1D8BA

Nmr structure of the hrdc domain from saccharomyces cerevisiae recq helicase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
b'ELNNLRMTYERLRELSLNLGNRMVPPVGNFMPDSILKKMAAILPMNDSAFATLGTVEDKYRRRFKYFKATIADLSKKRSSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SGS1 RECQ HELICASE
publication title The three-dimensional structure of the HRDC domain and implications for the Werner and Bloom syndrome proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 27
structure length 81
sequence length 81
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11408 Helicase_Sgs1 Sgs1 RecQ helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1d8bA00
4OO1J 2E1EA 4NLCA 2CPRA 1D8BA 3CYMA 1YT3A 3SAHA 4NLBA 2HBLA 1WUDA 4CDGA 4QIWF 2MA1A 2RHFA 2DGZA 4QJFB 4CGZA 3SAGA 3SAFA 2HBKA 1GO3F 2KV2A 5C0YA 4O3MA 2RRDA 2E1FA 2HBMA 2HBJA
chains in the Genus database with same CATH superfamily
7ICSA 4QZDA 4I2IA 2ZUBA 2F3NA 4IRDA 4RQMA 4DL7A 3M6KA 3QYPA 1SGGA 3F5EA 4RPZA 2KKPA 4Y2UA 4OJLA 4UAUA 1X6JA 3M6ZA 4Q44A 1JROA 2JZBA 5DQIA 4UAVA 1DGJA 2V4RA 4RQ7A 1Z1VA 2IHMA 1NK4A 4IR9A 3H8MA 3T5LA 1URJA 3AN1A 2ZTDA 3QX7A 7ICPA 4J03A 4F4WA 4R65A 3T5JA 4I2AA 2ATLA 1MQ2A 4UAWA 4Z6FA 4YXMA 2G06A 2KK0A 2KN7A 3LWMA 5ALEA 2LBOA 4C80A 4Z6CA 1QQ5A 1N2XA 2B21A 4NJ8A 4DWIA 9ICKA 5EOZA 1ZRNA 3R9KA 3MR3A 2HOQA 4PZOA 5AI0A 2D6FC 3Q8MA 1SXEA 1L5UA 1MN8A 2LYBA 3V7KA 4YG2A 5KT7A 3H8SA 2D3DA 2HBKA 9ICSA 2JMGA 4FS1A 2F1HA 3N7RC 3H0MB 4NLCA 3KD3A 5AI5A 5IIMA 1SL2A 3NVWA 5DG9A 3EUB2 2J6SA 7ICEA 1WYGA 2GOLA 2WB1F 1NZPA 4O5KA 5ALKA 4C7YA 2YY6A 4UW9A 3RTVA 5AKXA 5ALWA 2EZXA 3BQTA 4TUSA 4NLZA 3KZIU 4KMOB 4NLGA 4YCXA 4KLIA 1XO0A 5KFEA 1ECWA 3PMLA 3BQ2A 4IQUA 2EQYA 1ZD5A 2K4EA 2MUTA 3TADA 1KFDA 5GTHU 5IINA 4KLOA 5ALQA 2MA1A 5AM5A 4FZMA 4I27A 1U4BA 9ICLA 3ZDAA 3BS5A 4Z6DA 1VDVA 4IQVA 4F5PA 5ALDA 3H4BA 3NGDA 4DSLA 2G5HB 3MGHA 4OJ5A 2A1JA 1N62A 2WHEA 3K4GA 2YX8A 2LM4A 3UPQA 2E1EA 2RLTA 3DV9A 3QUBA 4QWEA 3UMBA 3IG5A 4J9PA 2XICA 4QIWF 2DPIA 4MFCA 3NASA 3C29A 5L1LA 5KFFA 3PSTA 2XVTA 2XGPA 2FE9A 4Y2JA 2G0AA 4PHPA 2RRDA 2QARB 2HSZA 3C5FA 2MAXA 5KFNA 4A8EA 2GLEA 2W54A 3TADC 4YR3A 5KG3A 2R8GA 3OTQA 3MC1A 3B0YA 4F5RA 5CHGA 2HDOA 3UM9A 1QQ7A 3JPNA 1ZQCA 2DPJA 4RZRA 3TAPA 2YMPA 4OJPA 5AIAA 2AGQA 3LVVA 4O3MA 4EX7A 4NWIA 1X9MA 2KSOB 4B9NA 4BGDA 5AI9A 3IP4B 2ZIVA 1RYSA 4EBDA 4ECSA 1KFSA 4UASA 4KLQA 3HW8A 1FFVA 3Q8RB 1XSLA 1WCNA 5F9NA 1SWVA 4M6WB 3PSIA 5KFKA 4ED3A 2G5IB 3F5AA 4XQ8A 5EWGA 2Y9TA 3ZD9A 3RRGA 5KFDA 2JH1A 1QSYA 4JV0A 1ZQNA 4DF8A 3UMCA 5B66U 1ZD4A 4AP9A 5K4LA 2ZG6A 3FM9A 3OPXA 3OGUA 4PGYA 7ICIA 2PMZC 4DS5A 2HHSA 3FC4A 4DL3A 4LVSA 2FMSA 3SYZA 1KDHA 1ZQBA 2Y0SF 4RQ4A 5J8YA 3JPTA 4DSEA 4PPXA 4US9A 3OJSA 3F2CA 1T7PA 1HJPA 5AKYA 3SMVA 3GV8B 3PW5A 2ZXIA 5AKKA 2ZJ8A 2W9MA 4NXZA 4RNMA 4QWBA 5TISU 4YXJA 3JPOA 4KN4A 3BS7A 1ZQUA 7ICRA 1SV4A 4HAIA 1BVSA 4F2SA 4BJQA 3SZ2A 1X2IA 4PHAA 4P0QA 9ICOA 3QNMA 9ICCA 4R64A 1ZQRA 9ICUA 1WCLA 2I5HA 3PX0A 4NM1A 4MEYA 2UVVA 2PXIA 2QKQA 5AKLA 4B9VA 5J8YC 1ZQTA 2NO4A 3GIJA 5KFJA 4I28A 3E2EA 1NI3A 5KFBA 2JXJA 2BPGA 3QUQA 1V9PA 2KP7A 1CUKA 5HMMA 1PVQA 1SIJA 1ZQFA 1ZYQA 1NZBA 5HHIA 3PSFA 5AKIA 2ZXHA 4DS4A 2DFLA 2HHTA 2V9WA 2B6GA 3WKAA 1JRPA 3PY8A 4DOCA 3JPQA 4B9SA 3GZFA 3MGVA 5KTQA 5BOMA 5HNKA 1RYRA 4TURA 2C2DA 2QB0A 3FAHA 4I2CA 3QUCA 1S10A 2J6UA 1A76A 2AQ0A 2OH2A 1TKDA 3KZXA 4P4PA 5J2IA 2Y9UA 5KL1B 3RB4A 1SKWA 1ZQZA 1YZ6A 5BPCA 2F1IA 1XO1A 3TFRA 5AM1A 5J0PA 2IMWP 2FPLA 3EZ5A 2H5XA 3AEVA 1H38A 4ECYA 1DK2A 1ZQLA 2XCAA 5DB7A 4AYBC 1IM4A 2VKQA 5EE9A 1NK5A 2RHFA 2HI0A 5AI6A 1TFRA 2PKEA 3TKAA 3T5HA 5J2KA 3G6XA 2G08A 1ZQIA 2OXOA 2DUYA 2KE7A 3C1YA 4JV1A 5GTIU 1D8YA 5ALZA 4YR0A 5J2GA 3BQ1A 4Q8FA 1SL0A 3C2MA 3PO5A 2FLLA 3NS1A 4QZCA 7ICTA 5A0LA 5ALFA 1XSPA 1ZD2P 3TFSA 1NJYA 5KFOA 2FMPA 1RXVA 5CB1A 4DEZA 2WF5A 5AI8A 2JH7A 1ZQYA 1PK1A 8ICUA 1TK8A 1KL9A 3BZKA 4KLSA 4QW8A 4JK1A 3RJGA 4QZGA 1Z00B 1LKYB 2Q0ZX 5KFCA 4KLFA 9ICTA 2MU2A 1L7OA 2NYVA 2ZIXB 4RQ1A 8ICVA 4ICAA 2E8OA 4KX5A 4ED1A 4KLMA 4DL5A 4OD0A 5KFMA 4Y2RA 5L1IA 3ZDEA 4PL1A 3SI8A 4JMUA 2W9BB 3RB0A 2KZMA 5DKWA 1F5SA 4YVZA 4TUPA 8ICMA 4IQWA 4QWDA 2VA2A 2OCEA 4MFFA 2IOHA 2XY6A 9ICPA 3NTUA 3G6VA 2B0CA 3H0RB 2BGWA 1ZQEA 5DLGA 5CJ7A 9ICMA 2F77X 4DLGA 3IG8A 3NRZA 4ED6A 5AK3A 4YMNA 4B9MA 4BXOB 5HR6A 5AK4A 5AKEA 4GXIA 3Q8QB 1MC8A 2KJ9A 5IILA 2DKZA 5D46A 3L5KA 1N5WA 5DQHA 3T3FA 3MBYA 2HOFA 4NL9A 2LI6A 1DXSA 2KD1A 3PX6A 3WK6A 5ALPA 4UB5A 4I2JA 2NRTA 1TAQA 3UMGA 3RR7A 9ICFA 2PI4A 2K4IA 4ECZA 4JUZA 4Y2VA 3RF9A 4C8LA 3ETRA 2W8LA 1L3TA 1ZQKA 5AM0A 2LYHA 1UA1A 3MFIA 3KKAA 2IOFA 1V38A 3T79A 4X5VA 1ZJNA 5AKHA 4CCHA 4FFDA 1S77D 4M2YA 1B22A 4O0IA 4P0PB 5JU5A 5DB9A 4NL9C 2VJ5A 3EW9A 3PVXA 1J2NA 4DF4A 3H4DA 1J2MA 5KFXA 2FJ6A 1JN3A 2HOIA 3DEEA 3OHAA 2OWOA 3C28A 3B9JA 2LKYA 4M9LA 3ISDA 3A0BU 1BNOA 3MR2A 2KVSA 2E1FA 4IL6U 2KZ3A 3KBBA 1JMSA 3ORYA 4ELUA 1K1SA 4UB3A 1OXJA 3ICXA 5J0RA 2IHNA 1T94A 2W9CA 4Q45A 3KKAC 3M9MB 4PGXA 1N5XA 3IRUA 2KG5A 4UB1A 1NKBA 2OYYA 3K1ZA 3WKEA 1XU4A 1EXNA 2ZIUA 8ICGA 2JZBB 4O3PA 4RNNA 5DDMA 1ZQJA 5KAIU 2OHFA 5ALIA 2M9NA 3JPSA 1X40A 5DLFA 3UXNA 3TAQA 4QZ8A 2HHXA 1L8LA 5KG6A 4EENA 1UA0A 1ZQMA 5F9LA 2ASDA 3CNHA 4JWNA 4KTQA 4UB2A 2KJ8A 4CGZA 1L8OA 2BZFA 2BHNA 1ZQPA 3KOOA 5EE3A 1NK7A 2UVRA 4DQPA 1ZQ1C 2AU0A 1KQQA 3A0HU 4PL2A 8ICTA 1KBUA 1U48A 3F53A 4RQ0A 4DQRA 2O6KA 4NY8A 1IV8A 2AXTU 1NKEA 2HHUA 8ICLA 1ZQXA 3PNCA 4J9LA 5AHXA 2W8KA 1L3SA 2K4PA 1IIPA 1RQLA 3BJYA 1RG6A 3BZCA 2KMDA 4J9NA 3AQEA 1XC9A 3KHLA 3M9OB 5KFVA 3UQ2A 2EANA 2MUTB 4G9BA 7ICFA 4ELVA 3UXPA 1BPYA 2LHTA 1U47A 4Z6EA 3BS5B 3T5KA 3WKCA 2N1RA 3RB6A 2WAQC 4DFDA 5F3XB 3L3FX 3SEIA 5CRXA 3M8SA 1D9DA 1B0XA 1SKRA 4F72A 3F2DA 3HKZF 2A1JB 1HIWA 3ZDDA 1B43A 2E3TA 4UATA 4P4MA 1ZJMA 2PFPA 1CEZA 2BKEA 4QZ9A 3RBDA 2HVIA 2WTFA 3RAXA 2DGZA 1X42A 2LYAA 3MGIA 4QJFB 8ICPA 2BQUA 3VC8A 4I2GA 7ICHA 1SWWA 2KEYA 4IQTA 2KFNA 2AJQA 4O3SA 5L1MA 4I2FA 1IXRA 2K4HA 2JR5A 3V72A 2ISOA 3LDAA 2P35A 4ECVA 2WFAA 4DSFA 4J9QA 2BDPA 2HCFA 8ICKA 4YMOA 1JXLA 1S0OA 1TK0A 1U9LA 4KLTA 3AMZA 7ICLA 5J2EA 3D2QA 2HBJA 2F8KA 5ALJA 1NK0A 5DB6A 2KNJA 4R63A 4O5EA 2NV3A 2G07A 2ZIVB 4Y2SA 5AKGA 4MHVA 5KG0A 4FS2A 3TANA 1X9WA 4KX3A 4ECQA 2LPEA 9ICIA 4GC6A 3MDAA 3D2NA 4QZEA 2KIVA 5J29A 3N7SC 4R8UA 5C5JA 2A3VA 4ECWA 1RZTA 1KKXA 2V4QA 3N7PD 3C2KA 1RDFA 1TAUA 3Q8PB 5DGBA 9ICRA 4EYIB 2QLTA 3NVYA 3IM1A 4PHDA 2KZZA 2IOFK 3EYZA 1KEJA 1BPDA 1BNPA 3SENA 1RQNA 5CEHA 8ICRA 3Q8KA 3ED5A 4CF5A 4JV2A 1FIQA 2JV3A 2ZUCA 4C4SA 2ZIWA 2JEJA 3HWTA 5ALXA 4C7ZA 3RRHA 4XUSA 1VLBA 1RM6C 3B0XA 5KT3A 3MR6A 4BUGA 5AKJA 1PVRA 4F93B 4RQ6A 1D9FA 2PI5A 1SB3C 5J0UA 1V85A 4KN7A 3CW2C 8ICNA 2KKVA 2QB1A 3THVA 3RJHA 2XC9A 4R66A 2ZUDA 5D49A 4QZIA 4MF8A 1L7PA 2R8IA 3C1ZA 3N28A 4KMUA 3ALRA 3BQ0A 4P0QB 1ZETA 5CWRA 5KFIA 1ZQDA 3RJJA 2FLPA 2K89A 2NO5A 3GU3A 1BPEA 1PK3A 2WF8A 1CI4A 2A19A 5JUMA 3O0FA 5G5HA 7ICKA 1YZ7A 3PW4A 3OHBA 1JXEA 2H3FA 2BCSA 4IS7A 4KLEA 5ALUA 5C0YA 5KFTA 1Q3UA 3JPPA 3I28A 2JEIA 4UB4A 8ICJA 1RXWA 1O08A 1A77A 5KNIA 2HBLA 5ALVA 4KLGA 1KFTA 3RJFA 4E0DA 4Y2YA 8ICFA 2H3QA 4F50A 3SV4A 4EEYA 5KFZA 1TVAA 3WK8A 3MABA 3EPIA 1UPHA 1KLNA 4O5CA 3C5GA 4QZBA 2QB0B 1RYUA 1JIHA 2NRWA 2CPRA 9ICJA 3PW2A 3WKDA 4RQ5A 5L1KA 5DG7A 2VANA 4RPYA 1NJZA 3CRXA 3DDHA 4DSIA 3WK9A 2XGQA 3IN5A 2BQ3A 5J2FA 3AQFA 8ICIA 1WWVA 2HHQA 3K1RB 1PVPA 5DB8A 4DSKA 5J0YA 4J9RA 4DQQA 4KLUA 1NK6A 1MQ3A 4DL6A 3RFAA 2PMZF 1C20A 4ED2A 2WF7A 4ACOA 5DBCA 1BPXA 3L4PA 4YN4A 5ALRA 2BCQA 3ZD8A 2HMXA 1XSNA 4PJ0U 5G5GA 5TZVA 1ZQQA 2W3SA 1ED1A 3OSNA 1NJXA 3HRDD 2H3ZA 5AM2A 2KFZA 4UAZA 2YTUA 1ZQOA 2FI1A 4NLBA 3M7DA 3PSPA 4F92B 1JUDA 1JALA 5AKZA 1PK1B 4US8A 2W9AA 2AHOB 2G09A 1FFUA 5KFAA 4QNLA 2XY5A 4P2HA 4RQ2A 2HW3A 2FPMA 1XWLA 4KLJA 4ED7A 4U6PA 3Q8LA 1ZRMA 3HPOA 1UT5A 4GC7A 4OJ6A 3N4MB 4F5OA 5J2BA 5J0OA 2K8BB 4F4XA 4IRCA 1KSPA 4YR2A 2E8NA 1U45A 4M9GA 3QZ8A 4NLKA 5AM4A 1LVHA 2NRZA 4QZAA 5J2JA 3GIIA 2DQNB 3IHQB 1Q3VA 2RP5A 5L9XA 5CP2A 4LZGA 2ES6A 1MA7A 4G3IA 1QTMA 2K60A 3I76A 4ZOHC 2R8KA 3SV3A 2ISPA 4M9NA 1NOMA 3LWLA 2F1JA 4LJXA 1S76D 4C8MA 5CR0A 2WB1C 2PFOA 4HYKA 2E5SA 3FDSA 4QW9A 2R8HA 3RH4A 1QSSA 2P6RA 5KFPA 7ICNA 4C4TA 3H0LB 3HT3A 3WU2U 7ICJA 3QE9Y 7ICQA 1SZPA 3HX0A 1C7YA 3QXGA 3AU2A 1UQVA 2EDUA 2BDUA 5EE1A 4Y2QA 1T4GA 2JRZA 3AU6A 4PH5A 4XRHA 4RUCA 2I6XA 3KFUF 3CYMA 3QU5A 3UQ0A 1COOA 2H3IA 5KG2A 1PZNA 2UVUA 4AYBF 4UAYA 5IIOA 5FP0A 1KRPA 2VA3A 2P66A 3RB3A 3H8JA 4DSJA 1ZXIA 4QIWC 2R8JA 4OO1J 3RJKA 2DBYA 4EEKA 1Q8KA 3C21A 3SQIA 3V6KA 2ASLA 1KW4A 2C28A 2AGPA 3EWAA 5H2FU 2ZJ5A 5KG5A 2DWQA 8ICQA 4J9KA 1AQ6A 3D6JA 1L6NA 2GWSA 5HHHA 4IR1A 5J0WA 1LB2B 4RQ8A 7ICOA 2JGAA 1P7DA 2MSNA 5ALSA 3AUOA 4DFKA 5KAFU 4UARA 1T8EA 5EWEA 3PR5B 3RJIA 4F71A 5KFUA 2PFQA 4NV0A 2W3RA 2YMLA 4DOBA 2KV2A 5J2AA 9ICVA 1O03A 3H8WA 4DFMA 4BDPA 1UHUA 4XA5A 2Y1JA 1WWUA 5EE0A 4IRKA 9ICWA 2ODGA 1WG8A 4TUQA 2H3VA 2K8CB 2W9CB 1A0PA 3IDWA 1N61A 4FBTA 2AH5A 3VCBA 1UCVA 4F5NA 2DKXA 5KFSA 2ZIUB 1BPZA 3ZDCA 3SD7A 1DRGA 4F4ZA 1OUQA 3GV5B 2OEHA 4DOAA 4PGQA 4MFAA 3E0FA 3V7LA 4JWMA 2ESEA 1TAMA 1JX4A 2W43A 4RT2A 1TV9A 1S0VA 3PV8A 4PHEA 2C2EA 4CE6A 2W55A 4Y2PA 4OCZA 1N48A 2KOBA 2Y0SC 3MR5A 5KT4A 4C8OA 1DGSA 2Q4TA 3PMNA 4PZNA 4F5QA 2KICA 8ICWA 1VJ5A 2HVHA 2W11A 5J0TA 1ZOLA 2YMQA 4BX9C 4TQSA 1M6YA 9ICAA 7ICVA 2VIXA 4YFKA 4C0ZA 8ICYA 2IBKA 3GDXA 1X9SA 2OM6A 2W7OA 4USAA 1ZQSA 3G6YA 4C8NA 5KFRA 4DQIA 4M47A 1BPBA 5E79U 2BQRA 5DBAA 2JHDA 4F2RA 2ZTCA 5AM3A 1S8OA 2QARA 1S9FA 4BWMA 1RPLA 3K75D 3LVWA 1SL1A 1Z3EB 4ECTA 3TI0A 1Z19A 2YB1A 5ALOA 5DGAA 7ICGA 1A6SA 3U26A 3HJEA 1KN5A 2LM1A 4UBBA 1QQ6A 4RUAA 2XO7A 3GIMA 1NJWA 2KSOA 3PX4A 5AIBA 4F8RA 3RH6A 2CN1A 1S0MA 2FPKA 1HEKA 2LMRA 5EWFA 3ISBA 1N60A 3NRWA 3C23A 4KITB 4M6WA 3V6HA 5ALNA 4MF2A 2GH1A 4WJ3B 5ALTA 2EZYA 5BOLA 1ZQHA 2EH9A 4I2HA 8ICBA 2F8LA 4YP3A 2FLNA 1K1QA 1YT3A 1S0NA 4ZH4A 3ISCA 5J2HA 4GXJA 3EPGA 2WF6A 4DL2A 2KHVA 5J0SA 5DDYA 5J0QA 3RH5A 2XI9A 3WK7A 1XNSA 2YQEA 3RJEA 4F3OA 3HILA 8ICAA 3WK4A 3UXOA 4M9HA 4TQRA 3F2BA 1L3VA 3QZ7A 5L1JA 4C4RA 5KFHA 2AGOA 1IG6A 1N56A 1V97A 3JPRA 4I29A 3NUQA 1X6IA 2NRVA 1SKSA 1S97A 3SR6A 4R8UB 4GLXA 2E8PA 3SAFA 1NKCA 9ICXA 1NNLA 1KTQA 4YMMA 2K8AA 2DL0A 5J0XA 4FBUA 5AK5A 4I2BA 2HHVA 1X9XA 3TACB 2BR0A 2VJ4A 3KHRA 3NVZA 1ZQVA 4ECRA 3GFKB 4O3OA 2EZZA 4YD2A 2XCPA 2YN4A 2JEGA 2AQ4A 5T14A 2KJ5A 2Z7JA 2NRXA 4Y2TA 4DFPA 7ICUA 1SV0A 1NK8A 2ZIWB 4EX6A 8ICEA 1ZD3A 2I1QA 2CXYA 1MSWD 1FEZA 1SZHA 4I2DA 3PZPA 4P4OA 5ALMA 1S5LU 4QZHA 2KVCA 4JB3A 2ZJAA 4CNQA 5KG1A 8ICHA 1T3NA 2KIWA 2WAQF 4RT3A 1X66A 3V7JA 3KHHA 4EZ9A 3PW7A 3OJUA 5HP4A 3BDPA 2F44A 3SAHA 4ECUA 4M04A 8ICSA 1N63A 3QUTA 1TE2A 3M9NB 4EBCA 4K4HA 3FYHA 1UT8A 3QU9A 1OW5A 4J9MA 4ED0A 2FDRA 3GV7B 1L7NA 3SAGA 4NLNA 5KG4A 4UQGA 4DLEA 1GO3F 8ICXA 3TQ1A 1LV5A 5AK6A 1SV0C 1F44A 3H40A 2RQ5A 4CDGA 2E8MA 1HUOA 4K4IA 5AI4A 2I9GA 5KT2A 2IA6A 2F2AB 2GO7A 3PR4A 4DCCA 4DO9A 1NK9A 9ICNA 2HHWA 5KFLA 1SXDA 4UB8U 4O3QA 5KT6A 1Z4NA 2YMMA 3CP8A 9ICGA 3QU4A 2WF9A 4EBEA 3KHGA 3PW0A 1D8LA 5J2CA 2KHQA 9ICEA 5HMLA 3WKBA 4OJOA 5ALHA 2BCUA 2J6TA 2VA8A 4QZFA 4J9SA 2D8CA 4ELTA 8ICOA 1DK3A 4Q43A 5DBBA 4FE3A 4C8KA 3GIKA 4F4YA 3GQCA 4O3RA 4J9OA 4CF3A 4LZDA 3Q8SB 1Q46A 1BGXT 2P6UA 4ED8A 3ZI4A 3TARA 4ECXA 3V6JA 4EELA 5ALGA 4UBCA 4MEXA 3GILA 4KLDA 1XS9D 3M1YA 3KTQA 3ONNA 5KFYA 1Z00A 4GXKA 1LKYA 4KLLA 4FO6A 1QH9A 9ICHA 4B9LA 1ZQWA 3M8RA 2M0NA 3D2SA 2ALZA 2EAMA 2ZIXA 5KFQA 2W03A 4CRXA 2MRLA 4M0AA 1FO4A 4YQWA 4O9MA 2YB4A 5HR7A 4GIBA 3AL0B 1ZQAA 3MFHA 4B6JA 3HP6A 1D8BA 2W9BA 1WUDA 3QEAZ 2BPFA 4FZLA 2EAOA 1AROP 3QEBZ 3IV6A 4CF4A 4QWCA 4RQ3A 2BCRA 5J2DA 3J81j 2RDJA 4B9TA 4BWJA 3ZDBA 1L3UA 4GFJA 5AICA 2Y1IA 3E58A 3BQ7A 3I1YA 1HUZA 2XIDA 5CA7A 4RPXA 4UB6U 1J97A 4BXOA 1DOQA 4U7CA 2PFNA 2C2RA 4I2EA 1Z1BA 4DFJA 2FMQA 9ICBA 1TK5A 8ICZA 3H7IA 4Q8EA 4Y2XA 4KLHA 2ZTEA 8ICCA 2DF4B 5DQGA 3QU2A 2KTQA 7ICMA 9ICQA 2ASJA 1T3QA 2W04A 4EZ6A 5IIIA 3LK9A 4B9UA 1L7MA 4YD1A 1PUZA 3WK5A 3C2LA 3RAQA 3N97B 2BCVA 4O3NA 4RNOA 5ALLA 3RBEA 1JI7A 3OSPA 4FZNA 5JTIA 5D4BA 4IC9A 1K5OA 1QLNA 1F0MA 2F76X 5DG8A 5ALYA 1Z4OA 5JRTA 4QWAA 3ETLA 2C22A 4DQSA 3RR8A 1B4FA 2XY7A 1QCKA 1ZQGA 3LYSA 5B5EU 4RU9A 4F4KA 4RQNA 5KL8B 5IIJA 5KFGA 3MDCA 5KT5A 5KFWA 3AM9A 2W7PA 2HBMA 3QU7A 2RDIA 2JEFA 4NM2A 4P0PA 4F91B 2BPCA 2CRXA 2UVWA 1QSLA 2L5YA 1COKA 3NVVA 3HKZC 2EAPA 4K4GA 1Y88A 3PO4A 2R18A 3S6JA 4M9JA 5KG7A 4DL4A 1U49A 2A1AA 5IIKA 1CRXA 4EYHB
chains in the Genus database with same CATH topology
2K8AA 2E5SA 4GFJA 3RF9A 3LVWA 1ECWA 1NZBA 2KKVA 3M6KA 3CP8A 3PSFA 2ZXHA 2K4HA 2JH1A 2K4EA 2YB1A 1Z19A 3F5EA 2XIDA 3RFAA 3H0LB 2MA1A 2PMZF 2VJ4A 4FZMA 2H3VA 2K8CB 2KJ8A 4U7CA 2KKPA 4CGZA 1A0PA 1A6SA 4ACOA 2KHQA 2ZIXB 4OJLA 1Z1BA 3VCBA 4ICAA 3T79A 3M6ZA 2BDUA 2G5HB 2ZG6A 4OJOA 2ZIUB 1ZQ1C 3ALRA 3GZFA 5T14A 4KX5A 3OPXA 3MGVA 2KJ5A 4P0QB 2Z7JA 4OJ5A 3D2QA 2HBJA 2PMZC 4PL2A 1DRGA 2HMXA 1KBUA 1OUQA 4P0PB 2YX8A 1ED1A 3F53A 2KNJA 2ZIWB 2DF4B 4FE3A 2E1EA 4PL1A 2K89A 2G07A 2H3ZA 2NV3A 2ZIVB 2VJ5A 3CYMA 3GU3A 4JMUA 2Y0SF 4NLBA 3KFUF 3IG5A 3KZXA 3E0FA 1SZHA 2XICA 3M7DA 3PSPA 4QIWF 2CN1A 2W04A 3PZPA 1TAMA 1URJA 3C29A 1HEKA 4KX3A 3O0FA 2H3IA 5KL1B 3F2CA 3NRWA 3PSTA 2KVCA 2XVTA 3D2NA 2HOIA 2G09A 3DEEA 4AYBF 3N7SC 1IIPA 3C28A 4QNLA 2H3FA 2A3VA 2LKYA 1CRXA 2GH1A 3SMVA 4WJ3B 2G0AA 2KOBA 2Y0SC 5C0YA 2RRDA 2E1FA 4FZNA 2G06A 2ZXIA 2Q4TA 3H0RB 4IC9A 1Q3UA 4QIWC 3ONNA 2F76X 2KIWA 4OO1J 2WAQF 2LBOA 4A8EA 4U6PA 3AQEA 3N7PD 2F8LA 3SQIA 2KICA 3ICXA 2F77X 1YT3A 3IG8A 4AYBC 3SAHA 2HBLA 2VKQA 2HOQA 2RHFA 5HR6A 4OJ6A 1T94A 2D6FC 2M0NA 3LYSA 2OH2A 2LHTA 3D2SA 2LYBA 2H3QA 2N1RA 2ZIXA 2WAQC 2G08A 3SAGA 2KHVA 5KL8B 3L3FX 2OXOA 2W03A 2KJ9A 2K8BB 4BX9C 2OYYA 4CRXA 3K1ZA 5CRXA 1L6NA 1UPHA 2HBKA 4OJPA 2MRLA 2VIXA 1GO3F 2ZIUA 3LVVA 2JMGA 4BJQA 2XI9A 4C0ZA 2W7PA 3HKZF 2HBMA 4P0QA 3F2DA 1XNSA 4O3MA 2YB4A 4NWIA 1HIWA 2JGAA 1P7DA 5HR7A 3N7RC 4P0PA 3AL0B 3F2BA 3H0MB 1F44A 2OM6A 2ZIWA 4NLCA 2CRXA 5A0LA 2HOFA 3IP4B 2W7OA 2CPRA 1D8BA 2ZIVA 2DQNB 1Q3VA 2GOLA 1WUDA 2RP5A 4CDGA 2WB1F 4FZLA 2KD1A 2DGZA 2LYAA 4QJFB 3NUQA 1MA7A 3HKZC 2F2AB 2JH7A 2R18A 3CRXA 3VC8A 4BUGA 2JHDA 4NV0A 3IN5A 3PSIA 2KEYA 3SAFA 4KMOB 2KV2A 1PVQA 1PVRA 2K4IA 2G5IB 3AQFA 2WB1C 3F5AA 1XO0A 1PVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 J;  2E1E A;  4NLC A;  2CPR A;  1D8B A;  3CYM A;  1YT3 A;  3SAH A;  4NLB A;  2HBL A;  1WUD A;  4CDG A;  4QIW F;  2MA1 A;  2RHF A;  2DGZ A;  4QJF B;  4CGZ A;  3SAG A;  3SAF A;  2HBK A;  1GO3 F;  2KV2 A;  5C0Y A;  4O3M A;  2RRD A;  2E1F A;  2HBM A;  2HBJ A; 
#chains in the Genus database with same CATH topology
 7ICS A;  4QZD A;  4I2I A;  2ZUB A;  2F3N A;  4IRD A;  4RQM A;  4DL7 A;  3M6K A;  3QYP A;  1SGG A;  3F5E A;  4RPZ A;  2KKP A;  4Y2U A;  4OJL A;  4UAU A;  1X6J A;  3M6Z A;  4Q44 A;  1JRO A;  2JZB A;  5DQI A;  4UAV A;  1DGJ A;  2V4R A;  4RQ7 A;  1Z1V A;  2IHM A;  1NK4 A;  4IR9 A;  3H8M A;  3T5L A;  1URJ A;  3AN1 A;  2ZTD A;  3QX7 A;  7ICP A;  4J03 A;  4F4W A;  4R65 A;  3T5J A;  4I2A A;  2ATL A;  1MQ2 A;  4UAW A;  4Z6F A;  4YXM A;  2G06 A;  2KK0 A;  2KN7 A;  3LWM A;  5ALE A;  2LBO A;  4C80 A;  4Z6C A;  1QQ5 A;  1N2X A;  2B21 A;  4NJ8 A;  4DWI A;  9ICK A;  5EOZ A;  1ZRN A;  3R9K A;  3MR3 A;  2HOQ A;  4PZO A;  5AI0 A;  2D6F C;  3Q8M A;  1SXE A;  1L5U A;  1MN8 A;  2LYB A;  3V7K A;  4YG2 A;  5KT7 A;  3H8S A;  2D3D A;  2HBK A;  9ICS A;  2JMG A;  4FS1 A;  2F1H A;  3N7R C;  3H0M B;  4NLC A;  3KD3 A;  5AI5 A;  5IIM A;  1SL2 A;  3NVW A;  5DG9 A;  3EUB 2;  2J6S A;  7ICE A;  1WYG A;  2GOL A;  2WB1 F;  1NZP A;  4O5K A;  5ALK A;  4C7Y A;  2YY6 A;  4UW9 A;  3RTV A;  5AKX A;  5ALW A;  2EZX A;  3BQT A;  4TUS A;  4NLZ A;  3KZI U;  4KMO B;  4NLG A;  4YCX A;  4KLI A;  1XO0 A;  5KFE A;  1ECW A;  3PML A;  3BQ2 A;  4IQU A;  2EQY A;  1ZD5 A;  2K4E A;  2MUT A;  3TAD A;  1KFD A;  5GTH U;  5IIN A;  4KLO A;  5ALQ A;  2MA1 A;  5AM5 A;  4FZM A;  4I27 A;  1U4B A;  9ICL A;  3ZDA A;  3BS5 A;  4Z6D A;  1VDV A;  4IQV A;  4F5P A;  5ALD A;  3H4B A;  3NGD A;  4DSL A;  2G5H B;  3MGH A;  4OJ5 A;  2A1J A;  1N62 A;  2WHE A;  3K4G A;  2YX8 A;  2LM4 A;  3UPQ A;  2E1E A;  2RLT A;  3DV9 A;  3QUB A;  4QWE A;  3UMB A;  3IG5 A;  4J9P A;  2XIC A;  4QIW F;  2DPI A;  4MFC A;  3NAS A;  3C29 A;  5L1L A;  5KFF A;  3PST A;  2XVT A;  2XGP A;  2FE9 A;  4Y2J A;  2G0A A;  4PHP A;  2RRD A;  2QAR B;  2HSZ A;  3C5F A;  2MAX A;  5KFN A;  4A8E A;  2GLE A;  2W54 A;  3TAD C;  4YR3 A;  5KG3 A;  2R8G A;  3OTQ A;  3MC1 A;  3B0Y A;  4F5R A;  5CHG A;  2HDO A;  3UM9 A;  1QQ7 A;  3JPN A;  1ZQC A;  2DPJ A;  4RZR A;  3TAP A;  2YMP A;  4OJP A;  5AIA A;  2AGQ A;  3LVV A;  4O3M A;  4EX7 A;  4NWI A;  1X9M A;  2KSO B;  4B9N A;  4BGD A;  5AI9 A;  3IP4 B;  2ZIV A;  1RYS A;  4EBD A;  4ECS A;  1KFS A;  4UAS A;  4KLQ A;  3HW8 A;  1FFV A;  3Q8R B;  1XSL A;  1WCN A;  5F9N A;  1SWV A;  4M6W B;  3PSI A;  5KFK A;  4ED3 A;  2G5I B;  3F5A A;  4XQ8 A;  5EWG A;  2Y9T A;  3ZD9 A;  3RRG A;  5KFD A;  2JH1 A;  1QSY A;  4JV0 A;  1ZQN A;  4DF8 A;  3UMC A;  5B66 U;  1ZD4 A;  4AP9 A;  5K4L A;  2ZG6 A;  3FM9 A;  3OPX A;  3OGU A;  4PGY A;  7ICI A;  2PMZ C;  4DS5 A;  2HHS A;  3FC4 A;  4DL3 A;  4LVS A;  2FMS A;  3SYZ A;  1KDH A;  1ZQB A;  2Y0S F;  4RQ4 A;  5J8Y A;  3JPT A;  4DSE A;  4PPX A;  4US9 A;  3OJS A;  3F2C A;  1T7P A;  1HJP A;  5AKY A;  3SMV A;  3GV8 B;  3PW5 A;  2ZXI A;  5AKK A;  2ZJ8 A;  2W9M A;  4NXZ A;  4RNM A;  4QWB A;  5TIS U;  4YXJ A;  3JPO A;  4KN4 A;  3BS7 A;  1ZQU A;  7ICR A;  1SV4 A;  4HAI A;  1BVS A;  4F2S A;  4BJQ A;  3SZ2 A;  1X2I A;  4PHA A;  4P0Q A;  9ICO A;  3QNM A;  9ICC A;  4R64 A;  1ZQR A;  9ICU A;  1WCL A;  2I5H A;  3PX0 A;  4NM1 A;  4MEY A;  2UVV A;  2PXI A;  2QKQ A;  5AKL A;  4B9V A;  5J8Y C;  1ZQT A;  2NO4 A;  3GIJ A;  5KFJ A;  4I28 A;  3E2E A;  1NI3 A;  5KFB A;  2JXJ A;  2BPG A;  3QUQ A;  1V9P A;  2KP7 A;  1CUK A;  5HMM A;  1PVQ A;  1SIJ A;  1ZQF A;  1ZYQ A;  1NZB A;  5HHI A;  3PSF A;  5AKI A;  2ZXH A;  4DS4 A;  2DFL A;  2HHT A;  2V9W A;  2B6G A;  3WKA A;  1JRP A;  3PY8 A;  4DOC A;  3JPQ A;  4B9S A;  3GZF A;  3MGV A;  5KTQ A;  5BOM A;  5HNK A;  1RYR A;  4TUR A;  2C2D A;  2QB0 A;  3FAH A;  4I2C A;  3QUC A;  1S10 A;  2J6U A;  1A76 A;  2AQ0 A;  2OH2 A;  1TKD A;  3KZX A;  4P4P A;  5J2I A;  2Y9U A;  5KL1 B;  3RB4 A;  1SKW A;  1ZQZ A;  1YZ6 A;  5BPC A;  2F1I A;  1XO1 A;  3TFR A;  5AM1 A;  5J0P A;  2IMW P;  2FPL A;  3EZ5 A;  2H5X A;  3AEV A;  1H38 A;  4ECY A;  1DK2 A;  1ZQL A;  2XCA A;  5DB7 A;  4AYB C;  1IM4 A;  2VKQ A;  5EE9 A;  1NK5 A;  2RHF A;  2HI0 A;  5AI6 A;  1TFR A;  2PKE A;  3TKA A;  3T5H A;  5J2K A;  3G6X A;  2G08 A;  1ZQI A;  2OXO A;  2DUY A;  2KE7 A;  3C1Y A;  4JV1 A;  5GTI U;  1D8Y A;  5ALZ A;  4YR0 A;  5J2G A;  3BQ1 A;  4Q8F A;  1SL0 A;  3C2M A;  3PO5 A;  2FLL A;  3NS1 A;  4QZC A;  7ICT A;  5A0L A;  5ALF A;  1XSP A;  1ZD2 P;  3TFS A;  1NJY A;  5KFO A;  2FMP A;  1RXV A;  5CB1 A;  4DEZ A;  2WF5 A;  5AI8 A;  2JH7 A;  1ZQY A;  1PK1 A;  8ICU A;  1TK8 A;  1KL9 A;  3BZK A;  4KLS A;  4QW8 A;  4JK1 A;  3RJG A;  4QZG A;  1Z00 B;  1LKY B;  2Q0Z X;  5KFC A;  4KLF A;  9ICT A;  2MU2 A;  1L7O A;  2NYV A;  2ZIX B;  4RQ1 A;  8ICV A;  4ICA A;  2E8O A;  4KX5 A;  4ED1 A;  4KLM A;  4DL5 A;  4OD0 A;  5KFM A;  4Y2R A;  5L1I A;  3ZDE A;  4PL1 A;  3SI8 A;  4JMU A;  2W9B B;  3RB0 A;  2KZM A;  5DKW A;  1F5S A;  4YVZ A;  4TUP A;  8ICM A;  4IQW A;  4QWD A;  2VA2 A;  2OCE A;  4MFF A;  2IOH A;  2XY6 A;  9ICP A;  3NTU A;  3G6V A;  2B0C A;  3H0R B;  2BGW A;  1ZQE A;  5DLG A;  5CJ7 A;  9ICM A;  2F77 X;  4DLG A;  3IG8 A;  3NRZ A;  4ED6 A;  5AK3 A;  4YMN A;  4B9M A;  4BXO B;  5HR6 A;  5AK4 A;  5AKE A;  4GXI A;  3Q8Q B;  1MC8 A;  2KJ9 A;  5IIL A;  2DKZ A;  5D46 A;  3L5K A;  1N5W A;  5DQH A;  3T3F A;  3MBY A;  2HOF A;  4NL9 A;  2LI6 A;  1DXS A;  2KD1 A;  3PX6 A;  3WK6 A;  5ALP A;  4UB5 A;  4I2J A;  2NRT A;  1TAQ A;  3UMG A;  3RR7 A;  9ICF A;  2PI4 A;  2K4I A;  4ECZ A;  4JUZ A;  4Y2V A;  3RF9 A;  4C8L A;  3ETR A;  2W8L A;  1L3T A;  1ZQK A;  5AM0 A;  2LYH A;  1UA1 A;  3MFI A;  3KKA A;  2IOF A;  1V38 A;  3T79 A;  4X5V A;  1ZJN A;  5AKH A;  4CCH A;  4FFD A;  1S77 D;  4M2Y A;  1B22 A;  4O0I A;  4P0P B;  5JU5 A;  5DB9 A;  4NL9 C;  2VJ5 A;  3EW9 A;  3PVX A;  1J2N A;  4DF4 A;  3H4D A;  1J2M A;  5KFX A;  2FJ6 A;  1JN3 A;  2HOI A;  3DEE A;  3OHA A;  2OWO A;  3C28 A;  3B9J A;  2LKY A;  4M9L A;  3ISD A;  3A0B U;  1BNO A;  3MR2 A;  2KVS A;  2E1F A;  4IL6 U;  2KZ3 A;  3KBB A;  1JMS A;  3ORY A;  4ELU A;  1K1S A;  4UB3 A;  1OXJ A;  3ICX A;  5J0R A;  2IHN A;  1T94 A;  2W9C A;  4Q45 A;  3KKA C;  3M9M B;  4PGX A;  1N5X A;  3IRU A;  2KG5 A;  4UB1 A;  1NKB A;  2OYY A;  3K1Z A;  3WKE A;  1XU4 A;  1EXN A;  2ZIU A;  8ICG A;  2JZB B;  4O3P A;  4RNN A;  5DDM A;  1ZQJ A;  5KAI U;  2OHF A;  5ALI A;  2M9N A;  3JPS A;  1X40 A;  5DLF A;  3UXN A;  3TAQ A;  4QZ8 A;  2HHX A;  1L8L A;  5KG6 A;  4EEN A;  1UA0 A;  1ZQM A;  5F9L A;  2ASD A;  3CNH A;  4JWN A;  4KTQ A;  4UB2 A;  2KJ8 A;  4CGZ A;  1L8O A;  2BZF A;  2BHN A;  1ZQP A;  3KOO A;  5EE3 A;  1NK7 A;  2UVR A;  4DQP A;  1ZQ1 C;  2AU0 A;  1KQQ A;  3A0H U;  4PL2 A;  8ICT A;  1KBU A;  1U48 A;  3F53 A;  4RQ0 A;  4DQR A;  2O6K A;  4NY8 A;  1IV8 A;  2AXT U;  1NKE A;  2HHU A;  8ICL A;  1ZQX A;  3PNC A;  4J9L A;  5AHX A;  2W8K A;  1L3S A;  2K4P A;  1IIP A;  1RQL A;  3BJY A;  1RG6 A;  3BZC A;  2KMD A;  4J9N A;  3AQE A;  1XC9 A;  3KHL A;  3M9O B;  5KFV A;  3UQ2 A;  2EAN A;  2MUT B;  4G9B A;  7ICF A;  4ELV A;  3UXP A;  1BPY A;  2LHT A;  1U47 A;  4Z6E A;  3BS5 B;  3T5K A;  3WKC A;  2N1R A;  3RB6 A;  2WAQ C;  4DFD A;  5F3X B;  3L3F X;  3SEI A;  5CRX A;  3M8S A;  1D9D A;  1B0X A;  1SKR A;  4F72 A;  3F2D A;  3HKZ F;  2A1J B;  1HIW A;  3ZDD A;  1B43 A;  2E3T A;  4UAT A;  4P4M A;  1ZJM A;  2PFP A;  1CEZ A;  2BKE A;  4QZ9 A;  3RBD A;  2HVI A;  2WTF A;  3RAX A;  2DGZ A;  1X42 A;  2LYA A;  3MGI A;  4QJF B;  8ICP A;  2BQU A;  3VC8 A;  4I2G A;  7ICH A;  1SWW A;  2KEY A;  4IQT A;  2KFN A;  2AJQ A;  4O3S A;  5L1M A;  4I2F A;  1IXR A;  2K4H A;  2JR5 A;  3V72 A;  2ISO A;  3LDA A;  2P35 A;  4ECV A;  2WFA A;  4DSF A;  4J9Q A;  2BDP A;  2HCF A;  8ICK A;  4YMO A;  1JXL A;  1S0O A;  1TK0 A;  1U9L A;  4KLT A;  3AMZ A;  7ICL A;  5J2E A;  3D2Q A;  2HBJ A;  2F8K A;  5ALJ A;  1NK0 A;  5DB6 A;  2KNJ A;  4R63 A;  4O5E A;  2NV3 A;  2G07 A;  2ZIV B;  4Y2S A;  5AKG A;  4MHV A;  5KG0 A;  4FS2 A;  3TAN A;  1X9W A;  4KX3 A;  4ECQ A;  2LPE A;  9ICI A;  4GC6 A;  3MDA A;  3D2N A;  4QZE A;  2KIV A;  5J29 A;  3N7S C;  4R8U A;  5C5J A;  2A3V A;  4ECW A;  1RZT A;  1KKX A;  2V4Q A;  3N7P D;  3C2K A;  1RDF A;  1TAU A;  3Q8P B;  5DGB A;  9ICR A;  4EYI B;  2QLT A;  3NVY A;  3IM1 A;  4PHD A;  2KZZ A;  2IOF K;  3EYZ A;  1KEJ A;  1BPD A;  1BNP A;  3SEN A;  1RQN A;  5CEH A;  8ICR A;  3Q8K A;  3ED5 A;  4CF5 A;  4JV2 A;  1FIQ A;  2JV3 A;  2ZUC A;  4C4S A;  2ZIW A;  2JEJ A;  3HWT A;  5ALX A;  4C7Z A;  3RRH A;  4XUS A;  1VLB A;  1RM6 C;  3B0X A;  5KT3 A;  3MR6 A;  4BUG A;  5AKJ A;  1PVR A;  4F93 B;  4RQ6 A;  1D9F A;  2PI5 A;  1SB3 C;  5J0U A;  1V85 A;  4KN7 A;  3CW2 C;  8ICN A;  2KKV A;  2QB1 A;  3THV A;  3RJH A;  2XC9 A;  4R66 A;  2ZUD A;  5D49 A;  4QZI A;  4MF8 A;  1L7P A;  2R8I A;  3C1Z A;  3N28 A;  4KMU A;  3ALR A;  3BQ0 A;  4P0Q B;  1ZET A;  5CWR A;  5KFI A;  1ZQD A;  3RJJ A;  2FLP A;  2K89 A;  2NO5 A;  3GU3 A;  1BPE A;  1PK3 A;  2WF8 A;  1CI4 A;  2A19 A;  5JUM A;  3O0F A;  5G5H A;  7ICK A;  1YZ7 A;  3PW4 A;  3OHB A;  1JXE A;  2H3F A;  2BCS A;  4IS7 A;  4KLE A;  5ALU A;  5C0Y A;  5KFT A;  1Q3U A;  3JPP A;  3I28 A;  2JEI A;  4UB4 A;  8ICJ A;  1RXW A;  1O08 A;  1A77 A;  5KNI A;  2HBL A;  5ALV A;  4KLG A;  1KFT A;  3RJF A;  4E0D A;  4Y2Y A;  8ICF A;  2H3Q A;  4F50 A;  3SV4 A;  4EEY A;  5KFZ A;  1TVA A;  3WK8 A;  3MAB A;  3EPI A;  1UPH A;  1KLN A;  4O5C A;  3C5G A;  4QZB A;  2QB0 B;  1RYU A;  1JIH A;  2NRW A;  2CPR A;  9ICJ A;  3PW2 A;  3WKD A;  4RQ5 A;  5L1K A;  5DG7 A;  2VAN A;  4RPY A;  1NJZ A;  3CRX A;  3DDH A;  4DSI A;  3WK9 A;  2XGQ A;  3IN5 A;  2BQ3 A;  5J2F A;  3AQF A;  8ICI A;  1WWV A;  2HHQ A;  3K1R B;  1PVP A;  5DB8 A;  4DSK A;  5J0Y A;  4J9R A;  4DQQ A;  4KLU A;  1NK6 A;  1MQ3 A;  4DL6 A;  3RFA A;  2PMZ F;  1C20 A;  4ED2 A;  2WF7 A;  4ACO A;  5DBC A;  1BPX A;  3L4P A;  4YN4 A;  5ALR A;  2BCQ A;  3ZD8 A;  2HMX A;  1XSN A;  4PJ0 U;  5G5G A;  5TZV A;  1ZQQ A;  2W3S A;  1ED1 A;  3OSN A;  1NJX A;  3HRD D;  2H3Z A;  5AM2 A;  2KFZ A;  4UAZ A;  2YTU A;  1ZQO A;  2FI1 A;  4NLB A;  3M7D A;  3PSP A;  4F92 B;  1JUD A;  1JAL A;  5AKZ A;  1PK1 B;  4US8 A;  2W9A A;  2AHO B;  2G09 A;  1FFU A;  5KFA A;  4QNL A;  2XY5 A;  4P2H A;  4RQ2 A;  2HW3 A;  2FPM A;  1XWL A;  4KLJ A;  4ED7 A;  4U6P A;  3Q8L A;  1ZRM A;  3HPO A;  1UT5 A;  4GC7 A;  4OJ6 A;  3N4M B;  4F5O A;  5J2B A;  5J0O A;  2K8B B;  4F4X A;  4IRC A;  1KSP A;  4YR2 A;  2E8N A;  1U45 A;  4M9G A;  3QZ8 A;  4NLK A;  5AM4 A;  1LVH A;  2NRZ A;  4QZA A;  5J2J A;  3GII A;  2DQN B;  3IHQ B;  1Q3V A;  2RP5 A;  5L9X A;  5CP2 A;  4LZG A;  2ES6 A;  1MA7 A;  4G3I A;  1QTM A;  2K60 A;  3I76 A;  4ZOH C;  2R8K A;  3SV3 A;  2ISP A;  4M9N A;  1NOM A;  3LWL A;  2F1J A;  4LJX A;  1S76 D;  4C8M A;  5CR0 A;  2WB1 C;  2PFO A;  4HYK A;  2E5S A;  3FDS A;  4QW9 A;  2R8H A;  3RH4 A;  1QSS A;  2P6R A;  5KFP A;  7ICN A;  4C4T A;  3H0L B;  3HT3 A;  3WU2 U;  7ICJ A;  3QE9 Y;  7ICQ A;  1SZP A;  3HX0 A;  1C7Y A;  3QXG A;  3AU2 A;  1UQV A;  2EDU A;  2BDU A;  5EE1 A;  4Y2Q A;  1T4G A;  2JRZ A;  3AU6 A;  4PH5 A;  4XRH A;  4RUC A;  2I6X A;  3KFU F;  3CYM A;  3QU5 A;  3UQ0 A;  1COO A;  2H3I A;  5KG2 A;  1PZN A;  2UVU A;  4AYB F;  4UAY A;  5IIO A;  5FP0 A;  1KRP A;  2VA3 A;  2P66 A;  3RB3 A;  3H8J A;  4DSJ A;  1ZXI A;  4QIW C;  2R8J A;  4OO1 J;  3RJK A;  2DBY A;  4EEK A;  1Q8K A;  3C21 A;  3SQI A;  3V6K A;  2ASL A;  1KW4 A;  2C28 A;  2AGP A;  3EWA A;  5H2F U;  2ZJ5 A;  5KG5 A;  2DWQ A;  8ICQ A;  4J9K A;  1AQ6 A;  3D6J A;  1L6N A;  2GWS A;  5HHH A;  4IR1 A;  5J0W A;  1LB2 B;  4RQ8 A;  7ICO A;  2JGA A;  1P7D A;  2MSN A;  5ALS A;  3AUO A;  4DFK A;  5KAF U;  4UAR A;  1T8E A;  5EWE A;  3PR5 B;  3RJI A;  4F71 A;  5KFU A;  2PFQ A;  4NV0 A;  2W3R A;  2YML A;  4DOB A;  2KV2 A;  5J2A A;  9ICV A;  1O03 A;  3H8W A;  4DFM A;  4BDP A;  1UHU A;  4XA5 A;  2Y1J A;  1WWU A;  5EE0 A;  4IRK A;  9ICW A;  2ODG A;  1WG8 A;  4TUQ A;  2H3V A;  2K8C B;  2W9C B;  1A0P A;  3IDW A;  1N61 A;  4FBT A;  2AH5 A;  3VCB A;  1UCV A;  4F5N A;  2DKX A;  5KFS A;  2ZIU B;  1BPZ A;  3ZDC A;  3SD7 A;  1DRG A;  4F4Z A;  1OUQ A;  3GV5 B;  2OEH A;  4DOA A;  4PGQ A;  4MFA A;  3E0F A;  3V7L A;  4JWM A;  2ESE A;  1TAM A;  1JX4 A;  2W43 A;  4RT2 A;  1TV9 A;  1S0V A;  3PV8 A;  4PHE A;  2C2E A;  4CE6 A;  2W55 A;  4Y2P A;  4OCZ A;  1N48 A;  2KOB A;  2Y0S C;  3MR5 A;  5KT4 A;  4C8O A;  1DGS A;  2Q4T A;  3PMN A;  4PZN A;  4F5Q A;  2KIC A;  8ICW A;  1VJ5 A;  2HVH A;  2W11 A;  5J0T A;  1ZOL A;  2YMQ A;  4BX9 C;  4TQS A;  1M6Y A;  9ICA A;  7ICV A;  2VIX A;  4YFK A;  4C0Z A;  8ICY A;  2IBK A;  3GDX A;  1X9S A;  2OM6 A;  2W7O A;  4USA A;  1ZQS A;  3G6Y A;  4C8N A;  5KFR A;  4DQI A;  4M47 A;  1BPB A;  5E79 U;  2BQR A;  5DBA A;  2JHD A;  4F2R A;  2ZTC A;  5AM3 A;  1S8O A;  2QAR A;  1S9F A;  4BWM A;  1RPL A;  3K75 D;  3LVW A;  1SL1 A;  1Z3E B;  4ECT A;  3TI0 A;  1Z19 A;  2YB1 A;  5ALO A;  5DGA A;  7ICG A;  1A6S A;  3U26 A;  3HJE A;  1KN5 A;  2LM1 A;  4UBB A;  1QQ6 A;  4RUA A;  2XO7 A;  3GIM A;  1NJW A;  2KSO A;  3PX4 A;  5AIB A;  4F8R A;  3RH6 A;  2CN1 A;  1S0M A;  2FPK A;  1HEK A;  2LMR A;  5EWF A;  3ISB A;  1N60 A;  3NRW A;  3C23 A;  4KIT B;  4M6W A;  3V6H A;  5ALN A;  4MF2 A;  2GH1 A;  4WJ3 B;  5ALT A;  2EZY A;  5BOL A;  1ZQH A;  2EH9 A;  4I2H A;  8ICB A;  2F8L A;  4YP3 A;  2FLN A;  1K1Q A;  1YT3 A;  1S0N A;  4ZH4 A;  3ISC A;  5J2H A;  4GXJ A;  3EPG A;  2WF6 A;  4DL2 A;  2KHV A;  5J0S A;  5DDY A;  5J0Q A;  3RH5 A;  2XI9 A;  3WK7 A;  1XNS A;  2YQE A;  3RJE A;  4F3O A;  3HIL A;  8ICA A;  3WK4 A;  3UXO A;  4M9H A;  4TQR A;  3F2B A;  1L3V A;  3QZ7 A;  5L1J A;  4C4R A;  5KFH A;  2AGO A;  1IG6 A;  1N56 A;  1V97 A;  3JPR A;  4I29 A;  3NUQ A;  1X6I A;  2NRV A;  1SKS A;  1S97 A;  3SR6 A;  4R8U B;  4GLX A;  2E8P A;  3SAF A;  1NKC A;  9ICX A;  1NNL A;  1KTQ A;  4YMM A;  2K8A A;  2DL0 A;  5J0X A;  4FBU A;  5AK5 A;  4I2B A;  2HHV A;  1X9X A;  3TAC B;  2BR0 A;  2VJ4 A;  3KHR A;  3NVZ A;  1ZQV A;  4ECR A;  3GFK B;  4O3O A;  2EZZ A;  4YD2 A;  2XCP A;  2YN4 A;  2JEG A;  2AQ4 A;  5T14 A;  2KJ5 A;  2Z7J A;  2NRX A;  4Y2T A;  4DFP A;  7ICU A;  1SV0 A;  1NK8 A;  2ZIW B;  4EX6 A;  8ICE A;  1ZD3 A;  2I1Q A;  2CXY A;  1MSW D;  1FEZ A;  1SZH A;  4I2D A;  3PZP A;  4P4O A;  5ALM A;  1S5L U;  4QZH A;  2KVC A;  4JB3 A;  2ZJA A;  4CNQ A;  5KG1 A;  8ICH A;  1T3N A;  2KIW A;  2WAQ F;  4RT3 A;  1X66 A;  3V7J A;  3KHH A;  4EZ9 A;  3PW7 A;  3OJU A;  5HP4 A;  3BDP A;  2F44 A;  3SAH A;  4ECU A;  4M04 A;  8ICS A;  1N63 A;  3QUT A;  1TE2 A;  3M9N B;  4EBC A;  4K4H A;  3FYH A;  1UT8 A;  3QU9 A;  1OW5 A;  4J9M A;  4ED0 A;  2FDR A;  3GV7 B;  1L7N A;  3SAG A;  4NLN A;  5KG4 A;  4UQG A;  4DLE A;  1GO3 F;  8ICX A;  3TQ1 A;  1LV5 A;  5AK6 A;  1SV0 C;  1F44 A;  3H40 A;  2RQ5 A;  4CDG A;  2E8M A;  1HUO A;  4K4I A;  5AI4 A;  2I9G A;  5KT2 A;  2IA6 A;  2F2A B;  2GO7 A;  3PR4 A;  4DCC A;  4DO9 A;  1NK9 A;  9ICN A;  2HHW A;  5KFL A;  1SXD A;  4UB8 U;  4O3Q A;  5KT6 A;  1Z4N A;  2YMM A;  3CP8 A;  9ICG A;  3QU4 A;  2WF9 A;  4EBE A;  3KHG A;  3PW0 A;  1D8L A;  5J2C A;  2KHQ A;  9ICE A;  5HML A;  3WKB A;  4OJO A;  5ALH A;  2BCU A;  2J6T A;  2VA8 A;  4QZF A;  4J9S A;  2D8C A;  4ELT A;  8ICO A;  1DK3 A;  4Q43 A;  5DBB A;  4FE3 A;  4C8K A;  3GIK A;  4F4Y A;  3GQC A;  4O3R A;  4J9O A;  4CF3 A;  4LZD A;  3Q8S B;  1Q46 A;  1BGX T;  2P6U A;  4ED8 A;  3ZI4 A;  3TAR A;  4ECX A;  3V6J A;  4EEL A;  5ALG A;  4UBC A;  4MEX A;  3GIL A;  4KLD A;  1XS9 D;  3M1Y A;  3KTQ A;  3ONN A;  5KFY A;  1Z00 A;  4GXK A;  1LKY A;  4KLL A;  4FO6 A;  1QH9 A;  9ICH A;  4B9L A;  1ZQW A;  3M8R A;  2M0N A;  3D2S A;  2ALZ A;  2EAM A;  2ZIX A;  5KFQ A;  2W03 A;  4CRX A;  2MRL A;  4M0A A;  1FO4 A;  4YQW A;  4O9M A;  2YB4 A;  5HR7 A;  4GIB A;  3AL0 B;  1ZQA A;  3MFH A;  4B6J A;  3HP6 A;  1D8B A;  2W9B A;  1WUD A;  3QEA Z;  2BPF A;  4FZL A;  2EAO A;  1ARO P;  3QEB Z;  3IV6 A;  4CF4 A;  4QWC A;  4RQ3 A;  2BCR A;  5J2D A;  3J81 j;  2RDJ A;  4B9T A;  4BWJ A;  3ZDB A;  1L3U A;  4GFJ A;  5AIC A;  2Y1I A;  3E58 A;  3BQ7 A;  3I1Y A;  1HUZ A;  2XID A;  5CA7 A;  4RPX A;  4UB6 U;  1J97 A;  4BXO A;  1DOQ A;  4U7C A;  2PFN A;  2C2R A;  4I2E A;  1Z1B A;  4DFJ A;  2FMQ A;  9ICB A;  1TK5 A;  8ICZ A;  3H7I A;  4Q8E A;  4Y2X A;  4KLH A;  2ZTE A;  8ICC A;  2DF4 B;  5DQG A;  3QU2 A;  2KTQ A;  7ICM A;  9ICQ A;  2ASJ A;  1T3Q A;  2W04 A;  4EZ6 A;  5III A;  3LK9 A;  4B9U A;  1L7M A;  4YD1 A;  1PUZ A;  3WK5 A;  3C2L A;  3RAQ A;  3N97 B;  2BCV A;  4O3N A;  4RNO A;  5ALL A;  3RBE A;  1JI7 A;  3OSP A;  4FZN A;  5JTI A;  5D4B A;  4IC9 A;  1K5O A;  1QLN A;  1F0M A;  2F76 X;  5DG8 A;  5ALY A;  1Z4O A;  5JRT A;  4QWA A;  3ETL A;  2C22 A;  4DQS A;  3RR8 A;  1B4F A;  2XY7 A;  1QCK A;  1ZQG A;  3LYS A;  5B5E U;  4RU9 A;  4F4K A;  4RQN A;  5KL8 B;  5IIJ A;  5KFG A;  3MDC A;  5KT5 A;  5KFW A;  3AM9 A;  2W7P A;  2HBM A;  3QU7 A;  2RDI A;  2JEF A;  4NM2 A;  4P0P A;  4F91 B;  2BPC A;  2CRX A;  2UVW A;  1QSL A;  2L5Y A;  1COK A;  3NVV A;  3HKZ C;  2EAP A;  4K4G A;  1Y88 A;  3PO4 A;  2R18 A;  3S6J A;  4M9J A;  5KG7 A;  4DL4 A;  1U49 A;  2A1A A;  5IIK A;  1CRX A;  4EYH B; 
#chains in the Genus database with same CATH homology
 2K8A A;  2E5S A;  4GFJ A;  3RF9 A;  3LVW A;  1ECW A;  1NZB A;  2KKV A;  3M6K A;  3CP8 A;  3PSF A;  2ZXH A;  2K4H A;  2JH1 A;  2K4E A;  2YB1 A;  1Z19 A;  3F5E A;  2XID A;  3RFA A;  3H0L B;  2MA1 A;  2PMZ F;  2VJ4 A;  4FZM A;  2H3V A;  2K8C B;  2KJ8 A;  4U7C A;  2KKP A;  4CGZ A;  1A0P A;  1A6S A;  4ACO A;  2KHQ A;  2ZIX B;  4OJL A;  1Z1B A;  3VCB A;  4ICA A;  3T79 A;  3M6Z A;  2BDU A;  2G5H B;  2ZG6 A;  4OJO A;  2ZIU B;  1ZQ1 C;  3ALR A;  3GZF A;  5T14 A;  4KX5 A;  3OPX A;  3MGV A;  2KJ5 A;  4P0Q B;  2Z7J A;  4OJ5 A;  3D2Q A;  2HBJ A;  2PMZ C;  4PL2 A;  1DRG A;  2HMX A;  1KBU A;  1OUQ A;  4P0P B;  2YX8 A;  1ED1 A;  3F53 A;  2KNJ A;  2ZIW B;  2DF4 B;  4FE3 A;  2E1E A;  4PL1 A;  2K89 A;  2G07 A;  2H3Z A;  2NV3 A;  2ZIV B;  2VJ5 A;  3CYM A;  3GU3 A;  4JMU A;  2Y0S F;  4NLB A;  3KFU F;  3IG5 A;  3KZX A;  3E0F A;  1SZH A;  2XIC A;  3M7D A;  3PSP A;  4QIW F;  2CN1 A;  2W04 A;  3PZP A;  1TAM A;  1URJ A;  3C29 A;  1HEK A;  4KX3 A;  3O0F A;  2H3I A;  5KL1 B;  3F2C A;  3NRW A;  3PST A;  2KVC A;  2XVT A;  3D2N A;  2HOI A;  2G09 A;  3DEE A;  4AYB F;  3N7S C;  1IIP A;  3C28 A;  4QNL A;  2H3F A;  2A3V A;  2LKY A;  1CRX A;  2GH1 A;  3SMV A;  4WJ3 B;  2G0A A;  2KOB A;  2Y0S C;  5C0Y A;  2RRD A;  2E1F A;  4FZN A;  2G06 A;  2ZXI A;  2Q4T A;  3H0R B;  4IC9 A;  1Q3U A;  4QIW C;  3ONN A;  2F76 X;  2KIW A;  4OO1 J;  2WAQ F;  2LBO A;  4A8E A;  4U6P A;  3AQE A;  3N7P D;  2F8L A;  3SQI A;  2KIC A;  3ICX A;  2F77 X;  1YT3 A;  3IG8 A;  4AYB C;  3SAH A;  2HBL A;  2VKQ A;  2HOQ A;  2RHF A;  5HR6 A;  4OJ6 A;  1T94 A;  2D6F C;  2M0N A;  3LYS A;  2OH2 A;  2LHT A;  3D2S A;  2LYB A;  2H3Q A;  2N1R A;  2ZIX A;  2WAQ C;  2G08 A;  3SAG A;  2KHV A;  5KL8 B;  3L3F X;  2OXO A;  2W03 A;  2KJ9 A;  2K8B B;  4BX9 C;  2OYY A;  4CRX A;  3K1Z A;  5CRX A;  1L6N A;  1UPH A;  2HBK A;  4OJP A;  2MRL A;  2VIX A;  1GO3 F;  2ZIU A;  3LVV A;  2JMG A;  4BJQ A;  2XI9 A;  4C0Z A;  2W7P A;  3HKZ F;  2HBM A;  4P0Q A;  3F2D A;  1XNS A;  4O3M A;  2YB4 A;  4NWI A;  1HIW A;  2JGA A;  1P7D A;  5HR7 A;  3N7R C;  4P0P A;  3AL0 B;  3F2B A;  3H0M B;  1F44 A;  2OM6 A;  2ZIW A;  4NLC A;  2CRX A;  5A0L A;  2HOF A;  3IP4 B;  2W7O A;  2CPR A;  1D8B A;  2ZIV A;  2DQN B;  1Q3V A;  2GOL A;  1WUD A;  2RP5 A;  4CDG A;  2WB1 F;  4FZL A;  2KD1 A;  2DGZ A;  2LYA A;  4QJF B;  3NUQ A;  1MA7 A;  3HKZ C;  2F2A B;  2JH7 A;  2R18 A;  3CRX A;  3VC8 A;  4BUG A;  2JHD A;  4NV0 A;  3IN5 A;  3PSI A;  2KEY A;  3SAF A;  4KMO B;  2KV2 A;  1PVQ A;  1PVR A;  2K4I A;  2G5I B;  3AQF A;  2WB1 C;  3F5A A;  1XO0 A;  1PVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...