1D8AA

E. coli enoyl reductase/nad+/triclosan complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
publication title Molecular basis of triclosan activity.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 87
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1d8aA00
4FJ2A 4OQZA 5F5NA 1CYDA 3ZWBA 1WNTA 3HHPA 4TMFA 3B1FA 2Q1WA 4U7WA 1PGPA 1H6AA 2FPIA 5KJFA 1H6BA 3DBHA 4UEOA 1IB6A 3AOEA 2B69A 5DCYA 3RUCA 1NR1A 3QVOA 4HXYA 2UUPA 4DQUA 4IY1A 2DFDA 1BG6A 1HTBA 3I9MA 4NG5A 3TN7A 3I83A 1P77A 2D5AA 2X58A 3NDRA 4TVOA 1VLLA 4J49A 1IPFA 3ZV3A 1T1SA 4HFNA 4JN6B 3VDRA 1Z7BA 2UVDA 4OOFA 5T64A 2YFHA 2BI7A 4O5OA 2R2GA 5AQ1A 5L3ZA 3UN1A 1K6JA 4IXTA 1R66A 4JP2A 2AMFA 1PQWA 3BXXA 5CPBA 5JDCA 1V6AA 3PQEA 2X9GA 4BS9A 4D44A 5TS3A 4R69A 1MFZA 5KKCA 3ZZNA 3IP1A 2RAFA 1A7AA 2IEDA 3TZCA 1P1IA 1HSOA 1B2LA 4WCDA 2O3UA 4DUPA 1GU7A 2DM6A 3H5RA 1FDUA 4RPJA 4UAGA 3UGKA 2J3JA 4ALJA 1E1KA 4B4WA 1NQAO 1KYQA 1T25A 4XRRA 5C7LO 4NQZA 4J90A 4RVUA 4PLPA 3ZV4A 5U9CA 2G5CA 2GZ2A 1YWGO 4Q3NA 4HV4A 1HE4A 3KYDB 2Y05A 1ADBA 3EGOA 4ZRMA 1O0SA 4M86A 5IXYA 3B20A 1B15A 4MVJF 4II3A 4YVFA 2PZMA 3ZW9A 2I6TA 3L6EA 4FGSA 4GX5A 1VL0A 4RVSA 2AEFA 3EVNA 2VHVA 4N18A 3OBBA 3DO5A 4MVJI 5EMHA 4DTIA 1DC4A 1JKIA 3F5QA 4QEDA 4DIFA 3WJAA 5JY6A 4J3FA 1TEHA 3ANMA 4NBTA 1ZK1A 2X4GA 3JQDA 3BMNB 4XR4A 4TWRA 4TZTA 2JKVA 2O7QA 1NX6A 1XHLA 5AXAA 1YOVB 4LCJA 4L73A 3EVTA 4RZHA 1R16A 2B37A 3PZRA 2WSBA 2P4QA 1E3IA 3CMCO 3BHIA 4J4BA 4R3NA 4PG4A 5EJ2A 1R0KA 2NUAA 3PDUA 1ZNQO 3HDQA 4L74A 4Y6SA 3PRJA 4NDNE 1OOEA 3PHHA 3H9UA 2GPTA 2GYYA 2VN8A 4AJKA 4YRAA 3AI3A 4BVAA 5FI3A 4XQCA 4ZQGA 3RJ9A 4YR9A 4CM4B 3H9GA 5FI5A 3O38A 4AJHA 4GAEA 1PQPA 2HO5A 1CQJA 3VPSA 4FW8A 4TZKA 3A06A 1EE2A 5L4SA 3OIFA 3K9QO 3RBVA 1DSSG 1LC3A 3WS7A 1XEAA 3QVTA 3AY6A 3ZDFA 3KYDA 1GDHA 2NSDA 3HNPA 3HZZA 2I66A 1D4FA 3FSRA 2R6JA 1ZJYA 1JWBB 1YQGA 3Q2IA 1TVEA 4CUJA 4ZQHA 2NU7A 3H65A 1GPJA 1Y9AA 1HDYA 1B3RA 4LGVA 2D59A 2X5OA 3OEWA 2WD7B 1C14A 3UCFA 5MDHA 4YDRA 5K9ZA 1IULA 3VVCA 3G49A 3NTRA 3S2IA 4FJ1A 3JQ9A 4PLVA 4MVJH 3WGYA 3BMNA 3NUGA 5JW6A 2X0NA 1BDMA 1YOVA 2O2SA 3KXDA 3PI7A 4DQXA 1Y9EA 2DKNA 4FPXA 1V3VA 3ZNQA 4W4TA 3HDYA 1UP7A 4BNWA 2D0IA 4Y8VA 2E49A 2E4AA 2PD6A 1SBYA 1LDEA 1KY5A 3RUDA 4MDHA 1XU9A 4DBZA 1ENYA 2AE2A 2YY7A 2DFVA 4B3IA 4ZHSA 4DC0A 5DCWA 1PS0A 2Q50A 3PYMA 2J6IA 4IQ0A 3DL2A 4XIJA 5ENVA 4CODB 4D7AA 4J9UE 4CM4A 4CMAA 1NVTA 2OZPA 3H2ZA 4GGOA 4IBOA 2ZYGA 4YPOA 2VCYA 5ADHA 2FSVA 5JYEA 2HU2A 2VNAA 4JIGA 3NYWA 5EN4A 2DUWA 3S2FA 3BZUA 1PZEA 1Y5RA 3HB5X 5BSGA 4IDAA 4ZICA 3GQVA 3M6IA 3AY3A 1DLJA 3F47A 2BKAA 2QIOA 1R15A 4Z0HO 3BYZA 3GNTA 3S55A 1K6XA 1Q0QA 2WD7A 4PVDA 4Z3DA 3CPSA 4RORA 3ULKA 1C0KA 4I9UA 2X6TA 2Q49A 3JYPA 2C07A 1EFLA 1QRRA 1K89A 3GRKA 2GN6A 1U3WA 4ALKA 2EJVA 5CEFA 4ND5A 1NAIA 3JV7A 3NT2A 3VVBA 1ZO8A 2Z5LA 5JCJD 2HMUA 1MG5A 4YJFB 3ROQA 1SC6A 5CEEA 4BNTA 4D45A 3I4FA 2W2KB 4BOYA 3MJ4A 1YBMA 4WJZA 1NQTA 5A06A 1LXCA 4OKIA 2VT2A 2VUTA 2VYVA 3DMTC 5GY7A 3SC6A 3RASA 1G0OA 4F46A 2BGMA 3ZHXA 5IFLA 3GAZA 2PA3A 1K5HA 2DBQA 4UUOA 4CM6A 1P1HA 3NJ4A 1T2EA 1SO8A 3OJ0A 2CY0A 5I8ZA 3OJLA 1P1FA 2JAPA 4FFLA 4GWKA 2B4QA 3Q9UA 1A27A 3DFZA 4JJIA 2I99A 3LLSA 1B0AA 4AG3A 2EERA 4XRGA 3KRTA 1LRLA 4DA9A 1X0XA 3WIDA 3LLVA 3DZKA 1E3SA 4E31A 2PKQO 4KP7A 1D7OA 3JD2A 2IXAA 2O3SA 1ZSNA 3O9ZA 1GTMA 3Q2KA 4JGBA 1QR6A 2Q1SA 1HZJA 2I76A 4BGEA 1R12A 3IIEA 4AJJA 1P0FA 1KBZA 3ITDA 2EKPA 3D1LA 1AHHA 1BWSA 1DB3A 1ZK2A 2LDXA 4NJMB 4XYEA 1QYWA 3ZCXA 1FJHA 2BHLA 2W90A 3ZWVA 3WG9A 1UUFA 4B7CA 4BO1A 5JCJA 4YJGB 5COBA 3N7UA 3OFSA 2ZCVA 2FHSA 3HN7A 1NPTO 3AM4A 4J43A 4M49A 3MOIA 3WQSB 4DXHA 2W2KA 3M1AA 3WLFA 4RZIA 3JQCA 4QFDA 4E2XA 4E5KA 1M67A 3OJEA 2IYPA 5DBGA 3UOGA 3GN1A 4BNGA 4IUYA 1YJQA 4RGBA 1ZXBA 3FR8A 1MUUA 5COAA 3NT4A 3OF2A 3UVEA 1VSUA 5KVSA 3UHAA 2QG4A 1QLJA 3ETDA 3JYQA 4ALMA 4TRNA 3KHUA 1EQUA 1GZ6A 3K31A 2FY8A 4R5HA 3V1UA 4B3HA 3WX0A 5EERA 5IDXA 1TT7A 3VPXA 5ITWA 2OP1A 4E32A 4DL9A 5KJ6A 4BO8A 1N8KA 4MPDA 3P5SA 3PQFA 1M76A 3I1JA 5FF9A 1S6YA 3NKLA 3RCBA 2EGHA 5CDUA 5G0TA 2BFPA 1NHWA 3K96A 4Z9YA 5JAIA 3CTMA 1HDRA 1TB4A 4PCVA 5EINA 1EMDA 3WMWA 1X0VA 4KZPA 3H3FA 3ONDA 2GNAA 3NTQA 4W9NC 3OECA 4WLNA 4OO3A 3LT0A 4PLHA 3TJRA 1ORRA 1EK6A 3C1AA 1EUZA 2Q2VA 3N58A 3WGGA 1E6WA 3E82A 3FNFA 1KC1A 3QWAA 4RLSA 4NJMA 4PGFA 2HKIA 4EEZA 4I9HA 1RM4A 2Y1DA 1EVZA 4BQRA 2YZ7A 3EC7A 4GKBA 3E03A 2ZQYA 3ZU2A 4YCAA 4WCFC 4YJGA 2FR0A 4XX0A 4ND1A 4XA8A 1O94A 3ONEA 4CMEC 1ULSA 4LMRA 1DFIA 2OO5A 4U0KA 4D0SA 2VWHA 2GRAA 3CINA 5KWEA 1ZK4A 5G0UA 4OYRA 1NTOA 4ESOA 1B7GO 2FP4A 2Z1NA 4WE3A 3GGOA 4BO3A 5BT9A 2GDZA 4ZN6A 1GYQA 4R9RA 1E3WB 3LC2O 3OP4A 2BFAA 3IKTA 3TZQA 3CXRA 1KY4A 1LLCA 1YL7A 2QW8A 1V0JA 5KVCA 3GVPA 1K0UA 2HDHA 1WZIA 4FFNA 4Q3DA 1C3VA 5TT0A 2J3KA 3QIVA 1FMCA 2JCYA 3ADOA 3B1KA 3LQFA 2YHIB 3DAPA 4OOEA 1BVRA 3V2UA 1P44A 3C8MA 4BO7A 3GUYA 3D4OA 4HFMA 3LU1A 4WLEA 1HXHA 4IM7A 1I3LA 3ABIA 2OL4A 3UH1A 4PRLA 3RUFA 4AJ4A 3MJEA 4CM7A 2OUIA 3GFBA 2PKQP 4CM3A 1OAAA 4YAKA 4NNJA 3DBRA 3DOCA 4KWIA 4YAEA 1YE3A 4C4OA 5C7IO 2WE8A 3SC4A 2IZ0A 1HEUA 3GH3A 1U2GA 3WB9A 3JYOA 1M2WA 5CFZA 3JQAB 5IZ4A 5G0VA 3AUUA 3HN2A 4GSLA 1GV1A 2OBYA 1ONNA 4KUEA 4NH4A 4D43A 2F00A 2EG9A 2QYSA 1VE9A 1HRDA 2QQ5A 3C24A 1LDMA 3FWNA 2V6FA 4ND2A 5TX7A 1H5QA 5DULA 1SEVA 4L75A 4RPHA 3G3EA 4I5FA 2DTXA 2VOJA 2ZYAA 1H93A 3GNQA 4D3SA 2W2LA 5TF4A 2Y99A 1X7DA 3A28A 1L7DA 2YV1A 3QWIA 1E3WA 2GZ3A 4IMRA 5FWNA 3TSCA 3RSHA 1L1FA 4YRDA 1E7QA 3LT2A 5LCXA 2B36A 4CM9A 1MC4A 3HFSA 4KDFA 4OQYA 1I2ZA 2AQ8A 4NIMA 3DHYA 1IYZA 1YGYA 1FK8A 4YA6A 4WLOA 5DBIA 4CM9D 4YJDA 1MLDA 3PLNA 5IN5A 1ZEMA 3GRPA 4IS3A 5KVQA 4J6FA 2YHIA 3RROA 4RVDA 1DXYA 1QSGA 2CDAA 1R37A 4C7JA 5HWSA 4UUNA 3CKYA 3AWDA 3PHIA 4CLXA 5A03A 4CL3A 4IDCA 3WNVA 4E5YA 5KNLA 1RYDA 4O63O 4Y67A 4OXYA 3ZW8A 5GMOA 3GR6A 1PL6A 4J1NA 1YS4A 4AJEA 3WTCA 1FF9A 3KSDO 4XYGA 2GERA 3LF2A 3O4RA 3KBOA 3JQAA 5B37A 3S8MA 4BV8A 4AVYA 4I5DA 1B8PA 4ZU3A 5EESA 2X86A 3UKOA 3ANLA 4K1LA 3V2GA 2G76A 3JQAD 1BHSA 4NK5A 4DYVA 1ADFA 4IDEA 2CMDA 1IL0A 1DDOA 4CMIA 5B1YA 4JP3A 2CVQA 2ZIZA 4Y98A 5T5QA 1YH3A 1SMKA 4AFNA 1O6ZA 2CDCA 2VNSA 5JC8A 4PZCA 1ZKMA 4R4JA 4ILKA 4Q9NA 2VZ9A 4FC7A 5JAZA 1RKXA 2PZJA 3S2EA 3VZQA 3U4CA 2C7GA 3F6YA 2WD8A 5CDYA 4W7HA 2YQ5A 1UZNA 5A9RA 3MJTA 2RBEA 4U0JA 3QSGA 4NFYA 4A27A 2EF1A 4XB1A 1YDWA 4NBVA 2HRZA 2Q46A 3C7AA 5KJEA 5TRTA 2O4UX 4BNMA 1LX6A 3KOUA 1N7HA 4LK3A 4DLBA 4JXKA 3U5TA 1X1TA 4XWYA 4HKTA 2VHYA 2Y0CA 4CMBA 5JDIC 1J49A 3M1LA 5IN4A 2X0RA 1IE3A 3WTBA 2CFCA 5CDTA 2NADA 3HADA 2P68A 3PHGA 5H83A 3NX4A 1GUFA 1EE9A 5L9AA 1KIFA 1KVSA 1H2BA 2VHXA 2PGJA 5GZ1A 3W4KA 1WLYA 4E2YA 3QHAA 3WQQA 2Y1FA 4P22A 3DHNA 2BF7A 1RM0A 2YYYA 2WJPA 4RDHA 1Z45A 2NU9A 1YB1A 2VRBA 2V6BA 3V1YA 1DC5A 5HS4A 5KVVA 1PL7A 1Y8RB 3ZWNA 2RCYA 2DTDA 2AE1A 1PR9A 1Y6JA 3FNEA 5L7YA 1KEPA 4XDZA 4CQMD 3WGIA 1OBFO 2AW5A 2P2SA 3DBHB 5DP2A 4AJ2A 4BNIA 1E7MA 1I0ZA 5LDGA 2XXJA 1Z7EA 4FS3A 3T7CA 1IY8A 3JQFC 3GT0A 1CETA 3FWZA 4PRKA 3TQHA 5BSFA 2ZTLA 3D3EA 4U6SA 1XQ6A 4WUVA 5EQDA 4DRYA 3RD5A 2UDPA 3RI3A 4GL4A 4ZD6A 3FPCA 3PWZA 3G17A 1RPNA 4Q39A 3H8VA 3LC1O 3L4BA 1OMOA 3K5PA 4FC6A 1Y1PA 3HFGA 4BNHA 2IE0A 4J0FA 3RJ5A 4XJSA 3QV1A 4GLOA 3E5MA 2GGSA 3BHMA 5KIAA 3IDSA 4EJ6A 3V1TC 1MC5A 2Q99A 4MIEA 3Q9NA 4RF2A 1YONA 1BXGB 3CSDA 4PN3A 2VTDA 1H9AA 1YBVA 1JW9B 4MP6A 1WDKA 3A14A 2P9GA 5JPIA 1JLLA 3OQ6A 2HSDA 1I2BA 3HWRA 1CJCA 2B4RO 3TL3A 3WMXA 2G17A 3OICA 2I9PA 3GLQA 3I9LA 1F8GA 3ZWYA 4E21A 1Y8RA 3QVXA 5A3JA 4E3ZA 3PTZA 3Q6IA 3MOGA 3WGZA 4XKJA 4XQEA 1GY8A 2BLLA 4IDDA 4YB8A 3RFTA 1Y5MA 2V65A 1R6DA 2JD0A 4PFJA 2V6MA 4D42A 4GGPA 5G0WA 1E1MA 5IG2A 4IS2A 5HRUA 1X7HA 3AW9A 3KB6A 4PG8A 4RQTA 1EQ2A 1LDBA 3BMOB 1NPYA 2CD9A 4MVJE 3OMLA 1WVGA 2W8ZA 3JQBA 3KYBA 3VTFA 4F3YA 5L7TA 1ISJA 4IJWA 2HJSA 1JKJA 1PS9A 2VOEA 1PGNA 1QYCA 4ID9A 2J3IA 5B4TA 4M87A 1NM5A 4CLOA 2X5KO 5JC1A 2AG8A 3WGQA 2IEBA 1EVJA 3RKUA 1ZCJA 2NV6A 5HBRA 3RBZA 1Z73A 4AJIA 2FMUA 4YACA 1LUAA 3FBTA 4QFCA 1BGVA 4HBGA 1JTVA 3RUAA 4BUCA 1BXGA 4BNJA 4R16A 3MCVA 6ADHA 4EDFA 4Z3KA 4BKUA 2DPHA 2X9NA 3PPIA 1EDZA 4OMUA 1HKUA 1PQUA 1GD1O 2WDZA 2RH8A 4E5MA 3INRA 2EP7A 2WTBA 3B1JA 2O3RA 2X9VA 1ISMA 1X15A 4JBGA 1C1XB 3RUIA 3IOYA 3ROMA 3AUTA 1N1GA 1MX3A 4DPKA 3BMCA 3MEQA 3DDNA 1NVMB 5IZCC 3KLMX 3OM9A 2PD4A 3SXPA 2WM3A 2J8ZA 3G0OA 3PVZA 5BR7A 4I1IA 4RCVA 1BRMA 4FN4A 4TSKA 2LDBA 5TGDA 3TZKA 4RV9A 3ETEA 3U09A 1YQXA 2GN9A 1NPDA 2HCTA 3AM5A 3KLPX 3BMOA 2FSSA 4HFRA 3U49A 4P4NA 3UFXA 4MIYA 2ZCUA 2PTGA 3GA0A 4UVIA 3COSA 3FR7A 4HX5A 1N92A 1DFGA 1A9ZA 1CQIA 3SLKA 5I9MA 3U3XA 2I65A 5I7FA 5L51A 1U9JA 4E5PA 1LSJA 1QV7A 1QV6A 3GFGA 1PJQA 5EQFA 4CMCA 3KM0A 1E7SA 3I5MA 4CLHA 2O50A 3S2GA 1HE2A 3L0DA 4BNXA 3RU7A 2Q3EA 4F6CA 2JHGA 1P33A 3FN4A 1T4BA 5THQA 2A35A 1SAYA 5F5LA 3I9NA 4J7XA 4WPGA 5K6AC 2QRLA 1R4NA 2ZTVA 3PZBA 2DBZA 3DR3A 4NHEA 3PLRA 8ADHA 5JAMA 2JFHA 1W6UA 1C1XA 4YT4A 2BGKA 4KMSA 3RUEA 1TT5B 4GX2A 2VWQA 1ZIDA 2HMVA 3AU8A 3D4PA 1V3TA 3NGLA 3PFFA 4IDFA 4XYBA 4MOWA 1Q0LA 3AOEC 5T67A 4NU6A 5ES3A 4FJ0A 1ZJZA 1TXGA 2PWZA 2SCUA 2VRCA 1PWZA 4PLFA 4WECA 1U3UA 1PIWA 3GNSA 5C3MA 2XOXA 3SX2A 1F14A 2DPGA 4EZBA 4XDYA 1YL5A 3OHSX 4A5OA 2VRCD 4NPCA 5CHEA 3VDQA 1NWHA 2PY6A 4HWKA 2FN7A 1W4ZA 2Q2QA 1I8TA 1M66A 4L0QA 4DIBA 2FR8A 3F46A 4UEJA 1PTJA 1HWYA 3MWEB 5DOZA 4GVLA 1DAPA 3DFUA 3HB4X 5KTKA 3EZYA 3VPHA 1DIBA 4PLYA 3ZU4A 2VQ3A 3GPIA 1NASA 1Z82A 4PG5A 1MXHA 1V9LA 4OXKA 3H9JA 3LYLA 3WOHA 1B8VA 3H7AA 4TQGA 4ONEA 2GR9A 1PS8A 4EUEA 3UF0A 2ZQZA 3H3JA 3U0BA 4GH5A 1N2SA 2FZWA 5ENDA 4BB5A 1KETA 4D0RA 3WFIA 5IJZA 3R0IA 3U9LA 4IZHA 2B0JA 3GG9A 4RLHA 3A1NA 1PJ4A 2C82A 4FGWA 1TT5A 4QO8A 1DRWA 3ZWAA 1X7GA 1PSDA 1K2WA 4LN1A 3F1LA 1UXIA 4XYMA 5A9SB 4CPDA 3DBLB 5LC1A 1ADCA 4K6FA 4B8WA 4WNCA 3K30A 5JO9A 4BNFA 3OETA 2C7VA 3KTDA 4UVDA 4EBFA 1GZ3A 4E5NA 3QJ5A 4TKMA 3KZVA 4W82A 4XZ3A 1KEWA 1SPXA 1NQ5A 5GZ6A 5DCUA 1DHRA 2RHRA 3TRIA 2X22A 1PU2A 2EV9A 4AJOA 2VHZA 3KO8A 1IOLA 2ZB4A 3QA9A 1NYTA 3MJSA 4JNKA 4CQLB 1H2HA 4LRTB 4CLEA 1GYRA 2GF2A 3C85A 2AXQA 4J1SA 4YQYA 1U3TA 3F4BA 4R1SA 4BGUA 2Y1OA 3GHYA 2AEMA 2D2IA 3DZJA 2B4TO 2R00A 4KQWA 1KVRA 2EIHA 5U1PA 2VYVD 4BO6A 1PJLA 3U4IA 3GDFA 3K92A 1ZFNA 1IPEA 3AM3A 3PGJA 4DYDA 4WCFA 2OHXA 1K3TA 2DUUA 3OEYA 2BELA 3ICPA 3PJDA 4CMEA 1ONOA 4QX6A 2DAPA 1H6DA 3PK0A 3TL2A 4E13A 4J2HA 4Y6RA 3UUWA 1GFSA 1J0XO 4IINA 4FCCA 2WE7A 2CSUA 3V5NA 4MP3A 1KERA 1EVIA 5A3VA 3WDSA 1FDSA 3T4EA 4HY3A 4AJ1A 2VWGA 1JKFA 3WIEA 4UUPA 4OHUA 5JE8A 5A9SA 1HDOA 3UICA 4J9VA 3DBLA 3JQ9C 1SOVA 1BTOA 2DTEA 4P8RA 2F1KA 3LVFO 4G81A 3DONA 2AQKA 2ZB8A 2JAHA 3RIHA 1NP3A 1UJMA 4GQAA 1LLUA 2BRUA 2JHFA 3OQBA 4N7RA 2CZCA 1WPQA 1FDVA 4PG6A 5JYDA 1E6EA 4JLWA 1P1RA 3F9IA 1ISHA 5CDSA 1E7RA 5JS6A 1ZUD1 5CPFA 3K73O 4I5GA 3JQ8B 1AUPA 1LRJA 4CQLA 4Q3CA 1E3JA 1NNUA 1NFFA 1XA0A 4CJXA 2XAAA 4JX8A 1CDOA 1ID1A 1A5ZA 1IHYA 4NK4A 5CEJA 4W99A 4ZVVA 4FD3A 3T7EA 1GL3A 4J2OA 1X14A 3H9EO 4B7UA 4PLTA 1ISIA 1EDOA 4FFPA 3WXBA 1VM6A 5JFOA 2A92A 2Q1UA 3ON5A 1BMDA 1PR3A 5CAEA 1XG5A 3KVOA 1KC3A 4JCOA 5EPOA 1O5IA 3PGXA 4QECA 1XDWA 4GX0A 2YFQA 5A02A 2Z1MA 1BXZA 3H5AA 2POQX 3HE3A 1AHIA 1LBEA 3IAHA 3P2YA 4B4OA 3LK7A 2B35A 3MZ0A 3GOHA 1DRUA 1KOLA 4UVGA 4KUHA 5FEUA 2AA3A 2O23A 3R3JA 3DBRB 1EVYA 3F4LA 3QQPA 4RPGA 1PL8A 4BV9A 3OA2A 4BGVA 3C1TA 3I52A 1KVTA 5JSFA 1PGOA 3DB2A 3RC1A 2IYOA 2Y1CA 4A73A 1YL6A 3E48A 1GEEA 1M6WA 1ISGA 1H6CA 1NVGA 1RJWA 2OOSA 3PP8A 4RPKA 4CLDA 5T8KC 2V7PA 4R3WA 3EMKA 2UYYA 3SLGA 4A0SA 2GSDA 1SNYA 2NQTA 3JQ8A 4J7CA 3SBOA 4R68A 1TLTA 5F1OA 4XEHA 1LI4A 3JCZA 4R1NA 4UUMA 2AHRA 9LDTA 2CUKA 4YAGA 5F1KA 2EKLA 3W8DA 5TQVA 3F1KA 3CIFA 2JCVA 3CMMA 2QZ9A 3AFMA 2HRBA 3X2FA 2BD0A 3D64A 3U62A 4GWGA 4JQCA 1AE1A 4EYEA 1D3AA 1PGQA 1YRLA 3KEOA 4NZ9A 4B4UA 3QVSA 1HETA 4OIMA 3V8BA 3WFJA 4WLUA 2GO1A 1U5AA 1WAMA 2JFGA 4G2NA 4Q3BA 5ER9A 3ZV6A 1E5QA 2GLXA 3O03A 5HA5A 4E30A 2C2XA 4PVCA 5TT1A 2X23A 1V8BA 1P3DA 2PV7A 3ICCA 1BVUA 4IJUA 5F1PA 3GHHA 3OA0A 1IZ9A 1VL6A 4WKGA 4PLCA 1DIRA 1UAGA 2XPCA 2IRWA 3O8QB 4ZQEA 3ST7A 2QHXA 2EJWA 5KKAA 4DGSA 1NWCA 1VPDA 3GZNB 3PXXA 3TDKA 4QUKA 2PZKA 3DXFA 1ZH8A 5EL0A 5ER6A 4Z0TA 4OKNA 1EZ4A 2BI8A 2J3HA 5A9TA 3I9OA 1T2FA 3B6ZA 2GD1O 3GAFA 4CMIB 5DDIP 4QT0A 1C0IA 3HJAA 1ISFA 1E92A 1NFQA 3PQDA 2NQ8A 1PZHA 2W2LD 4FIZA 1BSVA 4ZRNA 4YEDA 1W0CA 3Q1LA 1Q7CA 3L6OO 3AI1A 3AJRA 2DBVO 4MKZA 2EWMA 3E18A 4FR5A 4LSWA 3VKVA 4J16A 4RPLA 4OSPA 4GVXA 3RUHA 3WBBA 3E6AA 3MJCA 4NFHA 4W6ZA 3DOJA 4JROA 2EGGA 4R51A 4DLAA 1NFRA 4BKPA 3C1OA 1J5PA 4IGEA 1DAOA 2EP5A 2O3TA 4B8ZA 1N7GA 1TA4A 3ZN2A 5IF3A 4IXWA 2VUSA 3O8QA 1I32A 4BNZA 2PNFA 2O2YA 3MJVA 3GUCA 2QRJA 3GZNA 3OQ1A 4O59O 5I7EA 1P9LA 1JDJA 1CERA 3F5SA 4L9RA 1SEPA 1IUKA 4RQUA 2NU6A 1A71A 5HM8A 1XSEA 4GMFA 1Y81A 4XGIA 1LLQA 5T57A 3NRCA 3RVDA 3VC7A 4CM1A 2C54A 3TNLA 4DWVA 5DF1A 3UCEA 4B3JA 3HSKA 1JN0A 2PK3A 4G5HA 2G82A 4A2CA 4KUGA 5TJ9A 3ZWCA 5DN9A 3K2EA 4II2A 1GCUA 3ZHZA 4TRJA 4OJNA 4EITA 2NVBA 1I33A 3ZWPA 2PZLA 5IAAA 5L40A 1LU9A 3EHEA 2C29D 3GPDG 4P38A 3BTUA 5JY1A 3A9WA 1J6UA 3H2SA 3IJRA 4N54A 5L53A 1KEVA 4YJHB 3QWFA 5A5FA 1F17A 4CV3A 3GGPA 3S1LA 4U5QA 1E6UA 2BFOA 4OM8A 3G1UA 4YT2A 1RM3A 5EIOA 1I5RA 3SVTA 4RF5A 3PEFA 3PWSA 3BAZA 2X1HA 1UDBA 3R6DA 4JBHA 4WOKA 1E7YA 3ASUA 3ZH2A 3VOSA 5J23A 2I5PO 4MO2A 1PGJA 3TZ6A 2PD3A 2PH5A 1YB4A 2TMDA 2B83A 3RFXA 5I7VA 1DOHA 1O9BA 5TSDA 5BNTA 1VKNA 3PYLA 1ZEJA 4RDIA 1KS9A 1UR5A 2Z95A 1U1IA 5BNIA 4BMVA 4O0LA 2C59A 2EKQA 3JD0A 3PJGA 5TLSA 2WMDA 5C37A 3PWKA 3NJ8A 2OXIA 3DBVO 2PKRA 3PIIA 1B16A 1M6HA 1SZJG 1RM5A 5F21A 3GN2A 4BIIA 3FF4A 1JAXA 3FCOA 4XGNA 1MGOA 3BTOA 2Q45A 2EEZA 4R9SA 5FYDA 3INGA 3SEFA 4OSOA 1G0NA 1HYEA 4L76A 1HDZA 1S7CA 4BB6A 5TIIA 1OFGA 2ZTMA 4AJNA 1WZEA 4EGFA 3ITKA 1HZZA 1UZMA 1JWAB 2EW2A 3RU9A 2I67A 1L7EA 1P1KA 1P74A 1YXMA 3G79A 3GEMA 3GGGA 2J5QA 1D8AA 1HYGA 2JCXA 4XR9A 5JAQA 1JAYA 4YJHA 2YQ4A 4LVCA 3LDHA 3PHLA 4R41A 3WBFA 1UZLA 4XQGA 5G2OA 1ULUA 3HUDA 4EEXA 1XWFA 4CLOB 3E9NA 2CDBA 4YT8A 4IDGA 4WLFA 2X7HA 1C1DB 1VJ1A 5I7SA 4XQ9A 1MB4A 3JQEA 3ZU3A 5IZCA 5KJ1A 3TOXA 1JA9A 3DC2A 4FOSA 1O95A 3GG2A 3GZ4A 4TKLA 4ALLA 4NJOA 5GZ3A 1EUCA 3SJUA 1VJ0A 4IDBA 5A04A 2X0IA 5T6BA 1ZVMA 2HK9A 3IQDB 1LDGA 4ND3A 3HG7A 5C5IA 3H9QA 4NBRA 3RC7A 3AI2A 4LW8A 3H6KA 4XCVA 5G4LA 4BNYA 2J5RA 2GCGA 1XCBA 2AG5A 4FFOA 4YRBA 1A72A 1SOWA 2OORA 3JYNA 2BMAA 1Y8QA 4M55A 3RC2A 5DT9A 2X0JA 1ADGA 4ZGWA 3HDJA 1X1EA 4WNIA 2Q2WA 4YYZA 3BMCB 4XIYA 2HMWA 1XIVA 2FPPA 1N5DA 2Y0EA 4R1TA 3EW7A 3VPGA 4DQVA 4IQGA 1B14A 3ANNA 3ZWMA 3LF1A 1N9GB 3NAQA 2G1UA 2HK8A 2Y66A 4BGIA 2UV8A 1WDMA 4QQRA 4MKXA 4IGFA 1EEHA 3DZFA 2Q1TA 5L45A 3DWFA 1QKIA 3X2EA 5I9NA 3DAGA 4TVBA 3ADPA 5IDYA 1BXKA 2NU8A 3F3SA 4CM5A 2A4KA 1C1DA 1CEQA 3W4JA 5BQFA 3UCXA 3D0OA 1WWKA 3Q0EA 3OJFA 4S1VA 3DTTA 1YKFA 4CM8B 3TZHA 4H16A 5KCZA 4IPTA 2Q4BA 1P31A 5A05A 4UVHA 2OMEA 3STHA 4LMPA 2NVUA 4J0EA 2O48X 1CRWG 3K2BA 3AUAA 5DBFA 1PZFA 3ETGA 1B8UA 3ORFA 1GQYA 1HE5A 2WWRA 4CUZA 4BNUA 5AYVA 5L95A 2GZ1A 1FDWA 4CL8A 3ZV5A 1IHXA 2H1SA 1R4NB 4MIOA 5K0ZA 4K26A 3ZWXA 1VC2A 2P5YA 3DZGA 4UREA 3LC7O 4HADA 3R1IA 4NBWA 5L7WA 4C7KA 4NMHA 2GASA 1I3NA 2FPGA 2A9FA 1H94A 1H9BA 3GDOA 4YAJA 3FI9A 3PFWO 1ENOA 4BMNA 1I30A 4AJPA 3W8FA 3WYBA 1N9GA 1I36A 3WSWA 4DC1A 3FD8A 2CVOA 3QY9A 3W1VA 5THKA 3CH6A 2ET6A 2O3QA 3KSZO 1ZSYA 1XR3A 4X54A 3QVWA 1U4OA 3NEPX 2E82A 1Q2XA 3L4BC 2Y93A 4PG7A 3N74A 2HMTA 3GVHA 2JFFA 3VZSA 5IDWA 2O7SA 3EUWA 5HTOA 1V35A 3RAJA 3FBGA 5DP1A 3GC6A 2OBNA 4F6LA 4ND4A 4CM8A 2EW8A 1LRKA 1QLHA 5B12A 4OGWA 5KOIA 2NLOA 3DHEA 4RVHA 3IUSA 4QO7A 1KVQA 2JL1A 1LC0A 1T2CA 4ZQFA 2P9EA 1WXDA 1JVBA 4GKVA 4EW6A 3ZHBA 4D41A 1RYEA 3WJ7A 2PH3A 4YAIA 4DREA 4BKRA 3Q11A 1DJQA 3FNHA 4R1UA 1G1AA 2W4QA 4O1MA 2P9CA 1P1JA 4QTZA 5JXWA 1LNQA 1PJ2A 3ONFA 3DMTA 3FRJA 2ZATA 3AOGA 3ENKA 1WP4A 3EK2A 3DAFA 2AQIA 3GEDA 4OL9A 1N1EA 1ARZA 2RIRA 3JQBC 4FFMA 2ZKLA 3HDHA 5IXSA 4BO2A 4J4HA 3UAGA 1UH5A 1XLTA 3VTZA 4BNKA 4FB5A 1QORA 1VI2A 1Q7BA 1VJTA 4GX1A 3ZU5A 4CMJA 2BH9A 4PIVA 1GUZA 2B5WA 5H81A 2NTVA 2DU8A 1GAEO 3D4NA 3W6ZA 4NR0A 3WR5A 2Y1GA 2JJYA 4LSMA 4J91A 4BO5A 4HNHA 5JDCC 3INTA 3IC5A 5HS6A 2H9IA 4D3DA 3KYCB 1GYPA 1O8CA 1W8DA 2DLDA 3CZRA 1XELA 4WLVA 2IZZA 4JJFA 5A1TA 3BTVA 2YHUA 1Q7GA 1Z74A 1GR0A 1B26A 1X13A 1U7TA 1I3MA 3PJEA 4I08A 2PGDA 2RH4A 3VKUA 1A9YA 4WCFB 1UXHA 2CNBA 1RWBA 2C5AA 5LDHA 3VH2A 4Q3EA 4D3FA 4BKQA 3IUPA 2D1YA 4BNNA 3JD4A 4YWJA 1LTHR 3ASVA 3QLJA 3P7MA 1T4DA 4RVFA 3HQ4O 2H63A 3D3WB 3GMSA 4QSMA 4AICA 2X8LA 3WGHA 3BMQB 4EI2A 3MTJA 4RO0A 5ITVA 4N5MA 4BNLA 1QG6A 4I9NA 2DVMA 1H0KA 1A4IA 3DTYA 1M75A 4N5NA 2Q4EA 4MVJA 2D8AA 1PWXA 3JD1A 4DPLA 3L9WA 3BHJA 4RF3A 3ZNPA 2ZB3A 3E9MA 3DZIA 4MVJD 3VHRA 2ZK7A 1YQDA 1E5LA 4Y6PA 3W6UA 3I3OA 5BSEA 8LDHA 3KUXA 3TFQA 3NTOA 1LJ8A 3VZRA 4AL4A 3PJFA 1UXKA 2EXXA 5ILGA 1ZMOA 4RF4A 4W9NA 2YJZA 1I01A 1U8FO 2BFMA 3JTMA 1E1NA 3KYCA 5DZSA 2Y68A 4EJMA 4K28A 1PJTA 1LDNA 7MDHA 3GMDA 1ZMTA 1W73A 4S3MA 3IKVA 3E1KA 5CP8A 1DJNA 4F45A 1EBFA 1NBOA 3LT4A 3UW3A 3PHJA 1LLDA 3CEAA 5T8KA 2NACA 1XKQA 5JBIA 3QRWA 5BNFA 2TMGA 1Z75A 3D3WA 1J4AA 2YUTA 4BO9A 4CMGA 2D5CA 1YO6A 3BMQA 4MJLA 4A7PA 4XYLA 2YW9A 1JVSA 2PGLA 4NFSA 1VKOA 1Y7TA 3KEQA 3H4VA 1GEGA 4WEQA 5DNAA 4WEOA 1DHTA 2HAEA 1OC2A 3E9QA 1NR7A 2ZJ0A 2VHWA 1E3LA 2B5VA 1T2AA 3RKRA 1PJ3A 4YT5A 2Y67A 4P4GA 2DT5A 3GK3A 3WGOA 7ADHA 2NTJA 5ICSA 1DEHA 4RJTA 4DIOA 4M8SA 1UDCA 2A94A 4BQPA 1U3VA 4UULA 1XU7A 2QRKA 2YV2A 3IMFA 4DMMA 2Y1EA 1ENZA 1XYGA 3QWHA 4KDEA 5JLAA 1IZ0A 1C0LA 1WDLA 4DBVO 3FTPA 1MFPA 5AXCA 1QP8A 3TFOA 3D5TA 1DFHA 4GSKA 3P2OA 1U4SA 9LDBA 3TF5A 4YJFA 1PZGA 1ZZEA 3K6JA 1NAHA 4MVJP 3L4SO 3I9JA 4UEKA 5JMWA 1PJCA 2D3TA 3FNGA 4MINA 4BMSA 1GZ4A 4E2ZA 4ZJUA 5FFFA 6LDHA 4EUHA 1U7HA 1AXGA 1CWUA 2YV3A 3IL2A 2PLAA 4PLZA 4H15A 4Q3AA 1O89A 3W8EA 2HMSA 1HDCA 3RWBA 4WK6A 2D4AA 1MV8A 4URFA 4D79A 1GUYA 2QYTA 4ALIA 4NI5A 1R4MB 1AGNA 2C0CA 4IZIA 3Q3CA 3U4DA 4DPMA 2GN8A 1ZK3A 4G65A 4DMLA 3W4IA 4FFRA 2E6UX 3K8ZA 1F8FA 1E0DA 2ZJ1A 3EZLA 1DIHA 1V3UA 3VH4A 2NWQA 4K9DA 4I5EA 3D7LA 5IDQA 1T24A 4BO4A 4IQ8A 1EK5A 4GLLA 5A5EA 5JO0A 2ZB7A 3JYLA 4Y9DA 1DBVO 1E3EA 4OXNA 1T1RA 3NDJA 4E4YA 1LSOA 5TNXA 3LZ6A 3L6DA 4RL6A 2W98A 2RHCA 1I24A 4DVJA 3SJ7A 2R00C 1DIGA 4JK3A 1HSZA 4E2WA 4H3VA 3MTGA 3PIDA 5I9LA 4CMHA 2AQHA 1DLIA 3CE6A 3C7DB 4LCEA 4XJTA 3L9XA 3RQSA 2PR2A 4W7IA 2FRDA 3C7CB 4IJVA 3V2HA 1FDTA 1MXFA 4L4RA 5KJCA 4J1QA 3VZPA 1YBAA 4UVEA 1GQ2A 2WYVA 3ROPA 4WOJA 1ML3A 1OZAA 3ROKA 3ZI0A 5B4UA 3O26A 4LISA 1F0YA 2YDXA 1F12A 1U5CA 3C3XA 1R0LA 3AFNA 3WSVA 1ZXLA 1GQQA 3BA1A 4B79A 3EDMA 4DLLA 3AUSA 4FOOA 1ZK0A 4Z9FA 1R4MA 4OAQA 3DOOA 2BGLA 3VPFA 1DC3A 3CUKA 1OC4A 1DO8A 2UUOA 3WLEA 2HK7A 3OIDA 4M54A 1WMBA 1JU9A 3GEGA 4E12A 4E33A 4M1QA 3NGXA 1MG0A 4ITUA 1YB5A 4GI2A 4J1TA 1LQUA 4EJ0A 2P5UA 3IP3A 4B7XA 5B4VA 1GCOA 3JQ7B 3NT5A 3WWZA 2ZYDA 1E1LA 1HDGO 4P4LA 4E6PA 3H5NA 1WMAA 1VL8A 3WICA 3WNQA 2C20A 1C0PA 4D46A 3OSUA 1LDYA 5JDIA 1HLDA 3ENNA 2I3AA 1G6KA 1VRWA 4M89A 3U4HA 2JD1A 4R5MA 4Z0PA 5CDGA 1E77A 4PLWA 2OGUA 3GF4A 5CG2A 4HFJA 5I8WA 3FTNA 3JQ6A 4MKRA 2OP0A 1HT0A 2P4HX 3P19A 5L4LA 4HUJA 2G0TA 1QYXA 4CV0A 5U4QA 1FXSA 5JNLA 1D1TA 4FQ8A 4NBUA 2JD2A 4A03A 4HP8A 1EBUA 3QWBA 1R0SA 4L4SA 4J7UA 1QXSA 4ZQBA 4I8XA 5AXBA 1EUDA 2XXBA 2P91A 1U28A 2IZ1A 4FDAA 4JBIA 2H6EA 3FHLA 1LSSA 3I4CA 4MP8A 5A4DA 2O3JA 1MA0A 1D1SA 4H7PA 1OI7A 3DEYX 5TC4A 5AOVA 4HNGA 1AN9A 3FPLA 3ZHYA 4JJGA 2IDZA 1I10A 4LRSB 5DOVA 2PFGA 2H5LA 2NTNA 3GY0A 4BHTA 5BSHA 2CF5A 1T2DA 3EYWA 3TOZA 1WW8A 2VZ8A 1HE3A 3VH3A 3JQFA 1UXJA 3PYXA 5CG1A 4CLRB 3DZHA 4N5LA 5C7OO 4R54A 3A4VA 1VSVA 1GADO 5H82A 4A10A 3JQ7A 4CMKA 1YDEA 1BW9B 2NM0A 3QE3A 3M2TA 3WWYA 1MP0A 2VZ0A 3JSAA 1TI7A 2IXBA 2UAGA 2X5JO 3I9KA 3NV9A 4GMGA 3E5RA 4XD2A 4B4VA 4BNVA 2FOIA 1PJBA 1ZBQA 4FBGA 4IIVA 1U8XX 4WGGA 4L8VA 3VH1A 1XQ1A 4GBJA 2QX7A 4KWHA 4BKOA 1DRVA 1SB9A 1QYDA 3B70A 2ZTUA 2EHDA 1A7KA 4PZDA 3DMYA 1PEDA 3UXYA 1HF3A 5TJHA 2WEKA 1ONPA 4TRRA 2C5EA 3GDGA 1DC6A 1ZW1A 1AXEA 4FSHA 1LQTA 3BTSA 5G4KB 1UXGA 1KEUA 4K6CA 4NU5A 2FR1A 3L07A 3I23A 3E8XA 3GVIA 4BO0A 3WYEA 1DIAA 4CQMB 4A26A 3IS3A 4KTTE 4MVJG 4IJKA 3AU9A 2VT3A 1UP6A 1PX0A 2O4CA 1I3KA 2DQ4A 2WYUA 3QP9A 1SCUA 2HLPA 1B3BA 2V6GA 3EAGA 3QW2A 1I2CA 1HDXA 1A4UA 1CIVA 3VAZA 3LSYA 3WGTA 1BDBA 4J4TA 2NVWA 3BIOA 3TWOA 1LA2A 1SB8A 1YVEI 2E37A 2QZZA 4CLRA 4ZA2A 4CR8A 1EFKA 4AJLA 1P45A 1BW9A 1UAYA 5COQA 1GPDG 2IODA 3D5QA 2VWPA 4CUKA 4INAA 1LSUA 4YQZA 1Y8QB 4IIUA 5L4NA 2FWMX 1JQBA 3JQGB 4KTVE 4L4XA 3DQPA 3OJOA 3M2PA 4OH1A 2VTEA 4RVGA 3RBXA 3ZGYA 1U2DA 4U6QA 4R01A 5AVOA 2C2YA 3R3SA 3WYCA 1UP4A 2DBRA 4WASA 2ILTA 1DPGA 1T26A 2YDYA 4TROA 3NDIA 4XB2A 4KOAA 2CVZA 3KSUA 4PLGA 5G4KA 4LVUA 4E0BA 3KV3O 3G1TA 1UDAA 2J5KA 2I3GA 4KQXA 2DC1A 1QYVA 4YBZA 1NQOA 4CQMA 4TRMA 3LT1A 3ZWOA 4IMPA 2HUNA 4XGKA 2CF6A 1P0CA 2E48A 4O6VA 2VYNA 5AXDA 4BL5A 2OFPA 3GVXA 1CF2O 2HQ1A 4CR6A 3CZMA 3KETA 1Z6ZA 4Z9XA 2VYND 3AK4A 5MGBA 5F3RA 3OIGA 1YJ8A 3DZBA 3ZWWA 4Z6KA 2NVUB 3I6IA 1ENPA 1NXQA 1XGKA 3JD3A 4EUFA 4CV2A 1NHGA 3OH8A 2AEJA 5G0SA 2Y0DA 3RFVA 1PJSA 1ZSVA 3RC9A 2WYWA 1Q0HA 2GN4A 1K6IA 3T4XA 3ZNNA 1E7WA 1GV0A 1HLPA 3EY4A 1Q1NA 3IJPA 1HL3A 3JQGA 2FZEA 3L77A 3MWDB 1HYHA 4ROSA 2NNLD 4CR7A 4CV1A 3ZNOA 4YTEA 1KVUA 1LEHA 3WQRA 3TPCA 2HJRA 5JMPA 2GUGA 5ICMA 4QXMA 5JCXA 2XF8A 4GPD1 4U8GA 3I6QA 1F06A 3PDJA 4MVJM 3GVCA 1QMGA 3AY7A 5K6AA 2VUUA 4PZEA 5ILOA 4ALNA 4YXFA
chains in the Genus database with same CATH superfamily
2EFDB 1S8NA 1ZVQA 3DEFA 4NZYA 3VR2A 3V34A 3VV2A 3U5ZB 2E21A 2JIOA 1CYDA 2YXLA 4MR8B 5D2CA 3ZY2A 4ASUA 4BZZA 5LYJB 3O1IC 4KEAA 4TMWA 4R2JA 5B3KA 4KIJA 1JIJA 1H6BA 3DBHA 4KV7A 4MYCA 4ZEOA 2WUWE 4CDGA 3TLKA 2O5VA 4AO8A 1L5HB 3HVJA 1NUSA 2J32A 2RC6A 2WG0A 4BXOA 3ORYA 2UUPA 2D7JA 2IBTA 1RXYA 4OBEA 4RSRA 2LUOA 3F8WA 3I9MA 1ZCFA 3IDOA 1Z22A 4X0EA 3WLQA 1FDOA 2B8NA 2QN9A 1Z0JA 2WT9A 4AY2A 4J49A 3FI0A 1DXOA 1RPAA 1E8MA 1T1SA 2QLFA 5FRDA 3VDRA 1Z7BA 4K2AA 1N2ZA 5I9SA 4WNAB 2RARA 2QRVA 1IQPA 1T1JA 3NEAA 3CVUA 2BI7A 4RW0A 3EH2A 4QOEA 4E4RA 3M6AA 5L3ZA 1JU3A 1K6JA 1VB5A 4JP2A 1Z2DA 1XD9A 3D4BA 1KEKA 4EP1A 3BXXA 1QFJA 4L5JA 4TYPA 1V6AA 5BSUA 4BS9A 2CMKA 5BR8B 4EPTA 4MCAA 5IH7A 2RJ3A 2JK1A 4B40A 3TI7A 3ZZNA 3O91A 4FGUA 3TDNA 3DT6A 5H3LA 1U6KA 4QNRA 4G2TA 2D5IA 1P1IA 1V3QE 4PF1A 1B2LA 1T43A 2O3UA 3WLHA 1Z8FA 2VQFB 1DCTA 2OC4A 2ZE5A 4W9RA 4I50B 1T25A 2VZLA 4C4YA 3ER9A 1SQGA 2ECPA 5AK6A 3OC6A 3ZV4A 5AW2A 3E4DA 3FJOA 2OILA 2WV9A 4PLPA 1JTFA 2G5CA 2C03A 3PUXA 3OZFA 4XXHA 2WJZB 3KBBA 1F6BA 5H1YA 5IXYA 1B15A 3EZ2A 1H0HA 3G2HA 4HL6A 4MVJF 1KZ1A 1JEQA 1Q7EA 1U1FA 1UT6A 2I6TA 2XQGA 3FZQA 3PXEA 3ROEA 1DAKA 4JLKA 2HRDA 1VL0A 4ZU6X 3PFBA 4YP5A 1QQBA 4P4SA 3UXMA 4N18A 1S8OA 4HQFA 1GNLA 1NUHA 4PC6A 4QEDA 4DIFA 1Q3TA 4D81A 3WJAA 2Q3BA 3OZUA 1EG7A 5ESRA 2VF4X 3VUFA 1ZK1A 3T9AA 4QTYA 3BMNB 2FMIA 4MUBA 4QQKA 4TWRA 2IWRA 5BN4B 2O7QA 3BDVA 4LDQA 3UMVA 2K4MA 2VNHA 9MHTA 1VHDA 3QYAA 2YJ5A 5FWXB 1WSBA 3TKYA 3C3PA 1VFPA 3PZRA 1ZS9A 2WSBA 3WL3A 3LD9A 3FTFA 4U63A 2OV6A 4AF7A 2EFYA 3QUAA 2XMGA 1R0KA 4YGXB 2PUFA 1X7XB 2IHBA 1P18A 4GQBA 4L74A 3ZDYB 5D8DA 3R7FA 1TYAE 1GP2A 3WE7A 2YXNA 2FW0A 2GN2A 4Y2QA 2YNMC 2GPTA 2HOQA 4RH1A 5K0JA 5M5BA 1HY3A 5FBVB 3TTYA 1ZD5A 2QE7A 3NFRA 5E2AA 2XCQA 4KXQA 3IIMA 1RMQA 1J8DA 4ZQGA 5EJ4A 4P08A 2ZI6A 3H9GA 3QBEA 3UA4A 2XGGA 2FU5C 1KMCA 1U7WA 5H8WA 3NBAA 3O7WA 2BGUA 3L7AA 4PNEA 1OFUX 4TTAA 2FCRA 5C1OA 3AKDA 2HO5A 4LI0A 5DEIA 2XNJA 1EE2A 3A06A 2ZBEA 2R5FA 3EUAA 4QOSA 2CXQA 1ZL0A 5D3MB 3UWMA 5AVSA 5FAKA 9ATCA 4C2UA 3OZBA 3PNSA 3H11A 4M76B 1PEYA 2B5OA 2BEUB 2ECKA 1OILA 1TC2A 2EBWA 4XIFA 2I66A 2QJTA 3TCNA 2G7MC 3TB4A 4HDQB 3PPYA 2QTFA 1NRXA 3OQVA 3UG6A 1NJ5A 3U7FB 2GYUA 1WU8A 1B3RA 2P35A 1WCYA 5EWJA 3WWCA 4PQGA 2D59A 2X5OA 3OEWA 2QYHA 1C14A 2WD7B 5AKIA 3WL5A 4LJ4A 4QG3A 1OXMA 5K9ZA 5DHSA 4A82A 1UAAA 4J0IA 3KJGA 1NNEA 4KXFB 5I4KA 1VKRA 4MVJH 3WGYA 2HBZA 3AUXA 3NUGA 3G2MA 4U3JA 3CLHA 2WHQA 5C1IA 1U3DA 4D9HA 3OFND 3KXDA 2QN7A 1TNDA 3TYXA 3DE6X 2COUA 4BWGA 1UT8A 2LR0A 5A3QA 4JYPA 3H2JA 1TCAA 4DQDA 4BNWA 2D0IA 4PZUA 2E49A 2JI4A 4FINA 1SBYA 2FPUA 2P4EA 3GP8A 2CVFA 1I0IA 1D4ZA 2G6BA 4WZBB 1PFVA 1OBVA 1KY5A 2VJLA 3QUCA 1V47A 1TIKA 1ENYA 4MRAA 2H4HA 3DV2A 2QORA 1XALA 3DC7A 1T1IA 4LWOA 1EVQA 3SCZA 5DCWA 2QX9A 3ELYA 4D7AA 4J9UE 1I7LA 4RZQA 1NVTA 4L7QA 4DKXA 1BWPA 2B8EA 1N2CE 3BFXA 4IBOA 2OYRA 4YPOA 1UBFA 5L3QA 4X97A 4LF9B 1E2QA 1PFQA 4FHZA 3O3NB 4NWIA 2FPRA 1GG5A 3D2LA 2WSMA 3EQZA 3NOQA 3S2FA 1E2PA 5BSGA 5GTDA 4C0SA 5AKHA 4ZICA 3HNOA 4K9PA 3GQVA 3MBKA 3UWSA 1FUYB 3TUZC 2QM3A 1TZCA 1NKVA 4MW4A 2ERCA 3EFOB 2P40A 3F47A 4MKIA 2XRFA 2XITA 5IT4A 2JAWA 2WWTA 2XODA 3BH6A 1BO6A 2Q21A 3EWSA 1DQYA 3L6BA 4HGZA 3GNTA 4Z0HO 1GTL1 1W35A 2VPIA 3FUUA 1K6XA 1JMVA 1SA0B 1Q0QA 2HIMA 3ELUA 3N2KB 4JA2A 1ZN8A 2CJWB 4PVDA 4Z3DA 4BAGA 2RGAA 3ULKA 3SQDA 3X1MA 1UKBA 4A0FA 4AW9A 1I1QB 2WDPA 3J7TA 3JYPA 2C07A 3K1JA 1EFLA 3L8HA 1QRRA 2EFCB 4J0QA 1UMDA 2P9YA 2ZZKA 2JAXA 3K9CA 4K86A 1EH5A 2A9JA 4US1R 4ARBA 3NT2A 3KQVA 1NQUA 2IOYA 3ROGA 3DTNA 4YJFB 2GJ9A 4EVQA 4IUCS 5CEEA 4DCOA 1CF4A 1Z0SA 4EPYA 5JR3A 1AF4A 3VZDA 2MWMA 4MW7A 2CFTA 3B1VA 3CX8A 4RABA 1K7SN 3SX0A 3VZBA 4AN0A 1AGYA 4OXXA 2HQRA 1MNQA 2AK3A 3JWIA 4EB0A 3NWPA 3A7EA 3C87A 4WJZA 2C5LA 1Q16A 2GFIA 1KAMA 3MAJA 4OKIA 3SSAA 2VT2A 4ENPA 2F3PA 1CLUA 1I51A 4MQFA 4UM9B 5GY7A 3SC6A 1ORWA 4J07A 1G0OA 2QLBA 2BGMA 2XF2A 3GCWA 5IFLA 2PA3A 3B78A 4HX2A 2PQ0A 1PDWA 1RE0A 1T2EA 2OCGA 1SO8A 1IEXA 1RLIA 4MS3A 1Q15A 4BAZA 5FYQA 2CY0A 1NVVR 2IZ5A 1XLTC 2JAPA 4FFLA 3G89A 1BWRA 4COOA 3Q9UA 3KAJA 4IVNA 3E2IA 3DFZA 4Q00A 2I99A 3U1VA 3U80A 3NEJA 2QK4A 4DA9A 3Q4GA 3IQEA 4TTRA 3WIDA 3LLVA 4UUQA 4E31A 1KAHA 3KJFA 2ZE7A 3VOAA 1GSAA 1P1CA 4KP7A 3R76A 5BR4A 1D7OA 4TV9A 2F3RA 2IXAA 1L7AA 3HC7A 4U2EA 3T35A 5CFPA 2ZITA 4H3KB 3G8DA 3BSFA 2IPAB 3BWDD 4JGBA 3QEOA 821PA 1QR6A 1HZJA 1CBUA 5AKZA 3UJ9A 4CN8A 1ZWLA 2NO7A 3A6EA 3KKZA 2XWJI 1ATIA 2C3MA 2H11A 3ITDA 4WBNF 5IK2D 5KTNA 3H8WA 3AB3A 1WCXA 4BLRA 3SBDA 4FYMA 1XCLA 2BHLA 2ZZNA 1A0OA 2Q6IA 3QPUA 1FPQA 2NO6A 4E46A 4IIXA 4BJ1A 3RC8A 4QBIA 1KNQA 1PHPA 4U02A 4YJGB 5EZYA 5LYYA 4B3CA 3ZD6A 2I4LA 2IL1A 3LOQA 3NETA 3O95A 2ZCVA 1ZRMA 3AM4A 1ML4A 3GUZA 2W2KA 3M1AA 4HH4A 4JCCA 3VUEA 2C2KA 3G0BA 4QFDA 4RZIA 4KIWA 4E2XA 4E5KA 3FWPA 4URXR 3NWJA 3GN1A 4ADSG 3CWQA 1TTTA 3CLSC 5COAA 4QLOA 4MJ3A 4M8NE 2FP4B 2V97A 2VP5A 2Z56A 4YJ2F 4AMUA 4B75A 5KX5F 3KU1A 1ZMRA 4M99A 2QG4A 3K0AB 2X77A 3JYQA 1X77A 1KE2A 2AYZA 3EIXA 4YRFA 1WU7A 2JEYA 3CWCA 4G1MB 4X3CA 4ZTBA 1EXVA 3DLPX 1X42A 3EISA 3LYAA 3DVQX 3F2IA 4UM9D 4OGGA 2XQVA 3B1YA 1YDGA 1GN8A 2HU7A 3BB4A 4TS4A 1MJGA 3DL0A 1L8XA 3I2YX 4KYIB 2R6DA 2OGZA 2HA4A 1V7CA 3QFRA 3W5JA 3K1TA 5KQPA 1G7CA 2AMYA 4ZDWA 3G2NA 4P3OA 1Q0TA 5BUZA 2EGHA 1UK8A 3FZNA 1W19A 2BFPA 3JWEA 4MWSA 4OB8A 4P92A 5G0TA 3CJTA 4U7JA 2PUCA 1WB6A 4LI3X 2DKOA 2PUDA 5JAIA 1SQ6A 3L02A 1RQPA 5EVCA 3H3FA 3ONDA 1O9GA 3NTQA 3OECA 4W9NC 4OO3A 3X0DA 3TJRA 2X8AA 2JKYA 2XBLA 3A6GA 3AETA 1ECJA 1GPMA 1JSRA 3DPSA 3WGGA 5YASA 5C8YB 3E82A 1KC1A 1WSDA 2O14A 3QWAA 2JBAA 2Y4NA 2FKNA 4Z4GA 2XMDA 1S2IA 1U9IA 1YS7A 4PGFA 3RIEA 5ALNA 4I9HA 4A0RA 4EEZA 2Y1DA 4MO9A 2OT3B 1UBGA 4PM4A 5JLJA 2JFXA 4GKBA 2W4MA 3E03A 2IW1A 3N07A 3L40A 3UANA 2FR0A 3G9XA 1JG3A 4L6CA 5LZ9A 2BGGA 4E4TA 2O06A 3L2OB 4EKDA 2OO5A 2HMAA 4D0SA 3RVSA 1ZK4A 2GAAA 5G0UA 1NW4A 3WLAA 4ZIRA 1UKCA 4H17A 1MO2A 1VPVA 2PU7A 2Z1NA 3D6NB 1MABB 3GGOA 5DWDA 1GPAA 1Y4AE 2GDZA 4LHZA 5BT9A 1QHFA 4RSGA 2H2DA 3OP4A 3W2IA 1GG8A 4HB4A 1TVKB 4H18A 3TZQA 1YZUA 4B74A 5DRYA 4AS1A 4ZCRA 2Q5LA 2W8BA 3FUTA 1J1IA 1AXRA 4M9ZA 3HY6A 4RHYA 5AUNB 4ATNA 2ZDGA 4Y7CA 1E8NA 2OO3A 5G1PA 3RSOA 3U7QB 2GPAA 2HT6A 3KYIB 2AWOA 3GVPA 2I7VA 2HRRA 2J3KA 5IXJA 2PSDA 4P3KA 2OFWA 4GBMA 5TGTA 4HAXA 4IG9A 4C9BA 1IN4A 5BMVB 1IZ8A 1JLMA 2DE0X 4GRIA 1XTRA 3CSUA 2VP6A 3TLXA 4D4JA 3GJ7A 2PUGA 1SC4A 1HXHA 2BFBB 2CLCX 4WLEA 5EXEA 1JT9A 2XTJA 1PAUA 4RXMA 4GOLD 2I3ZA 2OL4A 2GZHA 4PRLA 3SQXA 4AJ4A 2FLKA 2ZT8A 3MJEA 1OB2A 4OI2A 1T1GA 4CM3A 3R20A 2Z8YM 4YAKA 1Y1LA 5BVGB 5CNJA 3DBRA 4KWIA 5K99A 5EIWA 4FFBB 1WG8A 2GXUA 3RGGA 4DF3A 2ZWVA 3EQ9A 4B6QA 1E0SA 4EJSA 4HLQB 3OT1A 1VE3A 4UTNA 1G8MA 3H5WA 1Y37A 1U2GA 2BTQB 1KDVA 3PU6A 4A16A 2YL2A 1OPXA 3JQAB 4TV8B 1WB9A 1IBKB 1IK4A 1Y8ZA 1Q57A 1N5KA 3DXXA 3OTGA 4JWKA 3PDCA 2O8CB 1WDWB 1HNWB 2ZDHA 4KUEA 2QM8A 4N3GA 3SS9X 4Z49A 2QYSA 1HRDA 2PX2A 2QQ5A 3C24A 3ED5A 1KP2A 1LDMA 3KALA 4UUBA 4A0QA 4EGAA 1AS2A 4ND2A 5TX7A 2VT6A 1LVHA 2BIFA 5A62A 4JKYA 3BICA 1FYVA 5BYAA 1UZUA 1E2IA 3R8XA 1H93A 3GNQA 4QVIA 4D3SA 2W2LA 3UB3A 2Y99A 3HLTA 4OI4A 3ZVKA 1WNFA 1D0SA 1L7DA 2YV1A 3CFYA 3QWIA 1QAOA 3AYXB 5CYFA 2GZ3A 4IMRA 4N0DA 4NICA 2IHNA 1VECA 1C7ZA 3CX6A 3GOQA 3IXLA 3LT2A 4YRDA 2PE5A 1L9KA 2MR6A 4OA8A 5CJPA 3U9TA 1U9YA 2FMXA 3NBUA 1ODJA 3H2BA 3W0LB 5AW0A 3H5LA 4NIMA 1VLQA 1IYZA 4DSOA 4HCJA 2HQOA 3HEBA 5DBIA 5CB8A 5SV2A 1TYZA 1ZEMA 2ZWOA 3OQIB 4IS3A 1L1EA 3DV0A 4CIVA 2YHIA 2BFCA 2G1KA 3N5KA 3ZQ6A 4DLUA 2ZREA 1R0WA 2CDAA 3CR7A 2H8KA 5CU7A 4B47A 5IUNC 3CKYA 2HBQA 1TL7C 4N5DA 1NN5A 2RAVA 3AWDA 4D5EA 5JOQA 5LWHA 4RL4A 4G5OA 1S0UA 5FBHA 2IYSA 4UOZA 3V4SA 1EFPA 5LBIA 4HO1X 5I7UA 3ZQUA 1NVAA 1WW3A 2TECE 3WC4A 3T99A 3ZW8A 5LQUA 3KSBC 2PZAA 1TAUA 1ECLA 3LX8A 1PL6A 2GEDA 1FF9A 2EBUA 2XTZA 5KWVA 2E4ZA 1E62A 4E03A 3QJYA 4AY6A 3O4RA 4EG7A 4YMVA 5B37A 2ODBA 4LDAA 1PJRA 4RHUA 3OU7A 2FUG6 4BV8A 5LVAA 3DMPA 1I14A 1G2IA 1XCPA 2CLFB 2FRDC 3ANLA 5JS2A 4CFSA 2PVPA 1DP4A 1N3LA 4EI9A 3V2GA 4DLYA 1SHKA 3JQAD 1Z62A 3NHPA 1TQ2A 2JFZA 4Y2RA 4NK5A 1U2QA 2I2AA 1ADFA 2PEZA 1ODTC 2OXCA 1N4AA 1VKHA 2DWOA 2FW9A 1WVIA 4Y2TA 1ORIA 5LM3A 4GI5A 1K92A 1IL0A 5JBQA 5JRJA 3DUWA 2XUFA 1XTIA 2NQ2C 3KLOA 5JCZA 3MRTA 1R18A 2XNDA 2UUBB 4EPWA 1WXGA 4B9EA 2AC2A 4JBYA 1HLFA 3CJQA 4PZCA 1ZKMA 4R4JA 4ZVRA 2YWCA 3IOEA 1CNMA 5CH3A 3H4TA 3Q12A 3CLTD 1CFZA 3G2LA 3PUJA 4MDEA 2GM3A 2GK4A 4MA4A 5ECWA 3U4CA 5KMGB 1UZNA 1VCIA 2XMQA 4JR1A 5I7OA 3LKVA 1IXRC 2XDYA 3R7AA 3SSOA 4OVKA 4YMWA 1ADYA 4QRDA 2EF1A 3T9EA 2R1UA 4CGYA 5KHLB 1ODCA 5F9HA 3SZMA 2LW7A 4ZVOA 1EWRA 1KBOA 5TRTA 1WKVA 4J75A 4TTIA 1F5NA 1GAJA 1PT7A 1FX1A 4DLBA 1C3OA 3EIUA 2PUEA 3DLIA 4XWYA 3ME5A 2VHYA 4FYVA 5DK4A 2IYLD 2Q62A 3F5DA 1A3CA 1YBFA 3CT6A 2ZJBA 4BVFA 1O77A 1YVRA 2X0RA 4DLPA 2AGVA 2EGUA 2QTAA 4QTTB 2ZI5A 4YP9A 3U2QA 1OY1A 5CDTA 5L3SA 2BKVA 4IQ4A 5DSZA 3W2TA 1MZPA 3PHGA 5LZ5A 3JRWA 3L7MA 3DQZA 1CNEA 3OF5A 3QU7A 4NZNA 1KSGA 1KIFA 5L9AA 1KVSA 1H2BA 2IYYA 3D9QX 2TYSB 2PQ6A 3BFVA 2RGXA 3JX9A 4RELA 5ALOA 4E2YA 3R2JA 1O6BA 1JLLB 3TQTA 4ER5A 2Y1FA 3DHNA 4OIFA 1CP2A 1LZLA 3W3AA 5H0IA 3SMQA 5KOJB 3FOFC 2Y0PA 4B6OA 4JI6B 2OA0A 3BJMA 2F8SA 1DC5A 4JZYA 2NP7A 1MB0A 3G59A 1PL7A 1W49A 4ES6A 3ZWNA 2JLRA 2DTDA 4YI3A 1E66A 1YIOA 3AF0A 5AM5A 2A33A 4AQYB 2Z2JA 5HOQA 1RLJA 1Y6JA 3FOWA 2DLNA 2QXUA 2XUGA 3FNEA 3MLAA 5FBQB 5L7YA 3EF0A 2JHPA 1IHUA 2FGJA 1KJWA 2KM1A 1C7JA 1UJBA 3EXHB 3EGWA 4XDZA 5ALZA 3WGIA 1GGFA 2Z6UA 2VL7A 2AW5A 3A6LA 2AOTA 2CMFA 1ZI8A 4ZHQA 1NP7A 4GF5A 3WMGA 4BNIA 4DG5A 1ZAYA 5EAIA 4OHKA 4PHFA 4FS3A 5EMLA 3S7ZA 3T7CA 3AUFA 3ESRA 3S44A 4A1OA 3JQFC 5GVRA 1CETA 4R8VA 5JYCA 2ONYA 1TUGA 3CPJB 3L7KA 4FBLA 4EELA 5CA0F 3R23A 3AXSA 3FNQA 3D3EA 1SELA 1TMKA 4Q9IA 2OAQ1 5EQDA 4EHLA 5IM4A 3GFFA 1C9MA 4MV4A 2X15A 4K88A 1IWOA 1JR3A 3G17A 3ZHUA 5CDHA 4H7DA 3H8VA 1UC5B 4RKRA 1OMOA 4GL2A 1Y1PA 3H2IA 1T15A 4MYUA 2PRIA 2IA5A 4J0FA 4X1IB 1IWPB 4XJSA 1U8UA 2FMHA 1ZD9A 3BHMA 5EZ6B 1D5WA 2DHQA 4EQ6B 4C04A 4EJ6A 5KO2A 3V1TC 1MC5A 2JLUA 2Q99A 3Q9NA 4M7OA 4RF2A 1W7AA 1T5HX 1YONA 3FM9A 2OHJA 4GKAA 4JVNA 2C4NA 2VTDA 4KRGA 4CFZA 4I9FA 4IHAA 1K8QA 3HA3A 2XT9A 4RXUA 1EGAA 4LSGA 3P0FA 4DV4B 4CT5A 1WDKA 1CZLA 1K7XB 2V54A 5JPIA 2G7ZA 4AXXA 3ZDCA 2WTNA 4CT4B 4AZ0A 4Z2AA 4WK4B 1KWKA 4O8CA 4EKIA 1Y7HA 3TL3A 2UYHA 1DCFA 1XZGA 1NOIA 1D5CA 1B0PA 1Y48E 2ADOA 3BS4A 3I9FA 3OICA 1SIOA 3QPCA 4M9CA 4S1PA 3DE1X 5FULA 1F8GA 4XCQA 3QVXA 5A3JA 4OQLA 3PTZA 2JIDA 4CKXA 1DADA 1FB5A 2H4YA 3VSCA 2YNMA 1SCBA 2R47A 2BLLA 5LJIA 1Z2PX 3BF8A 2UUAB 3F9CA 4G8CA 3I8XA 4YB8A 2JJ2D 1XRJA 3FPFA 3RFTA 2V65A 2VO1A 4D42A 4DIUA 4R31A 2YVAA 5IG2A 4DYHA 3HJBA 3L1KA 3UNXA 5HRUA 3QM1A 4PG8A 1JR2A 2CN1A 4J0JA 2RHMA 3U3OA 2NO1A 1VCOA 2C99A 1NLMA 4RQTA 4X1KB 1UMBA 2YX1A 4BTEA 2CXUA 3SDSA 3OMLA 2REOA 3VTAA 3JQBA 2WF5A 3KYBA 4DXAA 3VTFA 4F3YA 3N2GB 5LU9A 4OYHA 3IT1A 2JI7A 1PS9A 4KN5A 4RD0A 4LTNA 2JFUA 2DHDA 2GHRA 4M87A 1CS4C 2DCMA 4IKOA 4OA5A 2X6RA 4FMCF 3P32A 4DA7A 4NCAA 1RHJA 4BJ3A 1Y4SA 3JVVA 3C5HA 2P8JA 3KKKA 3RYCB 1QGUA 2B8WA 2QT0A 2V4ZA 4JDUA 3RKUA 2NV6A 3I5UA 4UBKA 1JE0A 4RKEA 3T3PB 3U4AA 4DCCA 1WQ4A 4FMDF 3FBTA 4QFCA 2PRJA 1V4BA 1OWNA 5HBGA 4G5QA 5E1MA 4AY4A 1JTVA 1QFSA 3RF7A 3RUAA 2PL5A 3DXZA 4NLLA 5JQGB 4HAOA 5E6UB 4YCNA 4BNJA 3IPYA 3MCVA 3TM4A 1MA3A 1MDBA 2UZ4A 2W4IA 2DPHA 2O1WA 4J0HA 1BX3A 4KE9A 1HA3A 4GICA 2A9RA 4OJTA 4QGBA 3T1VA 1COWD 1ESEA 3RS8A 2NYAA 2QTBA 3LXXA 1GD1O 5J1TB 3ZIAD 3OZ7A 4E5MA 1L5WA 4RIEA 2EP7A 4LHWA 4DW8A 5IHXA 1WMEA 2BEWA 3LPCA 4KXMA 2O3RA 2OR3A 5I4BA 1Q0SA 3H04A 3S3TA 4MCJA 3A25A 4FILA 2WJWA 2ZAYA 4MMYB 3TMYA 3ZQKA 5K8LA 3SWWA 5FHRA 3AIIA 4AZTA 1FJXA 4DPKA 3MEQA 4RGQA 5EP3A 5IZCC 4Q7QA 1DAFA 3SXPA 2WM3A 1WVMA 2J8ZA 4E08A 4IDQA 1I13A 4P36A 5TGDA 4EVRA 4BMDA 1WPGA 1YQXA 1RPTA 3AM5A 3W5BA 1UODA 2FPLA 4I9GA 1TW2A 1Z5WA 1ICEA 1GPYA 3UFXA 4MIYA 3HYNA 4EFLA 1MTZA 1JAIA 2K7ZA 3LWDA 4Y2XA 2PLWA 5AVTA 2VXCA 2HZ7A 4XWAA 3CEPB 1IZZA 1DFGA 1QIJA 2OGSA 3HP4A 3Q3VA 4HI0E 1A9ZA 3SLKA 3UQZA 2IDJA 2BP7B 5I7FA 1JNYA 1U9JA 5E9WA 1MO3A 4D2IA 4IIYA 2IYNA 3JQRA 4EG6A 3PA6A 5EQFA 1E7SA 1I6KA 2YZ2A 2ZP1A 1GRQA 2V7QD 4ENWA 2DYKA 1OX5A 3I3SR 1VL1A 3KWMA 3OIUA 4U2KA 4E1AA 4F11A 3INNA 1JDSA 1Z6QA 1A9SA 5E0OA 4CEIA 1N1MA 2I7TA 5DM0A 1T4BA 1X2EA 5CLHA 2VHCA 2GFHA 2G9ZA 3OLVA 3RVLA 1JA0A 5GVSA 3GDWA 2DFKB 3FOCA 5A1JA 5K6AC 1I3CA 5EP2A 5AK3A 1MDFA 1ESNA 3PI6A 2DH5A 1RBYA 2LGJA 3I39X 4IUDS 1TYCA 3PZBA 4QXPA 4WA7A 3DR3A 1QAQA 4MAAA 4Z4EA 5JAMA 2JFHA 1W6UA 5ERYA 1IQUA 4KMSA 4GX2A 1O4WA 2VWQA 1ZIDA 3DVAA 3NGLA 4IDFA 4BATA 4X6UA 4HT3B 1GL9B 5TV2A 1S2NA 1TFUA 4EHFA 3GLTA 2WAXA 3I76A 3LOPA 1Z7YA 2BMVA 4OI1A 4BNDB 4WECA 3NTXA 1OREA 4PLFA 4WN9B 4X1OA 2PR7A 4X3OA 2XOXA 2O2EA 3SX2A 2H17A 3KXLA 2IPNA 2WW8A 5AOAA 3I1FA 4A6PA 4QGSA 1MV5A 2B9EA 1YL5A 5IC5A 3D6AA 3OHSX 5DTQA 2VRCD 3HDGA 4KBFA 1LPNA 5CHEA 2YZMA 5HX7A 4RY2A 5K01A 1FOEB 3BORA 1V7PC 2W93A 4OU4A 4HWKA 5AMXA 2PMEA 3ZBQA 2E18A 1SN7A 1R3UA 1IM8A 1PKXA 1DPFA 5B6PA 1P8AA 3IELA 2HA0A 2IYQA 4MW1A 4TLEA 1GSIA 1M7GA 4XAQA 3RYIA 1HWYA 2JKZA 5F78A 2BKLA 5CD9A 5KTKA 5SZKB 4ZYTA 4D8VA 5JRZA 4IAOA 3VPDA 1DIBA 4TS1A 3ZU4A 1NASA 1KFKB 1MXHA 4OXKA 3LYLA 2YYAA 1E2MA 4RZ3A 1G20A 4E2FA 3H7AA 2Z8XA 4BVGA 4YQFA 4Z7QB 3AB7A 3H3JA 2YS7A 3U0BA 1K6MA 1LPBB 5ALYA 2R8BA 1N2SA 3I1YA 2Q9BA 3WFIA 3GO4A 2QQ0A 1XJQA 1I4OA 3OJWA 3U9LA 4IZHA 2B0JA 1L7VC 3GYGA 3BOSA 4C4ZA 3ZCQA 4Z1MA 3SF8A 1DOZA 2ZIXA 2C82A 4FGWA 4JEUA 1I9CA 1XX6A 1ZLYA 3QYPA 2ONKA 3RU3A 1TT5A 1V8OA 1X7ZB 5C8ZA 1J8FA 5AVVA 1WR8A 2IYAA 3ZC3A 2H1WA 8ABPA 1AM4D 1X1QA 1NUQA 4EB6A 4Y0AA 4RCZA 1UXIA 1Q3KA 3W90A 5A9SB 4M1SA 2J9ZB 3OE7A 5M04A 1IUPA 3HSSA 4MGYR 4UQPA 1RI3A 1U4NA 1ADCA 4B8WA 1KPHA 3JXEA 4WNCA 4MHOA 1L7OA 3K30A 1XWWA 4KMOA 5CXSA 3P2EA 3OETA 1RXCA 2C7VA 2DSTA 1Z5NA 1P62B 3BPSA 4UVDA 4EBFA 2XZOA 3F3MA 4E5NA 1EKXA 4EA9A 2H4ZA 1X8LA 3KZVA 1CUXA 2QTCA 2AWNA 2R5NA 4HN2A 1QHXA 4LDNA 5A6SA 1OH8A 4HNAA 1H69A 5DCUA 5GZ6A 3TRIA 1RXSA 4RNCA 2X22A 1J70A 3KLBA 2QVYX 2VHZA 1IOLA 3KQLA 1Z07A 2SECE 3UOAB 3QA9A 1CCWA 3QKWA 3MJSA 4O4IF 4YCLA 4O4HB 1H2HA 2FWBA 1UBRS 3RG8A 3GJRA 4EJFA 4EB8A 2C31A 3C85A 2AXQA 3H1FA 2QMHA 1KAGA 4YFYA 4FLEA 1PG2A 3WJ1A 3GHYA 3GJXC 3DZJA 2VDVE 5JAHA 2V98A 3MFQA 1ELOA 3LCCA 4KQWA 3IVMA 4RTQA 1KVRA 5DV9A 5J43A 2VYVD 1N77A 5C5DA 2FFHA 1X3LA 4RFSA 3GDFA 1ID8A 4G84A 1KQPA 2I2DA 3PICA 4EGSA 1QWSA 2BELA 5BQOA 4C7OB 5ICFA 3E3MA 4QX6A 3ILVA 1WY5A 3L0PA 3TX6A 5IYZA 1JG2A 3DDZX 3T5BA 3X1ZA 4RM2A 4Y6RA 1IXZA 2A8YA 5ALJA 4RTKA 1GFSA 1PDOA 1J0XO 1Z2AA 3HB1A 4IINA 3I12A 2CSUA 5DXFA 4PNZA 4RJJA 3K4QA 3EEFA 4TKVA 3Q72A 1YE8A 2ODTX 3T4EA 3CC8A 4AJ1A 1B6GA 2VWGA 2G70A 1E9SA 1T5TA 3KZ1E 5FNVA 4R83A 4QFMA 5JE8A 3KWJA 1HDOA 2ZWPA 3DLBA 2G9QA 1RWQA 2Q3DA 1PLKA 2DTEA 3JQ9C 5E8RA 1IZ7A 1LWNA 2BY4A 3FB4A 4G81A 4UHFA 3AJ9A 4XM1A 4EB6B 2IGTA 1NI5A 2JAHA 2UXDB 3OHPA 1R6BX 1KFBB 1F48A 3OZSA 2IHYA 4XOUA 3TNJA 4TN5A 1W36B 3X1YA 4P0PB 1NXOA 3SFZA 1J0EA 1IAVA 1HQDA 1SBTA 2ID8A 3O2NA 4PG6A 4V0LA 4YDSA 4YRIA 3GIWA 3VA7A 1RHMA 1W9MA 5BVHB 3F9IA 2EFEB 1REQA 1URPA 4ZEWA 4LZAA 1G5PA 5JS6A 4QPZA 1JJFA 4H35A 4PV7A 1OH7A 3TRJA 4HBZA 1T0UA 1YJAA 1LRJA 1LPSA 4CQLA 2I62A 1SHTX 3TVYA 4J7AA 3OM8A 4R0MA 5BN3A 5AOBA 4OHOA 1CDOA 3SPXA 4AYTA 4DCTA 3L1IA 5CEJA 1L5GB 3Q98A 4LHSA 2GFQA 1L6RA 4J2OA 3ZTYA 2WP8J 2X2PA 4L6AA 3I8OA 4A23A 1BOOA 4R2IA 2QTZA 4ZYYA 1EDOA 2O2CA 1NG9A 5EUCA 1WS6A 2IPXA 2A92A 4Q21A 4AXBA 5CAEA 4YMTA 4ZAVA 3KVOA 2CL6X 4ZAGA 5ED4A 2QPLA 3AZOA 4JCOA 4K6MA 3PGXA 4IIJF 2FPXA 2G5PA 4INZA 5IWCA 2Z1MA 2ZWMA 1BXZA 2ZWAA 3H5AA 3P97A 1UEJA 3UW1A 5GONA 3C6YA 3BQ9A 3CN7A 1CUJA 1QJCA 2B35A 1OVMA 1NU6A 1DBSA 1Y1QA 3B3JA 3MFYA 4JQZA 3UXHA 5HK9A 1W5SA 5IJ0B 5LIPA 3BQNB 1OW3B 3HR4A 2VJDA 3HZHA 1SRQA 2O23A 4ZT2A 2A1TR 2N1BA 3GNLA 1EVYA 3PQCA 3BSWA 3F4LA 1Z34A 2P11A 1YZHA 3H6GA 4HWPA 3DDUA 3EFBA 4BV9A 4YX9A 5D85A 3C1TA 3EASA 3I52A 4DNXA 1WJGA 1EWKA 1JPNA 1XDDA 1XO1A 3QFFA 4X6YA 2Y1CA 3PNOA 2V9ZA 4TZ0A 4QUIA 3QVGA 3DHWC 1S3FA 1A1SA 1M6WA 2WAMA 4OHCA 1O08A 2IUFA 3H19A 4IV5A 4RK6A 1YJCA 2Z04A 3K20A 2V7PA 1W36D 1D0IA 4WBNB 1LY1A 2HNKA 2UYYA 4KNVA 2ZI4A 1QZTA 2E9SA 2AUMA 3HH8A 1IHOA 1RWMA 2QB5A 4L50A 3I1IA 2NQTA 5FEMA 5FKJA 5IBQA 4Z7NB 4OUDA 3KKLA 3SBOA 5KWSA 2WILA 3USES 3VNUA 4E3WA 1K0FA 3E9ZA 2XXAB 3JCZA 4R1NA 4UUMA 4XSGA 5ILQA 2AHRA 1M2HA 1NIPA 1JQEA 2CUKA 4RMIA 5F1KA 3TSYA 3BD7A 1FVXA 3UJ3X 2D00A 5EC8A 4HUTA 2RK4A 1DZ3A 2RH9B 4X3PA 3KVRA 3K9LA 3CISA 3K6SB 3DE7X 5DTIA 3IUMA 1E2KA 5K3SA 1VHLA 2VJKA 4NCNA 2FUG1 3D64A 3ND6A 1AO0A 3RJZA 4IP0A 3S28A 1FZTA 1AS0A 3EEYA 4C4SA 1VJGA 1YRLA 1NMEA 4BWYA 4HH1A 4OIMA 1TD9A 1MB9A 4B2IA 2P1DA 5A4IS 4WLUA 4ZMBA 3ANYB 4MR7B 4YUAA 1Y1SA 3COWA 3ZV6A 5ER9A 2F1OA 4JJAA 5H7XA 1M0WA 3O03A 1Y3HA 3OFVA 1KDOA 1EESA 3C8ZA 2OXTA 4PVCA 2PGAA 1QG2A 1MO5A 4H0FA 1N5MA 4L4UA 1P3DA 4JYMA 4N7JA 5TT1A 3T5DA 4ENTA 4P58A 4HATA 2OKGA 3SGLA 4WZAE 2Z43A 2RHWA 1IZ9A 2XOKA 3TLCA 4F4FA 1RZRA 3ABRB 1LKZA 3HVHA 3EAFA 4PLCA 1Q14A 3WHPA 1UAGA 4H7IA 2XPCA 5K03A 2KSQA 2IRWA 4QQNA 1G4UR 3E9DA 4X66B 3NALA 4FI3C 5KKAA 1K5PA 3U3DA 2WVJA 1Y8CA 1UJ6A 1KK2A 3NPMA 4FSDA 2NU6B 3DXFA 4PAGA 4XJXA 2FZLA 2PAAA 5EL0A 4OKNA 1VJCA 2J3HA 5A9TA 4JGIA 1WBDA 1MCZA 2P62A 1GITA 5D3KA 1BFDA 5DK6A 2R0QC 4MGEA 4IVQA 4CXMA 2HFKA 4UQOA 4EQZA 4LV8B 4QT0A 3PUHA 3HJAA 3KG2A 1QP7A 4MR9A 1NFQA 4BFXA 3I04M 4N01A 1L7XA 1WW2A 2NQ8A 1A95A 1PZHA 4R6XA 3O0TA 3KOZA 4YC7A 1X74A 1HQKA 1V37A 2HCJB 4IX1A 1RPZA 2ONCA 3Q7EA 1ZW6A 2JGIA 1GXSA 1Q7CA 2V03A 5LA6A 1P2SA 1TE2A 1I4TD 2LKCA 1MAAA 1JQJC 4ZXFA 2EWMA 2PGIA 2IYWA 3E18A 4FR5A 1JTEA 1MIHA 1AKYA 4RPLA 3V8MA 1TUBA 1QB8A 1S4QA 3FLBA 1JHMA 3MF4A 1CRQA 1HNXB 1E59A 2VZEA 3TQRA 1NFRA 3T5PA 3ZJYA 4BKPA 3C3DA 1PK9A 5LQRA 2EP5A 2VF5X 1R27A 1V25A 2O3TA 2QMUA 5JSKA 4B8ZA 1BHO1 3ZN2A 3ZCRA 1EAYA 1EHCA 1NT4A 5KB3A 2VUSA 3OMXA 3O8QA 2YY6A 4QAJA 4BFSA 4DJAA 2ZAGA 5BT8A 3GUCA 2QRJA 3GZNA 1QGAA 3RRMA 1ZU5A 3H17A 2V1XA 4IOJA 2PUAA 5ICEA 1XJCA 3OURA 2RGRA 4JSTA 2V4UA 4MS4A 3I5YA 3D6VA 4WX2B 1A7JA 2UZ1B 4JC5A 2QZPA 3HJCA 3JAKB 4PBRA 5LWQA 4RKFA 1LLQA 3TAUA 2B7CA 5T57A 1NSTA 2YN4A 1VL5A 2WZBA 3UWKA 1CE8A 4O29A 3SHVA 4ETMA 5CUQA 4CM1A 3W5VA 1GKYA 4KO1S 3TNLA 2ZUEA 3TD9A 1IOVA 1YS6A 1JN0A 1XVAA 4B3JA 4E5DA 2PK3A 2YCLA 3J80A 2QZSA 4G5HA 4KBGA 4OLHA 3WYFA 4UASA 5KC8A 3KPWA 3ZHZA 3A10A 1R10A 3VI4B 4B3SB 5JECA 1G21E 1V1MA 1W47A 1XRRA 1OIXA 1TMGE 3EHEA 4P38A 4QHSA 4JEIA 5IKMA 4FLFA 3A9WA 3O4IA 1KQNA 4WOPA 1IXYA 5L53A 3L8CA 1VPWA 4M2LA 3DYVA 4GMKA 2W5UA 4U9HS 2Q5CA 4CV3A 1XZPA 2BEKA 4ON9A 1MQAA 1P75A 2BFOA 1LX7A 3G1UA 1KEEB 1RM3A 1VSQA 2JJMA 2WHPA 2ZIVB 3CNOA 3IKLA 5HQ3B 1OLSB 1PR2A 4Z7JA 2WTXA 1ZIXA 2FWJA 3N0RA 4G0XA 1TF7A 3KDPA 3ZWDA 2HV9A 3R6DA 4JBHA 5EXTA 1E7YA 2IELA 1IY1A 3KQOA 3ZH2A 4BQEA 3VOSA 5J23A 1SGWA 2BE7A 1XMIA 1Y3FE 1PGJA 5I7VA 2PD3A 2TMDA 1A2BA 3BKXA 4ZU1X 4RZSA 1GSOA 1O9BA 2O2JA 3CN9A 1KJZA 3GFPA 1PX2A 3OOYA 1ZEJA 4J0KA 4RNDB 2H1LA 4LJRA 1G8AA 2TMYA 3D7KA 5HDBB 3AWIA 3T54A 3KV1A 1BE1A 2H59A 4PAOA 5GV7A 2H52A 4GXNA 3JD0A 4O3MA 2E89A 4HRVA 2CVHA 3KB1A 5A3RA 2C1XA 3ZJVA 1T29A 3PWKA 3OU2A 1OX4B 1Q83A 4U7TB 3NEYA 3JAMA 3DBVO 3PIIA 1NTRA 4PGMA 2ATEA 4RACA 5F12A 1RM5A 5FWDA 1FP4A 3S6JA 2WF9A 3UJPA 1U28C 5BQPA 1VE5A 1KL7A 5E7JA 5TQ2B 4XGNA 3FW1A 1N3BA 5KEIA 2Q45A 4C88A 3INGA 4LMAA 4YRAA 2FPPB 4CRWB 5BORA 3MJHA 4BB6A 1D9ZA 2ZTMA 3EAQA 3BIFA 4R2KA 4QUAA 1N9ZA 1UZMA 5T41A 4GXTA 4AZWA 2BBTA 1TMOA 4B5KA 3BXGA 3IR5A 4GFDA 3THYA 1N3YA 4P4TA 1P74A 2HTE