1D7XA

Crystal structure of mmp3 complexed with a modified proline scaffold based inhibitor.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
169
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1 PRECURSOR
publication title Design, synthesis, and biological evaluation of matrix metalloproteinase inhibitors derived from a modified proline scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1999-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1d7xA00
5BPAA 2O36A 1XUDA 4PKWA 1I76A 1SRPA 1I1IP 3DPFA 2FV9A 3HY9A 2Z2DA 2OXZA 3KHIA 1KUFA 3HDBA 3I7IA 4GQLA 3GBOA 1SU3A 5L79A 1IADA 4PKRA 1G05A 2OZRA 4WF6A 3LQ0A 1MMBA 4WZVA 2JIHA 1B8YA 2E3XA 5D1TA 1G49A 5LABA 1SLNA 4IJOA 1ND1A 5CZMA 4GUYA 3WV2A 3F18A 2RJQA 1BQQM 1QICA 1CK7A 4FXYP 1CXVA 1G9KA 2YB9A 1H71P 3KMEA 1ZTQA 4GR8A 4XBHA 1EUBA 1GE6A 1PWUA 1K7GA 3ZVSA 1IACA 2AIGP 1XURA 2MLSA 1JIWP 2D1NA 3B2ZA 2MZEA 3HBUP 1J7NA 2W12A 4H49A 3HB2P 5I4OA 2J83A 2DW2A 1GO7P 1RM8A 4DV8A 3AYUA 3P24A 4H3XA 3ZXHA 2I47A 4XCTA 1JH1A 4L6TA 1SATA 4GWMA 4DPEA 1CAQA 2AYKA 1PWWA 1HV5A 1D8MA 5D3CA 456CA 4GR0A 1Z3JA 1KUHA 1UMTA 3EDZA 3TVCA 2OW1A 2DDFA 3F15A 3ELMA 1A86A 4A7BA 1EB6A 3VTGA 1BIWA 2MZIA 3HDAP 4JIJA 1BSWA 4PKQA 5H8XA 1R54A 3K7NA 3DWBA 2W0DA 1HY7A 3TSKA 2OY4A 3LUNA 1BUDA 3LQBA 1UEAA 1GE7A 4GWNA 2OY2A 4AXQA 3DPEA 2QPJA 2POJA 2WOAA 4A3WA 4XM8A 3HYGA 3F16A 1XFXA 3MA2A 1FBLA 1MMRA 2W15A 1Y93A 2XS3A 1KUGA 2A8HA 1KAPP 4ON1A 3LGPA 2W14A 1JKYA 3LIKA 1O0TA 1UTZA 1JK3A 3K7LA 5BOTA 3B8ZA 5I3MA 2N8RA 2X7MA 4H76A 2USNA 3I7GA 3G5CA 3E8RA 1BM6A 1XFVA 2WO8A 1FLSA 1HFSA 1ZXCA 2HU6A 2ERPA 3RTSA 4QKZA 3TS4A 3LKAA 2OXUA 3EDHA 1KUIA 1R1JA 3DNGA 1QJJA 3HBVP 1JAPA 5I12A 4L63A 1K7IA 3LUMA 2SRTA 1KBCA 3DSLA 4JP4A 966CA 5D2BA 3F1AA 5I0LA 1DTHA 1ZXVA 1JAOA 1OM7A 1CGEA 2X3BA 4DF9A 4WK7A 3V96B 3OHLA 3LEAA 4G0DA 3ZUKA 4DD8A 1D8FA 2X3CA 1GE5A 2JNPA 2OW0A 1Y0VA 1ZS0A 4GF1A 1UTTA 3LILA 1YP1A 1MMQA 5D1UA 4CTHA 2OW9A 1FM1A 1C3IA 3KECA 3P1VA 1QJIA 4ILWD 1ROSA 3G42A 1USNA 1XUCA 1ZP5A 4PKTA 1ATLA 1O0QA 2V4BA 4H84A 1IAEA 3N2UA 1JANA 1OS2A 4H30A 1RMZA 1SLMA 1DMTA 1OMJA 3BA0A 2MLRA 3UVCA 3KMCA 4AIGA 1K7QA 1G12A 1Y8JA 1AKLA 2CKIA 1QUAA 2Y6CA 1BQOA 1Q3AA 2O3EA 3B92A 1GXDA 4IN9A 3N2VA 5B5OA 1IAAA 3WV1A 2W13A 3LK8A 1PWVA 2MZHA 2FV5A 4H82A 2DW0A 4PKUA 1QIBA 2OW2A 3U1RA 1XFWA 3EHYA 1AF0A 1JAQA 1A85A 4HMAA 1YCMA 1C7KA 4AYKA 3KRYA 2TCLA 4I35A 5B5PA 1EAKA 5I43A 1XFUA 2CLTA 2KRJA 2PJTA 2JT5A 5L7FA 4J4MA 1R1HA 2XS4A 3LJGA 2DW1A 4XM6A 1OM6A 2JT6A 1PWQA 4WKEA 5BOYA 4JPAA 1OM8A 3TT4A 4ZR5A 3KEKA 2OVXA 2OI0A 3SHIA 3AYKA 2ERQA 3RTTA 3LJTA 2X3AA 2E2DA 4GR3A 3LMCA 1IAGA 3EDGA 1I73A 1BZSA 3LIRA 4Q1LA 1D5JA 1R1IA 1S4BP 3EHXA 2YIGA 4L19A 4H1QA 1ZVXA 2K9CA 4JA1A 3LJZA 1HFCA 3OHOA 1SMPA 1R55A 1B3DA 4FVLA 2EROA 3HY7A 4EFSA 3L0VA 5JMYA 3USNA 4G9LA 3F17A 4HX3A 2Y6DA 3CKIA 3AIGA 3NX7A 2RJPA 3O2XA 1GO8P 1OS9A 2OVZA 4H2EA 1HOVA 5CUHA 4WKIA 2D1OA 4PKVA 1ASTA 1MNCA 4PKSA 5CXAA 1JIZA 4R3VA 2K2GA 1XFYA 1CGFA 1CQRA 1KUKA 5I2ZA 1G4KA 1OO9A 3VI1A 4I03A 4FU4A 1CIZA 5D7WA 3Q2HA 1CGLA 3L0TA 3EDIA 3O64A 1BUVM 1L6JA 1UMSA 1BKCE 3F19A 1JJ9A 1AYKA 2DDYA 4AUOA 2J0TA 3Q2GA 1YOUA 1C8TA 2JSDA 1BKCA 2OXWA 4XM7A 3KEJA 3EWJA 2WO9A 1GKCA 1QIAA 1GKDA 1MMPA 830CA 1BKCI 1PWPA 3WV3A 1WNIA 1YQYA 1HTDA 5D1SA 4FXQA 3LE9A 1D7XA 4JQGA 1XFZA 2L0RA 1IABA 4IUWA 3DL1A 3KWVC
chains in the Genus database with same CATH superfamily
5BPAA 2O36A 1XUDA 4PKWA 1I76A 1SRPA 1I1IP 3DPFA 2FV9A 3HY9A 2Z2DA 2OXZA 3KHIA 1KUFA 3HDBA 3I7IA 4GQLA 3GBOA 1SU3A 5L79A 1IADA 4PKRA 1G05A 2OZRA 4WF6A 3LQ0A 1MMBA 4WZVA 2JIHA 1B8YA 2E3XA 5D1TA 1G49A 5LABA 1SLNA 4IJOA 1ND1A 5CZMA 4GUYA 3WV2A 3F18A 2RJQA 1BQQM 1QICA 1CK7A 4FXYP 1CXVA 1G9KA 2YB9A 1H71P 3KMEA 1ZTQA 4GR8A 4XBHA 1EUBA 1GE6A 1PWUA 1K7GA 3ZVSA 1IACA 2AIGP 1XURA 2MLSA 2YUFA 1JIWP 2D1NA 3B2ZA 2MZEA 3HBUP 1J7NA 2W12A 4H49A 3HB2P 5I4OA 2J83A 2DW2A 1GO7P 1RM8A 4DV8A 3AYUA 3P24A 4H3XA 1XAXA 3ZXHA 2I47A 4XCTA 1JH1A 4L6TA 1SATA 4GWMA 4DPEA 1CAQA 2AYKA 3DTIA 1PWWA 1HV5A 1D8MA 5D3CA 456CA 4GR0A 1Z3JA 1KUHA 1UMTA 3EDZA 3TVCA 2OW1A 2DDFA 3F15A 3ELMA 1A86A 4A7BA 1EB6A 3VTGA 1BIWA 2MZIA 3HDAP 4JIJA 1BSWA 4PKQA 5H8XA 1R54A 3K7NA 3DWBA 2W0DA 1HY7A 3TSKA 2OY4A 3LUNA 1BUDA 3LQBA 1UEAA 1GE7A 4GWNA 2OY2A 4AXQA 3DPEA 2QPJA 2POJA 2WOAA 4A3WA 4XM8A 3HYGA 3F16A 1XFXA 3MA2A 1FBLA 1MMRA 2W15A 1Y93A 2XS3A 1KUGA 1XM5A 2A8HA 1KAPP 4ON1A 3LGPA 2W14A 1JKYA 3LIKA 1O0TA 1UTZA 1JK3A 3K7LA 5BOTA 3B8ZA 5I3MA 2N8RA 2X7MA 4H76A 2USNA 3I7GA 3G5CA 3E8RA 1BM6A 1XFVA 2WO8A 1FLSA 1HFSA 1ZXCA 2HU6A 2ERPA 3RTSA 4QKZA 3TS4A 3LKAA 2OXUA 3EDHA 1KUIA 1OZ9A 1R1JA 3DNGA 1QJJA 3HBVP 1JAPA 5I12A 4L63A 1K7IA 3LUMA 2SRTA 1KBCA 3DSLA 4JP4A 966CA 5D2BA 3F1AA 5I0LA 1DTHA 1ZXVA 1JAOA 1OM7A 1CGEA 2X3BA 4DF9A 4WK7A 3V96B 3OHLA 3LEAA 4G0DA 3ZUKA 4DD8A 1D8FA 2X3CA 1GE5A 2JNPA 2OW0A 1Y0VA 1ZS0A 4GF1A 1UTTA 3LILA 1YP1A 1MMQA 5D1UA 4CTHA 2OW9A 1FM1A 1C3IA 3KECA 3P1VA 1QJIA 4ILWD 1ROSA 3G42A 1USNA 1XUCA 1ZP5A 4PKTA 1ATLA 1O0QA 2V4BA 4H84A 1IAEA 3N2UA 1JANA 1OS2A 4H30A 1RMZA 1SLMA 1DMTA 1OMJA 3BA0A 2MLRA 3UVCA 3KMCA 4AIGA 1K7QA 1G12A 1Y8JA 1AKLA 2CKIA 1QUAA 2Y6CA 1BQOA 1Q3AA 2O3EA 3B92A 1GXDA 4IN9A 3N2VA 5B5OA 1IAAA 3WV1A 2W13A 3LK8A 1PWVA 2MZHA 2FV5A 4H82A 2DW0A 4PKUA 1QIBA 2OW2A 3U1RA 1XFWA 3EHYA 1AF0A 1JAQA 1A85A 4HMAA 1YCMA 1C7KA 4AYKA 3KRYA 2TCLA 4I35A 5B5PA 1EAKA 5I43A 1XFUA 2CLTA 2KRJA 2PJTA 2JT5A 5L7FA 4J4MA 1R1HA 2XS4A 3LJGA 2DW1A 4XM6A 1OM6A 2JT6A 1PWQA 4WKEA 5BOYA 4JPAA 1OM8A 3TT4A 4ZR5A 3KEKA 2OVXA 2OI0A 3SHIA 3AYKA 2ERQA 3RTTA 3LJTA 2X3AA 2E2DA 4GR3A 3LMCA 1TVIA 1IAGA 3EDGA 1I73A 1BZSA 3LIRA 4Q1LA 1D5JA 1R1IA 1S4BP 3EHXA 2YIGA 4L19A 4H1QA 1ZVXA 3DTKA 3DTEA 2K9CA 4JA1A 3LJZA 1HFCA 3OHOA 1SMPA 1R55A 1B3DA 4FVLA 2EROA 3HY7A 4EFSA 3L0VA 5JMYA 3USNA 4G9LA 3F17A 4HX3A 2Y6DA 3CKIA 3AIGA 3NX7A 2RJPA 3O2XA 1GO8P 1OS9A 4L7AA 2OVZA 4H2EA 1HOVA 5CUHA 4WKIA 2D1OA 4PKVA 1ASTA 1MNCA 4PKSA 5CXAA 1JIZA 4R3VA 2K2GA 1XFYA 1CGFA 1CQRA 1KUKA 5I2ZA 1G4KA 1OO9A 3VI1A 4I03A 4FU4A 1CIZA 5D7WA 3Q2HA 1CGLA 3L0TA 3EDIA 3O64A 1BUVM 1L6JA 1UMSA 1BKCE 3F19A 1JJ9A 1AYKA 2DDYA 4AUOA 2J0TA 3Q2GA 1YOUA 1C8TA 2JSDA 1BKCA 2OXWA 4XM7A 3KEJA 3EWJA 2WO9A 1GKCA 1QIAA 1GKDA 1MMPA 830CA 1BKCI 1PWPA 3WV3A 1WNIA 1YQYA 1HTDA 5D1SA 4FXQA 3LE9A 1D7XA 4JQGA 1XFZA 2L0RA 1IABA 4IUWA 3DL1A 3KWVC
chains in the Genus database with same CATH topology
5BPAA 2O36A 1XUDA 4PKWA 1I76A 1SRPA 1I1IP 3DPFA 2FV9A 3HY9A 2Z2DA 2OXZA 3KHIA 1KUFA 3HDBA 3I7IA 4GQLA 3GBOA 1SU3A 5L79A 1IADA 4PKRA 1G05A 2OZRA 4WF6A 3LQ0A 1MMBA 4WZVA 2JIHA 1B8YA 2E3XA 5D1TA 1G49A 5LABA 1SLNA 4IJOA 1ND1A 5CZMA 4GUYA 3WV2A 3F18A 2RJQA 1BQQM 1QICA 1CK7A 4FXYP 1CXVA 1G9KA 2YB9A 1H71P 3KMEA 1ZTQA 4GR8A 4XBHA 1EUBA 1GE6A 1PWUA 1K7GA 3ZVSA 1IACA 2AIGP 1XURA 2MLSA 2YUFA 1JIWP 2D1NA 3B2ZA 2MZEA 3HBUP 1J7NA 2W12A 4H49A 3HB2P 5I4OA 2J83A 2DW2A 1GO7P 1RM8A 4DV8A 3AYUA 3P24A 4H3XA 3ZXHA 2I47A 4XCTA 1JH1A 4L6TA 1SATA 4GWMA 4DPEA 1CAQA 2AYKA 3DTIA 1PWWA 1HV5A 1D8MA 5D3CA 456CA 4GR0A 1Z3JA 1KUHA 1UMTA 3EDZA 3TVCA 2OW1A 2DDFA 3F15A 3ELMA 1A86A 4A7BA 1EB6A 3VTGA 1BIWA 2MZIA 3HDAP 4JIJA 1BSWA 4PKQA 5H8XA 1R54A 3K7NA 3DWBA 2W0DA 1HY7A 3TSKA 2OY4A 3LUNA 1BUDA 3LQBA 1UEAA 1GE7A 4GWNA 2OY2A 4AXQA 3DPEA 2QPJA 2POJA 2WOAA 4A3WA 4XM8A 3HYGA 3F16A 1XFXA 3MA2A 1FBLA 1MMRA 2W15A 1Y93A 2XS3A 1KUGA 2A8HA 1KAPP 4ON1A 3LGPA 2W14A 1JKYA 3LIKA 1O0TA 1UTZA 1JK3A 3K7LA 5BOTA 3B8ZA 5I3MA 2N8RA 2X7MA 4H76A 2USNA 3I7GA 3G5CA 3E8RA 1BM6A 1XFVA 2WO8A 1FLSA 1HFSA 1ZXCA 2HU6A 2ERPA 3RTSA 4QKZA 3TS4A 3LKAA 2OXUA 3EDHA 1KUIA 1R1JA 3DNGA 1QJJA 3HBVP 1JAPA 5I12A 4L63A 1K7IA 3LUMA 2SRTA 1KBCA 3DSLA 4JP4A 966CA 5D2BA 3F1AA 5I0LA 1DTHA 1ZXVA 1JAOA 1OM7A 1CGEA 2X3BA 4DF9A 4WK7A 3V96B 3OHLA 3LEAA 4G0DA 3ZUKA 4DD8A 1D8FA 2X3CA 1GE5A 2JNPA 2OW0A 1Y0VA 1ZS0A 4GF1A 1UTTA 3LILA 1YP1A 1MMQA 5D1UA 4CTHA 2OW9A 1FM1A 1C3IA 3KECA 3P1VA 1QJIA 4ILWD 1ROSA 3G42A 1USNA 1XUCA 1ZP5A 4PKTA 1ATLA 1O0QA 2V4BA 4H84A 1IAEA 3N2UA 1JANA 1OS2A 4H30A 1RMZA 1SLMA 1DMTA 1OMJA 3BA0A 2MLRA 3UVCA 3KMCA 4AIGA 1K7QA 1G12A 1Y8JA 1AKLA 2CKIA 1QUAA 2Y6CA 1BQOA 1Q3AA 2O3EA 3B92A 1GXDA 4IN9A 3N2VA 5B5OA 1IAAA 3WV1A 2W13A 3LK8A 1PWVA 2MZHA 2FV5A 4H82A 2DW0A 4PKUA 1QIBA 2OW2A 3U1RA 1XFWA 3EHYA 1AF0A 1JAQA 1A85A 4HMAA 1YCMA 1C7KA 4AYKA 3KRYA 2TCLA 4I35A 5B5PA 1EAKA 5I43A 1XFUA 2CLTA 2KRJA 2PJTA 2JT5A 5L7FA 4J4MA 1R1HA 2XS4A 3LJGA 2DW1A 4XM6A 1OM6A 2JT6A 1PWQA 4WKEA 5BOYA 4JPAA 1OM8A 3TT4A 4ZR5A 3KEKA 2OVXA 2OI0A 3SHIA 3AYKA 2ERQA 3RTTA 3LJTA 2X3AA 2E2DA 4GR3A 3LMCA 1IAGA 3EDGA 1I73A 1BZSA 3LIRA 4Q1LA 1D5JA 1R1IA 1S4BP 3EHXA 2YIGA 4L19A 4H1QA 1ZVXA 3DTKA 3DTEA 2K9CA 4JA1A 3LJZA 1HFCA 3OHOA 1SMPA 1R55A 1B3DA 4FVLA 2EROA 3HY7A 4EFSA 3L0VA 5JMYA 3USNA 4G9LA 3F17A 4HX3A 2Y6DA 3CKIA 3AIGA 3NX7A 2RJPA 3O2XA 1GO8P 1OS9A 4L7AA 2OVZA 4H2EA 1HOVA 5CUHA 4WKIA 2D1OA 4PKVA 1ASTA 1MNCA 4PKSA 5CXAA 1JIZA 4R3VA 2K2GA 1XFYA 1CGFA 1CQRA 1KUKA 5I2ZA 1G4KA 1OO9A 3VI1A 4I03A 4FU4A 1CIZA 5D7WA 3Q2HA 1CGLA 3L0TA 3EDIA 3O64A 1BUVM 1L6JA 1UMSA 1BKCE 3F19A 1JJ9A 1AYKA 2DDYA 4AUOA 2J0TA 3Q2GA 1YOUA 1C8TA 2JSDA 1BKCA 2OXWA 4XM7A 3KEJA 3EWJA 2WO9A 1GKCA 1QIAA 1GKDA 1MMPA 830CA 1BKCI 1PWPA 3WV3A 1WNIA 1YQYA 1HTDA 5D1SA 4FXQA 3LE9A 1D7XA 4JQGA 1XFZA 2L0RA 1IABA 4IUWA 3DL1A 3KWVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPA A;  2O36 A;  1XUD A;  4PKW A;  1I76 A;  1SRP A;  1I1I P;  3DPF A;  2FV9 A;  3HY9 A;  2Z2D A;  2OXZ A;  3KHI A;  1KUF A;  3HDB A;  3I7I A;  4GQL A;  3GBO A;  1SU3 A;  5L79 A;  1IAD A;  4PKR A;  1G05 A;  2OZR A;  4WF6 A;  3LQ0 A;  1MMB A;  4WZV A;  2JIH A;  1B8Y A;  2E3X A;  5D1T A;  1G49 A;  5LAB A;  1SLN A;  4IJO A;  1ND1 A;  5CZM A;  4GUY A;  3WV2 A;  3F18 A;  2RJQ A;  1BQQ M;  1QIC A;  1CK7 A;  4FXY P;  1CXV A;  1G9K A;  2YB9 A;  1H71 P;  3KME A;  1ZTQ A;  4GR8 A;  4XBH A;  1EUB A;  1GE6 A;  1PWU A;  1K7G A;  3ZVS A;  1IAC A;  2AIG P;  1XUR A;  2MLS A;  1JIW P;  2D1N A;  3B2Z A;  2MZE A;  3HBU P;  1J7N A;  2W12 A;  4H49 A;  3HB2 P;  5I4O A;  2J83 A;  2DW2 A;  1GO7 P;  1RM8 A;  4DV8 A;  3AYU A;  3P24 A;  4H3X A;  3ZXH A;  2I47 A;  4XCT A;  1JH1 A;  4L6T A;  1SAT A;  4GWM A;  4DPE A;  1CAQ A;  2AYK A;  1PWW A;  1HV5 A;  1D8M A;  5D3C A;  456C A;  4GR0 A;  1Z3J A;  1KUH A;  1UMT A;  3EDZ A;  3TVC A;  2OW1 A;  2DDF A;  3F15 A;  3ELM A;  1A86 A;  4A7B A;  1EB6 A;  3VTG A;  1BIW A;  2MZI A;  3HDA P;  4JIJ A;  1BSW A;  4PKQ A;  5H8X A;  1R54 A;  3K7N A;  3DWB A;  2W0D A;  1HY7 A;  3TSK A;  2OY4 A;  3LUN A;  1BUD A;  3LQB A;  1UEA A;  1GE7 A;  4GWN A;  2OY2 A;  4AXQ A;  3DPE A;  2QPJ A;  2POJ A;  2WOA A;  4A3W A;  4XM8 A;  3HYG A;  3F16 A;  1XFX A;  3MA2 A;  1FBL A;  1MMR A;  2W15 A;  1Y93 A;  2XS3 A;  1KUG A;  2A8H A;  1KAP P;  4ON1 A;  3LGP A;  2W14 A;  1JKY A;  3LIK A;  1O0T A;  1UTZ A;  1JK3 A;  3K7L A;  5BOT A;  3B8Z A;  5I3M A;  2N8R A;  2X7M A;  4H76 A;  2USN A;  3I7G A;  3G5C A;  3E8R A;  1BM6 A;  1XFV A;  2WO8 A;  1FLS A;  1HFS A;  1ZXC A;  2HU6 A;  2ERP A;  3RTS A;  4QKZ A;  3TS4 A;  3LKA A;  2OXU A;  3EDH A;  1KUI A;  1R1J A;  3DNG A;  1QJJ A;  3HBV P;  1JAP A;  5I12 A;  4L63 A;  1K7I A;  3LUM A;  2SRT A;  1KBC A;  3DSL A;  4JP4 A;  966C A;  5D2B A;  3F1A A;  5I0L A;  1DTH A;  1ZXV A;  1JAO A;  1OM7 A;  1CGE A;  2X3B A;  4DF9 A;  4WK7 A;  3V96 B;  3OHL A;  3LEA A;  4G0D A;  3ZUK A;  4DD8 A;  1D8F A;  2X3C A;  1GE5 A;  2JNP A;  2OW0 A;  1Y0V A;  1ZS0 A;  4GF1 A;  1UTT A;  3LIL A;  1YP1 A;  1MMQ A;  5D1U A;  4CTH A;  2OW9 A;  1FM1 A;  1C3I A;  3KEC A;  3P1V A;  1QJI A;  4ILW D;  1ROS A;  3G42 A;  1USN A;  1XUC A;  1ZP5 A;  4PKT A;  1ATL A;  1O0Q A;  2V4B A;  4H84 A;  1IAE A;  3N2U A;  1JAN A;  1OS2 A;  4H30 A;  1RMZ A;  1SLM A;  1DMT A;  1OMJ A;  3BA0 A;  2MLR A;  3UVC A;  3KMC A;  4AIG A;  1K7Q A;  1G12 A;  1Y8J A;  1AKL A;  2CKI A;  1QUA A;  2Y6C A;  1BQO A;  1Q3A A;  2O3E A;  3B92 A;  1GXD A;  4IN9 A;  3N2V A;  5B5O A;  1IAA A;  3WV1 A;  2W13 A;  3LK8 A;  1PWV A;  2MZH A;  2FV5 A;  4H82 A;  2DW0 A;  4PKU A;  1QIB A;  2OW2 A;  3U1R A;  1XFW A;  3EHY A;  1AF0 A;  1JAQ A;  1A85 A;  4HMA A;  1YCM A;  1C7K A;  4AYK A;  3KRY A;  2TCL A;  4I35 A;  5B5P A;  1EAK A;  5I43 A;  1XFU A;  2CLT A;  2KRJ A;  2PJT A;  2JT5 A;  5L7F A;  4J4M A;  1R1H A;  2XS4 A;  3LJG A;  2DW1 A;  4XM6 A;  1OM6 A;  2JT6 A;  1PWQ A;  4WKE A;  5BOY A;  4JPA A;  1OM8 A;  3TT4 A;  4ZR5 A;  3KEK A;  2OVX A;  2OI0 A;  3SHI A;  3AYK A;  2ERQ A;  3RTT A;  3LJT A;  2X3A A;  2E2D A;  4GR3 A;  3LMC A;  1IAG A;  3EDG A;  1I73 A;  1BZS A;  3LIR A;  4Q1L A;  1D5J A;  1R1I A;  1S4B P;  3EHX A;  2YIG A;  4L19 A;  4H1Q A;  1ZVX A;  2K9C A;  4JA1 A;  3LJZ A;  1HFC A;  3OHO A;  1SMP A;  1R55 A;  1B3D A;  4FVL A;  2ERO A;  3HY7 A;  4EFS A;  3L0V A;  5JMY A;  3USN A;  4G9L A;  3F17 A;  4HX3 A;  2Y6D A;  3CKI A;  3AIG A;  3NX7 A;  2RJP A;  3O2X A;  1GO8 P;  1OS9 A;  2OVZ A;  4H2E A;  1HOV A;  5CUH A;  4WKI A;  2D1O A;  4PKV A;  1AST A;  1MNC A;  4PKS A;  5CXA A;  1JIZ A;  4R3V A;  2K2G A;  1XFY A;  1CGF A;  1CQR A;  1KUK A;  5I2Z A;  1G4K A;  1OO9 A;  3VI1 A;  4I03 A;  4FU4 A;  1CIZ A;  5D7W A;  3Q2H A;  1CGL A;  3L0T A;  3EDI A;  3O64 A;  1BUV M;  1L6J A;  1UMS A;  1BKC E;  3F19 A;  1JJ9 A;  1AYK A;  2DDY A;  4AUO A;  2J0T A;  3Q2G A;  1YOU A;  1C8T A;  2JSD A;  1BKC A;  2OXW A;  4XM7 A;  3KEJ A;  3EWJ A;  2WO9 A;  1GKC A;  1QIA A;  1GKD A;  1MMP A;  830C A;  1BKC I;  1PWP A;  3WV3 A;  1WNI A;  1YQY A;  1HTD A;  5D1S A;  4FXQ A;  3LE9 A;  1D7X A;  4JQG A;  1XFZ A;  2L0R A;  1IAB A;  4IUW A;  3DL1 A;  3KWV C; 
#chains in the Genus database with same CATH topology
 5BPA A;  2O36 A;  1XUD A;  4PKW A;  1I76 A;  1SRP A;  1I1I P;  3DPF A;  2FV9 A;  3HY9 A;  2Z2D A;  2OXZ A;  3KHI A;  1KUF A;  3HDB A;  3I7I A;  4GQL A;  3GBO A;  1SU3 A;  5L79 A;  1IAD A;  4PKR A;  1G05 A;  2OZR A;  4WF6 A;  3LQ0 A;  1MMB A;  4WZV A;  2JIH A;  1B8Y A;  2E3X A;  5D1T A;  1G49 A;  5LAB A;  1SLN A;  4IJO A;  1ND1 A;  5CZM A;  4GUY A;  3WV2 A;  3F18 A;  2RJQ A;  1BQQ M;  1QIC A;  1CK7 A;  4FXY P;  1CXV A;  1G9K A;  2YB9 A;  1H71 P;  3KME A;  1ZTQ A;  4GR8 A;  4XBH A;  1EUB A;  1GE6 A;  1PWU A;  1K7G A;  3ZVS A;  1IAC A;  2AIG P;  1XUR A;  2MLS A;  2YUF A;  1JIW P;  2D1N A;  3B2Z A;  2MZE A;  3HBU P;  1J7N A;  2W12 A;  4H49 A;  3HB2 P;  5I4O A;  2J83 A;  2DW2 A;  1GO7 P;  1RM8 A;  4DV8 A;  3AYU A;  3P24 A;  4H3X A;  1XAX A;  3ZXH A;  2I47 A;  4XCT A;  1JH1 A;  4L6T A;  1SAT A;  4GWM A;  4DPE A;  1CAQ A;  2AYK A;  3DTI A;  1PWW A;  1HV5 A;  1D8M A;  5D3C A;  456C A;  4GR0 A;  1Z3J A;  1KUH A;  1UMT A;  3EDZ A;  3TVC A;  2OW1 A;  2DDF A;  3F15 A;  3ELM A;  1A86 A;  4A7B A;  1EB6 A;  3VTG A;  1BIW A;  2MZI A;  3HDA P;  4JIJ A;  1BSW A;  4PKQ A;  5H8X A;  1R54 A;  3K7N A;  3DWB A;  2W0D A;  1HY7 A;  3TSK A;  2OY4 A;  3LUN A;  1BUD A;  3LQB A;  1UEA A;  1GE7 A;  4GWN A;  2OY2 A;  4AXQ A;  3DPE A;  2QPJ A;  2POJ A;  2WOA A;  4A3W A;  4XM8 A;  3HYG A;  3F16 A;  1XFX A;  3MA2 A;  1FBL A;  1MMR A;  2W15 A;  1Y93 A;  2XS3 A;  1KUG A;  1XM5 A;  2A8H A;  1KAP P;  4ON1 A;  3LGP A;  2W14 A;  1JKY A;  3LIK A;  1O0T A;  1UTZ A;  1JK3 A;  3K7L A;  5BOT A;  3B8Z A;  5I3M A;  2N8R A;  2X7M A;  4H76 A;  2USN A;  3I7G A;  3G5C A;  3E8R A;  1BM6 A;  1XFV A;  2WO8 A;  1FLS A;  1HFS A;  1ZXC A;  2HU6 A;  2ERP A;  3RTS A;  4QKZ A;  3TS4 A;  3LKA A;  2OXU A;  3EDH A;  1KUI A;  1OZ9 A;  1R1J A;  3DNG A;  1QJJ A;  3HBV P;  1JAP A;  5I12 A;  4L63 A;  1K7I A;  3LUM A;  2SRT A;  1KBC A;  3DSL A;  4JP4 A;  966C A;  5D2B A;  3F1A A;  5I0L A;  1DTH A;  1ZXV A;  1JAO A;  1OM7 A;  1CGE A;  2X3B A;  4DF9 A;  4WK7 A;  3V96 B;  3OHL A;  3LEA A;  4G0D A;  3ZUK A;  4DD8 A;  1D8F A;  2X3C A;  1GE5 A;  2JNP A;  2OW0 A;  1Y0V A;  1ZS0 A;  4GF1 A;  1UTT A;  3LIL A;  1YP1 A;  1MMQ A;  5D1U A;  4CTH A;  2OW9 A;  1FM1 A;  1C3I A;  3KEC A;  3P1V A;  1QJI A;  4ILW D;  1ROS A;  3G42 A;  1USN A;  1XUC A;  1ZP5 A;  4PKT A;  1ATL A;  1O0Q A;  2V4B A;  4H84 A;  1IAE A;  3N2U A;  1JAN A;  1OS2 A;  4H30 A;  1RMZ A;  1SLM A;  1DMT A;  1OMJ A;  3BA0 A;  2MLR A;  3UVC A;  3KMC A;  4AIG A;  1K7Q A;  1G12 A;  1Y8J A;  1AKL A;  2CKI A;  1QUA A;  2Y6C A;  1BQO A;  1Q3A A;  2O3E A;  3B92 A;  1GXD A;  4IN9 A;  3N2V A;  5B5O A;  1IAA A;  3WV1 A;  2W13 A;  3LK8 A;  1PWV A;  2MZH A;  2FV5 A;  4H82 A;  2DW0 A;  4PKU A;  1QIB A;  2OW2 A;  3U1R A;  1XFW A;  3EHY A;  1AF0 A;  1JAQ A;  1A85 A;  4HMA A;  1YCM A;  1C7K A;  4AYK A;  3KRY A;  2TCL A;  4I35 A;  5B5P A;  1EAK A;  5I43 A;  1XFU A;  2CLT A;  2KRJ A;  2PJT A;  2JT5 A;  5L7F A;  4J4M A;  1R1H A;  2XS4 A;  3LJG A;  2DW1 A;  4XM6 A;  1OM6 A;  2JT6 A;  1PWQ A;  4WKE A;  5BOY A;  4JPA A;  1OM8 A;  3TT4 A;  4ZR5 A;  3KEK A;  2OVX A;  2OI0 A;  3SHI A;  3AYK A;  2ERQ A;  3RTT A;  3LJT A;  2X3A A;  2E2D A;  4GR3 A;  3LMC A;  1TVI A;  1IAG A;  3EDG A;  1I73 A;  1BZS A;  3LIR A;  4Q1L A;  1D5J A;  1R1I A;  1S4B P;  3EHX A;  2YIG A;  4L19 A;  4H1Q A;  1ZVX A;  3DTK A;  3DTE A;  2K9C A;  4JA1 A;  3LJZ A;  1HFC A;  3OHO A;  1SMP A;  1R55 A;  1B3D A;  4FVL A;  2ERO A;  3HY7 A;  4EFS A;  3L0V A;  5JMY A;  3USN A;  4G9L A;  3F17 A;  4HX3 A;  2Y6D A;  3CKI A;  3AIG A;  3NX7 A;  2RJP A;  3O2X A;  1GO8 P;  1OS9 A;  4L7A A;  2OVZ A;  4H2E A;  1HOV A;  5CUH A;  4WKI A;  2D1O A;  4PKV A;  1AST A;  1MNC A;  4PKS A;  5CXA A;  1JIZ A;  4R3V A;  2K2G A;  1XFY A;  1CGF A;  1CQR A;  1KUK A;  5I2Z A;  1G4K A;  1OO9 A;  3VI1 A;  4I03 A;  4FU4 A;  1CIZ A;  5D7W A;  3Q2H A;  1CGL A;  3L0T A;  3EDI A;  3O64 A;  1BUV M;  1L6J A;  1UMS A;  1BKC E;  3F19 A;  1JJ9 A;  1AYK A;  2DDY A;  4AUO A;  2J0T A;  3Q2G A;  1YOU A;  1C8T A;  2JSD A;  1BKC A;  2OXW A;  4XM7 A;  3KEJ A;  3EWJ A;  2WO9 A;  1GKC A;  1QIA A;  1GKD A;  1MMP A;  830C A;  1BKC I;  1PWP A;  3WV3 A;  1WNI A;  1YQY A;  1HTD A;  5D1S A;  4FXQ A;  3LE9 A;  1D7X A;  4JQG A;  1XFZ A;  2L0R A;  1IAB A;  4IUW A;  3DL1 A;  3KWV C; 
#chains in the Genus database with same CATH homology
 5BPA A;  2O36 A;  1XUD A;  4PKW A;  1I76 A;  1SRP A;  1I1I P;  3DPF A;  2FV9 A;  3HY9 A;  2Z2D A;  2OXZ A;  3KHI A;  1KUF A;  3HDB A;  3I7I A;  4GQL A;  3GBO A;  1SU3 A;  5L79 A;  1IAD A;  4PKR A;  1G05 A;  2OZR A;  4WF6 A;  3LQ0 A;  1MMB A;  4WZV A;  2JIH A;  1B8Y A;  2E3X A;  5D1T A;  1G49 A;  5LAB A;  1SLN A;  4IJO A;  1ND1 A;  5CZM A;  4GUY A;  3WV2 A;  3F18 A;  2RJQ A;  1BQQ M;  1QIC A;  1CK7 A;  4FXY P;  1CXV A;  1G9K A;  2YB9 A;  1H71 P;  3KME A;  1ZTQ A;  4GR8 A;  4XBH A;  1EUB A;  1GE6 A;  1PWU A;  1K7G A;  3ZVS A;  1IAC A;  2AIG P;  1XUR A;  2MLS A;  2YUF A;  1JIW P;  2D1N A;  3B2Z A;  2MZE A;  3HBU P;  1J7N A;  2W12 A;  4H49 A;  3HB2 P;  5I4O A;  2J83 A;  2DW2 A;  1GO7 P;  1RM8 A;  4DV8 A;  3AYU A;  3P24 A;  4H3X A;  3ZXH A;  2I47 A;  4XCT A;  1JH1 A;  4L6T A;  1SAT A;  4GWM A;  4DPE A;  1CAQ A;  2AYK A;  3DTI A;  1PWW A;  1HV5 A;  1D8M A;  5D3C A;  456C A;  4GR0 A;  1Z3J A;  1KUH A;  1UMT A;  3EDZ A;  3TVC A;  2OW1 A;  2DDF A;  3F15 A;  3ELM A;  1A86 A;  4A7B A;  1EB6 A;  3VTG A;  1BIW A;  2MZI A;  3HDA P;  4JIJ A;  1BSW A;  4PKQ A;  5H8X A;  1R54 A;  3K7N A;  3DWB A;  2W0D A;  1HY7 A;  3TSK A;  2OY4 A;  3LUN A;  1BUD A;  3LQB A;  1UEA A;  1GE7 A;  4GWN A;  2OY2 A;  4AXQ A;  3DPE A;  2QPJ A;  2POJ A;  2WOA A;  4A3W A;  4XM8 A;  3HYG A;  3F16 A;  1XFX A;  3MA2 A;  1FBL A;  1MMR A;  2W15 A;  1Y93 A;  2XS3 A;  1KUG A;  2A8H A;  1KAP P;  4ON1 A;  3LGP A;  2W14 A;  1JKY A;  3LIK A;  1O0T A;  1UTZ A;  1JK3 A;  3K7L A;  5BOT A;  3B8Z A;  5I3M A;  2N8R A;  2X7M A;  4H76 A;  2USN A;  3I7G A;  3G5C A;  3E8R A;  1BM6 A;  1XFV A;  2WO8 A;  1FLS A;  1HFS A;  1ZXC A;  2HU6 A;  2ERP A;  3RTS A;  4QKZ A;  3TS4 A;  3LKA A;  2OXU A;  3EDH A;  1KUI A;  1R1J A;  3DNG A;  1QJJ A;  3HBV P;  1JAP A;  5I12 A;  4L63 A;  1K7I A;  3LUM A;  2SRT A;  1KBC A;  3DSL A;  4JP4 A;  966C A;  5D2B A;  3F1A A;  5I0L A;  1DTH A;  1ZXV A;  1JAO A;  1OM7 A;  1CGE A;  2X3B A;  4DF9 A;  4WK7 A;  3V96 B;  3OHL A;  3LEA A;  4G0D A;  3ZUK A;  4DD8 A;  1D8F A;  2X3C A;  1GE5 A;  2JNP A;  2OW0 A;  1Y0V A;  1ZS0 A;  4GF1 A;  1UTT A;  3LIL A;  1YP1 A;  1MMQ A;  5D1U A;  4CTH A;  2OW9 A;  1FM1 A;  1C3I A;  3KEC A;  3P1V A;  1QJI A;  4ILW D;  1ROS A;  3G42 A;  1USN A;  1XUC A;  1ZP5 A;  4PKT A;  1ATL A;  1O0Q A;  2V4B A;  4H84 A;  1IAE A;  3N2U A;  1JAN A;  1OS2 A;  4H30 A;  1RMZ A;  1SLM A;  1DMT A;  1OMJ A;  3BA0 A;  2MLR A;  3UVC A;  3KMC A;  4AIG A;  1K7Q A;  1G12 A;  1Y8J A;  1AKL A;  2CKI A;  1QUA A;  2Y6C A;  1BQO A;  1Q3A A;  2O3E A;  3B92 A;  1GXD A;  4IN9 A;  3N2V A;  5B5O A;  1IAA A;  3WV1 A;  2W13 A;  3LK8 A;  1PWV A;  2MZH A;  2FV5 A;  4H82 A;  2DW0 A;  4PKU A;  1QIB A;  2OW2 A;  3U1R A;  1XFW A;  3EHY A;  1AF0 A;  1JAQ A;  1A85 A;  4HMA A;  1YCM A;  1C7K A;  4AYK A;  3KRY A;  2TCL A;  4I35 A;  5B5P A;  1EAK A;  5I43 A;  1XFU A;  2CLT A;  2KRJ A;  2PJT A;  2JT5 A;  5L7F A;  4J4M A;  1R1H A;  2XS4 A;  3LJG A;  2DW1 A;  4XM6 A;  1OM6 A;  2JT6 A;  1PWQ A;  4WKE A;  5BOY A;  4JPA A;  1OM8 A;  3TT4 A;  4ZR5 A;  3KEK A;  2OVX A;  2OI0 A;  3SHI A;  3AYK A;  2ERQ A;  3RTT A;  3LJT A;  2X3A A;  2E2D A;  4GR3 A;  3LMC A;  1IAG A;  3EDG A;  1I73 A;  1BZS A;  3LIR A;  4Q1L A;  1D5J A;  1R1I A;  1S4B P;  3EHX A;  2YIG A;  4L19 A;  4H1Q A;  1ZVX A;  3DTK A;  3DTE A;  2K9C A;  4JA1 A;  3LJZ A;  1HFC A;  3OHO A;  1SMP A;  1R55 A;  1B3D A;  4FVL A;  2ERO A;  3HY7 A;  4EFS A;  3L0V A;  5JMY A;  3USN A;  4G9L A;  3F17 A;  4HX3 A;  2Y6D A;  3CKI A;  3AIG A;  3NX7 A;  2RJP A;  3O2X A;  1GO8 P;  1OS9 A;  4L7A A;  2OVZ A;  4H2E A;  1HOV A;  5CUH A;  4WKI A;  2D1O A;  4PKV A;  1AST A;  1MNC A;  4PKS A;  5CXA A;  1JIZ A;  4R3V A;  2K2G A;  1XFY A;  1CGF A;  1CQR A;  1KUK A;  5I2Z A;  1G4K A;  1OO9 A;  3VI1 A;  4I03 A;  4FU4 A;  1CIZ A;  5D7W A;  3Q2H A;  1CGL A;  3L0T A;  3EDI A;  3O64 A;  1BUV M;  1L6J A;  1UMS A;  1BKC E;  3F19 A;  1JJ9 A;  1AYK A;  2DDY A;  4AUO A;  2J0T A;  3Q2G A;  1YOU A;  1C8T A;  2JSD A;  1BKC A;  2OXW A;  4XM7 A;  3KEJ A;  3EWJ A;  2WO9 A;  1GKC A;  1QIA A;  1GKD A;  1MMP A;  830C A;  1BKC I;  1PWP A;  3WV3 A;  1WNI A;  1YQY A;  1HTD A;  5D1S A;  4FXQ A;  3LE9 A;  1D7X A;  4JQG A;  1XFZ A;  2L0R A;  1IAB A;  4IUW A;  3DL1 A;  3KWV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...