1D8AA

E. coli enoyl reductase/nad+/triclosan complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of triclosan activity.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
total genus 87
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1d8aA00
4CQMA 2DBVO 2GGSA 2X9VA 3CH6A 3DAFA 4CLEA 4NFYA 1L7DA 1KVRA 4H16A 3GGPA 2BI8A 4GSLA 3ZWVA 1FDUA 4BB5A 3AUTA 5KVQA 3FD8A 3E9QA 2HKIA 1YKFA 4E5KA 3AUSA 4Y8VA 2E48A 2POQX 3OA0A 5A9SA 4DMLA 3ROMA 2R6JA 2PV7A 1CEQA 2OXIA 5H81A 1EVYA 2I76A 2O4CA 3WMWA 1UR5A 4L73A 1Y81A 5IFLA 4BIIA 2C2XA 1ONOA 5DOZA 1YBMA 1Z82A 5TGDA 4TROA 3VVCA 1X13A 4DC0A 5F1OA 3RAJA 3KYCB 1ISGA 1H6AA 1PTJA 3GC6A 2UAGA 2OO5A 1YB4A 1SMKA 3PVZA 5JNLA 2PD6A 3BMOB 5COBA 4R16A 4CLDA 1DSSG 1HE2A 1V35A 3GFGA 4NNJA 3ZHBA 2DFVA 2IEBA 3P7MA 2G1UA 4RCVA 4K9DA 4BO8A 2AHRA 1HSOA 4BQRA 5L7WA 1D3AA 1SAYA 2HAEA 2D1YA 3H9GA 4HXYA 4R1SA 3SVTA 3WYEA 1WXDA 2YDYA 1HRDA 5DNAA 4PLWA 4QFDA 4A7PA 4GX0A 4BGUA 3VZSA 3WQSB 4EDFA 4U8GA 4NK4A 5IDWA 1LRKA 3WG9A 6ADHA 3K2BA 5MDHA 3JD1A 2YYYA 5ICMA 2NACA 2WWRA 4CQMD 3PHIA 4FIZA 3GN2A 2DVMA 4L4SA 1U4SA 2BFPA 4B7CA 1NR7A 4DL9A 2Y1DA 2FR8A 4MVJA 1AXEA 1VSUA 2FWMX 2X6TA 4U5QA 2AG8A 2AE1A 1IOLA 3W8DA 1Y5RA 3PJFA 3WTBA 3LK7A 3HNPA 3BMNA 2BGLA 3PWZA 2Z5LA 3ZZNA 2P5UA 2Z1MA 3GUYA 1E5QA 3H7AA 3JQAB 3C8MA 1P0FA 4NG5A 4GGPA 4JBIA 4Q39A 4FOSA 1OBFO 3NTOA 1OZAA 2E82A 3QVXA 3ASVA 4R1TA 1BRMA 1UXJA 2YUTA 3HN7A 1LJ8A 2PD3A 4I5DA 2ZATA 5LDGA 5FFFA 4KWHA 5DCYA 1D1SA 3ANLA 1PGNA 3G3EA 4FB5A 3GVPA 3OJEA 4GLOA 4PRKA 4GL4A 2JD2A 3NJ4A 1AUPA 2B5WA 2NTNA 3PK0A 3FR7A 4XB2A 5T5QA 3PLRA 2X0NA 4I9NA 2JJYA 3JQAA 3K9QO 4RPHA 1U2DA 2H5LA 3VVBA 3DR3A 1NBOA 2ZB8A 4GI2A 1BHSA 1SC6A 1LDMA 2FP4A 4OQZA 2DM6A 1KY5A 4BL5A 3MTGA 2VWHA 4YT2A 4J49A 1JLLA 2AEJA 2Q3EA 3E6AA 4IIUA 3AFMA 1S6YA 5AXDA 2OZPA 8ADHA 4EBFA 2VYVD 3HJAA 3ONEA 4DREA 3JYQA 4WLFA 3R3SA 1X7DA 3B1KA 2YY7A 3HDYA 4Z9YA 1DJQA 1RM5A 2UVDA 3FTPA 2PFGA 2WD7B 2ZJ1A 4ND3A 1DDOA 2JHGA 4AG3A 3JQBC 4AJPA 1H94A 2DUUA 1EBFA 2O3UA 5A3JA 2FRDA 3M1LA 4RLSA 4RVGA 3GMSA 4M86A 5HTOA 3RUFA 1JN0A 1QRRA 4OXNA 3BA1A 3RROA 1MC4A 1YB5A 3OFSA 1MGOA 3W6ZA 2Q2WA 3E1KA 4XWYA 1E3EA 5LDHA 1C0IA 1P1JA 1LDEA 2Z1NA 4F6LA 3VDRA 4OSPA 1P33A 4IGFA 5KJCA 1P31A 1NNUA 4MKRA 5CEJA 4QX6A 5KVSA 5L95A 3TL2A 3EVNA 2VQ3A 4GMGA 5I9MA 2Y68A 3Q2IA 4B8ZA 5COAA 2ZK7A 1B8UA 2C7GA 1YJQA 1UAGA 1T2AA 1KVTA 4DMMA 3GHYA 4WNIA 3RKUA 4B3HA 3PPIA 2NU9A 3ZWNA 1CERA 3G0OA 3H65A 4BNGA 1L1FA 4DXHA 5JYDA 1IZ0A 3G1UA 3JYPA 1DEHA 3Q9UA 4FS3A 4RF5A 5TJHA 1M6WA 1T2CA 3MJTA 4W7IA 1BTOA 5EESA 1DIBA 4IDBA 4PLGA 2IE0A 3MZ0A 1LI4A 4CR6A 3L0DA 4F6CA 3LT0A 4RVSA 3RQSA 3TF5A 1NASA 3ZU2A 3G17A 3WXBA 3FNEA 1XYGA 1EK6A 5IF3A 3GGGA 4LW8A 4DLLA 3ZV3A 1YQGA 3LC1O 3JQ6A 3H2SA 3HB5X 4GGOA 3NJ8A 3PRJA 3QV1A 1EVIA 4WGGA 5B1YA 2YHIB 4PN3A 2JL1A 1P44A 3PYLA 4RV9A 4JCOA 4YRBA 1AHIA 1IE3A 4J91A 3WQRA 1E3JA 1J5PA 2B0JA 2W8ZA 3BHIA 3ROPA 4EJMA 5CFZA 4R01A 3AK4A 1ZSNA 1SB9A 3V2UA 3WNQA 4BOYA 2W2LA 5I9LA 4J4TA 4CODB 4CLOB 4C7KA 3PI7A 4IINA 5EQDA 1B14A 1HTBA 2P4HX 3GY0A 1DB3A 2BI7A 2EV9A 3W4JA 4CM9A 1XHLA 3GOHA 2X22A 5L9AA 1DJNA 2G82A 1YDWA 4XQ9A 3FPLA 1EDZA 1U2GA 3EHEA 4XRRA 1FDVA 4DWVA 3GZNA 3OEWA 1C0KA 4L4RA 1CDOA 3DBRB 3JD4A 3AW9A 1U28A 3QVTA 2B4TO 2Q1WA 4UVEA 1QYWA 5KJEA 3IL2A 5DCWA 4WOKA 3TSCA 4K26A 4J0FA 1PS0A 4CMGA 3S1LA 3KTDA 1NFFA 1UP6A 2B37A 3AI1A 3QWIA 5IZCC 1ZFNA 3Q0EA 4NU6A 2HK9A 3B6ZA 4I8XA 3ANNA 2J3HA 3F4LA 3GT0A 2D59A 3TOXA 3WYBA 3C3XA 4MDHA 1H6CA 4BNFA 3FTNA 1ISFA 1ZEJA 1IPEA 1XU9A 4J1NA 1QYDA 3LF2A 3KVOA 4LMRA 1A4IA 1EUDA 5KKAA 4ALJA 3KYDB 3PHJA 3MJEA 3VPHA 4CQLA 2J5QA 4IDEA 4IIVA 4CM1A 2GNAA 1K5HA 2AEFA 1LRJA 2J5RA 2F00A 1J6UA 2BELA 5IJZA 2ZYAA 4MVJG 4Z9FA 1ZMOA 3MEQA 4E2YA 2WE8A 5THKA 1UZMA 3WWZA 1JA9A 4YAJA 1E92A 2VNSA 2XOXA 5JY1A 4E33A 3B1FA 3PLNA 5LC1A 3AWDA 3IOYA 3D5TA 3H9JA 1BDMA 2JCVA 3C24A 1R4NA 2DBQA 4UUOA 2Y67A 2GYYA 3RJ5A 4FGSA 3RIHA 4YCAA 2BKAA 4DRYA 4Y67A 4WECA 3OQBA 3NKLA 3ULKA 4ESOA 5GZ6A 2D5CA 4GX1A 1GYRA 1HXHA 3RASA 4UUPA 1CQJA 1HDOA 2QZZA 2XAAA 1JWBB 2Y99A 4PZEA 1VL0A 3QY9A 4AJ2A 3UXYA 5H82A 2JFGA 3UCEA 2C54A 2GRAA 3H3JA 3MJCA 1ZSYA 1C1DA 1K0UA 2X7HA 2YW9A 4DQVA 2AXQA 4DPLA 4URFA 3U4HA 1KVSA 3LLVA 1A72A 1H5QA 1HEUA 2R2GA 3I52A 3R6DA 5G0UA 5JLAA 3LSYA 4BS9A 2B69A 3HHPA 5ER6A 3DQPA 4TRJA 4CMEA 1YL5A 1F17A 2W2LD 4GH5A 3UFXA 1GZ3A 3BTSA 3EGOA 4BNZA 3PQDA 1PZGA 1V3TA 1W8DA 4CM6A 3OQ6A 4J7CA 4YT4A 1R15A 4E12A 3ZI0A 1U4OA 3OIFA 1NPTO 2PR2A 4UVGA 1B3BA 1T4BA 5BNFA 4A2CA 4KTVE 1YONA 4BHTA 1BXGB 4C4OA 1NHGA 3D3WB 4WLNA 3O4RA 4Y9DA 1R12A 3RUHA 1XDWA 5MGBA 2Q49A 3OIDA 4GBJA 2OP0A 2YQ4A 1Y9EA 1P1KA 4CMIA 1F0YA 4R68A 1YOVA 3PTZA 3QVSA 1UDCA 1SNYA 3ZWAA 4QO7A 4R3WA 5TF4A 1SPXA 2NU6A 1R16A 3FF4A 5DP1A 4BVAA 3WFIA 1Y8QB 1QV6A 1E7SA 3MOGA 2PKRA 3PYMA 4BB6A 1T1SA 1MFPA 1D4FA 5FI3A 3EW7A 1N9GA 2X0JA 2X58A 4UAGA 1Q7BA 4PLZA 1PZFA 1O5IA 2VOEA 2I3AA 3RVDA 3M1AA 1DAPA 1NTOA 2ZTLA 3L6OO 2O2YA 1NQ5A 3PYXA 2QYSA 3D5QA 3JQFC 1YBAA 3WSWA 1DFHA 3MTJA 4IXTA 4XGKA 1VC2A 4L75A 2HRZA 4CV0A 3TWOA 3RU7A 1EDOA 1O89A 5L7YA 4ZICA 2VZ0A 5EPOA 3DBLA 3O8QB 1GEGA 2C2YA 2W98A 3N74A 4XYEA 5JPIA 1I32A 1X1TA 3WGYA 3DOJA 5TT0A 1E77A 2Q2QA 4BQPA 1BXZA 5IDXA 2A94A 5HBRA 3I5MA 4MPDA 3EDMA 4CM7A 3RUAA 3LT1A 3L07A 1Y8RA 5G0VA 2NV6A 5HRUA 5DP2A 1ZIDA 4PLPA 4U6QA 4RDIA 3ZU4A 3RBZA 4S3MA 2CSUA 2PZLA 3PHLA 3BHMA 5JS6A 2NQTA 2BGKA 4DIBA 2AW5A 2A92A 1XU7A 4XA8A 1LXCA 2IXAA 1U3WA 1W0CA 4GLLA 1UUFA 3DBLB 3ZWMA 2FMUA 3ZW8A 4O1MA 1JU9A 3COSA 3VOSA 2PZMA 4L74A 4OQYA 1ID1A 2B35A 2OOSA 3KB6A 4OH1A 4P4NA 1LDBA 1V3UA 5U1PA 3I9LA 3EK2A 4FQ8A 3ZWXA 3IIEA 2EGGA 3TZQA 2PZJA 4R5HA 1EZ4A 1J49A 3IC5A 3DC2A 1BG6A 1VJ1A 4XKJA 1RYEA 4YYZA 1OFGA 2NNLD 1O9BA 1C14A 1LDYA 3JSAA 3MJSA 1WMBA 1SOVA 4BO7A 1E7RA 2FHSA 3NEPX 1WDMA 1DIAA 1E6EA 4HX5A 1ZJYA 5JAZA 3A06A 3L9WA 1E7WA 1R37A 2IXBA 3JQGA 4NFSA 3TZCA 1DIRA 3I9JA 4GKVA 4XQEA 3UCXA 3PIDA 2B83A 3FNGA 4E5YA 4RDHA 2P5YA 4EZBA 2YFQA 1YOVB 1QMGA 1U1IA 1NFRA 4WNCA 3TDKA 2TMGA 3EY4A 4RVHA 3EUWA 4X54A 4AJIA 1PQWA 4N18A 3NDRA 3PJEA 3ZNQA 4BGVA 3JTMA 4PG6A 4CL3A 1VSVA 4TRNA 1TI7A 3IUPA 1HKUA 1GD1O 3IS3A 2YV2A 1XKQA 3WIDA 1P74A 3OSUA 3DTYA 2P9CA 1SZJG 3G79A 4E5PA 1PX0A 1P3DA 5CEEA 5IZ4A 3EAGA 3NAQA 4ZU3A 3TNLA 2DTEA 4ROSA 2EP5A 1EQ2A 1OOEA 4KUHA 5A3VA 1ISIA 1DLJA 2WYUA 4I5GA 2P4QA 2AQ8A 2XPCA 7MDHA 3OP4A 3GEMA 5KOIA 3A28A 4A26A 2OFPA 1N8KA 2NLOA 1DXYA 1SOWA 5CPBA 5DZSA 4F3YA 1QP8A 1MXHA 3I3OA 4ITUA 4H7PA 4XYBA 3TRIA 3VTZA 2EHDA 3GEDA 1GAEO 3GNQA 5AXCA 5L4NA 2RIRA 2O3RA 5F5LA 4ZQEA 4L76A 4J43A 4E2XA 1HYEA 1FJHA 2WTBA 5I8ZA 3F1KA 2I66A 2NWQA 1U5AA 1K2WA 3D4PA 3K5PA 2NADA 5EQFA 1SEVA 3WJAA 2Q46A 4CM8B 2DKNA 4D41A 2CY0A 3C7CB 3FR8A 3D4NA 4E3ZA 4UREA 1HLDA 1ZSVA 1I36A 5EL0A 3NGXA 5A04A 4GWKA 5IN4A 5JMPA 2DU8A 1Y9AA 1ZVMA 2HUNA 4LVCA 4IQGA 1X14A 3I9MA 1U9JA 3PP8A 2CVOA 4I08A 4YJFB 3DAPA 3V5NA 1GZ4A 1KBZA 2Y1CA 3AU8A 2D4AA 3GDGA 3R1IA 5BT9A 3U4CA 1KETA 4DPMA 2IRWA 5IG2A 3PGXA 3G49A 4L9RA 1UDAA 1NWHA 3NV9A 3AOEA 4BNYA 1UP7A 4MINA 1ISMA 3H3FA 1UXKA 1J4AA 1GQ2A 2ET6A 2IODA 2C07A 4HUJA 4RGBA 4BNKA 1GCUA 3HWRA 4CM4A 2DTDA 4G65A 3GVCA 2J3KA 4QFCA 1D7OA 3EVTA 1R66A 2V6GA 4PCVA 4E4YA 1P1FA 5K0ZA 3JV7A 4RF4A 1PL6A 5GZ1A 3SLKA 4HWKA 2YHIA 1DO8A 1H6BA 1I24A 3DZIA 1HDGO 2DUWA 2C5AA 3RC7A 1O0SA 3CUKA 3AM3A 2PTGA 5G4KA 4AL4A 4TRMA 2A35A 4W4TA 2GPTA 1PJTA 5DT9A 1IHXA 3T4XA 4BO4A 1U3UA 4GPD1 5JAMA 5C3MA 1MP0A 3D64A 2OP1A 3D1LA 3ZHZA 1T4DA 3LZ6A 2I3GA 1KEWA 3OM9A 3C7DB 3QRWA 4XB1A 3PDJA 5K9ZA 3LYLA 3H5NA 2ILTA 1V6AA 2EEZA 3KSUA 3OA2A 4Z9XA 4IDGA 3QWBA 3AI2A 3DB2A 1HE3A 4D42A 1UP4A 3PXXA 3NYWA 3RC1A 2HMUA 1PS8A 4D3FA 2Z95A 1IY8A 3WQQA 1NP3A 1H93A 4I1IA 3RJ9A 3CMMA 2ZB4A 3OETA 4XCVA 1IPFA 4Y6RA 3VHRA 4FC7A 2J8ZA 4LISA 2X86A 5CDYA 1LEHA 1CQIA 3CSDA 3K96A 4RVFA 3LC7O 1UZNA 3N7UA 5DBGA 3ANMA 4LRSB 4RPGA 1VM6A 4Q3BA 4NK5A 3E9MA 2VYND 3QVOA 3HDHA 3O38A 4A0SA 4TRRA 2Q1TA 1PEDA 1WNTA 4YJDA 3ZV6A 1QSGA 3K73O 4BKUA 1BMDA 2Y66A 1PWZA 1X1EA 5TJ9A 3H2ZA 4WLVA 4QEDA 3F47A 4J1SA 5TRTA 5LCXA 1BVUA 3NDJA 1I3KA 3S8MA 3I4FA 4CM3A 4XGNA 5CPFA 1JWAB 4DYVA 4D46A 4ZN6A 4E6PA 3TZ6A 5G0SA 4CMBA 4CM8A 3ABIA 4GVXA 3DMTA 3CZRA 2G0TA 5A03A 3TFQA 1A7AA 2B4QA 4J9UE 4EYEA 4JBHA 4BO0A 4B7UA 1GDHA 3ADPA 1PGJA 2CFCA 3MJ4A 4DQUA 1NAIA 1A7KA 1GQYA 3D4OA 2JCYA 4J1TA 1ZW1A 4OKIA 1LBEA 4O63O 4FFNA 4XX0A 3TL3A 3VPSA 1EUCA 5EERA 3IP3A 5A06A 2JHFA 1R0SA 2G17A 4UVHA 3MWEB 3ZN2A 4K6FA 5A05A 4XYGA 5B4VA 4G81A 1AN9A 2Y93A 2JFFA 3RBVA 1F8FA 3TZKA 3LF1A 4P4LA 4U7WA 1KC3A 5CEFA 2E4AA 1I2BA 1GFSA 5L3ZA 2V6MA 1GZ6A 4IZHA 4J7UA 4P22A 1QYXA 1A9YA 2HMSA 1R6DA 4MVJH 3C1AA 1P1RA 4IMPA 5IXSA 4D79A 3NT5A 3CPSA 3P2YA 4PIVA 2VHZA 4IQ8A 1DC5A 3LQFA 1GV1A 1YQXA 4YT8A 4KQWA 3DAGA 1EMDA 4HNGA 5JAIA 3ZWWA 1T2FA 2VRBA 3AOEC 2GCGA 5G0WA 4CUZA 2C0CA 4W82A 1XLTA 1M76A 2HRBA 1XWFA 2DPGA 1R0KA 3F4BA 1UXIA 4ALLA 4UVIA 2JD0A 3ZHXA 1XQ6A 1IHYA 2OHXA 1HDZA 1VL8A 3JQ7A 1LDNA 4JBGA 4E5NA 5BNIA 4DBZA 4KWIA 2FPGA 1B16A 2HQ1A 4N7RA 4A5OA 2FY8A 1DRWA 1G0NA 2BGMA 4IUYA 4IXWA 4NBRA 5IXYA 4KUGA 1OAAA 1YE3A 4UUMA 3IUSA 1PQPA 3OICA 4TMFA 1Q7GA 1HL3A 1MB4A 1UXHA 1O6ZA 1XR3A 4OL9A 3KSZO 4XD2A 4ND5A 4NI5A 5GMOA 4DYDA 4WASA 5CAEA 4NJOA 2X5KO 1PJSA 2EXXA 4BKOA 1R4NB 2FSSA 3OEYA 4BMNA 2W2KA 1P77A 4OOEA 1LQUA 3GUCA 2C5EA 5JE8A 1W73A 1CETA 3GNSA 3F6YA 4WK6A 5B4TA 4AVYA 1E1LA 1I30A 1XSEA 2FR0A 1G0OA 3I9KA 4UEJA 4PLTA 2BMAA 2HLPA 5U4QA 4ZRNA 4CMKA 5I7EA 2DBRA 1YWGO 5ICSA 5AVOA 3OHSX 1LQTA 4A03A 3ZDFA 4QO8A 2AEMA 1PJ3A 1EE9A 2LDXA 2GLXA 5TLSA 1GR0A 4RF2A 3WLFA 2ZTVA 4J2HA 5B4UA 3DXFA 1RJWA 4YRDA 1OMOA 2C29D 2NUAA 4WPGA 5KJFA 1WDLA 4YBZA 3KYDA 3UUWA 4YT5A 1ULSA 3U3XA 5A4DA 1N7HA 2QHXA 2H63A 5DN9A 3I6IA 3QHAA 5IDYA 4YB8A 1T1RA 2ZQYA 2O7SA 2FR1A 3O03A 4NIMA 4CLHA 4PRLA 2DFDA 4N54A 1QV7A 3I6QA 1GADO 4E0BA 5KJ6A 2R00C 3WNVA 5JAQA 3RWBA 1BGVA 4IPTA 3U0BA 5T6BA 4BO2A 5IZCA 2IYOA 2AQHA 1M6HA 4GMFA 4H15A 3WSVA 4BGIA 2AQIA 4R4JA 1C1XA 3LC2O 4FDAA 2WSBA 4NU5A 1ORRA 4NBUA 2B5VA 2WM3A 3NUGA 3L4BC 3PQFA 3WTCA 3HZZA 5C7LO 4XR4A 1LSUA 1RYDA 3KEQA 2H9IA 2VWPA 2PKQO 1CJCA 4NBVA 3W8FA 5A02A 1ZJZA 2I6TA 1D1TA 3GH3A 3TQHA 3X2FA 3FNHA 1Y8QA 1R4MB 4N5NA 2X23A 5JCXA 4JX8A 1MXFA 2DPHA 4R5MA 3JQGB 4OSOA 4CM9D 4BNHA 3PWKA 1E7MA 4AJNA 3JQ8B 2FPPA 4ID9A 1I01A 1MC5A 2EWMA 1YL6A 3DFUA 3B20A 1WAMA 2YDXA 7ADHA 5F5NA 1HZZA 1SB8A 2ZB7A 5ENVA 4MVJP 1LU9A 2NVUB 4NHEA 4TQGA 8LDHA 3ZWYA 5CDSA 4YJGB 5L51A 4DPKA 4XDZA 4P38A 3U49A 3V1TC 4CMAA 1A9ZA 1ZXLA 3KHUA 2GUGA 4MVJF 3UH1A 4YQZA 1I3MA 4Q3AA 4GSKA 3VDQA 3U09A 2OBYA 1PU2A 3D3WA 4CV1A 5JXWA 2V7PA 4OM8A 3WDSA 4I9UA 1TA4A 1LDGA 3QVWA 1XA0A 2C20A 1HYHA 2GR9A 2Y05A 4IDAA 1TT5A 2XXJA 3DBVO 4R51A 2IEDA 4L0QA 1EE2A 4Z3KA 3JYLA 2H6EA 2I67A 2QRKA 4TKMA 4TZTA 3ZCXA 3VPGA 3I23A 3I4CA 4U0KA 2PWZA 3HSKA 5DULA 3STHA 3D0OA 1BDBA 2OORA 3I9NA 3HADA 4B7XA 4LK3A 3QE3A 4XEHA 4TZKA 1TB4A 1G6KA 3GAFA 3D7LA 5JDCC 5B12A 2B36A 3FN4A 3HG7A 2CZCA 1O95A 2LDBA 3FBGA 5ADHA 1TT5B 1SCUA 2QIOA 4IM7A 1UH5A 4MIYA 4ZQGA 5HA5A 3V2HA 3ZU3A 3PJDA 4J3FA 2UYYA 1U8FO 2YJZA 4NMHA 3DZGA 5DOVA 2GZ1A 3GGOA 4WLOA 3H9EO 3E03A 3WB9A 5CHEA 1YO6A 4EITA 1Y5MA 1PJCA 4PFJA 1EVJA 1B3RA 1VKNA 4D0RA 5A9SB 2CVZA 1EFLA 2C82A 4YA6A 4BNJA 3QIVA 4BV9A 4BGEA 3OQ1A 4DLAA 4EGFA 4QQRA 3IP1A 4R1UA 1DRUA 3ZGYA 1PJLA 1DAOA 1JAXA 4ZQHA 2EW8A 3DOOA 4DTIA 3PFWO 4M1QA 5C7OO 3N58A 3BXXA 3AY6A 4CLRA 4IBOA 3KYCA 4PG4A 3QWFA 1NVMB 3EYWA 3GNTA 3SBOA 5JCJA 3RFXA 3GK3A 3WICA 2V6BA 4BO9A 3OJFA 2J3JA 5TX7A 1I33A 3CXRA 1QG6A 2D2IA 3INRA 1E6UA 5C5IA 1B26A 3VH1A 2ZYGA 5ILGA 2GN6A 5I7FA 2QZ9A 4OYRA 1PL7A 5C37A 1ZKMA 4R1NA 3HQ4O 1H2HA 4PLCA 2RH4A 3UN1A 4EI2A 3INTA 4CLRB 2BFMA 1C3VA 5T57A 3WFJA 5DBFA 2O48X 2DT5A 3WWYA 3KSDO 1A4UA 5FWNA 5THQA 3V8BA 3OJOA 2Q1UA 4YEDA 1B8VA 4AJEA 4RPLA 4ZD6A 2QRLA 1UDBA 3MCVA 3BMNB 2ZTMA 1Q0QA 1DBVO 1LUAA 1PL8A 4KZPA 4CJXA 4QUKA 3W6UA 4PVCA 1PJBA 4WUVA 1GUFA 1WZEA 4PZDA 4RVUA 4ONEA 3MWDB 3CKYA 1IYZA 4JN6B 1ADBA 3B1JA 3EZYA 1WLYA 4HV4A 4D43A 1CWUA 3GHHA 3ZHYA 1JQBA 5GZ3A 1LSJA 3E5RA 3GMDA 3C7AA 3GRKA 4QECA 4YJFA 1X0VA 3ZWOA 4XRGA 1GU7A 2ZB3A 1XGKA 1BW9A 1C0LA 3DZBA 3GQVA 3GVIA 1PIWA 2NQ8A 1HETA 1B7GO 1QXSA 4M49A 1ENYA 4NH4A 4EUEA 1IB6A 2EG9A 3QWHA 1HZJA 3QSGA 4FBGA 4EUHA 1SBYA 1ENPA 3DDNA 3DMYA 1MA0A 2X9GA 1HDXA 1XCBA 1PJQA 1DOHA 2ZYDA 4CR7A 5G4KB 2CD9A 2HMTA 4WLEA 4B4VA 3RFVA 1HE4A 1XG5A 2D0IA 3K31A 4YAGA 1U8XX 4IJKA 3DOCA 1PZHA 4XIJA 4C7JA 3JD3A 1H0KA 2J6IA 3JQEA 1WZIA 3WJ7A 5H83A 1ZUD1 2P2SA 1CRWG 2X0RA 3VAZA 2WDZA 3PJGA 1RKXA 4I9HA 2JCXA 2O3TA 1E1MA 4GKBA 4YDRA 1ADCA 1VLLA 3BZUA 4QTZA 4AJOA 3WIEA 4K28A 4D3DA 2BH9A 4HADA 5CG1A 5K6AC 4NJMB 1WWKA 4TVOA 3VPXA 4FOOA 1X15A 3IKVA 4ZA2A 4ND1A 1ONNA 5L53A 1WDKA 1QYCA 3VC7A 3VPFA 3ENKA 3DZJA 1DC6A 4XJTA 4RPKA 3DZFA 1DHTA 3KOUA 3C1TA 3BMQB 2ZQZA 2PLAA 1B2LA 1V9LA 4M54A 3SC4A 1V3VA 1O94A 3VH2A 3WLEA 4WLUA 3AUAA 4DA9A 5KVCA 4O0LA 1Q0HA 1Q1NA 1NPYA 4DIOA 4ALMA 2X1HA 3GDFA 1X0XA 3KV3O 4ALKA 1K6JA 4CV3A 4R69A 2JD1A 4CR8A 1LLUA 2GD1O 3PGJA 4HFJA 1Z7BA 1NX6A 3FHLA 4IJWA 2UUOA 5DF1A 2QYTA 4RZHA 2V65A 4ZVVA 2HMWA 5I7VA 3AU9A 4ZRMA 4J4BA 4GAEA 4MKXA 4FFRA 3OJLA 2PNFA 5T8KA 1B8PA 2EERA 3HDQA 2BRUA 4FR5A 5EMHA 3WBBA 1Q7CA 4OO3A 2IZ1A 5A9RA 4DIFA 5A5FA 1FDTA 2I99A 1RWBA 4R41A 4UEKA 4YWJA 2VUTA 2VTEA 1DC4A 1FMCA 4BKRA 1ZK0A 3QA9A 5G4LA 3KUXA 4BKPA 1TT7A 1G1AA 5JMWA 2AG5A 3L4BA 3WGGA 2QQ5A 2E37A 2WJPA 1QKIA 2BFOA 1W6UA 2QX7A 3U9LA 1NFQA 1LRLA 3GDOA 4FFPA 5CDGA 1XELA 3U5TA 1PQUA 1Z75A 5ER9A 3IJPA 2AMFA 5K6AA 3K2EA 3HE3A 2Q4BA 1MG5A 1RM4A 2R00A 3BIOA 3CTMA 1VRWA 2O4UX 3SLGA 3TZHA 1LC3A 4YQYA 4FFMA 4XR9A 1EUZA 1I2ZA 1EK5A 5AXAA 2QG4A 1EVZA 3JQBA 3L77A 4U0JA 4UUNA 1E3LA 2VHVA 1PGQA 3ADOA 4FJ1A 5JDIC 4AJJA 1HDRA 3WS7A 4FCCA 4F45A 3LVFO 1ZK4A 1ZCJA 5KVVA 5JO9A 2OUIA 1LX6A 4CUJA 3DBRA 3RKRA 1QLJA 2C7VA 4DQXA 3RD5A 2O23A 1KEPA 1GPJA 3INGA 2PY6A 1WVGA 3ZNNA 1U5CA 1GL3A 1LC0A 3VTFA 1FDWA 5ITWA 1X7HA 2PGLA 2I9PA 2VRCD 1LLQA 4MJLA 1NVGA 5TSDA 3H9UA 1ZK1A 1M75A 3D3EA 4II2A 3CMCO 5JO0A 3DWFA 5T8KC 1C1DB 4CMCA 2CF6A 3GEGA 2OMEA 1E5LA 2PH5A 1ULUA 1HDCA 2YFHA 5C7IO 2IYPA 1I5RA 3B70A 3Q9NA 3QLJA 4PG5A 3GPIA 1I2CA 4U6SA 4GQAA 3WGZA 4IDFA 3M2TA 4NQZA 1U3VA 2X4GA 4W9NC 1TEHA 3FWZA 3KO8A 5KJ1A 2Y0CA 2JAPA 2HDHA 1X7GA 1YGYA 4M55A 2UDPA 3EMKA 3HUDA 4O5OA 4E13A 4XYLA 1B15A 3RSHA 3DHYA 3T4EA 3H4VA 4TSKA 1EFKA 4XJSA 4Q9NA 4GX5A 3H5RA 3BAZA 4N5LA 1ZNQO 3IJRA 4ALIA 4LRTB 1FXSA 4LSMA 3WYCA 4BO6A 1CF2O 1ZZEA 3Q6IA 1GTMA 6LDHA 4PVDA 5G0TA 2A4KA 1YH3A 1NQTA 4F46A 4Z6KA 4L4XA 3WMXA 2V6FA 3CEAA 4LN1A 1VL6A 1E3IA 3ITDA 4NBTA 5AYVA 4PLYA 4CLOA 1NPDA 3BMCB 3DONA 2HMVA 3F1LA 3I1JA 3Q2KA 3ZW9A 4AJLA 3ETGA 2VCYA 1H9BA 3A1NA 1Z74A 1KVUA 1PS9A 2VRCA 1NWCA 4EUFA 4Q3DA 4Z0TA 1JVBA 3UOGA 3SJUA 1I0ZA 2XXBA 3VKVA 4PGFA 3BTUA 2CDBA 2BLLA 3I9OA 1KIFA 2X8LA 3C85A 1ENOA 4UVDA 5DBIA 2YHUA 2D5AA 3CZMA 3WGOA 1JTVA 4NPCA 3VZPA 3O26A 4MP3A 4NZ9A 3V2GA 4GVLA 3ZNOA 2X0IA 3SC6A 5IN5A 1C1XB 1LNQA 1WMAA 3PDUA 4MVJI 4HY3A 4Z3DA 5JBIA 2Y1EA 3KLPX 1F12A 3OH8A 4EEXA 4AJHA 5CG2A 4LVUA 3DFZA 4IQ0A 4E2ZA 3JD0A 5JFOA 1CYDA 3OIGA 4OGWA 3Q11A 4JJGA 4WCFB 2EW2A 3UAGA 2B4RO 2TMDA 2HO5A 1GUYA 1XIVA 3GF4A 3LDHA 1MFZA 3UF0A 1UXGA 3FSRA 4BMVA 2WEKA 3L9XA 1KEVA 4JK3A 4W7HA 5DCUA 3SEFA 2VHWA 4PZCA 1F06A 1NHWA 4HP8A 1ZO8A 3CINA 4CMEC 1A27A 2EJWA 4FC6A 4N5MA 1YBVA 1BXGA 1Y1PA 4RORA 4CPDA 2HJRA 5CP8A 4XQGA 3UKOA 2HK8A 4ZQFA 3OBBA 4UULA 2EJVA 2FPIA 1PGPA 2PH3A 4OXYA 2OBNA 5T67A 3AOGA 2X5OA 3NT4A 5BNTA 4PLFA 2VWGA 1I8TA 3AM4A 3FI9A 1GCOA 1Y8RB 2VZ9A 1O8CA 3LT2A 2UV8A 4OXKA 4K1LA 3QQPA 1P45A 2JKVA 2WYWA 2ZKLA 1M67A 5KCZA 5JC8A 2Q2VA 2PGJA 4YJGA 2PA3A 1KVQA 1DC3A 3HDJA 1P1IA 5EN4A 4IJUA 3H5AA 4FGWA 4M87A 4YJHA 4B4WA 4J4HA 3WGHA 3TFOA 3KZVA 1A71A 4MOWA 3ON5A 4BNXA 3JD2A 4BUCA 4EEZA 3JQ8A 4RQUA 4CMHA 5AOVA 3P19A 5KNLA 2C59A 3PEFA 4R3NA 3WBFA 2Y0DA 3JYNA 2PKQP 3BTVA 1RPNA 2CNBA 3IQDB 4BNMA 2JFHA 1GQQA 2YV1A 4AFNA 3OJ0A 1P9LA 3LT4A 1DLIA 3UICA 3FRJA 1DPGA 4MVJD 4Y98A 3GPDG 2YZ7A 1KYQA 3PZBA 2O7QA 2VHYA 1VI2A 3F9IA 3SX2A 4YR9A 3UW3A 5HWSA 3A4VA 1UJMA 5JY6A 3JQ9C 1PR3A 2J5KA 1MV8A 1PZEA 3WGQA 1VE9A 2RCYA 4W99A 4EJ6A 5CDTA 5I9NA 1VPDA 3DZHA 3H8VA 3OF2A 4OIMA 4MVJE 1ADGA 1DIHA 3HFGA 4FN4A 4II3A 2Q45A 1Y6JA 2QW8A 4J0EA 5JW6A 3ZWBA 2CDCA 4KQXA 1OC4A 4ALNA 1MG0A 2NVBA 3GA0A 3W1VA 4OAQA 4DVJA 4A27A 2OGUA 1XQ1A 4WCDA 3V1YA 2W4QA 3BMOA 2VN8A 2Q4EA 4YPOA 4PG7A 3RUCA 4Y6PA 1NM5A 1EQUA 1QLHA 1YS4A 4KTTE 1P1HA 2E49A 4W6ZA 5F21A 4D7AA 2RAFA 4GWGA 4J9VA 3DBHB 1ZXBA 3W8EA 4IS2A 1PR9A 4CUKA 4ZHSA 5L45A 3GG2A 2VZ8A 3MJVA 1PWXA 2VHXA 1T2DA 2NVWA 5I8WA 4LSWA 5JDCA 4MIEA 3AUUA 3WR5A 3AM5A 1MLDA 1T2EA 3JCZA 2GDZA 2NVUA 3ASUA 2O2SA 1ML3A 3PIIA 1R0LA 4XQCA 5KKCA 5L7TA 4CLXA 3ZV5A 3SJ7A 3L6DA 3TPCA 3ONFA 2DC1A 1N7GA 1B0AA 3E48A 3KRTA 4IZIA 1I3NA 1BW9B 4JQCA 5FYDA 2H1SA 3P5SA 4J7XA 4KMSA 3UCFA 5ES3A 1TLTA 5JCJD 3OMLA 1C0PA 4JGBA 4JXKA 2NTVA 3AFNA 5A9TA 4RZIA 1BWSA 3DBHA 2WD7A 2FOIA 3RC2A 1K6IA 4KP7A 2PZKA 4TKLA 1KC1A 2XF8A 4JJIA 2BFAA 4FW8A 4FJ2A 2Q99A 4ZJUA 1QR6A 3Q3CA 2SCUA 3NGLA 1NVTA 5TNXA 4BO5A 4I5FA 1KOLA 1GEEA 4Z0HO 4LCEA 1D8AA 1F8GA 2HCTA 3SXPA 4BNIA 4E5MA 1WW8A 1E1NA 2EKQA 2EGHA 3O8QA 4RO0A 2JAHA 4NR0A 4J2OA 4ZQBA 2VUUA 4BNWA 5AXBA 3RCBA 1NAHA 3HB4X 1WP4A 3ROKA 4E31A 4NJMA 3S2GA 4KDFA 1J0XO 4UEOA 2DTXA 3DL2A 3RUDA 1ADFA 3KM0A 5B37A 1QORA 5BSFA 1XEAA 2BF7A 4IDCA 4Q3EA 1PSDA 2VT2A 3HFSA 1KS9A 3TOZA 3DHEA 1E0DA 3RFTA 4YRAA 3BMQA 4RL6A 3F5SA 1DIGA 1WPQA 3E8XA 4DC1A 3E5MA 4JROA 3K30A 4NFHA 4R9SA 4XIYA 3ZWPA 1TXGA 4HNHA 1T26A 3RUEA 3GFBA 3PFFA 5A1TA 4IMRA 2VOJA 3PQEA 2CMDA 3F3SA 1S7CA 9LDTA 5BR7A 4WOJA 1N92A 4LGVA 4W9NA 4PLVA 1N1EA 5BSGA 2G76A 2RHCA 4HFMA 5KIAA 4JNKA 3A14A 3GVHA 4R9RA 3GRPA 1RM0A 1LLDA 4NBWA 4IS3A 1UZLA 4BNTA 2GN8A 4D3SA 1AGNA 1EBUA 2NTJA 1N2SA 5HM8A 1GPDG 2HJSA 5JYEA 4HFRA 1VJ0A 1ONPA 5F3RA 1W4ZA 3T7EA 3VZRA 1T24A 1E3WB 2EKPA 3KBOA 1N1GA 1YXMA 1VKOA 3QW2A 3S2IA 1FK8A 1JW9B 5FI5A 1HSZA 1ZK3A 2VT3A 3IMFA 4FD3A 4K6CA 2G5CA 1YVEI 3JYOA 4KUEA 4WJZA 2HK7A 4PG8A 4ZGWA 4WEQA 1Y7TA 4O59O 4RPJA 3BTOA 3PHHA 1F14A 1PJ4A 1E7YA 4QT0A 4BNNA 5JDIA 1Z45A 1M66A 1GY8A 3ROQA 3AJRA 3KETA 3BHJA 1JDJA 3DTTA 3A9WA 4YAKA 2GN9A 1ARZA 2I65A 4OJNA 1DHRA 1BSVA 3RBXA 4FSHA 1ISHA 3F5QA 3GVXA 4S1VA 4M8SA 1PJ2A 3KXDA 4IDDA 3VZQA 4DUPA 2FSVA 1IL0A 1M2WA 4ND2A 2CF5A 2D3TA 3GG9A 3TJRA 3UGKA 3UVEA 3S2EA 1GV0A 3DO5A 3ETDA 4DBVO 5TIIA 3VH3A 4FJ0A 3CIFA 2O50A 3RU9A 5COQA 1K3TA 2P68A 1BXKA 1BVRA 2A9FA 4DLBA 2Y1OA 5CDUA 3FPCA 5J23A 1AXGA 4JJFA 3JQFA 2RHRA 4B8WA 1H2BA 4GX2A 4O6VA 4J6FA 4MO2A 5EJ2A 4CM5A 4YVFA 1ZBQA 4H3VA 1JAYA 1QYVA 4AICA 1K89A 2DBZA 2P9EA 3ZU5A 2EF1A 5IAAA 5BSEA 2X9NA 4FPXA 4JIGA 3V1UA 4FFLA 3AY3A 1HT0A 1YB1A 1NQAO 4RLHA 1V8BA 1TVEA 3KLMX 1GYQA 2GF2A 1LSSA 5ENDA 1VJTA 2PD4A 2AE2A 2WYVA 4AJKA 3ENNA 3ST7A 4XGIA 4BO1A 1KERA 2OL4A 1MX3A 3ITKA 4CV2A 5BSHA 4MP6A 3GN1A 4I5EA 3JQCA 3TN7A 4HFNA 4CM4B 3HN2A 4OKNA 4B4OA 4D45A 3ZV4A 1FDSA 4CMJA 3ORFA 1HLPA 1I3LA 4YTEA 2GSDA 4A73A 3GZNB 4BKQA 4E21A 3ZWCA 2PGDA 4E32A 4WKGA 2IDZA 3QJ5A 3WOHA 1ISJA 1DRVA 3FWNA 5T64A 3WGIA 3M2PA 1U7HA 1HE5A 2VYVA 4ILKA 2O3JA 4A10A 1E3WA 1SEPA 3DEYX 1YQDA 4KOAA 4BNLA 1NXQA 3H9QA 2CDAA 5I7SA 4BO3A 5EINA 3AI3A 2GN4A 3L4SO 1E3SA 3KYBA 1U7TA 4QSMA 1JKJA 4XDYA 3E9NA 4PLHA 2NU7A 1E1KA 2WMDA 3IDSA 1A5ZA 4B4UA 1LA2A 3QWAA 4R54A 4J16A 4HBGA 3S2FA 3NT2A 4EJ0A 1H9AA 1GUZA 1Z7EA 2W2KB 3VH4A 1YRLA 3RC9A 2FZWA 2D8AA 2FZEA 3X2EA 4E2WA 1CIVA 2EP7A 2GERA 3DMTC 5GY7A 1H6DA 4ND4A 5TT1A 3ONDA 3U62A 4INAA 3IKTA 2ZIZA 4WEOA 4NDNE 3K8ZA 1L7EA 3W4KA 2CVQA 3W4IA 4WCFA 1IUKA 1JKIA 3K6JA 3F46A 4Q3CA 4CL8A 2Q50A 9LDBA 4QXMA 2FN7A 5F1KA 4JP2A 3LU1A 1YL7A 4KDEA 3BYZA 2AA3A 1OC2A 4LCJA 3EZLA 2RBEA 2I5PO 2GASA 3KEOA 5ILOA 2VWQA 3NDIA 3FCOA 1YDEA 2YV3A 3E18A 1AHHA 1LSOA 2WD8A 2BD0A 3H6KA 3PHGA 4OHUA 1N9GB 4M89A 3GR6A 5KTKA 3JQ9A 3FBTA 2ZTUA 4CQMB 3NX4A 1ENZA 1V0JA 1GYPA 3BMCA 4YXFA 4D44A 2AQKA 4D0SA 1OI7A 3GAZA 4JLWA 4WE3A 4AJ4A 4MKZA 1Z73A 2Q1SA 2ZJ0A 1NR1A 3E82A 1LLCA 2W90A 4YJHB 2Y1GA 3NTRA 1NQOA 1I10A 3ICPA 4YACA 3DHNA 2IZZA 4TVBA 2EIHA 3GLQA 3WGTA 5IDQA 2F1KA 1AE1A 2VUSA 2P9GA 2WE7A 3K92A 4CQLB 5JSFA 2NSDA 3NRCA 1KY4A 3R0IA 2QRJA 2ZCVA 5FEUA 4IGEA 4WCFC 1K6XA 2EKLA 1MUUA 5TQVA 4YAIA 2PK3A 3AY7A 1ZMTA 4FFOA 5FF9A 1NYTA 3GZ4A 4CMIB 1N5DA 1HF3A 3PZRA 2YQ5A 2HSDA 2HU2A 4EW6A 3QP9A 1DFGA 1JVSA 1EEHA 4YAEA 2NU8A 2Y1FA 4MP8A 2GO1A 2RH8A 1ZH8A 5DDIP 3Q1LA 3RI3A 4HKTA 2O3QA 2VYNA 2VNAA 4B79A 3LLSA 4IJVA 3C1OA 4MIOA 4RF3A 4BNUA 1P0CA 2GZ2A 1IULA 3WX0A 1KEUA 3U4IA 2DQ4A 2UUPA 5EIOA 2DAPA 3S55A 1E6WA 1HDYA 1RM3A 1U3TA 4RQTA 4TWRA 1PGOA 4IY1A 2J3IA 4RJTA 5TC4A 2ZCUA 3ZH2A 3RUIA 4P4GA 5AQ1A 3P2OA 2X5JO 5KWEA 3JQAD 4J90A 4BNVA 1ZK2A 3M6IA 1FF9A 2IZ0A 3MOIA 2VTDA 5TS3A 3O9ZA 3I83A 2P91A 3JQ7B 2NM0A 5JC1A 2Y0EA 3EC7A 4XZ3A 5L40A 1DFIA 1SO8A 3PWSA 3ICCA 2E6UX 4B3IA 5F1PA 3ETEA 2BHLA 3VKUA 3NTQA 4G2NA 1Q0LA 4Y6SA 5U9CA 2DLDA 4LMPA 1Q2XA 2O3SA 4E30A 3G1TA 5BQFA 4RVDA 4P8RA 3T7CA 4BV8A 3L6EA 3IAHA 5L4LA 1HYGA 1Z6ZA 1JKFA 1HWYA 2CUKA 3FNFA 3U4DA 4OMUA 3UHAA 4Q3NA 4Z0PA 2GZ3A 1E7QA 4AJ1A 4JP3A 4B3JA 1R4MA 4BMSA 5HS4A 3JQDA 5A5EA 4J1QA 3R3JA 3CE6A 4XYMA 3ZNPA 4G5HA 5HS6A 5ITVA 1ZEMA 4L8VA 1IZ9A 3DZKA 5G2OA 4DGSA 3OECA 1T25A 1UAYA 4OOFA 4MVJM 1LTHR 1YJ8A 5L4SA
chains in the Genus database with same CATH superfamily
4CQMA 2DBVO 2LVBA 4AZTA 2X5XA 3OQIB 3DAFA 4CLEA 3L4JA 1WXIA 2OCLA 1KVRA 4R9VA 5KTNA 4DR3B 1HPLA 5KOJB 4E7PA 4ZK6A 4F3KA 3OLQA 1IXYA 4BB5A 4AKGA 4RABA 1PTKA 5D86A 4C07A 5CB6A 5KOHA 3E9QA 4RHUA 4E5KA 1U0BB 2JH3A 5I7AA 4F2WA 1XPOA 3BKXA 1S3SA 3AUSA 4Y8VA 4C7OB 4KDCA 3PFNA 3QU5A 5A9SA 3VZCA 2GKOA 5H0IA 1BN6A 5CM9C 1B0PA 5E38A 1CEQA 5E0OA 4KR2A 1E9EA 1ZGHA 3MWLA 4WZBB 2IHJA 3ITNA 4GMDA 4FGJA 4IKPA 1UWKA 1Y81A 2NGRA 1HG1A 4MULA 4BIIA 2OECA 2Q4OA 4H31A 5DOZA 1N8SA 1YBMA 4TROA 3OE7D 1TCAA 4G4SP 1X13A 2IHUA 3IALA 4TX1A 3I1IA 3M6MD 3QU2A 2VK1A 1LZKA 1IJKA 1L5ZA 1PTJA 3KYCB 3LWNA 2CXXA 4L07A 1FNBA 4JA2A 4PICA 1QPGA 1R9GA 2OO5A 2C9OA 5AKZA 1SMKA 4DEXA 5DGHA 2WQ7A 3ZQ4A 5COBA 5DNWA 1TW3A 1WSBA 4NNJA 4UCXA 2X8JB 3N6VA 1SHJA 2IEBA 4M7OA 4NICA 4RCVA 4DDKA 4K9DA 4BO8A 1TYZA 4UHEA 2H2AA 3LWBA 1YDFA 1D3AA 3ED5A 3FY4A 2IEGA 3TO5A 4R1SA 3U80A 5FT9A 4FDTA 3DEZA 3HK2A 1LBQA 5JAHA 2XCLA 2BGIA 2Z2JA 3KJZA 4PLWA 4QFDA 4AN1A 4KVGA 4RMIA 2ZPUA 4U8GA 4G36A 4AU1A 5IDWA 1G8JA 1GT6A 1O54A 3ABZA 4FFDA 3WG9A 6ADHA 3GLFE 2XCUA 4OK6A 1VG9B 1OAOA 1O95D 1E4VA 4KXYA 4NV0A 4PR3A 5FEMA 3S7ZA 3GN2A 1CKEA 4CQMD 1U4SA 5LOVA 1FC0A 3U4QB 1Y5IA 2CL7X 1X9IA 3AX6A 4WESA 4ER5A 1E2HA 3BXEA 4LX8A 1Z88A 4RWZA 3DE2X 3HJBA 1AXEA 3FI0A 1SU7A 2FWMX 3QFFA 2XNSA 2OT3B 2AG8A 1U5BA 4OBWA 5L3VA 1TLFA 3LP8A 1D07A 3PC3A 1IVSA 1NURA 3BMNA 3HRIA 2QTVB 5GWXA 4R1PA 1CUYA 5F52A 1UFRA 1XCLA 1WB9A 4ZTZB 1SUBA 2L0XA 1UQUA 1HBJA 1NN3A 4FX5A 1REQB 4GQBA 1ZP6A 3C8MA 1W5BA 2JEZA 4NG5A 4GGPA 1RYFA 2W2QA 2FPRA 2O7NA 3F5MA 3LMKA 4TKVB 3NHAA 4Q39A 5DKFA 5CDFA 4FCTA 3Q88A 2ENWA 4FNGA 4I1UA 4R1TA 3ZGLA 1UXJA 2PX0A 4N5DA 3HN7A 2J3EA 3PHCA 4I5DA 3NOXA 2ZATA 5H1YA 5FFFA 2WG1A 5LDGA 2YNMD 4KWHA 1D1SA 2ZBRA 2RGAA 3TD9A 5ALUA 3HBLA 3TM4A 4FB5A 4GLOA 4RK7A 1QX3A 2KQUA 1YJAA 2AI2A 1JIKA 3H13A 1UCFA 4LOKA 1WSDA 1I1OA 2NPFA 4AZ3B 2DJIA 3WLPA 4U39A 1WBBA 4XB2A 5AICA 5T5QA 3N0VA 2H00A 3PLRA 5EHNA 1KKLA 3JQAA 7REQA 4NCBA 4N41A 4RKFA 3T5GA 2H5LA 4OJQA 1T4GA 1L2TA 4HEQA 1NBOA 2ZB8A 3QENA 3SG0A 4GI2A 1SC6A 3DC7A 3EUAA 4OQZA 4ZO7A 3RODA 4US2R 5K8TA 3MTGA 1ZHHA 3GGJA 4PZZA 1Z5OA 3E6AA 3P52A 2FLKA 4BLVA 3P8ZA 4R8LA 5AXDA 4DWWA 4BAZA 1NN5A 3BGWA 2YHSA 3NQ41 5DEIA 4CG0A 4EBFA 3VJRA 3QE0A 3HJAA 3B51X 4DREA 1H8HD 3VNUA 1I4EB 4IDNA 4C20A 4KVZA 1R8YA 5P21A 1JRLA 3T34A 2PFGA 1KS2A 4QD3A 1LS1A 3FIJA 3LQRA 1H2WA 4AJPA 1H94A 5BWBA 3CW8X 4OAOA 4JV5B 4O4IA 4H77A 5A3JA 3GMSA 4QJBA 3IQHX 4ZOLA 2JLZA 2JCBA 5FIUA 5K0GA 4QUGA 4HNRA 5DFAA 1U2EA 4PTLA 4LDZA 1WKBA 4JYZA 3BA1A 4GM4A 1YB5A 3K70C 1MGOA 4ZQIA 1PV4A 2QRVB 2A58A 1SCBA 4TYPA 1P1JA 1L8LA 3TB6A 3MRSA 1A9RA 3FFAA 2QP3A 1E9RA 1WUJS 3OPXA 3O8RA 2JVKA 5KJCA 4ND8A 1PG5A 4MYHA 5IWCA 1NNUA 1NUPA 2E4XA 4W1RA 4QX6A 1IZ7A 5DM70 5L95A 3OZSA 3EVNA 3RAJA 4ZYZA 2VQ3A 1VYUA 4PHFA 1GFZA 2QG9A 5I9MA 5H59A 1Q22A 3H87A 4M1EA 4BBJA 2ZWOA 3Q2IA 4Q1CA 4E46A 5FPSA 4DKXA 1QO9A 3ELUA 3EG9B 3ONNA 4HS4A 4MWBA 4AMYA 4JXZA 1Z0ZA 2H5JA 3G0DA 3CURA 1UODA 3QPWA 1S02A 1PT7A 3OCVA 3PF8A 2C7GA 3UWSA 3GRCA 4LOJA 1UAGA 3KELA 3LI2A 1G20E 1EXMA 1U7WA 4KR3A 4LJKA 3TS1A 1KEEB 1KE1A 4GKJB 1GILA 3ZX5A 5EPUA 1UJ5A 4DMMA 3N6XA 4LHEA 4H6PA 4ZO8A 4B3HA 4P7KA 2I7CA 3PPIA 1SGWA 1XNGA 2CB0A 3D7RA 2CKDA 2X3FA 3HRHA 3MUOA 3ZWNA 3H65A 1L1FA 3EGEA 1MVNA 4DXHA 5BRJA 4MGYR 3X0DA 3G1UA 3JYPA 3UGJA 3R3XA 1NI4A 4FS3A 3FPBA 4CTOA 1XMOB 4RF5A 5TJHA 5K8LA 2I2CA 4W7IA 2GCNA 4LY3A 4K6MA 5EESA 1Z7GA 1DIBA 2YCLA 3Q7TA 2QB5A 5ED0A 5CFQA 5CYGA 1QWSA 1V26A 1LI4A 1MD9A 4Q01A 5HE9A 4OHXA 4CR6A 4YDQA 2ZUEA 5KHAA 1ONBA 4FYJA 5AW2A 4UQOA 4RVSA 4P1ZA 5F4BA 1LPNA 3OD5A 3FNEA 1A4RA 1EK6A 1F9EA 3PFGA 1I5OA 5IF3A 4DR7B 3U17A 3GGGA 3ZV3A 1NW8A 1SVSA 1VSQA 2I4NA 4C30A 1M72A 4RFSB 5KUTA 3HB5X 5J47A 3EVZA 3NJ8A 3PRJA 1M2FA 1S8AA 4XX0B 2H9YA 1EUCB 4CF5A 3E2IA 4WGGA 4DN6A 4LJSA 4F7DA 4PN3A 3P96A 2B8EA 1W2GA 4P7FA 4YRBA 1WULS 2FZKA 3CO5A 3O47A 4ZOEA 4M1KA 3WQRA 2W8ZA 1J5PA 2B0JA 2G9UA 4EJMA 2ZM5A 1VXOA 5E1BA 1T6BY 2X6RA 4MKFA 3H5OA 2FKNA 2NO5A 1J2YA 3FYDA 4RLFA 3V2UA 4F1JA 5I9LA 1YA4A 2AMVA 4CODB 4C7KA 3FKSD 4R6WA 3RU3A 3GY0A 4O2AA 2P4HX 3TRKA 2A8YA 3F9CA 2NXNA 2BI7A 2EV9A 4RD6A 4L28A 1XHLA 3FNIA 4MX8A 3W4JA 3IXQA 4CM9A 1T6YA 6REQB 4BB9A 3HXQA 2BPOA 2X8AA 4J16C 4JYPA 4F38A 4Q1BA 4OLHA 4ZJZA 4C78A 1ZOLA 3AR5A 1C0KA 3SD7A 1JEQB 2Q3MA 2WAOA 4L4RA 2NNWB 3WKAA 3JD4A 3U4AA 2H1CA 3AW9A 1U28A 1LBSA 1AKEA 1RXYA 3QVTA 5C7YA 4UVEA 4TZ0A 1QYWA 5KJEA 3BRSA 4DSNA 3MBOA 2XRFA 3IQEA 1SULA 1G4HA 2XI4A 1FP7A 3PNOA 5EKSA 4ZVQA 1BE1A 1PS0A 3TSCA 5GIOE 3O2JA 3QI2A 4R0NA 2IXTA 1U7OA 4JI4B 1ZFNA 3Q0EA 4NY1A 5I7WA 1DG9A 1OJLA 1AOXA 3B6ZA 3F96A 5IAEA 4I8XA 4ASUD 2J3HA 2W4IA 4TWRA 5HKLA 1TVKB 3I5YA 4S0XA 3GFVA 3Q3VA 3CSSA 3F4LA 3LHFA 5EQTA 3TOSA 3GH1A 2P7HA 4D9MA 3SHQA 4JT9A 3TH5A 3NPAA 1H6CA 3REQA 2CMHA 1B0UA 2WAMA 3FTNA 2GAOA 4BZXA 3SIWA 3KB1A 2QP4A 3PWTA 4RHCA 4XPIA 3U61B 2HPHA 1BZYA 4J1NA 3T3EA 3LF2A 5IUNC 3KVOA 3SEAA 2RHMA 3ER9A 2OGSA 4OA8A 4ALJA 3CNEA 3BE8A 5AUPB 3EC2A 2VJKA 1GZHB 1Z2CA 2H1WA 3W79A 3BQ9A 5KSPA 1FU7A 2Q0SA 3CVJA 4LUCA 4M36A 1T6XA 1P8JA 2AC7A 3FPEA 5K8IA 3ZQJA 4DILA 4JBXA 2B20A 3NTXA 3WLSA 1IN6A 1W93A 4U02A 3EXG2 4I9FA 3HCFA 4Q21A 2VNSA 2XOXA 1R9JA 2P4EA 1LI7A 3BD7A 1WHTA 2VPYA 3HR7A 4MJ7A 3T3IA 3AWDA 4MLZA 3OPNA 2O57A 1BDMA 2XE8A 3MWEA 3D2AA 3C24A 3QFSA 3SKYA 5FTMA 4IIJF 2R60A 3S6JA 4FGSA 3UMFA 1XD2B 3A2NA 1ZN7A 3WHIA 2J6HA 4GGMX 4Y67A 5SZIA 1E1RA 4YUAA 5D3MA 4Y2RA 5CB4B 3KJXA 1F8XA 1Z35A 5KWIA 1HNZB 2D5CA 5FTNA 3RASA 5JXGA 1AG9A 3SOPA 2IUUA 2VRNA 1CQJA 1HDOA 1ZM4A 4AJ2A 1JWBB 2VAWA 4MXDA 2W6ZA 4B87A 1PEAA 3UXYA 2F6RA 1NMQA 4GZ6A 3TM5A 1RJEA 3IAM6 3DCNA 3H6GA 3Q10A 2GRAA 1MOPA 3O8BA 4PYRA 4P0PB 1H4SA 3WRYC 4BFCA 3V46A 2P2ZA 4P4UA 3II6X 3G2JA 3M34A 4DQVA 2AXQA 4KPUB 1R18A 3A1EA 1HDEA 2FETA 3KR1A 3OQMA 5EPEA 1A72A 1H5QA 2JLRA 3HA7A 3I52A 3KHSA 3R6DA 4X92A 1MEOA 5G0UA 1COWD 5JLAA 3G1WA 3OM1A 2WUVA 4FKMA 1YSCA 3HHPA 1Y80A 2YJTD 4ECEA 3C6BA 2E89A 2Z1DA 3DQPA 4MYCA 3KPJA 4TMXA 4AUKA 4CMEA 1CJKC 1AURA 3P0RA 1XFDA 1C3LA 3DNFA 3DLAA 2G0NA 3OZCA 5E6RA 1GZ3A 3BTSA 1GL6A 2YH2A 1L4LA 4BNZA 5HCNA 3H6HA 3H1GA 3R74A 2Q28A 1XTZA 4FLFA 2KLBA 1L7MA 1LJUA 1W8DA 1C4OA 2BM1A 2Z4SA 3OQ6A 3QVJA 5L8VA 1QPBA 1XZAA 2QEQA 3ZI0A 3LPCA 5F64A 2BBTA 5FBKA 1U4OA 4ACAA 2CXHA 1UK9A 4UVGA 1B3BA 1T4BA 5BV8A 8ABPA 2QD5A 3CN7A 1YONA 2HRDA 4LHSA 2V0CA 4BRSA 3RUHA 4JI8B 1SQ0A 2B0CA 1TMGE 4KQ9A 3ILSA 5K3AA 2X4DA 2OP0A 2YQ4A 3A3YA 2GPBA 3OZEA 2GZAA 3KTAA 1E1CA 3COJA 1P1KA 3R5FA 3E9YA 1F0YA 3QFRA 2PUGA 1G20A 4U8HA 3NATA 1J2JA 3NBAA 5FTKA 3PTZA 5IKOA 4E5DA 2L17A 4EW1A 4JI2B 5JSQA 3ZWAA 2H1HA 4QO7A 4Y2SA 2AZTA 4R3WA 3C43A 3QEBZ 1DTSA 4TXNA 3TLAA 1SPXA 1V8FA 2G71A 3SBXA 1XEWX 1U0FA 3FF4A 2NSJA 3GRRA 3L1VA 1HKHA 3OT5A 4MS1B 4QXOA 5DP1A 2IDMA 3EJWA 3EBOA 3MOGA 1NXPA 4D0GA 2Y3IA 3U7JA 2QPLA 1KU0A 1ORHA 4HDRA 4C89A 4IX9A 2X0JA 2NZVG 2X58A 3LBIA 1O5IA 1EHIA 1Y1RA 2VOEA 5FUVA 1CUUA 4UNRA 1MT0A 5D85A 3IUEA 1R5NA 2XSZA 3L6OO 4G9GA 3BD6A 3H0EA 4FU0A 2QYSA 3ZG6A 4EMUA 3QEMA 4NWIA 4ZI5A 1DFHA 4D81A 4XGKA 2EJUA 3QVGA 2JEYA 2ZSEA 2HRZA 4CV0A 4YAFA 1GZVA 4YV1A 1TUBB 3BEOA 4P5DA 5I7HA 3RU7A 1CRPA 3KT3A 4Y1RB 5EYPA 4EZIA 5KINB 2MSKA 4YUVA 3DBLA 4J75A 1GEGA 2DY0A 3WRYA 4FFBB 2FFQA 2VXBA 2W98A 5EUQB 5JPIA 2CEKA 3JQQA 2F43B 4L3VA 3VV3A 4I36A 1RNLA 3CLRC 4M8IA 5TT0A 1BQEA 2YZ2A 2CZQA 3PRKE 2O5EA 2R2AA 521PA 4OGGA 5JNSA 4MPDA 3CR7A 1XPUA 2HF2A 1Y4ZA 2ERCA 3LT1A 5B7PA 4ZEVA 1E1QA 2NV6A 4U6QA 1E8NA 3ZU4A 4RQAA 4RKWA 1U9CA 5JPCA 2V6IA 2I4TA 4S3MA 4YRLA 3ZCTA 4LE0A 4DHEA 2PUJA 1L4MA 5C8DA 3BHMA 1G8HA 2XJ9A 2XB4A 4GDMA 1MGPA 2C5HA 3O6VA 4X1OA 4DIBA 4KGVA 4Q4HA 3UNXA 1RC8A 2E4UA 2ZJFA 3V55A 1F1JA 4LBZA 3NNSA 2EX4A 1W0CA 2HBRA 1ZNYA 2RGUA 1U1DA 2JGJA 3VOSA 1NNLA 1N5LA 1VYTA 2OEPA 3ESQA 4KWCA 5JIBA 1XVVA 3BFPA 2H7VA 1SKBA 1U7XA 2VP4A 3L7LA 4JC5A 1CCWA 4D8TA 1MB0A 5U1PA 5EJ9A 1WQ4A 1JG1A 1WXFA 3AXTA 2EKDA 3ESXA 3I9LA 4IEEA 3ZWXA 5BWCA 1C9EA 1CJVC 2PZJA 3RIMA 2ARKA 2C1EA 1BG6A 1CU1A 2P9FA 2PT9A 3DJYA 1BKYA 3FRIA 3GEHA 4KYTA 1VJ1A 1XCPA 3LS2A 2WIJA 1RYEA 4XKJA 2NNLD 1N2CA 3KB8A 1O9BA 4C4RA 4YYZA 4CL2A 4V0RA 3SSAA 3EXHA 1VCNA 1IVNA 4TV8B 3S27A 3EQZA 3OZWA 4RHEA 2B3DA 1E7RA 2XDQA 2ACWA 1OKKD 2EQ5A 2FHSA 3NEPX 5AW5A 3TLGB 1ITZA 3KXIA 4M1OA 3VR1A 4UFPA 4RTLA 2AMJA 2AYYA 3SK0A 3ZZ1A 2YJ5A 3RV4A 3W7AA 2ZANA 3TEJA 3EZ9A 4YBRA 1E7WA 3IAUA 3SNKA 5IEJA 4ZDIA 2FKAA 1A8QA 2HDWA 1DIRA 1MJHA 2DF8A 2WG0A 3UCXA 2HU8A 5JRDS 1Y7LA 3RRYA 1XFAA 2N3ZA 2PMDA 4WXEA 4BVGA 3WISA 2DERA 4CZ2A 4CHTA 2YFQA 3L40A 1BVHA 4PQFA 3DLTA 3OKAA 1VHLA 1YOVB 1QMGA 3GP3A 3LC0A 5KSYA 3I05A 1NFRA 3UKJA 3EPJA 1UBEA 1DJLA 4NCXA 2PXAA 5G1NA 5KQSA 4NCAA 5FBHA 1N2CE 3ZNQA 3NDRA 2AUMA 1UEXC 3JTMA 4G0WA 1ORVA 1OLSA 4A6PA 4F3RA 4BE9A 2A14A 5KPDA 1NSFA 1XZMA 2WJWA 3JZFA 3V6LA 4I14A 2G1JA 1HKUA 1GD1O 1M2HA 2CCGA 1DWUA 3DE7X 4YYEA 2DFPA 4GC5A 2F8MA 2VI5A 5DX0A 1SZJG 5F3WB 4JQZA 3G79A 1W30A 5HDQA 1P3DA 3FWHA 5CEEA 5HXAA 5IZ4A 4LWZA 2ZUSA 3ZWDA 1HMYA 1N0IA 4G85A 4E08A 2QVYX 4G2TA 3TNLA 5AVUA 2IPAB 1ZY2A 3QXJA 5EJFA 1G7RA 3FJYA 5LZ4A 2WMYA 3BJZA 4KUHA 1G1MA 2D2VA 5A3VA 2XGSA 4KQKA 4BP8A 2WYUA 3AB3A 4AY2A 2I3BA 3OP4A 3W5UA 5KOIA 3DMFA 3FOZA 1N8KA 5DZSA 1Z2AA 3T7TA 3TFWA 3GEDA 1LKZA 4KMMA 1J70A 3RE1A 3THYB 3T9CA 2RIRA 5UKDA 4ZQEA 3LDFA 4D0LB 821PA 1HT3A 1OA1A 3HKDA 3WZLA 1HYEA 2J33A 2WTBA 3LVBA 5JXIA 1PZXA 2HBQA 2NWQA 2ZJ4A 1K2WA 3C39A 3OJCA 4JJZA 4NMXB 4Z8XA 5DGTA 4FZRA 4HEA6 2FMTA 3VYRB 3U2QA 5TDHA 3NXKA 1UKZA 4LXYA 3C6XA 1SIBE 1FNCA 4AKTA 1Z6QA 1SD5A 3K9HA 5DHFA 3E5NA 4EQ6B 2AIRA 3TCKA 4RYDA 1FW8A 3ZDEA 1LVGA 5AVWA 3TD6A 2J3LA 1YRBA 3NGXA 2GRUA 4GWKA 2J31A 2J48A 5EL0A 5LYYA 2DU8A 1X2BA 2HM7A 4LVCA 4O0MA 3T9FA 5DBEX 1P75A 1X14A 4QC2A 3I9MA 2PZFA 3PP8A 2H1IA 5AVVA 4DM7A 3A4LA 4MCHA 3EN0A 1GZ4A 1KBZA 1NW6A 1P2FA 2ZIUB 3H2YA 3FOWA 3R1IA 4KNVA 3MTIA 5J63A 3OD1A 2DHDA 1QZZA 3GFRA 3PGXA 3DLPX 5GGXA 4B31A 1SBNE 4PNHA 3RJMA 4ZCRA 5KO2A 3H7IA 3NV9A 3AOEA 5AM1A 1T2NA 4U2DA 4V2IA 5GADl 1RP7A 2BR3A 3O94A 3A7EA 3H3FA 3SQOA 3QNUA 4U7TB 1GQ2A 1PW7A 3HM2A 3MWDA 1JR6A 2QBYB 1RLMA 3IPYA 4BJ1A 3H1FA 1TC2A 4Y30A 3CRVA 3HWRA 1ZBDA 2RHLA 2D8MA 1T13A 1ZOOA 4G65A 4NC9A 4D9JA 3MMPA 4Q1AA 1PUXA 4QBKA 3DE0X 3TUJC 3CJQA 4ENSA 2VDLB 4QFCA 5K4GA 2LXNA 8OHMA 1BD4A 1MORA 3DFIA 1Y3BE 3IO5A 2OK8A 4E4YA 1RABA 2NUTB 3HRKA 5I9SA 5ECYA 3NBXX 5GZ1A 2Q3JA 1YJXA 2J9RA 3OPYB 3VJLA 5LXTA 1R6TA 1F48A 3E0XA 1DO8A 4BFSA 1JHQA 1IM5A 1B76A 1I24A 3ZW7A 3JARA 4MEAA 5F78A 3WHKA 2C5AA 1SUCA 2I4MA 4MI9A 4FNAA 4PGHA 4BLPA 1KMCA 2QUAA 4TRMA 3NASA 5CYPA 3DTVD 1PJTA 1QQ6A 4KKXB 5D2CA 2ONCA 3CX3A 4C0SA 1SOUA 2AGVA 1U3UA 2Q3LA 1C7FA 4AMUA 4PYMA 4AY5A 4MS4A 3JWHA 4WWHA 5C3MA 3NHPA 4F1WA 4NOKA 3U3RA 1BRTA 2FN9A 2C92A 2H4WA 3FAZA 4LHVA 5H4HA 3ZDRA 1KWGA 2NTYC 4ANFA 1JE0A 3KQOA 1LPMA 5K9ZA 1OAKA 3VXKA 3Q40A 4F12A 1GRNA 1BFDA 3H5NA 5IFKA 1V6AA 2EEZA 3KSUA 3OA2A 4CFZA 4IDGA 1KIAA 4LY6A 4XVRA 4YCMA 1WZ2A 3AI2A 2QU7A 1ZZGA 3W06A 1GVHA 2Z95A 3WQQA 3HKBA 4UZSA 1NP3A 3DT9A 3LL7A 1CUBA 5JEDA 2C7PA 2G07A 1EWYA 1N2BA 4UARA 4XCVA 1JEJA 1AM4D 1IRXA 3S0JA 3OCXA 3VHRA 4KLNA 5CNJA 5CDYA 1LEHA 1ZGJA 2OVFA 3CSDA 1Y4AE 4BVKA 2SCUB 1UZNA 2QMHA 4OMCA 4Z4HA 1JPNA 5DBGA 4YCLA 3P4UA 5IU6A 4LRSB 1K7EB 4RPGA 4Q3BA 1AK1A 1VECA 4EYQA 4H1VA 1R0YA 5JR3A 2A0UA 1WVMA 1HA3A 2IP1A 3HDHA 4JBNA 4YJDA 1PEDA 3VNBA 1LPOA 3K73O 2O2JA 4BKUA 1CJUC 4OHOA 1SRQA 4QEDA 4J1SA 3FJOA 5GJBA 4CG3A 3EIQA 5LMUB 4U9IS 4D46A 4B76A 1PQ4A 1E5DA 4P83A 3T9EA 4CM8A 3QLVC 4FNMA 3ABIA 2QAGC 2QR3A 5CFNA 2VPZA 3OOHA 1W1UA 1FCJA 2HPZA 3CZRA 4N0PA 4DF3A 3PC2A 1GWNA 5A03A 2J0QA 2BFCA 3B9BA 1GITA 3CH7A 3ELBA 3VI3B 4CEJA 5I6DA 1V11B 2B4QA 1RT9A 4J9UE 1YTLA 4J3NA 1FYDA 2VBFA 2INGX 2OV1A 3MGAA 3QFHA 4BO0A 4PFKA 4NULA 1PGJA 3HM9A 3D7NA 2QRVA 4WRRA 3HMKA 4DQUA 1KYTA 5J2UB 4ER3A 1GQYA 2JCYA 2HLDD 3ZZ0A 3VPSA 2PPLA 3GDHA 3IO3A 1TNDA 4YCBA 5H80A 4W9MC 5BSKA 2CL0X 3ZXSA 2AD5A 2FMKA 2G17A 2CLKB 3ZY6A 2P5TB 2QTFA 1WUYA 3JASA 4Y18A 1A9OA 1XDBA 2XQKA 5C81A 1QZXA 1C41A 2IOYA 4N8SA 4F9FA 2Q6TA 4KQEA 1GA6A 2JFFA 3D43A 4A6DA 3F9RA 1OAOC 3AHDA 4PTZA 1F8FA 3TZKA 5AK6A 2G77B 3SQMA 1RI5A 4U7WA 2ZZMA 1UK7A 2VCHA 4FYKA 5EE9A 1GFSA 3X1JA 3S2YA 2RGWA 2CXTA 1O3YA 2R751 4IZHA 2BTOA 4P22A 1QYXA 1YULA 1SK8A 2I55A 1A9YA 4HSEA 3RSGA 1R6DA 4EG7A 4IMPA 5CBKA 1DAMA 1SXJE 2E6KA 4D79A 1ESDA 4TGLA 5A7HA 4YH1A 3P2YA 4PIVA 2H18A 1FNNA 4IQ8A 4WOCA 4DV4B 4HEHA 1SJ9A 1QGUA 2OLKA 2P2GA 2ZI9A 3DYIA 4KQWA 3UK2A 4GPAA 3DAGA 4HNGA 1JH8A 2B34A 4I50B 1E8MA 2PAFA 4IVRA 3SYMA 4LV6A 5D5PA 4JL6A 1R2QA 1XEXA 5CTJA 4ED9A 2DPGA 3N1UA 1AQ6A 5AJYA 5A4KA 3F4BA 3UY4A 2JD0A 2JLSA 3UT6A 5HFNA 1XQ6A 1CY2A 1QDLB 4JBGA 5ABPA 4EFNA 3VPDA 5CDHA 3VSCA 1A0OA 1RHJA 2ACKA 3HGMA 3W6PA 2FPGA 3SQXA 1G21B 1RFGE 1G0NA 5LB4A 1C3OB 3KAQA 4IUYA 4JJ4A 1KBOA 5IK2A 2R4TA 4HDNB 5EMJA 5KQMA 2IBSA 4I8DA 1RKQA 4KUGA 4WHMA 4UUMA 5JS7A 1PQPA 1QG4A 2RHJA 3C5EA 3GMIA 4KK3A 4BLUA 3JAKB 3LFUA 4OK5A 4PZ0A 1XUOA 4OL9A 4EY8A 1SHKA 3PQ8A 1T5LA 4TSRA 5DK6A 1RKBA 3G7UA 3TXXA 5CAEA 1TJNA 3A6HA 1RQPA 1N2HA 4LJ4A 4CNBA 3WIUA 3HHEA 1HFWA 2G8NA 2ZUCA 2P3LA 3H97A 3NNNA 3PICA 1K3UB 3ZIUA 2ZU6A 5KTSA 3U9SA 4G26A 3OEYA 2CVFA 2XE4A 3VYWA 1F0NA 1RHQA 1P77A 4O2AF 3OQPA 4OOEA 3SC3A 1VXRA 2BFFA 2HCRA 4KN9S 2Z5VA 4BFYA 3G8BA 4G0XA 1Q3KA 3D8HA 2VDNB 2AXEA 2PLNA 1QFJA 3WLOA 1E1LA 1I30A 1E1RD 3TLZA 4YMTA 3I0MA 3UQYS 3UWOA 3G85A 3OLCX 1C9YA 2HLPA 4KQMA 1ULBA 3RC3A 3LPLA 4J0IA 3VHXB 4P0QB 2L82A 1QCYA 2BUAA 2OLEA 1TZKA 4XUDA 5ES4B 1STOA 5I7EA 1OTYA 4RTSA 1EGQA 1YWGO 3EXAA 3PI6A 1JXOA 1CB0A 2ZYUX 3LQQA 3ZDFA 3D6JA 4OI2A 1ZCFA 3FUCA 1PJ3A 4QO8A 2F1JA 5BQ5A 1AKUA 4A0QA 1F1BA 3S8YA 1MHTA 2GLXA 5BN4B 3Q9SA 3RRMA 3INYA 4RF2A 5BQXA 5TLSA 3JY6A 2GBCA 3KYJB 2ZTVA 4W5HA 3DTNA 2EKZA 3DXFA 4YRDA 2NUAA 4AZWA 4WPGA 4BBAA 1WX1A 1WDLA 2C5BA 1AQJA 3U1BA 2J3DA 5HK8A 1J56A 3D1VA 3E8SA 3QYJA 4QPPA 2WIAA 1DJOA 2P8JA 1MMFB 3OPMA 2H63A 4IIHA 1JEAA 4N03A 5DN9A 5SY9A 3ZGVA 2PU7A 3QHAA 2WNSA 5IDYA 3CF4A 1Y5NA 4J0JA 5HKKA 4W5RA 2O7SA 4KYUA 1RKUA 2PS0A 1PK8A 2JLYA 3THXB 1GZSA 1WMFA 4OP1A 1F38A 3I6QA 1GADO 4HVTA 3HCEA 5KJ6A 2R00C 5BVHA 3WNVA 1M10A 5JAQA 4I55A 1BGVA 4RK1A 5EJMA 3S68A 3QU7A 5T6BA 3HCWA 2YXNA 4GP9A 2G4VA 2AQHA 3C5CA 5TS2A 1ZIPA 2JVIA 3WSVA 4EUSA 3IT0A 1BCSB 4GPBA 1GT91 2DSNA 1N3BA 1IBMB 1JXQA 1ORRA 4NBUA 5FPYA 4B2PA 4EHHA 2FVYA 2WM3A 3STWA 1QHXA 1K7CA 3L4BC 1VKHA 4MTCA 1GKUB 1UM9A 3EQ6A 5C7LO 1LSUA 2H2HA 5C34B 3RM3A 5LPNA 3UM9A 3URKA 2QENA 1QE0A 4BQOA 2DETA 1JDPA 4NEQA 4TLDA 5LOVB 1E94E 2J6BA 1RRKA 5HIKA 4ZV9A 3DOFA 3GH3A 4RE5A 5F12A 4N0EA 3X2FA 1C7EA 5JCXA 2X23A 5KREA 1DWOA 1V1RA 1MXFA 1XTIA 4HTFA 3V3TA 1F2TB 1NIPA 1GNQA 2PWPA 2ZPTX 3JQGB 1R0ZA 4Q48A 4CM9D 4XVCA 4BNHA 3PKJA 4U7FA 4AJNA 2J3QA 1EGMB 2R97A 2FPPA 2V7TA 2JGAA 4TWIA 1KWKA 4TMWA 1YL6A 3WAJA 4ZVMA 2H08A 2QAGB 4QG3A 2ATXA 7ADHA 1JT2A 5AW1A 4NE9A 4ZVPA 1SB8A 1TYCA 2XTZA 5IMSA 3M6WA 2FK8A 4ZYLA 4FEGA 4Y6QA 5CJJA 5CDSA 1H2ZA 2BE7A 3BXHA 4YJGB 2CJWA 4QRDA 1DKUA 4QFMA 6NULA 5EJ7A 4PSUA 2YN2A 3U49A 2GVDC 3GEIA 5A6SA 2LUOA 5HIMA 3MSXA 4JU8A 4QUDA 4HDQB 3COPA 2MJLA 1I3MA 3LXRA 4EARA 2B1JA 4H60A 2IEIA 1CUJA 3IAEA 1PU2A 3D3WA 1LD3A 3REFA 3SMVA 2EP8A 2Q6KA 1CZNA 2V58A 1KJQA 2BGTA 4EG6A 4GHWA 3QVWA 1XA0A 3WL7A 1HYHA 1NXVA 2ZBVA 4L27A 4MVYA 1U0NA 1JG3A 3KLOA 1TT5A 4EMTA 5K3SA 5AVQA 5HQ3B 3RG8A 2IEDA 1MIHA 2ABWA 4CKEB 3F6EX 1TKAA 4BX3A 4EHFA 5JMOA 1QGZA 1E1QD 4OUKX 2X3UA 2I67A 1CTQA 3KKLA 2CL6X 3ZCXA 3NKVA 3I23A 3I4CA 3IE1A 3M4XA 4N4AA 2PWZA 4X6UA 1RHUA 2D74A 4A6XA 3SFTA 5JW6A 3B8EA 3A32A 1KXZA 1QVAA 3OE4A 3QHPA 1BDBA 3I9NA 4XIIA 2PSFA 5FULA 1CE8B 4RETA 3RHSA 2P41A 4CU5A 2IQIA 2OAQ1 3EH1A 1KFBB 4LDRA 2QRUA 4A23A 3C3JA 3FOFC 1X1AA 5F76A 1T9AA 4KWEA 2ZBFA 3H0CA 4MW9A 2CZCA 2IBMA 5ADHA 2I87A 1TT5B 2QIOA 3ORQA 4HQKA 4ZVLA 3ETCA 1D6SA 4JJ6A 3A4TA 1DBSA 4ZT4A 2ICAA 4X20A 3QM1A 1DL5A 3SGLA 3R6GA 4WESB 3NZEA 3E03A 3QVGB 3I2YX 3HUUA 4QXAA 2W93A 5SV2A 1ND6A 1Y5MA 4O4HB 1GGFA 1QKJA 2XVZA 2HA5A 1EVKA 4TVKA 5AHRA 2IPLA 3QIVA 2Z6UA 4JFRA 2GETA 2WU8A 4QQRA 4RENA 4C01A 1L7RA 1DAOA 1JAXA 5E2AA 4RTNA 2QAJA 3D8RA 3H4TA 3YASA 3JRNA 5HJ7A 1Z12A 2REOA 4URWR 3PXAA 4M1QA 5ELLA 2A9VA 3N58A 1YQEA 1SU6A 2K87A 1UPBA 4PFQA 2PMCA 1QH8A 1Z06A 4FDVA 2JKZA 2ZETA 1E1YA 4X20B 3LGAA 4X5OA 3TGLA 2CFRA 1T5SA 3K2IA 1FYVA 4Q34A 1DARA 4ZKDA 3SBOA 1ZNXA 3WICA 3TBKA 1H5UA 3O5AA 3KQYA 1ZR2A 3UG7A 2QQEA 2HDNB 3OJFA 2J3JA 4Q4HB 5TV2A 4E4RA 5LSAA 3JX9A 1XPJA 3KBBA 1E6UA 3F6RA 2QJOA 5C5IA 4BPRA 1NP6A 3EUFA 4K9NA 3AF3A 4RTKA 1T35A 3LGSA 2GN6A 3W5BA 3EH2A 3JAWB 2QZ9A 4FLMA 1PL7A 4ZCMA 1Z2PX 2GXQA 3OCWA 3A4YA 3OUTA 1V95A 2WT9A 3E4DA 2SBTA 3PXDA 1IEWA 4PLCA 2V74B 4L78A 3U4MA 3UGTA 1M8FA 2E0IA 2C5SA 2FEKA 1DT5A 1I2DA 3UN1A 2WNIA 2PUHA 2BFMA 2Q3DA 3A04A 1TKRA 3SI7A 2XBLA 3M81A 3RWMB 1R5OA 2RG7A 1JQDA 5FDFA 1EFHA 1SA0B 2C5GA 2ZT7A 3K9GA 5IW8A 4J0HA 5HW0A 2QD3A 3HNOA 1KF0A 3ZY5A 2M6KA 3EIXA 3PPYA 4K5QA 2Q1UA 2EKBA 1B8VA 2OVBA 1LK0A 2D0OB 4AJEA 4P2GA 4BV2A 3UFBA 3EEBA 4D9NA 1JFTA 3QF4A 5AESA 1HE1C 2IUEA 3O82A 1VB3A 4MQLA 4UCQA 5B1DA 2ZTMA 4AWAA 3K71B 4Q18A 1XAIA 2WWGA 3O2SB 1NLUA 4Q1EA 3ZE6A 2ISQA 3HKCB 3ZCRA 4IEFB 4NYMQ 4PVCA 2ZT5A 4QQKA 2WA1A 5JS2A 1JG6A 1IYZA 4F91B 1FSFA 1ZM7A 1ADBA 1MNAA 2B99A 1S3FA 4HV4A 1ZCAA 2ALJA 3B38A 4J0QA 2W42A 4MR8A 1SA0A 5GZ3A 1JQBA 1LBTA 3P9PA 3E5RA 2ST1A 4QECA 3C7AA 3EYAA 3RTEA 2FWBA 2NPOA 2RBKA 1ZJJA 1XGKA 2XT6A 3WRXC 2PDAA 2YZGA 3PC8A 3BULA 1PIWA 2DEUA 1HETA 4B82A 4ZP1A 1XZBA 3U19A 3M4ZA 3ELWA 4MZXA 3K6KA 3QF4B 1JFFB 4GLFA 2Q7XA 3QSGA 3PGKA 1SBYA 1JKXA 5K3FB 3FOBA 1NE2A 1NI3A 3DMYA 2X9GA 4Q82A 1VHJA 5KX5B 2D1SA 4H1WA 5G4KB 1RIFA 5E3HA 4M0UA 1N4DA 1Q19A 2BP7B 2XT0A 3HTXA 3TNFA 5BYJA 1D4OA 1NOJA 5SZHB 5J3JA 2D0IA 3QE2A 1XNRB 4DW8A 1W4RA 3TVTA 2BHSA 4IJKA 1PZHA 2WTXA 4HDKA 4IGIA 4EJSC 3R6LA 3JD3A 3AQIA 3LX4A 1A2BA 1J1IA 1OREA 1KDPA 3DDCA 5GVSA 2H1OA 2PO7A 2UZ1B 1CUFA 1T9KA 4DJEC 1JLSA 1ZUD1 3EWSA 4X95A 2X1LA 1G5RA 1RKXA 3PJGA 5FBVB 2O3TA 5AH0A 1TZCA 1ZD4A 4XPIB 4D3DA 3N3AC 1HTWA 5CG1A 3B60A 1WWKA 4L7QA 1Y37A 2VPWA 1UADA 4LBVA 1D2MA 1X15A 1BDJA 2N1BA 3HU2A 3IKVA 4MWTA 1WDKA 3ASZA 3D3JA 1CY6A 1N78A 3H17A 4POAA 4U9UA 4ZIRB 2B1IA 2ONZA 3DZJA 1DC6A 4HRVA 3M6VA 2PFKA 3OC0A 4UHCA 3LZCA 4BATA 1MBZA 2R1TA 2C2HA 2LW7A 2XVAA 3ETHA 1BFKA 1EWQA 3R5TA 3BMQB 1NKTA 3VR0A 3RT7A 2A59A 5JVDA 2K6GA 2AEEA 2ZQZA 3C8ZA 4M54A 5KU7A 2Z04A 1LI5A 3BJIC 3AERA 4NMWA 3WLEA 3CO0S 3V4ZA 4GOLD 1DBIA 1J8YF 1PNQA 1TVMA 2NZWA 2X1HA 3PXGA 2GK3A 4AECA 1I1QB 4RHTA 1SCQA 1W85B 3LNTA 3DHVA 1FRNA 4TQ9A 3K09C 2EBUA 3G0GA 2JD1A 1G2QA 2R1ZA 1WMEA 4HFJA 3LXXA 4OQDA 3EPHA 1C9KA 2FZVA 2O05A 3GLHA 4O4JA 4ZIRA 1VI6A 1X9HA 3T61A 1TYEB 2DPXA 2OO3A 3D3QA 3O2QB 1ZL2A 1TA0A 2R1TB 3OZUA 3D5EA 5CVEA 3CF2A 4CFYA 4BNDB 1MH9A 4GAEA 3ZXUB 1FFAA 2FN4A 2AYZA 1Y5LA 5BYKA 2UYQA 3C3AA 4EPVA 1L6RA 1W5FA 4RQBA 5T8KA 2BTQB 2QPOA 3ASYA 4G1VA 3ECSA 4LVOA 2BRUA 3SKXA 3UHFA 3TTXA 2IZ1A 2H06A 2H2WA 3ANTA 3P0HA 4I4CA 4OQLA 3WIBA 4KNYA 4ZKEA 3C8HA 1PDVA 4EX7A 1RWBA 3CY6A 3A36A 4UEKA 4BLTA 3WDMA 4ILEA 3D8NA 3EDCA 3SCZA 4UC0A 5D01A 2WV7A 3FETA 1E61A 3VX3A 2VUTA 1X9GA 4ZOAA 2VTEA 1M2NA 1DC4A 4B74A 5JD4A 4U7GA 5JNVA 1FMCA 1O5OA 2XGOA 1ZK0A 2P3QA 1ZGBA 1RR6A 3BGSA 3L4BA 5AVYA 1V1JA 3WGGA 1IG0A 2NYRA 1QKIA 3Q6MA 1OXTA 1JLKA 4LXHA 5LKAA 2CLFB 1WTCA 2IITA 4XFDA 1TK9A 1M3SA 4HWGA 2VNHA 1OU0A 2GVNA 4KLCA 2V5AA 3TCXB 1N0VC 3IJPA 1Q0UA 3A1SA 5HTKA 4B4DA 3N0TA 4KG7A 1MG5A 3UO8B 2R00A 3CTMA 1E9FA 1RAAA