q4Y2 1UXXX 3UJQA 1VBC2 1JZ6A 3FE5A 4LULA 4AFMA 3WW1A 4E27A 2YC0A 4RHV3 4Z2AA 5DDJ3 2CWMA 2VAUA 4RR3B 4A44A 2VVEA 3OCPA 4XDPA 3POYA 5F5QA 4WVMA 3DEMA 5A32A 1UN1A 2RMU1 1NA1B 4BXSV 3MW2A 2R063 3NNFA 1RUG2 4L2NA 2ZTNA 5IVBA 4Y20B 1SCSA 1DZRA 4I01A 3SH4A 2WSVA 1AX2A 4UW5A 1OPMA 1IKQA 2XVKA 2XLAA 4JHTA 3VBFA 3N9OA 2WNUC 3LAGA 3KWVA 2X8KA 5GLWA 3T2OA 4NRQA 3APBA 3EXUA 5FLJA 1BVVA 4LLOA 1JI6A 3AZYA 4N90A 1UPIA 1KJRA 3VZNA 1MS3A 1UO9A 1SBDA 1I5PA 5T50A 4C1XA 4BJ0A 4F3JA 3ZFEC 5FZOA 4LBKA 1S0EA 4UXAA 3VZJA 2EF6A 4A7KA 4LBOA 2Z69A 4OVEA 1XNBA 3E1F1 3BPZA 4KG0A 5I0UA 4QHOA 3T2QA 4XFFA 1UX6A 1MS9A 1Y7BA 1W6OB 2OZ6A 2WNVC 3B94A 4IE5A 4CDQB 2GNMA 4GAZA 1IKPA 1RUI2 1PO21 1ZBA1 1YRZA 2PHTA 2PLV1 4DEVA 1E5SA 4YSFA 4LHNA 2TUNA 5A70A 3LGRA 1YQ6A 2VOXA 2IZWA 2WN3A 1OD5A 2VPVA 1PMHX 4NROA 2C1FA 4B8EA 4PDWC 4CDUA 1XQNA 1EV12 1B09A 3C8XA 2OUJA 5F5CA 1OC1A 1QJY3 1V6IA 1MR5A 1F35A 1WUVA 2B45X 3WHUA 3T3YA 5A3PA 5JR2A 1LB2A 4A3ZA 2WNOA 5I0DA 5KHIA 1C8NA 4HOOA 2A1XA 1I5ZA 2W1QA 1H0BA 3ACFA 4JV4A 1WA4A 2JG8A 1XSRA 4MG2A 3IWZA 4C0BA 3S5QA 5HV4A 2E32A 2VTXA 5L36A 3POWA 5F7UA 3MF6A 4ASKA 2EXKA 4XXAA 5K9YA 5HCAA 3B02A 1HRI3 3PU8A 3K75B 3WNXA 3H1WA 4CCLA 3USUB 3DKWA 1AL22 1TEIA 2W47A 1DP0A 2ORXA 1LCLA 1BBT2 1YI9A 2ZOEB 3KMHA 3OSDA 2GC3A 3T2TA 1PZ8A 3O0VA 3PUIA 2VULA 1ASJ1 5A7WB 1QJZA 1PGSA 2VCAA 3T09A 4A6OA 4QXKA 3U07A 4QT6A 1JZ7A 2A75A 2PHRA 1AYM2 1KDKA 3NAPC 1RVF3 4GWJA 3VBSB 5F5IA 4GIQA 1U12A 2P3IA 1F4AA 2QQMA 3TB0A 2F4LA 3TWIA 2XWJB 3SCGA 4QDQA 2FDGA 1NCRC 1SLIA 2A3WA 3VBRB 1GV9A 2AH2A 2NN8A 2QZ2A 5I8TA 5J3UA 3WDXA 4LBMA 1C8M1 5ABJB 2R6QA 2WZ8A 1MQTA 1LECA 4FCAA 5F6LB 1OVSA 1LR5A 2JWPA 4QPIC 4BPZA 3S30A 2LROA 3ZN6B 1ND3B 2JB8A 3AP7A 1UQXA 1JYVA 1QGLA 3NJZA 2BW8A 2J7MA 4OI4A 4W50A 5EYXA 1GOHA 5FYSA 5JPNB 2BPA2 4L8QA 2UWAA 1MEC2 4RGAA 3O1PA 5FZGA 4DMIA 4U2AA 3NW4A 3LKJA 2WINB 1QNWA 5LASA 3V64A 1AZDA 1W9YA 4FQ4A 4GZ9A 3ZYFA 5ACA3 5LWBA 3V0AA 3RI8A 4QM8A 3ASIA 1RITA 2XGXA 2EXJA 2VZQA 2ZMKA 3UKVA 3UL2A 5A3UA 4OI1A 4GA9A 4AVSA 4A4AA 1XNAA 3J7MA 3MICA 1N3QA 1R083 4KQ7A 4XC9A 1DZQA 3EO6A 2JDHA 1FMD1 2O1QA 4A2UA 2DFBA 2K46A 1RUH3 3BALA 4FOVA 1AJKA 1DHKB 2OA2A 2BYVE 3RZHA 3M1HA 2Z5WA 1XBFA 1RUF3 3INAA 4Y5Z0 4AVVA 2NP0A 1DDLA 3U78A 2E26A 2VNVA 3IDEA 4HMZA 5FCCA 1JODA 1RGSA 2QKDA 1COV1 1QOOA 5F32A 1WW5A 4IEUA 5J36A 1AR81 4UF0A 5F3GA 5H9QA 4PQ9A 2Q1MA 1TME2 3FUQA 2HWD1 4NJ4A 5AC91 4AR2A 1RIRA 5HI0A 5IATA 2RS12 3CF6E 3I3DA 2DVAA 3VBOA 1UYXA 1GMMA 4K8FA 4YGDA 1PK6A 1X8MA 1F2NA 3CZUA 2JIJA 2Y26A 4XABA 2BOIA 1W2NA 2DCJA 5FYYA 3WSOA 3WXPA 5FMCA 2QQUA 1LRHA 1W6MA 4Y1YA 3I59B 4UFJA 5F5AA 2E53A 4HVOA 2VMHA 4LXLA 3S7EA 2UY8A 2IXJA 5C4WA 4HVRA 4XJZA 5T54A 4NHYA 2BBAA 3KV5A 4GB32 2J1AA 1GOGA 5L19A 5JPMB 1REDA 1VPHA 2X5IA 4I3GA 1UKRA 4IEVA 4B4QA 3JD72 5FO7B 3ZFGB 3GM8A 1QJX2 2B8MA 3AM2A 4O61A 5CZKA 3P5BA 5FZ9A 2D3PA 1SBEA 2AEYA 1VE0A 2DTYA 1AR92 4IV3B 4QGNA 3ZSKA 1O91A 1Y4WA 2WNUB 4BH9A 4CCKA 4CU6A 1NQJA 1N3PA 3K3NA 1DCSA 2A73B 3JXSA 4LKEA 1N1YA 1DQ1A 5IK4A 4HXCA 1DBNA 5E89A 4E9KA 1JYTA 1V6KA 4K21A 3ZR6A 2MEV3 2YYOA 4LORA 4OMDA 4AVTA 5I0RA 4BB3A 3B69A 1ZRDA 5LK7B 1JTZX 1UX7A 5FQ0B 2NMNA 2VNRA 1ULPA 1JN2P 3AMHA 3CDZB 2WNVB 3R4UA 4JAAA 1SPPB 1RUD3 1W2UA 2RM23 4MXWB 3VD3A 1HB1A 2EIBA 2GC2A 2R0HA 4WM7C 1CESA 1PX4A 4QM9A 1V6NA 1HDKA 5DQ0A 1SMVA 2OQ6A 4D0QA 1H1AA 4YVWA 3R6SA 2QCSB 4ASMB 5CG9A 3LOBA 4LBQD 1JMUB 1EAH1 1RMU2 3PVOA 4BMEA 5G05L 4HK9A 4XFGA 5CADA 4HPKB 1ZM1A 5FZHA 2RDQA 2XWBB 5K0UB 5J1XA 1J3QA 1VBB1 1FPN2 2DVDA 2HEVF 2VQ0A 4LBQA 3A23A 4Y1VA 5FPBA 5D21A 1F31A 1MZFA 5JIAA 1W0OA 5FIXA 2BOJA 5LBEA 3RZMA 4E4DX 3VBHC 1PM4A 3A0NA 1PGW2 4YG3A 5FOBB 1UZYA 1B35C 2ZPXA 4ORFA 5FZAA 5FYHA 2AR6A 3BGAA 3HIFA 4Q0SA 4BZ4A 5IT6A 1I1EA 4GWIA 4NAMA 1YIFA 2VBPA 1W6NA 2VR4A 3DN7A 2DUQA 3PUSA 4Y1UA 3RI9A 4NUBA 3WQ1A 1VR3A 2XOMA 4N9IA 4XEZA 3AZXA 1JYNA 4XUPA 1J3PA 2JDKA 4NOTA 1YEWA 4R9BA 1X82A 5FXZA 4AXOA 2IXIA 4AFDA 4B1LA 1REEA 3LZZA 1HQLA 2CL2A 1DZTA 3RYKA 2CGPA 2LTNA 5FXVA 1FATA 1QY4A 2HWB2 4CDXC 5A3TA 5LBFA 4OHYA 2D43A 1W2AX 3THDA 2A5ZA 2FD8A 5FPXA 3NAPB 3OBZA 3OY8A 3WP3A 1EYBA 2ZGKA 1EY2A 5DZFA 1RMU3 1LHWA 2PHDA 3BODA 2OIIA 2QDRA 1HJGA 1WD3A 2IFRA 3B93A 3IDCB 2JDZA 5J96B 3OBTA 3WV6A 3KCCA 5C3QA 3GBGA 1K5MA 4ATFA 5IK5A 3CBNA 5B4NA 2PN5A 1OBNA 3AFGA 3B5LB 1BVP1 5FFOC 2B39A 2JICA 3AYDA 2PLV2 1UYYA 1WD4A 5F2SA 2X53S 2BNOA 4FP3A 4NIGA 1RUJ2 1OA3A 2WFF3 4MGTA 5I93A 2RMU3 5EZWA 2HYXA 1JU3A 3MI8A 4MGIE 3OEAA 1TNFA 3AX4A 4MSVA 3QLQA 5FYIA 4X8NA 4Y4YA 5G04L 1DQ2A 3ECQA 2OUHA 2XUEA 5A32B 4NWWA 4EROA 2D6KA 1PVC2 2Q5TA 2FDHA 2XB6C 4KWKA 3AL5A 1ZZCA 2VNGA 2YGMA 2XUMA 4RQPA 1C5IA 2VUJA 3IIAA 4IEOA 1JOPA 4XFHA 4URTA 3AMPA 4LKSA 1LULA 1WMEA 3TNQA 2F17A 3M7AA 1TVGA 3PIGA 2D7FA 4AW7A 4AE2A 4BQXA 3GHMA 1G6NA 5FY5A 4XACA 1W3VA 4Q4V3 2YPDA 5CISA 2VQTA 1VB2A 2ES3A 1SQ4A 2H0BA 1OF4A 3BKZA 1ZBA3 1OMIA 1CZSA 1PO23 1UY3A 5HCHA 1N1SA 2VTFA 1ASJ2 4DFSA 1XPWA 2VUCA 4K7JA 1W06A 2B46X 2E31A 3N9NA 3OD4A 3FLTA 3C7EA 1O5LA 3AYAA 4AGRA 4XJUA 2CHHA 3VHRA 1ULGA 1YQ8A 4HKOA 2WABA 1GBGA 1H2LA 3K46A 3ZPOA 4HN1A 4OZOA 1GANA 1SBFA 4Y4RA 5FUPA 4YZ2A 1GWKA 1FOD1 1AR71 5F3EA 3OOXA 1GR3A 4YM2A 1NYWA 5FUIA 3OGGA 5KXDA 4YM0A 1A8MA 2QQJA 3HQRA 3PVNA 4CU7A 5J48A 3FMGA 1C8M2 3H7YA 5JR7B 3FHQA 2YROA 3PLQA 4CU8A 2J22A 1YJLA 2LUWA 2WQZC 1F4HA 1X8EA 2GSYA 3ETQA 5DUVA 4CPBD 2NZ9A 4QPYA 5F1RA 4AVAA 5JSOA 2QE3A 5LA9A 3ILFA 4DUWA 1H4GA 4SBVA 2P3KA 2GC0A 4RD7A 3CLPA 4LIVA 2JG8B 1UY0A 4CPBA 3BIEA 2VZSA 2D6LX 5FTTC 5DAQA 2R073 2A6WA 3WF2A 1HX6A 4XF1A 3DXTA 1POQA 3OF1A 2DURA 4IEWA 4PBOA 2R49A 3E6DA 4NHKA 5EWSA 1HN0A 4KU8A 4N8MA 1DYOA 1CZTA 1D4VB 2JIGA 4AWDA 1SLTA 3GNEA 2OPKA 1W9FA 1LTEA 1ST8A 1FMD2 1XNDA 3KV9A 3A7QA 1YWKA 5ERLA 1T6BX 3BU7A 3O12A 2PFWA 3ALQA 5T5LA 5T52A 2Y6GA 3POFA 2AENA 4CUGA 1UYPA 1X33A 4R4ZA 5DXDA 5C9AC 4Y5TA 2JENA 3RZZA 4ARYA 3IN9A 1C8M3 3W59A 4CCOA 3VLBB 4EN9B 5LRSA 1SDDB 2O0OA 2ZX3A 3MIEA 4CZSA 2BTVC 3VHPA 2CGOA 2WZEA 2AZ5A 2A7AA 2UU8A 2Q8OA 3WZ1A 4AG4A 4GMP1 2AC1A 4H2AA 4L9BA 5AC92 4XTMA 4TYSA 4COWA 1ZYBA 3DECA 1UIJA 2JECA 4PI0A 1X50A 2C9AA 2EIGA 1H8TA 5FP7A 1S0JA 2N7GA 1ULDA 3U0ZA 5JUVA 1GZWA 3CU7A 3NJYA 3RGBA 1F8VA 1DFQA 1WBLA 3B7MA 1LODA 2QTWB 2PAMA 2F4PA 2YMZA 3WNPA 4EWDA 4HKLA 4DIQA 4FO9A 4BDVB 5FY0A 4WV8A 4LO8A 1RVF1 2UWBA 3JB4C 4XHBA 1FMD3 1F5FA 1NLRA 3BUCA 2PXJA 4R8HA 4XBNA 1OQDA 3MUY1 3C7GA 2FMYA 1GYKA 1OLQA 2GN7A 2L9LA 2W0XA 2WIIB 4NVPA 4OQ9A 1UMIA 2ARAA 4GH4B 4Q26A 4UW6A 5APAA 1OT5A 1LAJA 3EYPA 4D3WA 1D2QA 1AX0A 3OUJA 1LJ7A 3LEKA 1RHI2 4AHYA 2WT2A 1CPMA 4I2OA 3HAGA 5DZEA 4D7TA 1COV3 3TYJA 4BIOA 5C71A 1SLBA 1AR83 1JZ5A 3B3QE 5BNOC 3AMNA 4AFAA 1QNYA 1ND2A 3DUIA 1SACA 1NA1C 2W52A 4FPFA 1M4WA 1W39A 3L2HA 2HWD3 1HB2A 2ZHKA 3QD6A 1HRV1 2CYFA 4LHSA 4FP2A 2WA3A 3KM5A 4CCCA 4FTSA 3PVEA 3B01A 1DLCA 5L7OA 1XE8A 2ZJCA 3M3QA 4EN7B 3TN91 5FY4A 5ACA1 1XOYA 4YVSA 4IGPA 4COVA 1PK6B 5F39A 1FNZA 2JDMA 5KXEA 1UZVA 3THTA 3VKNA 1YFWA 1R081 4YW7A 3TOJA 3PL0A 2HWC3 2WNEA 1O5UA 4PI2A 4XUNA 1UL9A 3VZLA 4Y26A 3SEEA 1LNSA 4A42A 2XMLA 3ON7A 4KI5M 2MNGA 1NE6A 1YFUA 4COUA 2DVFA 3E6BA 1OLMA 2ARXA 2JXAA 5FO8B 4P9IA 1VBB2 4AF9A 5FYUA 1AL0G 5C3PA 4QX0A 3S6PA 3MPPG 1PGL2 1K42A 3NSTA 4AFBA 1DQ0A 4FOQA 2Y6HA 2VO5A 4YW5A 4P9WA 3ZFFC 3NWKA 3AJZA 5F2WA 1K45A 1NKGA 2FCVA 4AZZA 1D0HA 1GQHA 5IVCA 2Y6JA 4LOTA 5DABA 2AEZA 3CQOA 2VCBA 5GZFA 5GM0A 3CJIC 1N47A 1PVXA 3FHIB 4XIOA 2XBO2 1OFSA 3HQUA 3T4HB 1RJ8A 1TMF1 2F6BA 2OW4A 4YGEA 5BV6A 2VM9A 4E2GA 1ACCA 5DAXA 3ZSEA 3RNSA 5IK8A 4PIZA 2O8OA 3FBMA 1CAVB 5FY1A 4CA9A 4Y5SA 2R042 1BK0A 1EAH3 5AVPA 2RJ2A 5FR3A 3IM0A 1LOEA 4D69A 4YG0A 4N9HA 2R0FA 5ANNA 1SLAA 3WCSA 2BGOA 2WS91 3DGTA 3DL3A 4BWOA 4DOUA 1WA6X 4ZKTB 5T5JA 2RS33 3DKQA 3LPGA 1JYCA 4CP9A 2TEPA 2XONA 3A21A 3GZAA 2Y6KA 3V56A 2BEOA 3N9PA 3VBRC 2OVUA 4QKNA 4BMBA 3RWKX 3PJYA 2JB4A 2W92A 1MZEA 5ABJC 2QQVA 4JCKA 5BPXA 2P3YA 1XSQA 3SC7X 5SV8A 5HV0A 5FWEA 2ZBJA 2ZZJA 1IZ3A 5L9BA 2ZHMA 4KU7A 1IOAA 1SFNA 1W6NB 4LO6B 1RUD1 1PX3A 2PHFA 2RM21 4XOGA 2ATFA 4AL9A 1QU0A 3CNAA 1BYHA 4E2SA 4P9XA 5FMDA 4XJ9A 2GP5A 3MLJA 4DRRA 1KRIA 2V5YA 3CO2A 1GZTA 3DPRC 4J1XA 2D3RA 2GAUA 3H8RA 1HQWA 2WO7A 3FN9A 3HMYA 2WZR1 3WF0A 1NT0A 3R4SA 5C3OA 1UIKA 3LA3A 2XR4A 3A4UA 1LOCA 5FXXA 5C9AB 4DXRA 1ZBE3 2ZGLA 5JLVA 2WT0A 3N9MA 4L92A 3TEYA 1NAEA 2Q4SA 4QD2A 3TN92 3O1TA 1OD3A 4L11A 4RHV2 5GALA 5A1LA 3DYOA 1K5MB 5DDJ2 2BERA 2PAKA 4FPJA 1VBE1 1GQGA 1W90A 3WDVA 5A3LA 3UNPA 4OUEA 4QHBA 2RR11 4N43A 1G9FA 3SEPA 2R062 4JZRA 4NPMA 3TEZA 3VDAA 2Y60A 3LQCA 1J59A 1UU4A 1HIXA 3ZXKA 5DG2A 2OXBA 4BLJA 2XJUA 4KG8A 2BNMA 3ZLIA 3NJVA 5GLTA 4COYA 4GKXA 4OHVA 5L9RA 1VP6A 1CWPA 1OHFA 1NE4A 5HCFA 1ZREA 4IV1C 1REFA 2YPJA 2BP6A 3OPWA 1JYWA 2BVVA 5FV3A 4YZ3A 4XUQA 3VD5A 3KT1A 3FWEA 4QXCA 5E8AA 2ZGSA 3ZOIA 4UFIA 3WQ0A 4ZU7A 4RQPB 3W20A 2A3YA 2WLPA 3K4AA 4NRPA 5T55A 3SMHA 4YW3A 3H8UA 5CEHA 4OI0A 4KGQA 1K3IA 3KS7A
chains in the Genus database with same CATH topology
4UAPA 2W91A 2E26A 3HNBM 5A1AA 1R64A 2VCCA 4M4RA 5JXHA 3PUHA 2J1EA 4QPWA 1O59A 3VD7A 4CUBA 3VD4A 2Y6LA 1IQDC 2WUHA 1XC6A 4QB6A 3WNKA 4UOJA 3I3DA 3IAPA 1UYXA 1GMMA 3UESA 2VC9A 1UYZA 3CZUA 2XHNA 1W9TA 4QB2A 2DCJA 3WSOA 2HLEA 3OBAA 3T2PA 4MOAA 2C9KA 1UXZA 3ACGA 2ZXQA 4DXSA 3W5NA 3A22A 3T0BA 3GDBA 2BBAA 4JX0A 2J1AA 1GOGA 4XUOA 4XUTA 3WNNA 1JZ2A 3IDAA 1W0NA 3CIHA 3I2IA 2ZEYA 3GM8A 5CYYA 5CZKA 2EICA 1GQPA 2LS6A 4LQRA 1W8OA 2RVAA 2WO1A 4CU6A 3OB8A 3JXSA 2V5DA 2BGPA 3U37A 2VOTA 3I97A 4OMDA 4W4ZA 1KGYA 2JE8A 2QQLA 4TTGA 1UX7A 3K4DA 5DMYA 3CMGA 2JD9A 4A41A 5IHRA 1GUIA 1ULPA 3CDZB 3THCA 4KMQA 3VD3A 2QQIA 2EIBA 3VD9A 1PX4A 5DQ0A 3SKVA 4D0QA 2R7EB 1JYXA 4IUGA 4OMCA 1RYYA 2CDPA 1SG3A 4CUCA 5G05L 2W1WA 3OGVA 2Y8KA 4UI9L 5J1XA 1CZVA 2W95A 3MUZ1 2C4XA 3A23A 4JKKA 2LW8A 4CUAA 4RN5A 3I2FA 1JZ8A 2VMEA 3LEIA 2XQXA 3BGAA 3GGLA 4GWIA 2VR4A 1JYNA 2VJXA 2VMDA 2XOMA 2JKXA 4P08A 4XUPA 1CIYA 1UY4A 2W5FA 3OG2A 2YG0A 2X10A 3THDA 1JZ3A 1JU4A 3LE0A 2VZ1A 5HXMA 1YQ2A 3WNLA 5LA0A 3P6BA 3UETA 2YC4A 5B4NA 2WO3A 5IFTA 2ZEZA 1UYYA 4DUVA 5C70A 4QAWA 3MV01 2HYXA 1JHJA 1JU3A 2QQKA 3ACHA 2YB7A 4XVHA 3OEAA 2EIEA 2WAAA 4JKLA 4MGSA 4ZY9A 5G04L 3ECQA 4BK4A 4P5YA 3I3BA 3MBWA 4QX1A 4ZZ5A 3CKHA 2ZEWA 4JKMA 3I2JA 4LKSA 2WN2A 3I2KA 3IIIA 1TVGA 1UMHA 1JZ4A 4JHZA 4KWUA 2WAOA 2WO2A 1NX9A 2VQTA 1OF4A 3MO4A 1CZSA 1UY3A 2VTFA 1XPWA 1P8JA 2E31A 2Z4FA 3C7EA 3I2GA 2W94A 4QX2A 3WQBA 5LA1A 3WF1A 2WABA 3NQHA 3K46A 4OZOA 5DPNA 2OKXA 2J1SA 1H6YA 1OF3A 2X05A 5JXJA 5FUIA 1W8NA 4ZZ8A 2QQJA 4CU7A 3OGRA 3MV11 3FHQA 4CU8A 3ETPA 2J22A 1F4HA 2VZPA 2J1UA 4DUWA 3I3EA 2B9VA 2V4VA 3DYPA 4BK5A 1UY0A 3BN6A 2VZSA 1PMJX 3VDBA 3WF2A 4XURA 1BHGA 3K4ZA 4DEQA 4MADA 1DYOA 1CZTA 2WDBA 2J1VA 3T08A 1J83A 2W46A 4L0PA 3AC0A 4PQQA 2W3JA 3A7QA 2VZUA 3VDCA 4P00B 2Y6GA 3J7HA 1CX1A 2YC2A 3P1IA 3IB3A 4ARYA 3EB7A 3OGSA 5C7GA 3WF4A 1SDDB 2J1RA 3T0AA 2J1TA 5IYYA 2WZEA 4AG4A 1H6XA 2YFZA 2BZDA 3DECA 4CVUA 3FL7A 5EIYB 4OYUA 5JUVA 1HN1A 2ZEXA 3LPFA 3WNPA 4BDVB 4FI9A 4M4PA 4TXWA 5IJRA 1T2XA 1EUTA 3MUY1 3C7GA 2L9LA 3HEIA 1UMIA 1GOFA 4QDRA 1OT5A 3WNMA 3EYPA 4ET7A 1O8PA 2DDUA 4XZUG 2QQOA 4ARXA 1GU3A 5HPOA 3C7FA 1EUUA 3LEKA 2ID4A 3HJRA 3W5MA 2WQ8A 1NUKA 5C71A 4MGQA 2V72A 1JZ5A 2VZRA 2VQUA 3DYMA 3HN3A 3ABZA 4LHSA 3OEBA 5JMOA 1UWWA 3GXUA 1US3A 3T0DA 1DLCA 4MO3M 4PT6A 5LA2A 2KD7A 3WEZA 2EIDA 1SHWB 4QDSA 4DXTA 4HG6B 1UXXX 1JZ6A 2VMCA 4RYDA 3C7HA 4Z2AA 1TG7A 4XUNA 2W87A 4A44A 3SEEA 1LNSA 4A42A 2DCKA 1W9WA 4KI5M 4BXSV 2VZTA 3C7OA 1XNTA 4E8CA 3LEGA 2QBXA 1L7QA 5EJZB 1K42A 4QX0A 4YPJA 3HNYM 1K12A 3T2OA 2Y6HA 2VO5A 1JI6A 5EJ1B 1K45A 1NKGA 2C26A 1I5PA 4BJ0A 1O8SA 2Y6JA 4DUXA 3CQOA 2VCBA 3E1F1 4CU9A 3T2QA 2ORZA 3SKJE 5JXIA 3FHAA 2VM9A 4DEVA 5B4XA 2VZ3A 3ACIA 2WN3A 1L7RA 2RJ2A 1GNYA 1PMHX 2W1UA 4QX3A 3C8XA 3NJXA 3HPNA 4E8DA 2BGOA 5JR2A 4QB1A 4A3ZA 5I0DA 3LPGA 2QQNA 2Y64A 2B4KA 5JXGA 2W1QA 2XONA 3ACFA 3A21A 2Y6KA 1W99A 2E32A 3WNOA 5F7UA 3NRUA 2WBKA 3D3AA 2W92A 2W1SA 1WKYA 3K75B 2JDAA 2W47A 4W8JA 2YFUA 1DP0A 2ORXA 5LCWL 2RV9A 2CDOA 3PUIA 1PX3A 1MPXA 2VCAA 3T09A 4A6OA 1KEXA 1JZ7A 5DN2A 4GWJA 4PF1A 1WCQA 3FN9A 1US2A 3WF0A 2E33A 1F4AA 2QQMA 3I2HA 3NNGA 4D8MA 4DXRA 4QDQA 2VZVA 1J84A 2WYSA 1NAEA 2VL4A 3IAQA 1UZ0A 4A45A 1OD3A 2VMFA 3DYOA 2BERA 4ZXEA 2WZ8A 2X09A 2VZOA 3HNMA 3UNPA 4OUEA 5IFPA 3SEPA 1UY1A 3WF3A 1JYVA 1W9SA 3VDAA 3LQCA 4W50A 2J7MA 3ZM8A 3K77A 1GOHA 1UY2A 4P02B 3NJVA 4GZ9A 2W9XA 3CZJA 4AAXA 2VZQA 1JYWA 4A4AA 1XNAA 4XUQA 3VD5A 4LPLA 1OH4A 3K4AA 3F2ZA 1ULOA 2PQSA 1K3IA 1D7PM 3HOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAP A;  2W91 A;  2E26 A;  3HNB M;  5A1A A;  1R64 A;  2VCC A;  4M4R A;  5JXH A;  3PUH A;  2J1E A;  4QPW A;  1O59 A;  3VD7 A;  4CUB A;  3VD4 A;  2Y6L A;  1IQD C;  2WUH A;  1XC6 A;  4QB6 A;  3WNK A;  4UOJ A;  3I3D A;  3IAP A;  1UYX A;  1GMM A;  3UES A;  2VC9 A;  1UYZ A;  3CZU A;  2XHN A;  1W9T A;  4QB2 A;  2DCJ A;  3WSO A;  2HLE A;  3OBA A;  3T2P A;  4MOA A;  2C9K A;  1UXZ A;  3ACG A;  2ZXQ A;  4DXS A;  3W5N A;  3A22 A;  3T0B A;  3GDB A;  2BBA A;  4JX0 A;  2J1A A;  1GOG A;  4XUO A;  4XUT A;  3WNN A;  1JZ2 A;  3IDA A;  1W0N A;  3CIH A;  3I2I A;  2ZEY A;  3GM8 A;  5CYY A;  5CZK A;  2EIC A;  1GQP A;  2LS6 A;  4LQR A;  1W8O A;  2RVA A;  2WO1 A;  4CU6 A;  3OB8 A;  3JXS A;  2V5D A;  2BGP A;  3U37 A;  2VOT A;  3I97 A;  4OMD A;  4W4Z A;  1KGY A;  2JE8 A;  2QQL A;  4TTG A;  1UX7 A;  3K4D A;  5DMY A;  3CMG A;  2JD9 A;  4A41 A;  5IHR A;  1GUI A;  1ULP A;  3CDZ B;  3THC A;  4KMQ A;  3VD3 A;  2QQI A;  2EIB A;  3VD9 A;  1PX4 A;  5DQ0 A;  3SKV A;  4D0Q A;  2R7E B;  1JYX A;  4IUG A;  4OMC A;  1RYY A;  2CDP A;  1SG3 A;  4CUC A;  5G05 L;  2W1W A;  3OGV A;  2Y8K A;  4UI9 L;  5J1X A;  1CZV A;  2W95 A;  3MUZ 1;  2C4X A;  3A23 A;  4JKK A;  2LW8 A;  4CUA A;  4RN5 A;  3I2F A;  1JZ8 A;  2VME A;  3LEI A;  2XQX A;  3BGA A;  3GGL A;  4GWI A;  2VR4 A;  1JYN A;  2VJX A;  2VMD A;  2XOM A;  2JKX A;  4P08 A;  4XUP A;  1CIY A;  1UY4 A;  2W5F A;  3OG2 A;  2YG0 A;  2X10 A;  3THD A;  1JZ3 A;  1JU4 A;  3LE0 A;  2VZ1 A;  5HXM A;  1YQ2 A;  3WNL A;  5LA0 A;  3P6B A;  3UET A;  2YC4 A;  5B4N A;  2WO3 A;  5IFT A;  2ZEZ A;  1UYY A;  4DUV A;  5C70 A;  4QAW A;  3MV0 1;  2HYX A;  1JHJ A;  1JU3 A;  2QQK A;  3ACH A;  2YB7 A;  4XVH A;  3OEA A;  2EIE A;  2WAA A;  4JKL A;  4MGS A;  4ZY9 A;  5G04 L;  3ECQ A;  4BK4 A;  4P5Y A;  3I3B A;  3MBW A;  4QX1 A;  4ZZ5 A;  3CKH A;  2ZEW A;  4JKM A;  3I2J A;  4LKS A;  2WN2 A;  3I2K A;  3III A;  1TVG A;  1UMH A;  1JZ4 A;  4JHZ A;  4KWU A;  2WAO A;  2WO2 A;  1NX9 A;  2VQT A;  1OF4 A;  3MO4 A;  1CZS A;  1UY3 A;  2VTF A;  1XPW A;  1P8J A;  2E31 A;  2Z4F A;  3C7E A;  3I2G A;  2W94 A;  4QX2 A;  3WQB A;  5LA1 A;  3WF1 A;  2WAB A;  3NQH A;  3K46 A;  4OZO A;  5DPN A;  2OKX A;  2J1S A;  1H6Y A;  1OF3 A;  2X05 A;  5JXJ A;  5FUI A;  1W8N A;  4ZZ8 A;  2QQJ A;  4CU7 A;  3OGR A;  3MV1 1;  3FHQ A;  4CU8 A;  3ETP A;  2J22 A;  1F4H A;  2VZP A;  2J1U A;  4DUW A;  3I3E A;  2B9V A;  2V4V A;  3DYP A;  4BK5 A;  1UY0 A;  3BN6 A;  2VZS A;  1PMJ X;  3VDB A;  3WF2 A;  4XUR A;  1BHG A;  3K4Z A;  4DEQ A;  4MAD A;  1DYO A;  1CZT A;  2WDB A;  2J1V A;  3T08 A;  1J83 A;  2W46 A;  4L0P A;  3AC0 A;  4PQQ A;  2W3J A;  3A7Q A;  2VZU A;  3VDC A;  4P00 B;  2Y6G A;  3J7H A;  1CX1 A;  2YC2 A;  3P1I A;  3IB3 A;  4ARY A;  3EB7 A;  3OGS A;  5C7G A;  3WF4 A;  1SDD B;  2J1R A;  3T0A A;  2J1T A;  5IYY A;  2WZE A;  4AG4 A;  1H6X A;  2YFZ A;  2BZD A;  3DEC A;  4CVU A;  3FL7 A;  5EIY B;  4OYU A;  5JUV A;  1HN1 A;  2ZEX A;  3LPF A;  3WNP A;  4BDV B;  4FI9 A;  4M4P A;  4TXW A;  5IJR A;  1T2X A;  1EUT A;  3MUY 1;  3C7G A;  2L9L A;  3HEI A;  1UMI A;  1GOF A;  4QDR A;  1OT5 A;  3WNM A;  3EYP A;  4ET7 A;  1O8P A;  2DDU A;  4XZU G;  2QQO A;  4ARX A;  1GU3 A;  5HPO A;  3C7F A;  1EUU A;  3LEK A;  2ID4 A;  3HJR A;  3W5M A;  2WQ8 A;  1NUK A;  5C71 A;  4MGQ A;  2V72 A;  1JZ5 A;  2VZR A;  2VQU A;  3DYM A;  3HN3 A;  3ABZ A;  4LHS A;  3OEB A;  5JMO A;  1UWW A;  3GXU A;  1US3 A;  3T0D A;  1DLC A;  4MO3 M;  4PT6 A;  5LA2 A;  2KD7 A;  3WEZ A;  2EID A;  1SHW B;  4QDS A;  4DXT A;  4HG6 B;  1UXX X;  1JZ6 A;  2VMC A;  4RYD A;  3C7H A;  4Z2A A;  1TG7 A;  4XUN A;  2W87 A;  4A44 A;  3SEE A;  1LNS A;  4A42 A;  2DCK A;  1W9W A;  4KI5 M;  4BXS V;  2VZT A;  3C7O A;  1XNT A;  4E8C A;  3LEG A;  2QBX A;  1L7Q A;  5EJZ B;  1K42 A;  4QX0 A;  4YPJ A;  3HNY M;  1K12 A;  3T2O A;  2Y6H A;  2VO5 A;  1JI6 A;  5EJ1 B;  1K45 A;  1NKG A;  2C26 A;  1I5P A;  4BJ0 A;  1O8S A;  2Y6J A;  4DUX A;  3CQO A;  2VCB A;  3E1F 1;  4CU9 A;  3T2Q A;  2ORZ A;  3SKJ E;  5JXI A;  3FHA A;  2VM9 A;  4DEV A;  5B4X A;  2VZ3 A;  3ACI A;  2WN3 A;  1L7R A;  2RJ2 A;  1GNY A;  1PMH X;  2W1U A;  4QX3 A;  3C8X A;  3NJX A;  3HPN A;  4E8D A;  2BGO A;  5JR2 A;  4QB1 A;  4A3Z A;  5I0D A;  3LPG A;  2QQN A;  2Y64 A;  2B4K A;  5JXG A;  2W1Q A;  2XON A;  3ACF A;  3A21 A;  2Y6K A;  1W99 A;  2E32 A;  3WNO A;  5F7U A;  3NRU A;  2WBK A;  3D3A A;  2W92 A;  2W1S A;  1WKY A;  3K75 B;  2JDA A;  2W47 A;  4W8J A;  2YFU A;  1DP0 A;  2ORX A;  5LCW L;  2RV9 A;  2CDO A;  3PUI A;  1PX3 A;  1MPX A;  2VCA A;  3T09 A;  4A6O A;  1KEX A;  1JZ7 A;  5DN2 A;  4GWJ A;  4PF1 A;  1WCQ A;  3FN9 A;  1US2 A;  3WF0 A;  2E33 A;  1F4A A;  2QQM A;  3I2H A;  3NNG A;  4D8M A;  4DXR A;  4QDQ A;  2VZV A;  1J84 A;  2WYS A;  1NAE A;  2VL4 A;  3IAQ A;  1UZ0 A;  4A45 A;  1OD3 A;  2VMF A;  3DYO A;  2BER A;  4ZXE A;  2WZ8 A;  2X09 A;  2VZO A;  3HNM A;  3UNP A;  4OUE A;  5IFP A;  3SEP A;  1UY1 A;  3WF3 A;  1JYV A;  1W9S A;  3VDA A;  3LQC A;  4W50 A;  2J7M A;  3ZM8 A;  3K77 A;  1GOH A;  1UY2 A;  4P02 B;  3NJV A;  4GZ9 A;  2W9X A;  3CZJ A;  4AAX A;  2VZQ A;  1JYW A;  4A4A A;  1XNA A;  4XUQ A;  3VD5 A;  4LPL A;  1OH4 A;  3K4A A;  3F2Z A;  1ULO A;  2PQS A;  1K3I A;  1D7P M;  3HOB A; 
#chains in the Genus database with same CATH topology
 4MLO A;  1JH5 A;  4UAP A;  4ZU4 A;  2CU5 A;  5JOZ A;  3BVC A;  5A1A A;  2XKP A;  1H8V A;  3KVA A;  3D82 A;  5GLV A;  3P3N A;  2FHR A;  4AYU A;  2DUP A;  3PUH A;  4K6B A;  4NWV A;  4OHZ A;  5BNO B;  2RJL A;  2J1E A;  2WFF 1;  1O59 A;  4QPW A;  4CUB A;  5BNP A;  5FY9 A;  3VD4 A;  2E7Q A;  1C5H A;  1IQD C;  2WUH A;  4Q0V A;  3WDU A;  3ZFG C;  2ETE A;  1PNG A;  5CVR A;  3UGH A;  3V0B B;  4V1P A;  4ZU5 A;  1QJY 2;  1FOD 3;  1AR7 3;  2W2I A;  3EJK A;  3IAP A;  3LFM A;  4UOJ A;  4HKW A;  2VC9 A;  4AED A;  3IPV A;  4IV3 C;  4Q2F A;  1UYZ A;  4QB2 A;  2ZGN A;  3WT3 A;  2GMM A;  1VAL A;  3KGZ A;  1URX A;  4JGZ A;  4BHP A;  4MOA A;  1UXZ A;  2ZXQ A;  5LBB A;  4IDZ A;  1IHM A;  1OUS A;  4RA0 A;  3T0B A;  1HXS 1;  1Q3E A;  1HRI 2;  4R4X A;  3PNA A;  2C5D A;  4JGY A;  2GMP A;  4B7K A;  3UT0 A;  3I2O A;  4Q4V 1;  2I07 B;  2MHF A;  4MET A;  1VMF A;  2R1D A;  3ZKY A;  1JZ2 A;  5C3R A;  2EAA A;  5FY8 A;  5FZK A;  3W9A A;  5A3O A;  3AYE A;  2UUR A;  1QWR A;  3I2I A;  4M0H A;  5FJH A;  2CY6 A;  2B9U A;  3TEX A;  5FZ6 A;  4AAP A;  3PIJ A;  4DS0 A;  3JZV A;  1LKN A;  3E97 A;  1GQP A;  1TNR A;  1RVF 2;  2JDN A;  1FYU A;  2YBK A;  1KFX L;  2WO1 A;  3PU3 A;  1ZNP A;  2HH9 A;  3ZFF B;  4N7I A;  4XF9 A;  4FPL A;  5K0U C;  4LBJ A;  1V70 A;  1AXY A;  5C33 A;  1RUN A;  2V5D A;  2ZGM A;  3TBD A;  1VMH A;  5DAP A;  5FZD A;  2VXR A;  3SQO A;  4ZHN A;  4GWM A;  4Y33 A;  1WMD A;  2VVD A;  5M0T A;  4COZ A;  3CJI B;  2QQL A;  1K5J A;  4W4Z A;  1G9B A;  1JUH A;  5JDB A;  3K4D A;  3CMG A;  2FDF A;  4XPV A;  4A41 A;  1WCD J;  3UYJ A;  3JQW A;  5C8C A;  3O0X A;  1NOV A;  5IHR A;  5IVY A;  2FQP A;  1YLL A;  4GMP 3;  4CEW A;  1WLT A;  2JE7 A;  3VZK A;  5BNQ A;  2ZKN A;  2QQI A;  2DCZ A;  5F8P A;  1PO1 1;  2NPI A;  3C2U A;  3M8L A;  1O6U A;  4KWL A;  1PMI A;  5FZ1 A;  1JYX A;  3ZXF A;  4ZS2 A;  3NVC A;  4NII A;  4OMC A;  1R1Z A;  1ALY A;  1OOP A;  4OHW A;  1LU2 A;  2R07 1;  3BTA A;  4GUL A;  1SG3 A;  4QKF A;  5ACA 2;  3OGV A;  4IEP A;  2RE9 A;  1DGW A;  1Q8S A;  1IQA A;  1BEV 1;  3ZXE A;  3IMM A;  2XJT A;  3K2O A;  4QQO A;  4NID A;  4UBG A;  1R08 2;  5I8S A;  2BUK A;  1VIW B;  4XTP A;  2PHW A;  5JVV A;  1UPS A;  2LW8 A;  1CJD A;  2PAE A;  3PUR A;  4CUA A;  1RUH 2;  3AZW A;  2H6C A;  3DXU A;  4NE9 A;  1W6P A;  5A7O A;  4WM8 A;  2VME A;  4QMA A;  1WW6 A;  4YNI A;  1HJF A;  1QJU 3;  1RUF 2;  3ENR A;  4KBB A;  5K7P A;  1PIV 3;  3GGL A;  3OYW A;  1NZC A;  4KGG A;  2D44 A;  2ZX4 A;  5IVJ A;  2VBD A;  1ZA7 A;  3FJS A;  4I3P A;  5BY5 A;  2VJX A;  2I45 A;  2Y38 A;  1JBC A;  2YU1 A;  2JG9 A;  1O4Y A;  4W6W A;  3H8O A;  3FBY A;  2W5F A;  4ZON A;  2D6N A;  4PLN A;  3RSJ A;  4XET A;  1RJ7 A;  4HET A;  3RZK A;  3H1Y A;  2ET7 A;  1HRV 3;  4FBF A;  5IAV A;  3ROU A;  1H1M A;  4FAH A;  2VW2 A;  4D6S A;  3DPR B;  4N53 A;  1ND2 B;  1ENQ A;  3LE0 A;  4LA3 A;  3VN4 A;  3TN9 3;  3UGF A;  1BCX A;  1WMX A;  1HKD A;  2HWF 1;  3ILN A;  4YFW A;  3PTY A;  3WW3 A;  5LA0 A;  2IC1 A;  3P6B A;  4IEZ A;  1S0G A;  2D40 A;  1V9U 1;  2R16 A;  2WO3 A;  3ZSJ A;  2WFP A;  3B9I A;  3Q8B A;  4LIT A;  5IFT A;  4LO5 B;  3SIT A;  4LLF A;  5IK7 A;  5C8W A;  4LT5 A;  3LDK A;  1N3O A;  1G9D A;  3HN1 A;  5D1I A;  4YVS B;  3WW4 A;  1GZ9 A;  1VBA 3;  3PVB B;  4A7Z A;  4EJR A;  4XZP A;  3RVH A;  3KLS A;  3RJ2 X;  3WX5 A;  3ZX7 A;  3ZYG A;  4MXV A;  2QVS B;  2GND A;  2BV4 A;  4GWN A;  2WAA A;  4CEY A;  2DU1 A;  2D6O X;  2VW0 A;  4MGS A;  4QX7 A;  3VBU A;  2H6B A;  1YC6 1;  1VRH 1;  3W21 A;  2V4A A;  1WMF A;  5EP9 A;  5FYT A;  3E5Q A;  3V65 A;  2K2S A;  2OZJ A;  5FZI A;  3CKH A;  4IV1 B;  3VDD A;  1UF2 C;  2ZEW A;  4XQW A;  3I2J A;  2WQ4 A;  2E9Q A;  1FXZ A;  5LZ6 A;  3I2K A;  2Q8D A;  3III A;  3BB6 A;  3AJY A;  4CDU C;  2MEV 2;  2WR9 A;  2XVG A;  1I3H A;  1JXN A;  2GNB A;  1ONA A;  3IZO A;  1X9T A;  4H14 A;  1JZ4 A;  2Y34 A;  4QQL A;  4JHZ A;  4KWU A;  2D5H A;  4HLT A;  1ULC A;  4BM8 A;  1TMF 3;  5BNN A;  3FLP A;  2XG3 A;  1JW6 A;  1VBD 3;  3D0J A;  4FFI A;  1RUD 2;  2RM2 2;  3NNJ A;  4QQ2 A;  4HT1 T;  4OFG A;  3GZU C;  4YW1 A;  2HWC 1;  1P8J A;  3WP5 A;  2JG8 C;  2Z4F A;  2ZAH A;  4XMI A;  4HN0 A;  1VB4 A;  1GNZ A;  4DY5 A;  4QX2 A;  3U1X A;  1NQD A;  2BJS A;  3N35 A;  4M00 A;  3SHR A;  3VZM A;  3J7N A;  3OGJ A;  2J1S A;  1H6Y A;  1NG0 A;  1DQ5 A;  1OF3 A;  2VE1 A;  2AGS A;  2WC2 A;  2WS9 3;  4K20 A;  2X05 A;  5JXJ A;  3WOG A;  4XMA A;  1CAW B;  4BQ5 A;  4UW3 A;  2D93 A;  3ETP A;  4Z07 A;  3FLR A;  2XDV A;  1Q5O A;  4LKD A;  2D97 A;  5CFD A;  3AKS A;  2J1U A;  2RR1 2;  1S0F A;  1LHN A;  3MFC A;  1DLL A;  1LHU A;  2V4V A;  1FAY A;  4EV0 A;  1LOF A;  3I7D A;  2JX9 A;  3H1M A;  1TQ5 A;  2PQQ A;  3MYX A;  2WYF A;  2OX0 A;  1DYK A;  4IEX A;  4CDW A;  4TWT A;  3KHC A;  3BPS A;  3K4Z A;  3JCI A;  2A6Y A;  3MW3 A;  4MAD A;  3O7O A;  3SIS A;  1G9A A;  3T08 A;  4WBB A;  1D2S A;  1E5I A;  1W3X A;  4L0P A;  4PQQ A;  3H50 A;  2WZR 3;  3AZV A;  4JQT A;  4WVW A;  2VZU A;  4M3C A;  2ZX0 A;  2DVG A;  4LA2 A;  3WG1 A;  3RZJ A;  3OD0 A;  1E5H A;  1GP5 A;  1ZZ6 A;  2WWJ A;  4CE8 A;  3L9J T;  1ZRR A;  3P1I A;  4RS5 A;  5D8A A;  1FX5 A;  2RS3 1;  3IB3 A;  3GZE A;  5BXX A;  3NNM A;  3EB7 A;  3OGS A;  5C7G A;  1WCU A;  1WLD A;  1VBE 3;  4S2D A;  3WF4 A;  2VOW A;  2YZ4 A;  1U0A A;  2P34 A;  2WFF 2;  3JQX A;  4GH4 C;  2RMU 2;  3VKO A;  3EMR A;  2CWS A;  2RR1 3;  2VNO A;  5F3I A;  4C1W A;  4IXL A;  3GJA A;  3BTZ A;  1XU1 A;  4AI3 A;  4MX3 A;  3MIF A;  4QPG A;  2BZD A;  4AI2 A;  5C5U A;  2BQP A;  4CVU A;  1CAU A;  3AP6 A;  3FL7 A;  3MF9 A;  4XE9 A;  4Z82 A;  4HVQ A;  1HV0 A;  3BOP A;  3GCX A;  4N43 B;  4DIN B;  4O9G A;  3ES1 A;  4J6G A;  4OYU A;  4B3N A;  2C24 A;  5T5O A;  3H8X A;  1GWL A;  3W58 A;  1ZZ7 A;  3AB0 A;  3BYW A;  4YFZ A;  4F7Z A;  4FI9 A;  5FPU A;  4TXW A;  1Z78 A;  3M3I A;  5A33 A;  1T2X A;  2WSU A;  5FLH A;  3WD5 A;  1CON A;  1EUT A;  4QU2 A;  3VBO C;  4GJY A;  4Q4V 2;  3KVB A;  3J4U H;  1PK6 C;  5LB6 A;  1ZBE 1;  3KCY A;  3WG2 A;  1GOF A;  3D0S A;  4ET7 A;  3WNM A;  1O3Q A;  1ZBA 2;  1PO2 2;  4U36 A;  4AEM A;  4Q0Q A;  4PIY A;  1WW4 A;  5LEK A;  3MZH A;  3UJO A;  4ISR A;  4NIA A;  4H55 A;  3VHN A;  3E5U A;  4MGQ A;  3U11 A;  2BU9 A;  1RUC 1;  2VQU A;  5C4W C;  1NZI A;  1W28 A;  3IKW A;  3JBG 3;  1IPJ A;  1LHO A;  1HLC A;  1XYO A;  3FFZ A;  2X5I C;  3ABZ A;  4DNY A;  4WVM B;  3OEB A;  4XFB A;  4UWD A;  3J8F 1;  1CQ9 A;  1XNK A;  1J1L A;  1ULE A;  5FZC A;  2ZA9 A;  2XJV A;  2GNT A;  1QMJ A;  3ZDS A;  4RFT 0;  3RWN A;  2KD7 A;  3URF A;  5LRR A;  1YQ5 A;  1YFY A;  3DV8 A;  1X9P A;  3IPV B;  3MDP A;  3O1U A;  1ODN A;  1BKZ A;  1SHW B;  3VBF B;  4DXT A;  4IEQ A;  3VD9 A;  2VG9 A;  2YBP A;  4HG6 B;  3ZXL A;  1AYN 1;  1HXS 3;  3HD8 B;  1MVE A;  4D6Q A;  5K8S A;  3H42 B;  1S1A A;  4ZPI A;  3C7H A;  3KF3 A;  3WUC A;  3ZYJ B;  1QOT A;  2W87 A;  1W8H A;  5FZO B;  3RG0 A;  2R07 2;  3O14 A;  2DCK A;  1W9W A;  4C91 A;  1RXG A;  3KSC A;  2ZZQ A;  4JGY B;  2VZT A;  3C7O A;  5JI7 A;  1XNT A;  3NV3 A;  3B9C A;  4O7X A;  2Y0O A;  4EWE A;  2D5F A;  1L7Q A;  5LBC A;  4EN8 B;  1IPK A;  4YPJ A;  2VH9 A;  2NM1 A;  3HNY M;  4I30 A;  3O1V A;  1LU1 A;  3GAL A;  1K12 A;  1S2E A;  4FFH A;  4FPH A;  3U75 A;  3I3M A;  4YVW C;  3K51 A;  4QXB A;  4QU1 A;  3SNM A;  1YYN A;  1XXN A;  4Q0U A;  2C26 A;  1CPN A;  4RR3 A;  1DGR A;  1O8S A;  1BJQ A;  4CDU B;  1H9P A;  5T5P A;  4CXW A;  1UZZ A;  4DUX A;  3HT1 A;  4S2F A;  2VGD A;  3LA2 A;  4X6Q B;  3N9Q A;  5CU1 A;  4CU9 A;  3WQ7 A;  4PHZ A;  1SLL A;  5FMO L;  5FP4 A;  1KD7 A;  3SKJ E;  5FZ4 A;  1GWM A;  4Y20 A;  1NLQ A;  1G7Y A;  1NXM A;  1PO1 3;  3LOI A;  2PHX A;  3J9S A;  4CXX A;  4N43 C;  2GN3 A;  5B4X A;  2VZ3 A;  3ACI A;  4CEW B;  1L7R A;  1GNY A;  3POE A;  2RS5 1;  3OPT A;  5JOY A;  4QX3 A;  5FWJ A;  1H9W A;  5FP3 A;  1BEV 3;  1LOA A;  4E8D A;  1Q56 A;  2AYH A;  3NMB A;  1D0G A;  2HWE 1;  2VUD A;  1YQC A;  1SEF A;  4XFI A;  1MS0 A;  3UV9 A;  4EN0 A;  1PM7 A;  2YHJ A;  1RUE 1;  3FC0 A;  4BE3 A;  4I09 A;  2Y64 A;  1W6O A;  2B4K A;  1QIQ A;  3QH6 A;  4CDQ A;  3OUI A;  1NCQ A;  5JXG A;  1Z7S 1;  4DY3 A;  2P1B A;  3MW4 A;  5FZE A;  3O1S A;  1W99 A;  3WNO A;  5FMB A;  1D4M 1;  3NRU A;  4IE4 A;  4Q4Y 1;  4Y1Z A;  4BLI A;  3QOP A;  1R1A 3;  1COV 2;  1K5M C;  1OQ1 A;  1WKY A;  3N3H A;  1AR8 2;  5FBJ A;  2JDA A;  4M0N A;  5IW0 A;  1WW7 A;  3BCW A;  5TSW A;  1VRH 2;  2K9Z A;  2YFU A;  3AMQ A;  5I0T A;  1T6G C;  5F6K A;  2E63 A;  2XJP A;  2HWD 2;  4HL0 A;  3N7J A;  1MQT B;  4AQS A;  4XIL A;  5IVF A;  4AOC A;  2CV6 A;  4LHK A;  1FT9 A;  5JWP A;  5FJK A;  2HYK A;  4MHU A;  4PF1 A;  2Q1F A;  1WCQ A;  3TNP B;  1H2N A;  1DG6 A;  2HWF 3;  2D3S A;  3AKP A;  4YGB A;  2QUO A;  1ZX5 A;  1L3J A;  3NNG A;  5JOX A;  1V9U 3;  1QDC A;  2WA4 A;  2XH6 A;  3O1M A;  2ZGQ A;  2VZV A;  1J84 A;  2WYS A;  3S0M A;  3USU A;  3ELN A;  3V0A B;  5CFC A;  4TN7 A;  3POJ A;  4A45 A;  5D2A A;  5FP8 A;  3I2D A;  3O5S A;  4Q5O A;  2HWC 2;  3OPZ A;  5F9T A;  2RDS A;  5A7S A;  4RQP C;  4QXH A;  4NHX A;  2ZAB A;  4AHW A;  3LDB A;  4CYD A;  2X09 A;  1JYI A;  1M06 G;  3LEM A;  2I2S A;  4ES8 A;  1QJU 1;  3H0O A;  2OPW A;  1PIV 1;  3LSE A;  4FSJ A;  3VV1 A;  3AZZ A;  4XYX A;  3VBS A;  3WF3 A;  3LIH A;  1O3T A;  1W9S A;  1WCK A;  1OA2 A;  1JHN A;  1RUI 1;  3G6J B;  3IT8 A;  1Y9M A;  4Z1V A;  3H9A A;  1UY2 A;  1VRH 3;  1W8U A;  2MPF A;  3D5O A;  1ZZB A;  3ORJ A;  5K4L A;  5CG8 A;  4KBZ A;  2JE9 A;  1AX1 A;  4UF0 B;  5FBZ A;  3AXE A;  4GXL A;  1EV1 1;  2HKX A;  4IND A;  4QGL A;  3KV4 A;  3Q8A A;  3VBU B;  3GZT B;  3WLU A;  2ADE A;  4KNC A;  4LPL A;  3BU0 A;  4AHZ A;  2P17 A;  3VBO B;  3VDD B;  2WKK A;  1ND3 A;  2CGN A;  2R1B A;  4JRL A;  3T1M A;  3F2Z A;  2W08 A;  3NO8 A;  1V6L A;  1H1I A;  2GZW A;  2PQS A;  3I49 A;  4YW4 A;  5LW9 A;  1D7P M;  1W6M B;  2W91 A;  3MFA A;  4I0A A;  2QQP A;  1ZRI A;  1R64 A;  5L73 A;  4M4R A;  2XJS A;  1AXZ A;  4CCM A;  3L2Y A;  5JXH A;  1VBA 1;  2QZ3 A;  1V6O A;  1Q8V A;  3T4V A;  5BNN B;  1EAH 2;  2O14 A;  5C4W B;  5GZC A;  2Y0I A;  3VD7 A;  3WUD A;  3QBQ A;  1OKQ A;  1AL2 1;  2Y6L A;  1YJK A;  2DUO A;  4IEY A;  2IXC A;  1XC6 A;  2RDR A;  4QB6 A;  3S7I A;  2X5I B;  1QQP 3;  5FYM A;  1YO8 A;  3RRD A;  4K1Z A;  4QKD A;  2AAC A;  3UES A;  3H3U A;  5H9P A;  2RS3 2;  1WLW A;  1W9T A;  2XHN A;  1OA4 A;  2Z42 A;  4Q4X 3;  1BLZ A;  2HLE A;  2EVX A;  4UFL A;  5E1R A;  4LUM A;  3OBA A;  4PJY A;  1O4T A;  3PTR B;  4H3W A;  2QFE A;  1AR6 3;  4NMI A;  2TBV A;  4O9E A;  3ACG A;  3WG4 A;  3GBW A;  2FCU A;  1HB4 A;  4XF4 A;  4LTA A;  4DXS A;  3W5N A;  1W8W A;  5IVV A;  2BGC A;  2ZHL A;  2IXH A;  1VMJ A;  1DGW X;  4JX0 A;  5JI9 A;  4XUO A;  1ENR A;  4XUT A;  4AI0 A;  2QQW A;  2BWA A;  2JD4 A;  5CFD B;  2ZML A;  1UU5 A;  4LBN A;  1EPZ A;  3IDA A;  1W0N A;  1KQR A;  1CGP A;  1VBD 1;  4LIU A;  2ZEY A;  4LR4 A;  4CP2 A;  4LJH A;  2YUE A;  3LIG A;  5CYY A;  1LOG A;  4AHX A;  4XHX A;  2EIC A;  1LEN A;  1QXP A;  2LS6 A;  3I59 A;  3K3O A;  1UOG A;  1W8O A;  3KHB A;  4CCD A;  2RVA A;  1MEC 1;  3HVD A;  1FI2 A;  2DU0 A;  1GZC A;  4YVW B;  2DV9 A;  3OB8 A;  4IE7 A;  1ZBE 2;  4XXP A;  2DFC A;  4F8A A;  4Y22 A;  2RJK A;  3MIH A;  1H8T C;  4E4H A;  2BGP A;  3U37 A;  1C4R A;  4M3C B;  3WHT A;  4JRA A;  2VQA A;  3FFQ A;  2P4E A;  2JE8 A;  4LBQ B;  2DWR A;  4TTG A;  4B7E A;  1Y3T A;  2IXL A;  4RS5 B;  3KQ4 B;  5D8A B;  4AVB A;  4RFR B;  1WWY A;  5FZM A;  4UYB A;  1OQE A;  2QJV A;  3M3O A;  1RC6 A;  2WNU A;  4MVT A;  3SKV A;  4FFF A;  2FDJ A;  4J1W A;  4JVA A;  4XJW A;  2R7E B;  5DAV A;  1KIT A;  4BU2 A;  2WJS A;  1XJA A;  4OUL A;  2CDP A;  4YZ4 A;  4BIS A;  4CUC A;  4EE2 A;  1YIP A;  2Z2S B;  4HSL A;  1AXK A;  2W1W A;  4IER A;  3ZFE A;  3ZSL A;  4DRV A;  2GME A;  2Y8K A;  2VOV A;  2XQR A;  2HEY F;  2UY9 A;  3KT4 A;  3LSD A;  4KWJ A;  4QGM A;  1W0P A;  4UI9 L;  1TME 1;  1CZV A;  1NLS A;  3AMM A;  3EQE A;  2C4X A;  3MUZ 1;  3RFR A;  3HR9 A;  2RS1 1;  1ND2 C;  1MS1 A;  2Q8E A;  5FQ0 A;  2ARE A;  1C28 A;  2LM3 A;  2ZGP A;  3WW2 A;  4DPN A;  3PUQ A;  2WNV A;  3OTF A;  4RN5 A;  5KC5 A;  3MLK A;  3I2F A;  4MXW A;  3OY8 B;  3LDR A;  1JZ8 A;  2HBU A;  2OS2 A;  5KXB A;  2PA7 A;  3K48 A;  5L7O C;  4PLO A;  2P6C A;  4IW3 A;  1WLC A;  5IAX A;  4PDW A;  3JB8 A;  4YVS C;  1MAC A;  4HPK A;  2YDE A;  2JKX A;  3OUH A;  1LED A;  4GB3 1;  1CIY A;  1RUC 3;  1LGC A;  1G9C A;  1UY4 A;  2LAL A;  3H3L A;  1IG3 A;  5K0U A;  3RMY A;  1CAX A;  2CNA A;  4AK3 A;  5KBF A;  3OG2 A;  4E4Z A;  3AP9 A;  3R0R A;  1A8D A;  2YG0 A;  3MLL A;  2JDU A;  4XDO A;  5E88 A;  2X10 A;  4BCU A;  2ERF A;  1H2K A;  3JD7 1;  1V00 A;  3R05 A;  2ET1 A;  1FOD 2;  1AR7 2;  4P9L A;  3TAY A;  1QEX A;  1GLH A;  1QJX 1;  3J8F 3;  3PDQ A;  4NO4 A;  4AI1 A;  1SZB A;  4UW4 A;  1UCX A;  3S5A A;  2VZ1 A;  5HXM A;  4BOW A;  5KWR A;  2R32 A;  2XLF A;  2CAV A;  4BQY A;  4HZF A;  5L9V A;  4K9S A;  2XLG A;  2A6Z A;  4Y3O A;  1CX4 A;  2BRT A;  3UK9 A;  4LO4 B;  4YYO A;  4NR1 A;  1GNH A;  1YUD A;  1AYN 3;  1XB9 A;  4YW6 A;  3NV1 A;  3NV4 A;  2A70 A;  1W2O A;  5E6H A;  5FMO S;  4TZD A;  2WLQ A;  5EV7 A;  5IVE A;  3AKT A;  1QXR A;  1UOB A;  4FPY A;  5C70 A;  1WZX A;  4QAW A;  3MV0 1;  1JHJ A;  2G1M A;  1KJL A;  3NAP A;  4Q0P A;  3WDW A;  1IG0 A;  4XVH A;  1XE7 A;  5FO9 B;  1KS5 A;  4QKB A;  3D4K A;  5H9S A;  5IWF A;  5SV5 A;  2TNF A;  1Y9Q A;  1O3R A;  1NCR A;  1L7L A;  1RUE 2;  1UMZ A;  2ARC A;  3MBW A;  3JBG 1;  3WP4 A;  5A1F A;  1N1T A;  4ZZ5 A;  4JKM A;  5KXC A;  2C6S A;  1ZA4 A;  4YLZ A;  5FKC A;  4AFC A;  4EWA A;  2WN2 A;  4QPI A;  3Q8F A;  2GAL A;  3GHN A;  2WL1 A;  3VZO A;  1PGW 1;  1AHS A;  1NX9 A;  4A7Y A;  4URA A;  5FUN A;  2AUY A;  4XFC A;  3MO4 A;  2LRP A;  1JS9 A;  2DYC A;  3AL6 A;  4RSU A;  1UU6 A;  3KT7 A;  1AVB A;  2HJI A;  3NKG A;  2VCM A;  4Q8K A;  4F83 A;  5J37 A;  4PBP A;  1F15 A;  1DYP A;  1OKO A;  2X29 A;  3WY6 A;  5GZG A;  1O4Z A;  2RS5 3;  4AEK A;  4FAG A;  3MHZ A;  5DUU A;  3KF5 A;  4IGQ A;  2GU9 A;  2HWE 3;  2HWB 1;  4XAE A;  1JOJ A;  3BIW E;  1MS8 A;  4ZZ8 A;  4WVZ A;  5GJ6 A;  3N9L A;  2GH8 A;  1RUE 3;  4P5H A;  5J09 A;  2VW1 A;  3KV6 A;  5F3C A;  1Z7S 3;  1QHD A;  4O65 A;  4M3C F;  4L97 A;  2VZP A;  1QJU 2;  4HON A;  1PIV 2;  3ATG A;  1D4M 3;  4Q4Y 3;  1W05 A;  3AKQ A;  4P9G A;  1VBC 3;  2B9V A;  5BYN A;  1NCQ B;  4OLL A;  4PF5 A;  4LE4 A;  1YNA A;  2XJQ A;  3ZYB A;  3N36 A;  4BK5 A;  3BN6 A;  4R9D A;  3T1L A;  3RJR A;  3ZN5 A;  1RUJ 1;  4LUK A;  4ISQ A;  4ZXK A;  3VL9 A;  2IFW A;  4XUR A;  1RL3 A;  2IVI B;  4OQ8 A;  1APN A;  1HRV 2;  5A6Y A;  1BHG A;  4DEQ A;  1RUG 3;  1MS4 A;  1YHF A;  1W8Z A;  1UOF A;  2J1V A;  2WDB A;  1J83 A;  4GJZ A;  3ZYI B;  4DXZ A;  2XVL A;  5H9R A;  1OVP A;  1U5Y A;  3AC0 A;  3B00 A;  3KZ4 C;  2KXL A;  3NKT A;  2PHU A;  2W3J A;  3NL1 A;  2GH2 A;  4LE3 A;  1PVC 1;  3I4I A;  2Q1Z B;  3VDC A;  4HFS A;  4FPG A;  3KCX A;  3I8T A;  1WCS A;  4FT8 A;  1H8T B;  3J7H A;  5DAW A;  5FOJ B;  2ZAC A;  5KHH A;  2EA7 A;  1ZZ9 A;  3R4D B;  1GZW B;  1YI7 A;  4XW3 A;  4YZ5 A;  1GSL A;  5CAZ A;  2ZKL A;  2FDK A;  2FMD A;  2PHL A;  1VBA 2;  4AI9 A;  1H4H A;  1SLC A;  1NY7 1;  5GZD A;  5CFC B;  5CKN A;  5A3M A;  2KM2 A;  4DZG A;  4MHR A;  3N4M A;  5LK5 A;  1U5Z A;  2VBB A;  1RUI 3;  1R1A 1;  2YFZ A;  4JTO A;  2E7A A;  1F5J A;  3EHK A;  3UKN A;  4XQD A;  4SLI A;  4Q1P A;  2DCT A;  4NRM A;  4R9A A;  5EIY B;  2WWU A;  1E5R A;  1GP4 A;  2CAU A;  3ME2 A;  2NYY A;  4XQ4 A;  3P3P A;  4UT5 A;  3DF0 A;  1HN1 A;  2ZEX A;  2JKB A;  1EV1 3;  2A6V A;  5FPZ A;  5FRE A;  3ZN4 A;  3POI A;  1OSG A;  5FKB A;  3T30 A;  4YZ1 A;  5BNP C;  5JSR A;  3GJB A;  1C3H A;  4M4P A;  1U5X A;  5IJR A;  3ZVX A;  2P3J A;  4AQ2 A;  1N1V A;  1WBF A;  2WT1 A;  2G9G A;  3RYP A;  3LD8 A;  4CP0 A;  1Q8O A;  5JZG C;  2VVF A;  4WM7 A;  3Q9O A;  4AED C;  3HEI A;  1TMF 2;  5L7O B;  4QDR A;  3RZG A;  3VBF C;  5HXV A;  1VBD 2;  3AP4 A;  3ZYP A;  4S2G A;  2K0G A;  2QQO A;  1POV 0;  3FZ3 A;  2PTM A;  3C7F A;  4OUS A;  4XZU G;  1HB3 A;  2W68 A;  2B7Y A;  4D7S A;  5I0S A;  3CEW A;  1A3K A;  1AJO A;  2ID4 A;  4JGZ C;  3VKL A;  5LAT A;  5A6X A;  4GD4 A;  2A6X A;  2V72 A;  2EAK A;  2VZR A;  4HK8 A;  4NPL A;  3BOW A;  1AL2 3;  1BQP A;  3HN3 A;  4TSV A;  3ZIW A;  3ZXJ A;  1BBT 3;  4YWA A;  4LKF A;  4JGY C;  1VRB A;  2DBN A;  4PIX A;  2WS9 2;  3VBH A;  2XKO A;  5BUV A;  1US3 A;  1B35 A;  3T0D A;  4CCN A;  1AYM 3;  2IXK A;  4GH4 A;  4MO3 M;  4YM3 A;  3OBR A;  4AEJ A;  5LA2 A;  2EID A;  3PHM A;  5FRA A;  5CB7 A;  4ONU A;  1OPO A;  3GYD A;  1QJF A;  4OZX A;  2E6V A;  4Z8B A;  1GIC A;  4MYE A;  4YM1 A;  3ST7 A;  3TRS B;  2VMC A;  1QH7 A;  4RYD A;  5FDB A;  3Q8C A;  5FP9 A;  1TG7 A;  1KDM A;  4XAA A;  2IVJ A;  3WCR A;  4CDX A;  4XF0 A;  3I54 A;  3ZMO A;  1DIW A;  3N7M A;  3SCF A;  4NAO A;  2NLR A;  2FCT A;  5FPL A;  1ZRF A;  3AYC A;  3TEW A;  1HV1 A;  2VY0 A;  4E8C A;  5C8C C;  3LEG A;  3M3C A;  4K40 A;  2QBX A;  3HBZ A;  1RTV A;  5EJZ B;  5LY2 A;  3ZSM A;  4BQW A;  5C6C A;  1XRU A;  4CEW C;  4GQ7 A;  2J42 A;  2WZR 2;  1MEC 3;  4CXY A;  3ZXD A;  4EYU A;  5ISL A;  4AQ6 A;  1FV3 A;  5DUX A;  4CCJ A;  5EJ1 B;  2HEW F;  2I74 A;  4EQV A;  1QQP 1;  1NXD 1;  3RMX A;  1OOP C;  4QHZ A;  1SDW A;  2G9F A;  1CD3 G;  1VJ2 A;  5T3N A;  4NIH A;  1PHM A;  1R09 1;  3MPB A;  3GBF A;  4Q4X 1;  4G9S B;  5FZ7 A;  1AF9 A;  1VBE 2;  4Y22 B;  3PMS A;  4IE6 A;  1AR6 1;  1CIW A;  4A3X A;  5A3N A;  2ORZ A;  5JXI A;  3FHA A;  4CP9 B;  1IS5 A;  1QXJ A;  3JU9 A;  4M3C E;  1RHI 1;  3C3V A;  4QWN A;  4WM8 C;  4K1Y A;  1POV 3;  2DCY A;  1FNY A;  2W1U A;  5JCT A;  3ZDV A;  4LMF A;  1DF0 A;  1UOJ A;  1MQT C;  1TME 3;  3LA7 A;  3NJX A;  3HPN A;  2JG9 C;  2RS1 3;  1OUX A;  2XL7 A;  4QB1 A;  3M4F A;  3ZFE B;  4BQ3 A;  3N7L A;  2QQN A;  1PZ7 A;  3USS A;  3WIN E;  2Q8C A;  3HWJ A;  4BQ2 A;  3O1O A;  4N53 C;  4OI2 A;  5DUW A;  4LK7 A;  1CAV A;  1ZRC A;  3ITQ A;  3M2M A;  2P5B A;  4MZU A;  1ZZ8 A;  2WBK A;  4XIK A;  2E7T A;  3WR0 A;  4Z92 B;  3D3A A;  3KB5 A;  4GB3 3;  4NHM A;  2W1S A;  3POG A;  5EHD A;  4QQH A;  1S0D A;  2GC1 A;  1DU3 D;  4W8J A;  1QH6 A;  5LCW L;  2RV9 A;  2CDO A;  3JBG 2;  3EBR A;  4PDW B;  3JD7 3;  4KL1 A;  1MPX A;  4XBL A;  4BA6 A;  5KHK A;  1QJX 3;  1OUR A;  3FX3 A;  1UZW A;  4NPR A;  2Y33 A;  5FZF A;  1CAX B;  1KEX A;  2V09 A;  3JUU A;  2QNK A;  5DN2 A;  1AR9 3;  1QOS A;  5FZ3 A;  2RDN A;  1PGL 1;  1US2 A;  1XYP A;  3MID A;  2E33 A;  3CHX A;  2XJR A;  3LWC A;  4YG6 A;  4CEY C;  1KXG A;  3I2H A;  3RPQ A;  4W6Y A;  4D8M A;  2BDR A;  2VMI A;  5FXW A;  2CTV A;  3WDY A;  5ANQ A;  3VBU C;  2BBV A;  1HXS 2;  2C0Z A;  4M01 A;  2ZX2 A;  2VL4 A;  3IAQ A;  1OXC A;  1UZ0 A;  4NHL A;  2JEM A;  2VMF A;  1LEM A;  3ZXA C;  3VDD C;  5FPA A;  4ZXE A;  4FOY A;  1IGO A;  1LHV A;  5KC6 A;  2VZO A;  1U5I A;  3LCP A;  1W6Q A;  3HNM A;  1YFX A;  2XBO 1;  1BXH A;  4CP1 A;  4HSJ A;  5IFP A;  5CA6 A;  1RB8 G;  1S0I A;  1UY1 A;  1ENX A;  1DQ4 A;  1W2T A;  4LNV A;  2H0V A;  3ZM8 A;  3K77 A;  5BNN C;  1STM A;  3KGL A;  4RL7 A;  4YRD A;  5C9A A;  4P02 B;  2R04 1;  1KS4 A;  3ES4 A;  1IS4 A;  1DGR N;  3S57 A;  1W03 A;  2W9X A;  3AXD A;  3CZJ A;  3KD4 A;  4FPK A;  4AAX A;  3M70 A;  4FTE A;  5BNP B;  4FOW A;  3SH3 A;  4XJ8 A;  1NCR B;  1FPN 3;  3OJB A;  2OT7 A;  1IS6 A;  2KA3 A;  3CL1 A;  2YU2 A;  5JZG B;  4Q4W 1;  1OH4 A;  3QAC A;  4AED B;  2G19 A;  3U4S A;  1J3R A;  2FBE A;  2PEL A;  4QPI B;  1ULO A;  4JC1 A;  1WGP A;  1QKQ A;  3HOB A;  3ILR A;  2VXJ A;  1PO1 2;  4JGZ B;  4D94 A;  3MIB A;  3HNB M;  4XCB A;  4RGK A;  2VEC A;  2VCC A;  3QCW A;  3U14 A;  5CFD C;  1I6X A;  2ADD A;  4FPE A;  1DQ6 A;  5EFU A;  2D6M A;  2VTX J;  4HAN A;  3ZKU A;  4AI8 A;  3PUA A;  4MGK E;  1PNF A;  3E6C C;  1BEV 2;  1LOF C;  4FQZ A;  3WNK A;  5EYY A;  5FZB A;  2HWB 3;  2GP3 A;  2ZS6 B;  2FZ1 A;  2IWG B;  3E5X A;  3GF6 A;  3AFK A;  2D98 A;  5E16 A;  1O3S A;  3HBK A;  1Z0H A;  2BWC A;  4CDW C;  1BMV 1;  5GLZ A;  4EZ4 A;  3VHO A;  4B4R A;  4DO0 A;  2ZMN A;  4FPO B;  1NY7 2;  4Q8L A;  1XE0 A;  2PMW B;  2VOK A;  1ZVF A;  2C9K A;  3T2P A;  1G86 A;  1LES A;  1FV2 A;  3J26 N;  2ZX1 A;  3IMN A;  4CTE A;  2ZGT A;  1XNC A;  2W39 A;  3A22 A;  5BNO A;  4GAL A;  3GDB A;  1NA1 A;  1R1A 2;  2PLV 3;  4I02 A;  3BTY A;  4OCT A;  4RHV 1;  3WNN A;  5DDJ 1;  3V0B A;  4RS5 C;  5D8A C;  4LEJ A;  1RUJ 3;  4CSW A;  3J7L A;  4UBH A;  3BI3 A;  3CIH A;  4UFH A;  1KFU L;  4D7Y A;  3LF7 A;  4IES A;  5C8C B;  2R06 1;  1IPS A;  4FVV A;  4C90 A;  4K3U A;  5GZE A;  2BNN A;  3SH5 A;  4OHX A;  2NQY A;  4LQR A;  1W04 A;  4IQP A;  3CJX A;  1PVC 3;  2HWF 2;  2BFU L;  5I8Y A;  4QPG C;  1A6C A;  3RYR A;  4P14 A;  1V9U 2;  1OOP B;  2CSG A;  4OUM A;  2ARB A;  4AVC A;  2IUW A;  5C3S A;  2VOT A;  3I97 A;  2EAL A;  1W8T A;  1KGY A;  4C0H A;  4C8D A;  2UYA A;  4QX8 A;  4XDQ A;  5DMY A;  2JD9 A;  2YGL A;  2E51 A;  3PJQ A;  1GUI A;  4ZS3 A;  5FZ8 A;  2Q0A A;  4Q1R A;  4LHL A;  4ASL A;  3THC A;  2ZAA A;  2RHP A;  4KMQ A;  4PLM A;  3SLI A;  1Y43 B;  1VBC 1;  5JSP A;  4KH9 A;  1W6P B;  4WM8 B;  2P2K A;  4YAR A;  1ASJ 3;  5FYB A;  4TLF A;  3AK0 A;  4P9J A;  4QQP A;  3I3Q A;  3D8C A;  5A7Q A;  3THP A;  4PCR A;  4IUG A;  3U10 A;  3OYW B;  3ZFF A;  3MEP A;  1RYY A;  2YV8 A;  2NMO A;  1C1L A;  1G8W A;  2YY1 A;  3M3E A;  2JG9 B;  1RUG 1;  2W95 A;  4R9C A;  1JOB A;  3CJI A;  4CCE A;  4JKK A;  1QJY 1;  5CNA A;  3ZXG A;  2FZ2 A;  1QJE A;  4H7L A;  3UGG A;  1OLR A;  4K8R B;  1F9K A;  3WG3 A;  4Z2W A;  4N53 B;  3NV2 A;  1H2M A;  3D6E A;  3AVR A;  3LEI A;  2XQX A;  4WZF A;  2XPJ A;  3MIG A;  2BVB A;  2XXZ A;  4DB5 A;  5F37 A;  4FTB A;  3H7J A;  5FYZ A;  1E57 A;  4IGO A;  4BQ4 A;  5JOW A;  4JDN A;  5CIR A;  4WM7 B;  1LGN A;  2KR2 A;  1OH3 A;  2VMD A;  2ZGO A;  1HRI 1;  4V2V A;  4P08 A;  5JMC A;  4BYY A;  1UW8 A;  5A7W A;  1GFF 2;  1Q8Q A;  2Y6F A;  1S55 A;  2D6P A;  3ACL A;  3ZMN A;  5FPV A;  1X36 A;  5FYV A;  1QQP 2;  2VMG A;  1RIN A;  1JZ3 A;  4IET A;  1ODM A;  1JU4 A;  1CN1 A;  1R09 2;  5DZG A;  1YQ2 A;  4Q4X 2;  3WNL A;  3VBR A;  2EXH A;  2V73 A;  4WZC A;  3RDI A;  4CEY B;  3VBH B;  3NNL A;  1ENS A;  1AR6 2;  1S2K A;  2XL9 A;  3UET A;  2YC4 A;  5AVA A;  1B35 B;  5ABJ A;  3AKR A;  2ZCW A;  2ZEZ A;  2FDI A;  4ATE A;  3A0K A;  2DBI A;  1V6J A;  3ZN6 A;  5CBL A;  1OLM E;  1S0B A;  2A71 A;  4BXF A;  4ITC A;  4DUV A;  2DVB A;  4E2Q A;  4Q27 A;  4RR3 C;  1XYN A;  2HBT A;  3DPR A;  2QQK A;  3ACH A;  4RGG A;  2YB7 A;  1MZ6 A;  2EIE A;  1TE1 B;  5C5T A;  5AC9 3;  5A6Q A;  4CDX B;  3QH7 A;  1HQN A;  4JKL A;  4ES9 A;  3VGI A;  4JDM A;  4BIF A;  1RUO A;  2WWS A;  4AGV A;  4ZY9 A;  3DCQ A;  4BK4 A;  5B2G B;  4P5Y A;  4FPC A;  3I3B A;  4J25 A;  4Y24 A;  1BBT 1;  5FK7 A;  4QX1 A;  2ENR A;  1MS5 A;  4MGY E;  4MUV A;  4EZH A;  1S4C A;  2G9Z A;  5A6Z A;  1R09 3;  4V2W A;  1AYM 1;  2YXS A;  3ZPY A;  1UMH A;  4JDO A;  1CJP A;  2OQ7 A;  1J1T A;  1HW5 A;  1RUH 1;  1Y9G A;  2WAO A;  4R52 A;  2WO2 A;  4MH0 E;  4XCA A;  4FXK B;  3WVJ A;  3X29 B;  3BTX A;  4X8P A;  1CR7 A;  4UFK A;  3O0W A;  1RUF 1;  1MVQ A;  3ZYR A;  4CDQ C;  5EQU A;  1LOB A;  1NCQ C;  1RHI 3;  1X7N A;  4S2H A;  4EN6 B;  5HCB A;  3GCW A;  4IL7 A;  4FXG B;  5IUQ A;  5FYC A;  1A78 A;  2QDN A;  4P9Y A;  4IV1 A;  2O8Q A;  2XHK A;  3LB9 A;  3I2G A;  2W94 A;  3WQB A;  3RZL A;  1VLN A;  5LA1 A;  3WF1 A;  2JDP A;  3Q8E A;  3NQH A;  4LBL A;  3SCH A;  5DPN A;  1RXF A;  2OKX A;  4LOS A;  4B29 A;  1S2B A;  2PYT A;  4XF3 A;  4D6R A;  3ZIX A;  4LK6 A;  1W8N A;  4CDW B;  2SLI A;  3MGU A;  1UD1 A;  3OGR A;  3MV1 1;  2WZP P;  2EXI A;  3HT2 A;  5AFB A;  3WP6 A;  3H3Z A;  4AGG A;  1QF3 A;  2A3X A;  3POS A;  3ZYH A;  3I3E A;  4JQR A;  1Q43 A;  4AQT A;  1SFP A;  5FK8 A;  5JAX A;  5CKQ A;  3ZFG A;  3DYP A;  1RUC 2;  4GKY A;  5EXO A;  3RS6 A;  1PMJ X;  1IS3 A;  5CFC C;  1VAV A;  3VDB A;  3VKM A;  3IBM A;  4W65 A;  4IV3 A;  4QX5 A;  4W6X A;  1QDO A;  4XBQ A;  5I91 A;  4Y1X A;  1CAW A;  1YXW A;  3VKF C;  5CKM A;  5EPA A;  3J8F 2;  3VB9 A;  4B1M A;  1VBB 3;  1UNB A;  5KR7 A;  5KHJ A;  1VAM A;  2JDY A;  3KQR A;  2W46 A;  5JIU A;  2UWC A;  1JUI A;  1SFY A;  1LGB A;  4Q29 A;  1POV 1;  5HBA A;  4QPG B;  3VBS C;  4Q4W 2;  3FUO A;  4XJA A;  1CAU B;  1DGL A;  3N7K A;  4P00 B;  5GLU A;  1CX1 A;  2YC2 A;  1AYN 2;  4TLG A;  2UYB A;  5A3W A;  3LFI A;  2ZGR A;  5FZ0 A;  2P37 A;  1J58 A;  1OI6 A;  3VL8 A;  1TZO A;  1W8F A;  4FFG A;  1UKG A;  4G4F A;  4I0W B;  2DTW A;  1SPP A;  2MEV 1;  1V6M A;  4DQA A;  1V0A A;  2J1R A;  1SCR A;  5A80 A;  2Q30 A;  4NN0 A;  5FY7 A;  3T0A A;  2J1T A;  5FAX A;  3ZR5 A;  5A33 B;  2XBO 3;  5IYY A;  4X6R B;  1H6X A;  2B42 B;  2JJ6 A;  5JZG A;  1A34 A;  5AFE A;  5A7N A;  2WRA A;  2YBS A;  1ND3 C;  2Z79 A;  3O1R A;  1H30 A;  4UFM A;  5LEJ A;  1W6Q B;  2SBA A;  1VAK A;  2R04 3;  4WVV A;  1BMV 2;  4CRQ A;  1BZW A;  3WDT A;  1ULF A;  1I9R A;  2P6H A;  3IDB B;  3AVS A;  3PME A;  3HQX A;  1EP0 A;  3LPF A;  5FLI A;  1PZ9 A;  2RG4 A;  4I0B A;  4H7M A;  2B5H A;  4L99 A;  1AR9 1;  3POB A;  4Q4W 3;  2DF7 A;  3G7D A;  1S0C A;  2R30 A;  1O7F A;  1YCI A;  3U4X A;  4N7U A;  1MZ5 A;  1O8P A;  2DDU A;  2VUA A;  5HPO A;  1C1F A;  1GU3 A;  4ARX A;  5J7M A;  1EUU A;  2OYZ A;  4E4S A;  3HJR A;  3W5M A;  5LY1 A;  1C57 A;  2WQ8 A;  5J98 B;  1NUK A;  5KHG A;  4YGC A;  1GKB A;  1OFN A;  4HBN A;  3AP5 A;  5DG1 A;  1BK1 A;  2RS5 2;  2GDF A;  3DYM A;  2VU9 A;  1XU2 A;  3VUO A;  1Q8P A;  4MV2 A;  3SXW A;  4B4P A;  2ZHN A;  4G3Y C;  1EPW A;  5GKA C;  1CVN A;  4YW2 A;  2HWE 2;  2BFU S;  2ZGU A;  1UWW A;  2ILM A;  5JMO A;  3GXU A;  3RQ0 A;  4MGZ E;  3UKT A;  4GMP 0;  1RMU 1;  4PT6 A;  4XFA A;  5EJ3 A;  4JTN A;  1AUY A;  1Z7S 2;  5A7P A;  3WEZ A;  4IE0 A;  2G4I A;  3ZO0 B;  4A6S A;  4LO7 A;  4QDS A;  4BQ1 A;  1FPN 1;  1GP6 A;  5FZL A;  1D4M 2;  1UAI A;  2VD7 A;  3F95 A;  4Q4Y 2;  1UXX X;  3UJQ A;  1VBC 2;  1JZ6 A;  3FE5 A;  4LUL A;  4AFM A;  3WW1 A;  4E27 A;  2YC0 A;  4RHV 3;  4Z2A A;  5DDJ 3;  2CWM A;  2VAU A;  4RR3 B;  4A44 A;  2VVE A;  3OCP A;  4XDP A;  3POY A;  5F5Q A;  4WVM A;  3DEM A;  5A32 A;  1UN1 A;  2RMU 1;  1NA1 B;  4BXS V;  3MW2 A;  2R06 3;  3NNF A;  1RUG 2;  4L2N A;  2ZTN A;  5IVB A;  4Y20 B;  1SCS A;  1DZR A;  4I01 A;  3SH4 A;  2WSV A;  1AX2 A;  4UW5 A;  1OPM A;  1IKQ A;  2XVK A;  2XLA A;  4JHT A;  3VBF A;  3N9O A;  2WNU C;  3LAG A;  3KWV A;  2X8K A;  5GLW A;  3T2O A;  4NRQ A;  3APB A;  3EXU A;  5FLJ A;  1BVV A;  4LLO A;  1JI6 A;  3AZY A;  4N90 A;  1UPI A;  1KJR A;  3VZN A;  1MS3 A;  1UO9 A;  1SBD A;  1I5P A;  5T50 A;  4C1X A;  4BJ0 A;  4F3J A;  3ZFE C;  5FZO A;  4LBK A;  1S0E A;  4UXA A;  3VZJ A;  2EF6 A;  4A7K A;  4LBO A;  2Z69 A;  4OVE A;  1XNB A;  3E1F 1;  3BPZ A;  4KG0 A;  5I0U A;  4QHO A;  3T2Q A;  4XFF A;  1UX6 A;  1MS9 A;  1Y7B A;  1W6O B;  2OZ6 A;  2WNV C;  3B94 A;  4IE5 A;  4CDQ B;  2GNM A;  4GAZ A;  1IKP A;  1RUI 2;  1PO2 1;  1ZBA 1;  1YRZ A;  2PHT A;  2PLV 1;  4DEV A;  1E5S A;  4YSF A;  4LHN A;  2TUN A;  5A70 A;  3LGR A;  1YQ6 A;  2VOX A;  2IZW A;  2WN3 A;  1OD5 A;  2VPV A;  1PMH X;  4NRO A;  2C1F A;  4B8E A;  4PDW C;  4CDU A;  1XQN A;  1EV1 2;  1B09 A;  3C8X A;  2OUJ A;  5F5C A;  1OC1 A;  1QJY 3;  1V6I A;  1MR5 A;  1F35 A;  1WUV A;  2B45 X;  3WHU A;  3T3Y A;  5A3P A;  5JR2 A;  1LB2 A;  4A3Z A;  2WNO A;  5I0D A;  5KHI A;  1C8N A;  4HOO A;  2A1X A;  1I5Z A;  2W1Q A;  1H0B A;  3ACF A;  4JV4 A;  1WA4 A;  2JG8 A;  1XSR A;  4MG2 A;  3IWZ A;  4C0B A;  3S5Q A;  5HV4 A;  2E32 A;  2VTX A;  5L36 A;  3POW A;  5F7U A;  3MF6 A;  4ASK A;  2EXK A;  4XXA A;  5K9Y A;  5HCA A;  3B02 A;  1HRI 3;  3PU8 A;  3K75 B;  3WNX A;  3H1W A;  4CCL A;  3USU B;  3DKW A;  1AL2 2;  1TEI A;  2W47 A;  1DP0 A;  2ORX A;  1LCL A;  1BBT 2;  1YI9 A;  2ZOE B;  3KMH A;  3OSD A;  2GC3 A;  3T2T A;  1PZ8 A;  3O0V A;  3PUI A;  2VUL A;  1ASJ 1;  5A7W B;  1QJZ A;  1PGS A;  2VCA A;  3T09 A;  4A6O A;  4QXK A;  3U07 A;  4QT6 A;  1JZ7 A;  2A75 A;  2PHR A;  1AYM 2;  1KDK A;  3NAP C;  1RVF 3;  4GWJ A;  3VBS B;  5F5I A;  4GIQ A;  1U12 A;  2P3I A;  1F4A A;  2QQM A;  3TB0 A;  2F4L A;  3TWI A;  2XWJ B;  3SCG A;  4QDQ A;  2FDG A;  1NCR C;  1SLI A;  2A3W A;  3VBR B;  1GV9 A;  2AH2 A;  2NN8 A;  2QZ2 A;  5I8T A;  5J3U A;  3WDX A;  4LBM A;  1C8M 1;  5ABJ B;  2R6Q A;  2WZ8 A;  1MQT A;  1LEC A;  4FCA A;  5F6L B;  1OVS A;  1LR5 A;  2JWP A;  4QPI C;  4BPZ A;  3S30 A;  2LRO A;  3ZN6 B;  1ND3 B;  2JB8 A;  3AP7 A;  1UQX A;  1JYV A;  1QGL A;  3NJZ A;  2BW8 A;  2J7M A;  4OI4 A;  4W50 A;  5EYX A;  1GOH A;  5FYS A;  5JPN B;  2BPA 2;  4L8Q A;  2UWA A;  1MEC 2;  4RGA A;  3O1P A;  5FZG A;  4DMI A;  4U2A A;  3NW4 A;  3LKJ A;  2WIN B;  1QNW A;  5LAS A;  3V64 A;  1AZD A;  1W9Y A;  4FQ4 A;  4GZ9 A;  3ZYF A;  5ACA 3;  5LWB A;  3V0A A;  3RI8 A;  4QM8 A;  3ASI A;  1RIT A;  2XGX A;  2EXJ A;  2VZQ A;  2ZMK A;  3UKV A;  3UL2 A;  5A3U A;  4OI1 A;  4GA9 A;  4AVS A;  4A4A A;  1XNA A;  3J7M A;  3MIC A;  1N3Q A;  1R08 3;  4KQ7 A;  4XC9 A;  1DZQ A;  3EO6 A;  2JDH A;  1FMD 1;  2O1Q A;  4A2U A;  2DFB A;  2K46 A;  1RUH 3;  3BAL A;  4FOV A;  1AJK A;  1DHK B;  2OA2 A;  2BYV E;  3RZH A;  3M1H A;  2Z5W A;  1XBF A;  1RUF 3;  3INA A;  4Y5Z 0;  4AVV A;  2NP0 A;  1DDL A;  3U78 A;  2E26 A;  2VNV A;  3IDE A;  4HMZ A;  5FCC A;  1JOD A;  1RGS A;  2QKD A;  1COV 1;  1QOO A;  5F32 A;  1WW5 A;  4IEU A;  5J36 A;  1AR8 1;  4UF0 A;  5F3G A;  5H9Q A;  4PQ9 A;  2Q1M A;  1TME 2;  3FUQ A;  2HWD 1;  4NJ4 A;  5AC9 1;  4AR2 A;  1RIR A;  5HI0 A;  5IAT A;  2RS1 2;  3CF6 E;  3I3D A;  2DVA A;  3VBO A;  1UYX A;  1GMM A;  4K8F A;  4YGD A;  1PK6 A;  1X8M A;  1F2N A;  3CZU A;  2JIJ A;  2Y26 A;  4XAB A;  2BOI A;  1W2N A;  2DCJ A;  5FYY A;  3WSO A;  3WXP A;  5FMC A;  2QQU A;  1LRH A;  1W6M A;  4Y1Y A;  3I59 B;  4UFJ A;  5F5A A;  2E53 A;  4HVO A;  2VMH A;  4LXL A;  3S7E A;  2UY8 A;  2IXJ A;  5C4W A;  4HVR A;  4XJZ A;  5T54 A;  4NHY A;  2BBA A;  3KV5 A;  4GB3 2;  2J1A A;  1GOG A;  5L19 A;  5JPM B;  1RED A;  1VPH A;  2X5I A;  4I3G A;  1UKR A;  4IEV A;  4B4Q A;  3JD7 2;  5FO7 B;  3ZFG B;  3GM8 A;  1QJX 2;  2B8M A;  3AM2 A;  4O61 A;  5CZK A;  3P5B A;  5FZ9 A;  2D3P A;  1SBE A;  2AEY A;  1VE0 A;  2DTY A;  1AR9 2;  4IV3 B;  4QGN A;  3ZSK A;  1O91 A;  1Y4W A;  2WNU B;  4BH9 A;  4CCK A;  4CU6 A;  1NQJ A;  1N3P A;  3K3N A;  1DCS A;  2A73 B;  3JXS A;  4LKE A;  1N1Y A;  1DQ1 A;  5IK4 A;  4HXC A;  1DBN A;  5E89 A;  4E9K A;  1JYT A;  1V6K A;  4K21 A;  3ZR6 A;  2MEV 3;  2YYO A;  4LOR A;  4OMD A;  4AVT A;  5I0R A;  4BB3 A;  3B69 A;  1ZRD A;  5LK7 B;  1JTZ X;  1UX7 A;  5FQ0 B;  2NMN A;  2VNR A;  1ULP A;  1JN2 P;  3AMH A;  3CDZ B;  2WNV B;  3R4U A;  4JAA A;  1SPP B;  1RUD 3;  1W2U A;  2RM2 3;  4MXW B;  3VD3 A;  1HB1 A;  2EIB A;  2GC2 A;  2R0H A;  4WM7 C;  1CES A;  1PX4 A;  4QM9 A;  1V6N A;  1HDK A;  5DQ0 A;  1SMV A;  2OQ6 A;  4D0Q A;  1H1A A;  4YVW A;  3R6S A;  2QCS B;  4ASM B;  5CG9 A;  3LOB A;  4LBQ D;  1JMU B;  1EAH 1;  1RMU 2;  3PVO A;  4BME A;  5G05 L;  4HK9 A;  4XFG A;  5CAD A;  4HPK B;  1ZM1 A;  5FZH A;  2RDQ A;  2XWB B;  5K0U B;  5J1X A;  1J3Q A;  1VBB 1;  1FPN 2;  2DVD A;  2HEV F;  2VQ0 A;  4LBQ A;  3A23 A;  4Y1V A;  5FPB A;  5D21 A;  1F31 A;  1MZF A;  5JIA A;  1W0O A;  5FIX A;  2BOJ A;  5LBE A;  3RZM A;  4E4D X;  3VBH C;  1PM4 A;  3A0N A;  1PGW 2;  4YG3 A;  5FOB B;  1UZY A;  1B35 C;  2ZPX A;  4ORF A;  5FZA A;  5FYH A;  2AR6 A;  3BGA A;  3HIF A;  4Q0S A;  4BZ4 A;  5IT6 A;  1I1E A;  4GWI A;  4NAM A;  1YIF A;  2VBP A;  1W6N A;  2VR4 A;  3DN7 A;  2DUQ A;  3PUS A;  4Y1U A;  3RI9 A;  4NUB A;  3WQ1 A;  1VR3 A;  2XOM A;  4N9I A;  4XEZ A;  3AZX A;  1JYN A;  4XUP A;  1J3P A;  2JDK A;  4NOT A;  1YEW A;  4R9B A;  1X82 A;  5FXZ A;  4AXO A;  2IXI A;  4AFD A;  4B1L A;  1REE A;  3LZZ A;  1HQL A;  2CL2 A;  1DZT A;  3RYK A;  2CGP A;  2LTN A;  5FXV A;  1FAT A;  1QY4 A;  2HWB 2;  4CDX C;  5A3T A;  5LBF A;  4OHY A;  2D43 A;  1W2A X;  3THD A;  2A5Z A;  2FD8 A;  5FPX A;  3NAP B;  3OBZ A;  3OY8 A;  3WP3 A;  1EYB A;  2ZGK A;  1EY2 A;  5DZF A;  1RMU 3;  1LHW A;  2PHD A;  3BOD A;  2OII A;  2QDR A;  1HJG A;  1WD3 A;  2IFR A;  3B93 A;  3IDC B;  2JDZ A;  5J96 B;  3OBT A;  3WV6 A;  3KCC A;  5C3Q A;  3GBG A;  1K5M A;  4ATF A;  5IK5 A;  3CBN A;  5B4N A;  2PN5 A;  1OBN A;  3AFG A;  3B5L B;  1BVP 1;  5FFO C;  2B39 A;  2JIC A;  3AYD A;  2PLV 2;  1UYY A;  1WD4 A;  5F2S A;  2X53 S;  2BNO A;  4FP3 A;  4NIG A;  1RUJ 2;  1OA3 A;  2WFF 3;  4MGT A;  5I93 A;  2RMU 3;  5EZW A;  2HYX A;  1JU3 A;  3MI8 A;  4MGI E;  3OEA A;  1TNF A;  3AX4 A;  4MSV A;  3QLQ A;  5FYI A;  4X8N A;  4Y4Y A;  5G04 L;  1DQ2 A;  3ECQ A;  2OUH A;  2XUE A;  5A32 B;  4NWW A;  4ERO A;  2D6K A;  1PVC 2;  2Q5T A;  2FDH A;  2XB6 C;  4KWK A;  3AL5 A;  1ZZC A;  2VNG A;  2YGM A;  2XUM A;  4RQP A;  1C5I A;  2VUJ A;  3IIA A;  4IEO A;  1JOP A;  4XFH A;  4URT A;  3AMP A;  4LKS A;  1LUL A;  1WME A;  3TNQ A;  2F17 A;  3M7A A;  1TVG A;  3PIG A;  2D7F A;  4AW7 A;  4AE2 A;  4BQX A;  3GHM A;  1G6N A;  5FY5 A;  4XAC A;  1W3V A;  4Q4V 3;  2YPD A;  5CIS A;  2VQT A;  1VB2 A;  2ES3 A;  1SQ4 A;  2H0B A;  1OF4 A;  3BKZ A;  1ZBA 3;  1OMI A;  1CZS A;  1PO2 3;  1UY3 A;  5HCH A;  1N1S A;  2VTF A;  1ASJ 2;  4DFS A;  1XPW A;  2VUC A;  4K7J A;  1W06 A;  2B46 X;  2E31 A;  3N9N A;  3OD4 A;  3FLT A;  3C7E A;  1O5L A;  3AYA A;  4AGR A;  4XJU A;  2CHH A;  3VHR A;  1ULG A;  1YQ8 A;  4HKO A;  2WAB A;  1GBG A;  1H2L A;  3K46 A;  3ZPO A;  4HN1 A;  4OZO A;  1GAN A;  1SBF A;  4Y4R A;  5FUP A;  4YZ2 A;  1GWK A;  1FOD 1;  1AR7 1;  5F3E A;  3OOX A;  1GR3 A;  4YM2 A;  1NYW A;  5FUI A;  3OGG A;  5KXD A;  4YM0 A;  1A8M A;  2QQJ A;  3HQR A;  3PVN A;  4CU7 A;  5J48 A;  3FMG A;  1C8M 2;  3H7Y A;  5JR7 B;  3FHQ A;  2YRO A;  3PLQ A;  4CU8 A;  2J22 A;  1YJL A;  2LUW A;  2WQZ C;  1F4H A;  1X8E A;  2GSY A;  3ETQ A;  5DUV A;  4CPB D;  2NZ9 A;  4QPY A;  5F1R A;  4AVA A;  5JSO A;  2QE3 A;  5LA9 A;  3ILF A;  4DUW A;  1H4G A;  4SBV A;  2P3K A;  2GC0 A;  4RD7 A;  3CLP A;  4LIV A;  2JG8 B;  1UY0 A;  4CPB A;  3BIE A;  2VZS A;  2D6L X;  5FTT C;  5DAQ A;  2R07 3;  2A6W A;  3WF2 A;  1HX6 A;  4XF1 A;  3DXT A;  1POQ A;  3OF1 A;  2DUR A;  4IEW A;  4PBO A;  2R49 A;  3E6D A;  4NHK A;  5EWS A;  1HN0 A;  4KU8 A;  4N8M A;  1DYO A;  1CZT A;  1D4V B;  2JIG A;  4AWD A;  1SLT A;  3GNE A;  2OPK A;  1W9F A;  1LTE A;  1ST8 A;  1FMD 2;  1XND A;  3KV9 A;  3A7Q A;  1YWK A;  5ERL A;  1T6B X;  3BU7 A;  3O12 A;  2PFW A;  3ALQ A;  5T5L A;  5T52 A;  2Y6G A;  3POF A;  2AEN A;  4CUG A;  1UYP A;  1X33 A;  4R4Z A;  5DXD A;  5C9A C;  4Y5T A;  2JEN A;  3RZZ A;  4ARY A;  3IN9 A;  1C8M 3;  3W59 A;  4CCO A;  3VLB B;  4EN9 B;  5LRS A;  1SDD B;  2O0O A;  2ZX3 A;  3MIE A;  4CZS A;  2BTV C;  3VHP A;  2CGO A;  2WZE A;  2AZ5 A;  2A7A A;  2UU8 A;  2Q8O A;  3WZ1 A;  4AG4 A;  4GMP 1;  2AC1 A;  4H2A A;  4L9B A;  5AC9 2;  4XTM A;  4TYS A;  4COW A;  1ZYB A;  3DEC A;  1UIJ A;  2JEC A;  4PI0 A;  1X50 A;  2C9A A;  2EIG A;  1H8T A;  5FP7 A;  1S0J A;  2N7G A;  1ULD A;  3U0Z A;  5JUV A;  1GZW A;  3CU7 A;  3NJY A;  3RGB A;  1F8V A;  1DFQ A;  1WBL A;  3B7M A;  1LOD A;  2QTW B;  2PAM A;  2F4P A;  2YMZ A;  3WNP A;  4EWD A;  4HKL A;  4DIQ A;  4FO9 A;  4BDV B;  5FY0 A;  4WV8 A;  4LO8 A;  1RVF 1;  2UWB A;  3JB4 C;  4XHB A;  1FMD 3;  1F5F A;  1NLR A;  3BUC A;  2PXJ A;  4R8H A;  4XBN A;  1OQD A;  3MUY 1;  3C7G A;  2FMY A;  1GYK A;  1OLQ A;  2GN7 A;  2L9L A;  2W0X A;  2WII B;  4NVP A;  4OQ9 A;  1UMI A;  2ARA A;  4GH4 B;  4Q26 A;  4UW6 A;  5APA A;  1OT5 A;  1LAJ A;  3EYP A;  4D3W A;  1D2Q A;  1AX0 A;  3OUJ A;  1LJ7 A;  3LEK A;  1RHI 2;  4AHY A;  2WT2 A;  1CPM A;  4I2O A;  3HAG A;  5DZE A;  4D7T A;  1COV 3;  3TYJ A;  4BIO A;  5C71 A;  1SLB A;  1AR8 3;  1JZ5 A;  3B3Q E;  5BNO C;  3AMN A;  4AFA A;  1QNY A;  1ND2 A;  3DUI A;  1SAC A;  1NA1 C;  2W52 A;  4FPF A;  1M4W A;  1W39 A;  3L2H A;  2HWD 3;  1HB2 A;  2ZHK A;  3QD6 A;  1HRV 1;  2CYF A;  4LHS A;  4FP2 A;  2WA3 A;  3KM5 A;  4CCC A;  4FTS A;  3PVE A;  3B01 A;  1DLC A;  5L7O A;  1XE8 A;  2ZJC A;  3M3Q A;  4EN7 B;  3TN9 1;  5FY4 A;  5ACA 1;  1XOY A;  4YVS A;  4IGP A;  4COV A;  1PK6 B;  5F39 A;  1FNZ A;  2JDM A;  5KXE A;  1UZV A;  3THT A;  3VKN A;  1YFW A;  1R08 1;  4YW7 A;  3TOJ A;  3PL0 A;  2HWC 3;  2WNE A;  1O5U A;  4PI2 A;  4XUN A;  1UL9 A;  3VZL A;  4Y26 A;  3SEE A;  1LNS A;  4A42 A;  2XML A;  3ON7 A;  4KI5 M;  2MNG A;  1NE6 A;  1YFU A;  4COU A;  2DVF A;  3E6B A;  1OLM A;  2ARX A;  2JXA A;  5FO8 B;  4P9I A;  1VBB 2;  4AF9 A;  5FYU A;  1AL0 G;  5C3P A;  4QX0 A;  3S6P A;  3MPP G;  1PGL 2;  1K42 A;  3NST A;  4AFB A;  1DQ0 A;  4FOQ A;  2Y6H A;  2VO5 A;  4YW5 A;  4P9W A;  3ZFF C;  3NWK A;  3AJZ A;  5F2W A;  1K45 A;  1NKG A;  2FCV A;  4AZZ A;  1D0H A;  1GQH A;  5IVC A;  2Y6J A;  4LOT A;  5DAB A;  2AEZ A;  3CQO A;  2VCB A;  5GZF A;  5GM0 A;  3CJI C;  1N47 A;  1PVX A;  3FHI B;  4XIO A;  2XBO 2;  1OFS A;  3HQU A;  3T4H B;  1RJ8 A;  1TMF 1;  2F6B A;  2OW4 A;  4YGE A;  5BV6 A;  2VM9 A;  4E2G A;  1ACC A;  5DAX A;  3ZSE A;  3RNS A;  5IK8 A;  4PIZ A;  2O8O A;  3FBM A;  1CAV B;  5FY1 A;  4CA9 A;  4Y5S A;  2R04 2;  1BK0 A;  1EAH 3;  5AVP A;  2RJ2 A;  5FR3 A;  3IM0 A;  1LOE A;  4D69 A;  4YG0 A;  4N9H A;  2R0F A;  5ANN A;  1SLA A;  3WCS A;  2BGO A;  2WS9 1;  3DGT A;  3DL3 A;  4BWO A;  4DOU A;  1WA6 X;  4ZKT B;  5T5J A;  2RS3 3;  3DKQ A;  3LPG A;  1JYC A;  4CP9 A;  2TEP A;  2XON A;  3A21 A;  3GZA A;  2Y6K A;  3V56 A;  2BEO A;  3N9P A;  3VBR C;  2OVU A;  4QKN A;  4BMB A;  3RWK X;  3PJY A;  2JB4 A;  2W92 A;  1MZE A;  5ABJ C;  2QQV A;  4JCK A;  5BPX A;  2P3Y A;  1XSQ A;  3SC7 X;  5SV8 A;  5HV0 A;  5FWE A;  2ZBJ A;  2ZZJ A;  1IZ3 A;  5L9B A;  2ZHM A;  4KU7 A;  1IOA A;  1SFN A;  1W6N B;  4LO6 B;  1RUD 1;  1PX3 A;  2PHF A;  2RM2 1;  4XOG A;  2ATF A;  4AL9 A;  1QU0 A;  3CNA A;  1BYH A;  4E2S A;  4P9X A;  5FMD A;  4XJ9 A;  2GP5 A;  3MLJ A;  4DRR A;  1KRI A;  2V5Y A;  3CO2 A;  1GZT A;  3DPR C;  4J1X A;  2D3R A;  2GAU A;  3H8R A;  1HQW A;  2WO7 A;  3FN9 A;  3HMY A;  2WZR 1;  3WF0 A;  1NT0 A;  3R4S A;  5C3O A;  1UIK A;  3LA3 A;  2XR4 A;  3A4U A;  1LOC A;  5FXX A;  5C9A B;  4DXR A;  1ZBE 3;  2ZGL A;  5JLV A;  2WT0 A;  3N9M A;  4L92 A;  3TEY A;  1NAE A;  2Q4S A;  4QD2 A;  3TN9 2;  3O1T A;  1OD3 A;  4L11 A;  4RHV 2;  5GAL A;  5A1L A;  3DYO A;  1K5M B;  5DDJ 2;  2BER A;  2PAK A;  4FPJ A;  1VBE 1;  1GQG A;  1W90 A;  3WDV A;  5A3L A;  3UNP A;  4OUE A;  4QHB A;  2RR1 1;  4N43 A;  1G9F A;  3SEP A;  2R06 2;  4JZR A;  4NPM A;  3TEZ A;  3VDA A;  2Y60 A;  3LQC A;  1J59 A;  1UU4 A;  1HIX A;  3ZXK A;  5DG2 A;  2OXB A;  4BLJ A;  2XJU A;  4KG8 A;  2BNM A;  3ZLI A;  3NJV A;  5GLT A;  4COY A;  4GKX A;  4OHV A;  5L9R A;  1VP6 A;  1CWP A;  1OHF A;  1NE4 A;  5HCF A;  1ZRE A;  4IV1 C;  1REF A;  2YPJ A;  2BP6 A;  3OPW A;  1JYW A;  2BVV A;  5FV3 A;  4YZ3 A;  4XUQ A;  3VD5 A;  3KT1 A;  3FWE A;  4QXC A;  5E8A A;  2ZGS A;  3ZOI A;  4UFI A;  3WQ0 A;  4ZU7 A;  4RQP B;  3W20 A;  2A3Y A;  2WLP A;  3K4A A;  4NRP A;  5T55 A;  3SMH A;  4YW3 A;  3H8U A;  5CEH A;  4OI0 A;  4KGQ A;  1K3I A;  3KS7 A; 
#chains in the Genus database with same CATH homology
 4UAP A;  2W91 A;  2E26 A;  3HNB M;  5A1A A;  1R64 A;  2VCC A;  4M4R A;  5JXH A;  3PUH A;  2J1E A;  4QPW A;  1O59 A;  3VD7 A;  4CUB A;  3VD4 A;  2Y6L A;  1IQD C;  2WUH A;  1XC6 A;  4QB6 A;  3WNK A;  4UOJ A;  3I3D A;  3IAP A;  1UYX A;  1GMM A;  3UES A;  2VC9 A;  1UYZ A;  3CZU A;  2XHN A;  1W9T A;  4QB2 A;  2DCJ A;  3WSO A;  2HLE A;  3OBA A;  3T2P A;  4MOA A;  2C9K A;  1UXZ A;  3ACG A;  2ZXQ A;  4DXS A;  3W5N A;  3A22 A;  3T0B A;  3GDB A;  2BBA A;  4JX0 A;  2J1A A;  1GOG A;  4XUO A;  4XUT A;  3WNN A;  1JZ2 A;  3IDA A;  1W0N A;  3CIH A;  3I2I A;  2ZEY A;  3GM8 A;  5CYY A;  5CZK A;  2EIC A;  1GQP A;  2LS6 A;  4LQR A;  1W8O A;  2RVA A;  2WO1 A;  4CU6 A;  3OB8 A;  3JXS A;  2V5D A;  2BGP A;  3U37 A;  2VOT A;  3I97 A;  4OMD A;  4W4Z A;  1KGY A;  2JE8 A;  2QQL A;  4TTG A;  1UX7 A;  3K4D A;  5DMY A;  3CMG A;  2JD9 A;  4A41 A;  5IHR A;  1GUI A;  1ULP A;  3CDZ B;  3THC A;  4KMQ A;  3VD3 A;  2QQI A;  2EIB A;  3VD9 A;  1PX4 A;  5DQ0 A;  3SKV A;  4D0Q A;  2R7E B;  1JYX A;  4IUG A;  4OMC A;  1RYY A;  2CDP A;  1SG3 A;  4CUC A;  5G05 L;  2W1W A;  3OGV A;  2Y8K A;  4UI9 L;  5J1X A;  1CZV A;  2W95 A;  3MUZ 1;  2C4X A;  3A23 A;  4JKK A;  2LW8 A;  4CUA A;  4RN5 A;  3I2F A;  1JZ8 A;  2VME A;  3LEI A;  2XQX A;  3BGA A;  3GGL A;  4GWI A;  2VR4 A;  1JYN A;  2VJX A;  2VMD A;  2XOM A;  2JKX A;  4P08 A;  4XUP A;  1CIY A;  1UY4 A;  2W5F A;  3OG2 A;  2YG0 A;  2X10 A;  3THD A;  1JZ3 A;  1JU4 A;  3LE0 A;  2VZ1 A;  5HXM A;  1YQ2 A;  3WNL A;  5LA0 A;  3P6B A;  3UET A;  2YC4 A;  5B4N A;  2WO3 A;  5IFT A;  2ZEZ A;  1UYY A;  4DUV A;  5C70 A;  4QAW A;  3MV0 1;  2HYX A;  1JHJ A;  1JU3 A;  2QQK A;  3ACH A;  2YB7 A;  4XVH A;  3OEA A;  2EIE A;  2WAA A;  4JKL A;  4MGS A;  4ZY9 A;  5G04 L;  3ECQ A;  4BK4 A;  4P5Y A;  3I3B A;  3MBW A;  4QX1 A;  4ZZ5 A;  3CKH A;  2ZEW A;  4JKM A;  3I2J A;  4LKS A;  2WN2 A;  3I2K A;  3III A;  1TVG A;  1UMH A;  1JZ4 A;  4JHZ A;  4KWU A;  2WAO A;  2WO2 A;  1NX9 A;  2VQT A;  1OF4 A;  3MO4 A;  1CZS A;  1UY3 A;  2VTF A;  1XPW A;  1P8J A;  2E31 A;  2Z4F A;  3C7E A;  3I2G A;  2W94 A;  4QX2 A;  3WQB A;  5LA1 A;  3WF1 A;  2WAB A;  3NQH A;  3K46 A;  4OZO A;  5DPN A;  2OKX A;  2J1S A;  1H6Y A;  1OF3 A;  2X05 A;  5JXJ A;  5FUI A;  1W8N A;  4ZZ8 A;  2QQJ A;  4CU7 A;  3OGR A;  3MV1 1;  3FHQ A;  4CU8 A;  3ETP A;  2J22 A;  1F4H A;  2VZP A;  2J1U A;  4DUW A;  3I3E A;  2B9V A;  2V4V A;  3DYP A;  4BK5 A;  1UY0 A;  3BN6 A;  2VZS A;  1PMJ X;  3VDB A;  3WF2 A;  4XUR A;  1BHG A;  3K4Z A;  4DEQ A;  4MAD A;  1DYO A;  1CZT A;  2WDB A;  2J1V A;  3T08 A;  1J83 A;  2W46 A;  4L0P A;  3AC0 A;  4PQQ A;  2W3J A;  3A7Q A;  2VZU A;  3VDC A;  4P00 B;  2Y6G A;  3J7H A;  1CX1 A;  2YC2 A;  3P1I A;  3IB3 A;  4ARY A;  3EB7 A;  3OGS A;  5C7G A;  3WF4 A;  1SDD B;  2J1R A;  3T0A A;  2J1T A;  5IYY A;  2WZE A;  4AG4 A;  1H6X A;  2YFZ A;  2BZD A;  3DEC A;  4CVU A;  3FL7 A;  5EIY B;  4OYU A;  5JUV A;  1HN1 A;  2ZEX A;  3LPF A;  3WNP A;  4BDV B;  4FI9 A;  4M4P A;  4TXW A;  5IJR A;  1T2X A;  1EUT A;  3MUY 1;  3C7G A;  2L9L A;  3HEI A;  1UMI A;  1GOF A;  4QDR A;  1OT5 A;  3WNM A;  3EYP A;  4ET7 A;  1O8P A;  2DDU A;  4XZU G;  2QQO A;  4ARX A;  1GU3 A;  5HPO A;  3C7F A;  1EUU A;  3LEK A;  2ID4 A;  3HJR A;  3W5M A;  2WQ8 A;  1NUK A;  5C71 A;  4MGQ A;  2V72 A;  1JZ5 A;  2VZR A;  2VQU A;  3DYM A;  3HN3 A;  3ABZ A;  4LHS A;  3OEB A;  5JMO A;  1UWW A;  3GXU A;  1US3 A;  3T0D A;  1DLC A;  4MO3 M;  4PT6 A;  5LA2 A;  2KD7 A;  3WEZ A;  2EID A;  1SHW B;  4QDS A;  4DXT A;  4HG6 B;  1UXX X;  1JZ6 A;  2VMC A;  4RYD A;  3C7H A;  4Z2A A;  1TG7 A;  4XUN A;  2W87 A;  4A44 A;  3SEE A;  1LNS A;  4A42 A;  2DCK A;  1W9W A;  4KI5 M;  4BXS V;  2VZT A;  3C7O A;  1XNT A;  4E8C A;  3LEG A;  2QBX A;  1L7Q A;  5EJZ B;  1K42 A;  4QX0 A;  4YPJ A;  3HNY M;  1K12 A;  3T2O A;  2Y6H A;  2VO5 A;  1JI6 A;  5EJ1 B;  1K45 A;  1NKG A;  2C26 A;  1I5P A;  4BJ0 A;  1O8S A;  2Y6J A;  4DUX A;  3CQO A;  2VCB A;  3E1F 1;  4CU9 A;  3T2Q A;  2ORZ A;  3SKJ E;  5JXI A;  3FHA A;  2VM9 A;  4DEV A;  5B4X A;  2VZ3 A;  3ACI A;  2WN3 A;  1L7R A;  2RJ2 A;  1GNY A;  1PMH X;  2W1U A;  4QX3 A;  3C8X A;  3NJX A;  3HPN A;  4E8D A;  2BGO A;  5JR2 A;  4QB1 A;  4A3Z A;  5I0D A;  3LPG A;  2QQN A;  2Y64 A;  2B4K A;  5JXG A;  2W1Q A;  2XON A;  3ACF A;  3A21 A;  2Y6K A;  1W99 A;  2E32 A;  3WNO A;  5F7U A;  3NRU A;  2WBK A;  3D3A A;  2W92 A;  2W1S A;  1WKY A;  3K75 B;  2JDA A;  2W47 A;  4W8J A;  2YFU A;  1DP0 A;  2ORX A;  5LCW L;  2RV9 A;  2CDO A;  3PUI A;  1PX3 A;  1MPX A;  2VCA A;  3T09 A;  4A6O A;  1KEX A;  1JZ7 A;  5DN2 A;  4GWJ A;  4PF1 A;  1WCQ A;  3FN9 A;  1US2 A;  3WF0 A;  2E33 A;  1F4A A;  2QQM A;  3I2H A;  3NNG A;  4D8M A;  4DXR A;  4QDQ A;  2VZV A;  1J84 A;  2WYS A;  1NAE A;  2VL4 A;  3IAQ A;  1UZ0 A;  4A45 A;  1OD3 A;  2VMF A;  3DYO A;  2BER A;  4ZXE A;  2WZ8 A;  2X09 A;  2VZO A;  3HNM A;  3UNP A;  4OUE A;  5IFP A;  3SEP A;  1UY1 A;  3WF3 A;  1JYV A;  1W9S A;  3VDA A;  3LQC A;  4W50 A;  2J7M A;  3ZM8 A;  3K77 A;  1GOH A;  1UY2 A;  4P02 B;  3NJV A;  4GZ9 A;  2W9X A;  3CZJ A;  4AAX A;  2VZQ A;  1JYW A;  4A4A A;  1XNA A;  4XUQ A;  3VD5 A;  4LPL A;  1OH4 A;  3K4A A;  3F2Z A;  1ULO A;  2PQS A;  1K3I A;  1D7P M;  3HOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...