1D8BA

Nmr structure of the hrdc domain from saccharomyces cerevisiae recq helicase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
ELNNLRMTYERLRELSLNLGNRMVPPVGNFMPDSILKKMAAILPMNDSAFATLGTVEDKYRRRFKYFKATIADLSKKRSSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of the HRDC domain and implications for the Werner and Bloom syndrome proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords SGS1 RECQ HELICASE
total genus 27
structure length 81
sequence length 81
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11408 Helicase_Sgs1 Sgs1 RecQ helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1d8bA00
2HBLA 4QJFB 4O3MA 1WUDA 5C0YA 4CDGA 2HBMA 1D8BA 2KV2A 1YT3A 2DGZA 2RHFA 4CGZA 3SAHA 4NLCA 3CYMA 2HBKA 4QIWF 3SAFA 3SAGA 2CPRA 4NLBA 2HBJA 2E1EA 1GO3F 2E1FA 4OO1J 2RRDA 2MA1A
chains in the Genus database with same CATH superfamily
4R64A 1A77A 2KTQA 2ZUDA 1NZBA 4DL4A 8ICUA 9ICWA 4F5RA 1ZQXA 2MUTA 3EPIA 1SZPA 3OSPA 2JEJA 2XGQA 9ICRA 4Z6FA 4O5EA 2ZIWA 2VANA 2M0NA 5AK4A 1J2NA 1MN8A 5J0WA 1ZETA 5AM5A 1KEJA 1RXVA 5KG2A 4NLCA 2JXJA 4PZNA 1VJ5A 2W3SA 1Z4OA 1NJYA 2KHQA 1NKCA 3BJYA 2AH5A 5ALUA 4QW8A 4P2HA 1SXEA 4BWJA 5F9LA 1Z1BA 5J2EA 7ICVA 2LYBA 1D9DA 3RJFA 1X6IA 4I2FA 4I2AA 1UQVA 1Q3VA 1D9FA 2PI4A 2AGOA 1JI7A 1QSSA 4KLDA 5G5GA 1ZQAA 3WKDA 4PJ0U 1ZQOA 2HHWA 2EZYA 4EEKA 5EE9A 4F4WA 4EBDA 1KDHA 3FC4A 4U7CA 2NRZA 3HILA 2OEHA 3SAFA 4NWIA 4QZHA 1MA7A 2BDUA 3H0RB 4I29A 8ICTA 2IHNA 5KNIA 2G5IB 5KTQA 4B9TA 2DWQA 1SIJA 1T8EA 4DSIA 1HIWA 1WCNA 4UATA 2HOFA 3EUB2 1RPLA 4CF5A 3I76A 4ED7A 2DKXA 1L7NA 5KL8B 5KFDA 2BCRA 2E1FA 4IQUA 4PHAA 4KLUA 3RH5A 2YQEA 3HT3A 8ICPA 5CP2A 5HHHA 4R8UA 2K8BB 1ZQBA 3WK6A 2KICA 1ZJNA 1ZQWA 1IXRA 3C2MA 3JPTA 2HOIA 3AMZA 8ICHA 1ZQUA 4LVSA 1SL0A 3OJUA 3JPNA 1S10A 3OTQA 2KVSA 4FZMA 4F72A 3RR7A 2OYYA 4GFJA 2KJ9A 1UA1A 2W04A 4UB5A 4DF8A 1TK8A 3I28A 3BQ7A 3O0FA 3NASA 4C4RA 4IRKA 5ALQA 5TISU 3CRXA 1RXWA 4RQMA 2VIXA 3DEEA 3C1YA 4UB8U 1U45A 4UAZA 5AKJA 4RNNA 2MAXA 2A3VA 1ZQSA 1JALA 3NVYA 5ALMA 3F2DA 3K1RB 3AQEA 3ISBA 3TAQA 4OJOA 3NTUA 7ICNA 2JH7A 5DB9A 4DQPA 2FI1A 2AXTU 3QX7A 5AM0A 3OHAA 3QE9Y 2QB0B 2KNJA 3NRWA 3SYZA 2NO4A 1N56A 3ISDA 4PZOA 1L3VA 4ECZA 2E8NA 3NUQA 1UT8A 2IOHA 2BQRA 3WK7A 5D46A 5DB6A 2J6TA 2A19A 1JN3A 2W7OA 4CE6A 3KFUF 2ISPA 4EYIB 4KLJA 4F93B 4BUGA 5KFTA 4F5OA 4DF4A 5EE3A 5J2IA 4USAA 1NNLA 3QUTA 5AM2A 2R8IA 4Q8FA 2K89A 5KFFA 5DB8A 2LBOA 4ZOHC 1D8LA 2XICA 4ELTA 3QYPA 5J0OA 5L9XA 1VLBA 3WK9A 8ICMA 5DDYA 1S0MA 1ZD2P 3C28A 2ZJ8A 4IQTA 2PMZC 2H3VA 4KLIA 2JEIA 4QZEA 3N7RC 3A0BU 3WKCA 4J03A 3FM9A 1DOQA 1Z19A 2KEYA 1SL1A 1N2XA 1KQQA 5DB7A 5HR7A 2JMGA 7ICPA 1Z4NA 3D2NA 4NJ8A 4DSFA 2W9CA 2QARB 3KHLA 1QLNA 3K1ZA 4FE3A 7ICKA 1KTQA 4UASA 4P0PB 5KFUA 1SKWA 2E3TA 5J2DA 3RRHA 3AN1A 5IIIA 3BQ0A 1NK7A 4EX7A 4C7ZA 2D3DA 3ZDBA 1ZRNA 4GXKA 2H3ZA 8ICFA 3I1YA 2EQYA 4MFFA 1BVSA 5ALYA 5J2KA 1NZPA 3QUBA 5J29A 1NK6A 1AROP 1S8OA 4M04A 4P0PA 1S0VA 4LZGA 5CWRA 2B6GA 1TAQA 4MFCA 2G0AA 3GDXA 5DG9A 3KKAA 4UB3A 3PVXA 2JZBA 4RPXA 1PZNA 2DPJA 1DXSA 2K8AA 4UAWA 5EWGA 1ZD4A 4M6WB 2K4PA 1ZRMA 3Q8SB 3M8SA 4YVZA 2WFAA 9ICBA 4M9LA 5DQHA 3QZ7A 2AJQA 4CRXA 1ZQYA 2XO7A 4FBTA 2Y9TA 3RR8A 4CF3A 5A0LA 4OJ6A 3JPQA 2KJ5A 5AKGA 5KFQA 5AI8A 1KFSA 5KT7A 2PFQA 1DK3A 1SV4A 8ICNA 4TQSA 9ICIA 4C80A 3L3FX 2Z7JA 2BPGA 3QNMA 1IV8A 4EZ9A 2ASDA 4F3OA 7ICOA 3RB0A 1V38A 1MSWD 1BNPA 4QWBA 2C22A 1TVAA 4CDGA 2BQUA 5L1LA 2WAQF 2FLLA 4RQ6A 2YY6A 1SL2A 4IR9A 1L3UA 4M6WA 3UMGA 4C8KA 1RDFA 3HX0A 1V85A 2Y1JA 1MQ3A 5KFBA 4DOCA 3M7DA 3H0LB 4IL6U 3S6JA 4ELVA 3GIMA 1RQNA 5ALXA 4KN4A 3M6ZA 3MR3A 2NYVA 2PFOA 3NVVA 1JX4A 1ZQFA 2ZTCA 2PKEA 4KITB 2KP7A 3SI8A 5EWEA 5DG7A 5J8YA 2W55A 3WK8A 1B0XA 2EAPA 3C2LA 1NK5A 4M9HA 2E8MA 2G07A 4UAVA 2H3QA 1NJXA 3PX6A 4M9GA 4RPZA 5J0TA 3UMCA 2P6RA 1YZ6A 3ALRA 3KZIU 5JUMA 1SZHA 3UQ2A 2B0CA 2W8KA 3BQ2A 5ALRA 2LM4A 5AKXA 2DPIA 8ICCA 5IIJA 3PW2A 5ALFA 4PH5A 4J9KA 1ZQVA 5IIMA 2FLNA 8ICXA 3L5KA 3ED5A 2RQ5A 9ICXA 1BPBA 4Y2TA 5HR6A 3RRGA 2BGWA 1IM4A 4IS7A 4EELA 2OHFA 5KFCA 1PK1B 3V6JA 1RYRA 1TK0A 4LJXA 1L3TA 1KSPA 1ZQHA 2EAOA 4BXOA 2EANA 2VA2A 3H8WA 1ZJMA 1SWVA 4OCZA 5DLGA 1NK4A 1SKSA 3GZFA 1L6NA 7ICLA 2PFPA 2M9NA 1P7DA 5KFAA 1ZQMA 8ICBA 1WCLA 2ZUCA 4IRCA 4YMOA 3WK5A 4KMUA 5AI9A 5KFLA 2ZIUB 2HBJA 1S97A 3MBYA 2G06A 2MA1A 2R18A 2XIDA 2W9AA 3H40A 1U9LA 4I2EA 2MRLA 2YMPA 2K8CB 4F5PA 5ALGA 1ZQIA 1NKBA 1CEZA 2ZG6A 5ALVA 3H0MB 2C2EA 4F4ZA 4M9JA 4DQRA 3AL0B 2HBKA 4YFKA 9ICHA 2C28A 4EENA 5KG7A 1HUOA 2YN4A 4YR2A 3SAGA 5AKKA 1X9MA 5DG8A 1ZQJA 5BOLA 4UAUA 2OWOA 4Y2UA 1PVPA 5J0XA 3EW9A 2XY5A 1SXDA 4F4YA 4I2JA 1C7YA 3Q8PB 3BQ1A 4AYBC 1ZQTA 8ICOA 4ZH4A 3KHGA 3F5EA 3V72A 5DQGA 5G5HA 7ICMA 2CN1A 2QB0A 2HHQA 2IOFA 1QCKA 2QLTA 3WKAA 2HW3A 4UW9A 1OW5A 2DKZA 4F5NA 3BZKA 4NL9A 2FLPA 3PO4A 4RU9A 3E58A 1DRGA 4RQ3A 4DSJA 4ED1A 3M8RA 1SWWA 5KFIA 2ZJAA 2BPCA 3FYHA 5HP4A 2E8OA 3GIJA 4EBEA 5J0UA 5DLFA 3UXOA 2ISOA 3Q8KA 4Y2YA 5EOZA 2K4IA 2KJ8A 9ICJA 3SZ2A 5DGBA 4F91B 1LVHA 2KV2A 4KN7A 3IN5A 1XWLA 2WHEA 2ZIUA 4MF2A 4RT3A 3LDAA 1KN5A 4EZ6A 4KX5A 4NM1A 1URJA 3MGVA 3IDWA 4NLBA 4M0AA 3RJJA 4X5VA 2B21A 9ICUA 1SV0A 2MSNA 3PW7A 2D8CA 3AQFA 5J0SA 5CR0A 3ISCA 4ACOA 3TANA 1BPEA 1UT5A 3EWAA 2GWSA 2Y0SF 1ZQDA 5DDMA 2HOQA 2AHOB 1L8LA 3IM1A 3CYMA 1ZD5A 1V97A 3SENA 4QZCA 1BGXT 2YB4A 3T5HA 3D2QA 4ECVA 4Y2JA 2E1EA 3SMVA 2HHTA 4US8A 3TADC 1ZQLA 2JGAA 4UB2A 4JUZA 2KZZA 4RNOA 3ZD9A 4RZRA 4Q44A 7ICUA 1XU4A 4AP9A 9ICKA 4O9MA 3RAQA 1QQ7A 4F71A 4DL2A 4OJLA 2W9MA 4C8OA 2GOLA 5AHXA 3HKZC 4O3PA 4B9MA 2F2AB 5AI0A 5B66U 4A8EA 2HSZA 4TUPA 3LK9A 4C8NA 5KAIU 2XCAA 2UVRA 4GC6A 5JU5A 2BZFA 4KLTA 4NY8A 2F1IA 3KD3A 2AGPA 4UBCA 2PMZF 3JPRA 1ZQCA 3BS5B 5GTHU 4R63A 4JMUA 1JIHA 2H3FA 4YQWA 9ICNA 2Y9UA 2ZIWB 1PK3A 3TADA 1N48A 3OJSA 4O5CA 4BDPA 4C0ZA 4F92B 4F50A 5CHGA 1IG6A 2BCQA 2N1RA 5KT2A 4GXIA 3RJIA 4O3NA 2NRXA 3IG5A 3E2EA 4YR3A 5IIOA 3RB3A 2W11A 1A76A 2O6KA 1L3SA 4NV0A 4DS5A 5CRXA 2QARA 3C1ZA 2BKEA 5HMMA 9ICTA 3LWMA 3MR6A 1D8BA 1RZTA 5KG1A 3ICXA 4KLQA 2KN7A 3UPQA 4QIWF 4QW9A 1NK8A 2CPRA 1LB2B 3RBEA 4JWNA 4P0QB 4UQGA 3RBDA 2MU2A 5AIAA 1XO1A 3Q8RB 2F44A 4QZ8A 3HJEA 3OHBA 8ICGA 2J6UA 1S5LU 5ALWA 4RQ1A 3PSIA 2NV3A 1U48A 3FDSA 3KBBA 1KKXA 1SKRA 5ALOA 5JRTA 4YXMA 2BCSA 1BPXA 3MR5A 4DFKA 4I2IA 3L4PA 3V6KA 2LYAA 1ZQZA 4J9SA 4I2HA 3UMBA 5J2AA 1QSLA 4FO6A 1L7PA 1BPZA 4J9NA 4KLSA 1ZXIA 3WKBA 3IRUA 4I2BA 3PNCA 4JWMA 4NLGA 3T3FA 4QZBA 5B5EU 7ICTA 2NRWA 4YD1A 1Q46A 2ZJ5A 3IP4B 5KFRA 2H5XA 1NJZA 2XY7A 2AGQA 4Y2QA 4EX6A 3RAXA 3KOOA 4BGDA 5KFGA 5L1JA 3TAPA 4R66A 3GFKB 3DV9A 4BX9C 3SAHA 1C20A 3C2KA 1YZ7A 4RQNA 5ALZA 1S0OA 3MC1A 3ZDAA 4DLEA 3VCBA 2OCEA 5CA7A 8ICZA 5L1IA 4DEZA 2BHNA 2DFLA 4QJFB 3HPOA 2KIWA 3MR2A 4DWIA 3U26A 4QWCA 1RYSA 3BS5A 3IV6A 3SR6A 4GLXA 5AK6A 4RQ2A 3PV8A 2JEFA 5KFHA 3LVVA 3SD7A 2C2DA 2YX8A 3MFIA 2FMPA 1FEZA 1ZYQA 3WK4A 2K4HA 4LZDA 4XUSA 5KT4A 9ICCA 5J0PA 3M9NB 3NGDA 1N5XA 3AEVA 4ED0A 4O5KA 3H4DA 4PPXA 2KSOA 2HHSA 2WB1F 1QH9A 3RJKA 1GO3F 1RQLA 1S9FA 1AQ6A 2JV3A 4DSKA 4UB6U 1ZQKA 3H8JA 5TZVA 3GV5B 1U49A 2FJ6A 4Y2XA 5KG3A 1FFUA 1WG8A 2A1AA 5K4LA 3PSTA 3JPPA 2F1JA 2VA3A 3ZD8A 4F4KA 4TURA 5EWFA 1J97A 3PMLA 1DGSA 2CRXA 4RQ4A 4ECWA 2W8LA 4KLFA 3PMNA 4ECSA 2UVVA 7ICJA 1TAMA 4Q45A 8ICKA 4GC7A 2I1QA 5DQIA 3QZ8A 4PHEA 3N4MB 5AKEA 3VC8A 2ESEA 2KVCA 4F5QA 3BS7A 3A0HU 3B0YA 4PHPA 1LKYB 3ZI4A 3CNHA 4RNMA 4F2SA 2EDUA 2LMRA 5KFJA 3PZPA 1X9SA 4US9A 8ICLA 2BCUA 3G6XA 5ALPA 1Z1VA 2KG5A 2BDPA 1NK0A 2NO5A 1RG6A 3PR5B 4KMOB 2L5YA 3GV7B 1COKA 3QU2A 4C8MA 5J0QA 3QU4A 7ICGA 5AKZA 5J2BA 4YD2A 5AM1A 4IR1A 3HW8A 1XC9A 1BPDA 1WUDA 2WAQC 3M6KA 8ICIA 2LHTA 4BJQA 7ICRA 1O03A 1KFTA 4Z6DA 4I2CA 1SGGA 3QEBZ 1SB3C 3PW4A 3F5AA 4C4SA 5KFYA 5ALHA 2W54A 3QU7A 4QZGA 1K1SA 3C29A 1S0NA 3MFHA 2DL0A 2P6UA 3RJHA 4Z6CA 2YMMA 4UB1A 1XS9D 3JPSA 1QSYA 2K4EA 1XO0A 2YMQA 2JRZA 1X66A 5KG0A 3GU3A 4I2DA 5DBCA 3T5LA 4PGXA 2NRVA 2RDJA 3KZXA 3ORYA 2R8GA 4FS2A 4U6PA 2E8PA 1QQ5A 1HEKA 1WWUA 3QUQA 5AKIA 4I2GA 2EZZA 3HRDD 5HHIA 4DFDA 5KT5A 8ICQA 3TARA 1B22A 3PY8A 2ZIXA 2HHVA 1EXNA 1H38A 1KLNA 4HAIA 1RM6C 1FFVA 1TKDA 1KFDA 2IMWP 3N7PD 5DBAA 4ED3A 1X9WA 2ZIXB 4DL7A 4ECUA 1Q3UA 4M2YA 7ICEA 8ICWA 3BZCA 2E5SA 4DSEA 3ZDCA 1L7MA 5DKWA 2KE7A 4FBUA 1HUZA 4QZAA 3C5GA 2W3RA 3PSPA 4P4OA 3TACB 9ICPA 1KW4A 3ONNA 4PHDA 3AU6A 5D4BA 3JPOA 2F8KA 4YMMA 4Y2SA 2YMLA 3QU9A 4P4MA 9ICLA 4EBCA 2YB1A 2R8HA 5KT3A 1ED1A 5KFPA 4P4PA 3ZDDA 2KIVA 4DQQA 2XGPA 4CCHA 1S76D 3SV4A 2IOFK 4BXOB 3KKAC 4YR0A 3TFSA 3D2SA 1CRXA 4KLLA 5KG6A 4Q43A 2P66A 2Y0SC 2XC9A 1X9XA 1ZQNA 2KHVA 5J2JA 4J9RA 4MFAA 2VA8A 2WF9A 1A6SA 3HP6A 3AM9A 3T5JA 1B43A 2DF4B 4C7YA 4RT2A 2DGZA 4ED8A 2HVIA 2RHFA 3SEIA 1M6YA 4DQSA 5ALSA 9ICQA 5F9NA 3LWLA 4Y2VA 5KFZA 2ZIVA 4DL5A 4B9NA 1X42A 3QEAZ 2VJ5A 3CW2C 3NS1A 1NOMA 1J2MA 2WF8A 3R9KA 3MGIA 1L7OA 3WKEA 2CXYA 1ZQRA 3UXPA 5J2GA 2FPKA 4P0QA 1T94A 2F3NA 2VKQA 3RJEA 1N62A 2V4RA 2XCPA 7ICHA 5KFOA 2ZUBA 4DCCA 2ZIVB 5AI4A 1N61A 2WTFA 3T79A 3NVWA 5EE0A 4O3SA 4O3OA 3PX4A 2OXOA 3PSFA 5AI5A 1ZQPA 4CGZA 1Z00A 2EZXA 5KFVA 2EH9A 9ICOA 5ALLA 3N97B 2IA6A 1L8OA 4I28A 4DFJA 3RTVA 4RQ7A 2J6SA 4JK1A 2KZ3A 1B4FA 4O3MA 2P35A 3NRZA 1FO4A 3HWTA 3C23A 5EE1A 5C0YA 4DSLA 2UVWA 1WWVA 4PGYA 5BOMA 1L5UA 2F77X 5DGAA 4B9LA 4HYKA 1F44A 2W9BA 3GIKA 1MQ2A 1KL9A 5AI6A 5KT6A 2ZTDA 3LVWA 1DGJA 5AIBA 3RB6A 1XSLA 3D6JA 4J9PA 4UARA 1UHUA 4QZIA 4F4XA 3RF9A 1TFRA 1V9PA 2ZTEA 5D49A 3G6VA 4IQVA 2FMSA 4O0IA 1U4BA 1O08A 1PVRA 5T14A 3RB4A 5KFEA 4CNQA 1T7PA 4F2RA 1NJWA 1F5SA 4MF8A 4QZ9A 1K5OA 5ALKA 9ICEA 3MDAA 5L1MA 4MHVA 4Z6EA 1ZQGA 2DUYA 4F8RA 5AM3A 4WJ3B 9ICMA 1LV5A 2A1JA 3KHRA 1T3NA 4DFPA 4G3IA 3F53A 3EZ5A 2LKYA 2PFNA 4G9BA 2HBLA 1LKYA 8ICAA 3EYZA 8ICEA 3HKZF 4JV2A 3ETLA 5KFSA 2W9BB 3OPXA 5GTIU 2V4QA 2BCVA 3N28A 3ETRA 4RUCA 3OSNA 4KLHA 3CP8A 4DQIA 4UBBA 2NRTA 4NM2A 1OUQA 4QWEA 1K1QA 4XQ8A 3V6HA 5KL1B 8ICYA 4GXJA 4YCXA 1YT3A 1X2IA 2ASLA 1JROA 1N60A 4C4TA 5AK3A 2ODGA 4J9QA 1QTMA 1UPHA 3THVA 4M47A 1XSPA 3B0XA 1PUZA 4C8LA 2GLEA 2LM1A 3E0FA 9ICVA 4Q8EA 3AUOA 5ALJA 4K4GA 1A0PA 3NVZA 3V7LA 5IIKA 2HVHA 2FPMA 1XNSA 1S77D 1XSNA 9ICAA 1ZD3A 4TQRA 2W9CB 2ZXHA 3UM9A 2RP5A 2W43A 3Q8LA 2V9WA 2RDIA 2I6XA 3PO5A 1BPYA 3C21A 3PW5A 3TFRA 5AKHA 4KLEA 2EAMA 4QIWC 2AU0A 5ALTA 2XVTA 5BPCA 7ICIA 1N63A 5HMLA 4NLNA 2GO7A 4CF4A 2G08A 2KKPA 2YTUA 4EYHB 2FDRA 4B9VA 4RQ8A 2ES6A 8ICSA 2Q0ZX 4QZFA 2FE9A 5KFXA 2G09A 4QNLA 4PL1A 1NI3A 2W7PA 4ICAA 4ECQA 1MC8A 1WYGA 2AQ0A 4DS4A 3M1YA 2WF5A 2ASJA 4GIBA 4QWAA 4QZDA 4FFDA 2VJ4A 2JZBB 3MDCA 5ALIA 1T4GA 3GILA 4KX3A 4NXZA 1VDVA 4B6JA 1Z00B 2JR5A 2W03A 4IRDA 5CJ7A 4YMNA 3AU2A 1CUKA 5J2HA 5KG5A 2XY6A 4IC9A 1FIQA 5CB1A 5ALEA 2KFNA 4YG2A 2R8JA 4TUQA 2HMXA 2RLTA 3LYSA 4YP3A 2KMDA 4KLMA 4OJPA 4RUAA 7ICQA 2A1JB 5F3XB 2LI6A 3MGHA 1ZOLA 1JRPA 3WU2U 2JHDA 4IQWA 2ZXIA 5H2FU 1SV0C 4K4IA 4EEYA 1DK2A 5HNKA 2KOBA 3V7KA 4UB4A 1BNOA 2HCFA 5L1KA 3PX0A 4E0DA 4XRHA 4J9LA 1TAUA 5IINA 3OGUA 1TE2A 2KSOB 2KZMA 2BQ3A 2RRDA 4DLGA 2HHXA 4ELUA 1PK1A 5J0YA 5DBBA 4DL6A 8ICVA 1NKEA 5C5JA 1Z3EB 2WB1C 4OD0A 4Y2PA 3KHHA 9ICSA 5KFWA 5JTIA 4YXJA 2IHMA 1JMSA 2FPLA 2PI5A 2F8LA 3F2BA 1CI4A 4PGQA 4ED2A 1X6JA 4B9UA 5J2CA 4NL9C 5AICA 3UXNA 5KAFU 5J2FA 3B9JA 3M9OB 4J9OA 2R8KA 3K4GA 2PXIA 2HBMA 4ED6A 2UVUA 4RQ5A 3QUCA 1JUDA 3BQTA 1QQ6A 4NLZA 3K75D 4O3QA 4FZLA 2XI9A 5AK5A 2C2RA 4K4HA 4KTQA 2GH1A 4UAYA 5J0RA 4ECTA 4M9NA 4PL2A 4OO1J 5J8YC 4DFMA 9ICGA 4BWMA 4DOBA 3BDPA 2KKVA 3Q8MA 4ECYA 1RYUA 3H8SA 5ALDA 4B9SA 2KFZA 1OXJA 1ECWA 4DOAA 1F0MA 3FAHA 3ZDEA 1IIPA 2I9GA 3PR4A 4O3RA 2I5HA 3H8MA 3Q8QB 3GV8B 1UCVA 2JH1A 1UA0A 3RH4A 5KG4A 1ZQQA 3QU5A 4RQ0A 3RJGA 1Y88A 2IBKA 2K60A 4QWDA 9ICFA 3H4BA 1JXEA 2FMQA 2MUTB 2WF6A 4YN4A 4TUSA 2QB1A 3H7IA 3QXGA 3M9MB 3MABA 3J81j 4ECXA 4FZNA 4DL3A 4NLKA 3PW0A 3RFAA 4RPYA 5E79U 3G6YA 4JV0A 3RH6A 2D6FC 2LPEA 1T3QA 2BR0A 4JV1A 1PVQA 2OM6A 2JEGA 3EPGA 2AQ4A 4KLGA 3SV3A 1KRPA 3UQ0A 1HJPA 1X40A 2WF7A 3T5KA 5FP0A 4DO9A 2F1HA 2ATLA 1N5WA 7ICSA 1ZQ1C 2LYHA 1TV9A 2BPFA 1Q8KA 4ECRA 2DQNB 2KD1A 3IHQB 4J9MA 2ALZA 3GQCA 2Y1IA 2F76X 5AM4A 4MEXA 2HHUA 4XA5A 5KFNA 3GIIA 4JB3A 4KLOA 4OJ5A 3KTQA 2G5HB 2QKQA 2HDOA 2DBYA 2HI0A 4Y2RA 5ALNA 4I27A 3TQ1A 1COOA 4MEYA 1D8YA 8ICJA 2H3IA 5AKLA 5CEHA 5KFMA 4FS1A 4R65A 4R8UB 3N7SC 8ICRA 5IILA 2Q4TA 3F2CA 3TI0A 3DDHA 2KK0A 5AKYA 3IG8A 1ZQEA 5KFKA 1U47A 3SQIA 1TK5A 1KBUA 1NK9A 3TKAA 3C5FA 2OH2A 4AYBF 3V7JA 7ICFA 1JXLA
chains in the Genus database with same CATH topology
2KJ8A 2KNJA 3NRWA 4C0ZA 2ZXIA 2G5IB 1TAMA 1NZBA 4QIWC 3NUQA 2N1RA 4CDGA 2KV2A 1HIWA 2XVTA 2ZIXA 3IN5A 2WAQF 2ZIUA 3VC8A 2KVCA 4P0QA 4WJ3B 3GZFA 4BX9C 1L6NA 1T94A 3SAHA 1P7DA 2KOBA 2HOFA 4KX5A 2H3ZA 3D2SA 4FZNA 3N7PD 2VKQA 1URJA 2G08A 2KKPA 3F53A 2LKYA 3IG5A 3RFAA 3MGVA 2W7OA 3KFUF 2D6FC 4NLBA 2ZIXB 3VCBA 2ZIUB 2HBJA 4NV0A 5KL8B 3PZPA 1Q3UA 2ZIWA 2E5SA 2E1FA 2RRDA 2ZIVB 2G06A 2OM6A 2MA1A 2HBLA 4BUGA 4QJFB 1PVQA 3M7DA 2R18A 2XIDA 3AQFA 3H0LB 2KIWA 2G09A 3T79A 4QNLA 2M0NA 3HKZF 4PL1A 2MRLA 4P0PA 4ACOA 2OXOA 2K89A 3PSFA 2K8BB 2K8CB 3M6ZA 1D8BA 2LBOA 2WB1C 2ZG6A 1ZQ1C 2KICA 2XICA 2Y0SF 3OPXA 3ICXA 3PSPA 2W7PA 3H0MB 4CGZA 2HOQA 4ICAA 4NLCA 2DQNB 2KD1A 3CYMA 4KMOB 3ONNA 2HBKA 4QIWF 3AL0B 2G0AA 5CRXA 3LVVA 2F8LA 2YB4A 3D2QA 2HOIA 3SAGA 2CPRA 3C28A 3F2BA 4P0QB 2PMZC 2F76X 2H3VA 2E1EA 3N7RC 3SMVA 2YX8A 2KHQA 2K8AA 2JGAA 3CP8A 1PVPA 2YB1A 4O3MA 1OUQA 4OJ5A 1ED1A 1WUDA 2K4HA 2G5HB 2WAQC 3M6KA 4FZMA 5C0YA 2LHTA 4BJQA 3PSIA 2G07A 2H3QA 5KL1B 2KEYA 2HBMA 1Z19A 2VJ4A 2NV3A 1YT3A 2F77X 2OYYA 4GFJA 1Z1BA 1F44A 4AYBC 2KJ9A 2W04A 5HR7A 4OJLA 3F5EA 2GOLA 4CRXA 2JMGA 3HKZC 4KX3A 2H3IA 1UPHA 2CN1A 3F5AA 3O0FA 1CRXA 2LYBA 2XI9A 2F2AB 3ALRA 4FZLA 3C29A 2W03A 1SZHA 2GH1A 3D2NA 2WB1F 2LYAA 2Y0SC 3CRXA 3LVWA 4A8EA 2KHVA 1GO3F 3E0FA 4PL2A 5A0LA 1Q3VA 3N7SC 4OJ6A 4OO1J 2VIXA 3DEEA 2KJ5A 1A0PA 2Q4TA 4IC9A 3F2CA 2KKVA 3K1ZA 1A6SA 3IG8A 1DRGA 2PMZF 2HMXA 3LYSA 2DF4B 4FE3A 2A3VA 2K4EA 1XNSA 2DGZA 3RF9A 3F2DA 3SQIA 1XO0A 2RHFA 3AQEA 4OJPA 4P0PB 4JMUA 2H3FA 1ECWA 1KBUA 3GU3A 3PSTA 4U7CA 3IP4B 2ZXHA 3SAFA 4NWIA 4OJOA 2RP5A 3L3FX 5HR6A 1MA7A 2JH7A 1IIPA 1PVRA 2Z7JA 2ZIWB 3KZXA 2ZIVA 2BDUA 3H0RB 5T14A 2CRXA 4AYBF 2JHDA 2JH1A 2VJ5A 2OH2A 4U6PA 1HEKA 2K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBL A;  4QJF B;  4O3M A;  1WUD A;  5C0Y A;  4CDG A;  2HBM A;  1D8B A;  2KV2 A;  1YT3 A;  2DGZ A;  2RHF A;  4CGZ A;  3SAH A;  4NLC A;  3CYM A;  2HBK A;  4QIW F;  3SAF A;  3SAG A;  2CPR A;  4NLB A;  2HBJ A;  2E1E A;  1GO3 F;  2E1F A;  4OO1 J;  2RRD A;  2MA1 A; 
#chains in the Genus database with same CATH topology
 4R64 A;  1A77 A;  2KTQ A;  2ZUD A;  1NZB A;  4DL4 A;  8ICU A;  9ICW A;  4F5R A;  1ZQX A;  2MUT A;  3EPI A;  1SZP A;  3OSP A;  2JEJ A;  2XGQ A;  9ICR A;  4Z6F A;  4O5E A;  2ZIW A;  2VAN A;  2M0N A;  5AK4 A;  1J2N A;  1MN8 A;  5J0W A;  1ZET A;  5AM5 A;  1KEJ A;  1RXV A;  5KG2 A;  4NLC A;  2JXJ A;  4PZN A;  1VJ5 A;  2W3S A;  1Z4O A;  1NJY A;  2KHQ A;  1NKC A;  3BJY A;  2AH5 A;  5ALU A;  4QW8 A;  4P2H A;  1SXE A;  4BWJ A;  5F9L A;  1Z1B A;  5J2E A;  7ICV A;  2LYB A;  1D9D A;  3RJF A;  1X6I A;  4I2F A;  4I2A A;  1UQV A;  1Q3V A;  1D9F A;  2PI4 A;  2AGO A;  1JI7 A;  1QSS A;  4KLD A;  5G5G A;  1ZQA A;  3WKD A;  4PJ0 U;  1ZQO A;  2HHW A;  2EZY A;  4EEK A;  5EE9 A;  4F4W A;  4EBD A;  1KDH A;  3FC4 A;  4U7C A;  2NRZ A;  3HIL A;  2OEH A;  3SAF A;  4NWI A;  4QZH A;  1MA7 A;  2BDU A;  3H0R B;  4I29 A;  8ICT A;  2IHN A;  5KNI A;  2G5I B;  5KTQ A;  4B9T A;  2DWQ A;  1SIJ A;  1T8E A;  4DSI A;  1HIW A;  1WCN A;  4UAT A;  2HOF A;  3EUB 2;  1RPL A;  4CF5 A;  3I76 A;  4ED7 A;  2DKX A;  1L7N A;  5KL8 B;  5KFD A;  2BCR A;  2E1F A;  4IQU A;  4PHA A;  4KLU A;  3RH5 A;  2YQE A;  3HT3 A;  8ICP A;  5CP2 A;  5HHH A;  4R8U A;  2K8B B;  1ZQB A;  3WK6 A;  2KIC A;  1ZJN A;  1ZQW A;  1IXR A;  3C2M A;  3JPT A;  2HOI A;  3AMZ A;  8ICH A;  1ZQU A;  4LVS A;  1SL0 A;  3OJU A;  3JPN A;  1S10 A;  3OTQ A;  2KVS A;  4FZM A;  4F72 A;  3RR7 A;  2OYY A;  4GFJ A;  2KJ9 A;  1UA1 A;  2W04 A;  4UB5 A;  4DF8 A;  1TK8 A;  3I28 A;  3BQ7 A;  3O0F A;  3NAS A;  4C4R A;  4IRK A;  5ALQ A;  5TIS U;  3CRX A;  1RXW A;  4RQM A;  2VIX A;  3DEE A;  3C1Y A;  4UB8 U;  1U45 A;  4UAZ A;  5AKJ A;  4RNN A;  2MAX A;  2A3V A;  1ZQS A;  1JAL A;  3NVY A;  5ALM A;  3F2D A;  3K1R B;  3AQE A;  3ISB A;  3TAQ A;  4OJO A;  3NTU A;  7ICN A;  2JH7 A;  5DB9 A;  4DQP A;  2FI1 A;  2AXT U;  3QX7 A;  5AM0 A;  3OHA A;  3QE9 Y;  2QB0 B;  2KNJ A;  3NRW A;  3SYZ A;  2NO4 A;  1N56 A;  3ISD A;  4PZO A;  1L3V A;  4ECZ A;  2E8N A;  3NUQ A;  1UT8 A;  2IOH A;  2BQR A;  3WK7 A;  5D46 A;  5DB6 A;  2J6T A;  2A19 A;  1JN3 A;  2W7O A;  4CE6 A;  3KFU F;  2ISP A;  4EYI B;  4KLJ A;  4F93 B;  4BUG A;  5KFT A;  4F5O A;  4DF4 A;  5EE3 A;  5J2I A;  4USA A;  1NNL A;  3QUT A;  5AM2 A;  2R8I A;  4Q8F A;  2K89 A;  5KFF A;  5DB8 A;  2LBO A;  4ZOH C;  1D8L A;  2XIC A;  4ELT A;  3QYP A;  5J0O A;  5L9X A;  1VLB A;  3WK9 A;  8ICM A;  5DDY A;  1S0M A;  1ZD2 P;  3C28 A;  2ZJ8 A;  4IQT A;  2PMZ C;  2H3V A;  4KLI A;  2JEI A;  4QZE A;  3N7R C;  3A0B U;  3WKC A;  4J03 A;  3FM9 A;  1DOQ A;  1Z19 A;  2KEY A;  1SL1 A;  1N2X A;  1KQQ A;  5DB7 A;  5HR7 A;  2JMG A;  7ICP A;  1Z4N A;  3D2N A;  4NJ8 A;  4DSF A;  2W9C A;  2QAR B;  3KHL A;  1QLN A;  3K1Z A;  4FE3 A;  7ICK A;  1KTQ A;  4UAS A;  4P0P B;  5KFU A;  1SKW A;  2E3T A;  5J2D A;  3RRH A;  3AN1 A;  5III A;  3BQ0 A;  1NK7 A;  4EX7 A;  4C7Z A;  2D3D A;  3ZDB A;  1ZRN A;  4GXK A;  2H3Z A;  8ICF A;  3I1Y A;  2EQY A;  4MFF A;  1BVS A;  5ALY A;  5J2K A;  1NZP A;  3QUB A;  5J29 A;  1NK6 A;  1ARO P;  1S8O A;  4M04 A;  4P0P A;  1S0V A;  4LZG A;  5CWR A;  2B6G A;  1TAQ A;  4MFC A;  2G0A A;  3GDX A;  5DG9 A;  3KKA A;  4UB3 A;  3PVX A;  2JZB A;  4RPX A;  1PZN A;  2DPJ A;  1DXS A;  2K8A A;  4UAW A;  5EWG A;  1ZD4 A;  4M6W B;  2K4P A;  1ZRM A;  3Q8S B;  3M8S A;  4YVZ A;  2WFA A;  9ICB A;  4M9L A;  5DQH A;  3QZ7 A;  2AJQ A;  4CRX A;  1ZQY A;  2XO7 A;  4FBT A;  2Y9T A;  3RR8 A;  4CF3 A;  5A0L A;  4OJ6 A;  3JPQ A;  2KJ5 A;  5AKG A;  5KFQ A;  5AI8 A;  1KFS A;  5KT7 A;  2PFQ A;  1DK3 A;  1SV4 A;  8ICN A;  4TQS A;  9ICI A;  4C80 A;  3L3F X;  2Z7J A;  2BPG A;  3QNM A;  1IV8 A;  4EZ9 A;  2ASD A;  4F3O A;  7ICO A;  3RB0 A;  1V38 A;  1MSW D;  1BNP A;  4QWB A;  2C22 A;  1TVA A;  4CDG A;  2BQU A;  5L1L A;  2WAQ F;  2FLL A;  4RQ6 A;  2YY6 A;  1SL2 A;  4IR9 A;  1L3U A;  4M6W A;  3UMG A;  4C8K A;  1RDF A;  3HX0 A;  1V85 A;  2Y1J A;  1MQ3 A;  5KFB A;  4DOC A;  3M7D A;  3H0L B;  4IL6 U;  3S6J A;  4ELV A;  3GIM A;  1RQN A;  5ALX A;  4KN4 A;  3M6Z A;  3MR3 A;  2NYV A;  2PFO A;  3NVV A;  1JX4 A;  1ZQF A;  2ZTC A;  2PKE A;  4KIT B;  2KP7 A;  3SI8 A;  5EWE A;  5DG7 A;  5J8Y A;  2W55 A;  3WK8 A;  1B0X A;  2EAP A;  3C2L A;  1NK5 A;  4M9H A;  2E8M A;  2G07 A;  4UAV A;  2H3Q A;  1NJX A;  3PX6 A;  4M9G A;  4RPZ A;  5J0T A;  3UMC A;  2P6R A;  1YZ6 A;  3ALR A;  3KZI U;  5JUM A;  1SZH A;  3UQ2 A;  2B0C A;  2W8K A;  3BQ2 A;  5ALR A;  2LM4 A;  5AKX A;  2DPI A;  8ICC A;  5IIJ A;  3PW2 A;  5ALF A;  4PH5 A;  4J9K A;  1ZQV A;  5IIM A;  2FLN A;  8ICX A;  3L5K A;  3ED5 A;  2RQ5 A;  9ICX A;  1BPB A;  4Y2T A;  5HR6 A;  3RRG A;  2BGW A;  1IM4 A;  4IS7 A;  4EEL A;  2OHF A;  5KFC A;  1PK1 B;  3V6J A;  1RYR A;  1TK0 A;  4LJX A;  1L3T A;  1KSP A;  1ZQH A;  2EAO A;  4BXO A;  2EAN A;  2VA2 A;  3H8W A;  1ZJM A;  1SWV A;  4OCZ A;  5DLG A;  1NK4 A;  1SKS A;  3GZF A;  1L6N A;  7ICL A;  2PFP A;  2M9N A;  1P7D A;  5KFA A;  1ZQM A;  8ICB A;  1WCL A;  2ZUC A;  4IRC A;  4YMO A;  3WK5 A;  4KMU A;  5AI9 A;  5KFL A;  2ZIU B;  2HBJ A;  1S97 A;  3MBY A;  2G06 A;  2MA1 A;  2R18 A;  2XID A;  2W9A A;  3H40 A;  1U9L A;  4I2E A;  2MRL A;  2YMP A;  2K8C B;  4F5P A;  5ALG A;  1ZQI A;  1NKB A;  1CEZ A;  2ZG6 A;  5ALV A;  3H0M B;  2C2E A;  4F4Z A;  4M9J A;  4DQR A;  3AL0 B;  2HBK A;  4YFK A;  9ICH A;  2C28 A;  4EEN A;  5KG7 A;  1HUO A;  2YN4 A;  4YR2 A;  3SAG A;  5AKK A;  1X9M A;  5DG8 A;  1ZQJ A;  5BOL A;  4UAU A;  2OWO A;  4Y2U A;  1PVP A;  5J0X A;  3EW9 A;  2XY5 A;  1SXD A;  4F4Y A;  4I2J A;  1C7Y A;  3Q8P B;  3BQ1 A;  4AYB C;  1ZQT A;  8ICO A;  4ZH4 A;  3KHG A;  3F5E A;  3V72 A;  5DQG A;  5G5H A;  7ICM A;  2CN1 A;  2QB0 A;  2HHQ A;  2IOF A;  1QCK A;  2QLT A;  3WKA A;  2HW3 A;  4UW9 A;  1OW5 A;  2DKZ A;  4F5N A;  3BZK A;  4NL9 A;  2FLP A;  3PO4 A;  4RU9 A;  3E58 A;  1DRG A;  4RQ3 A;  4DSJ A;  4ED1 A;  3M8R A;  1SWW A;  5KFI A;  2ZJA A;  2BPC A;  3FYH A;  5HP4 A;  2E8O A;  3GIJ A;  4EBE A;  5J0U A;  5DLF A;  3UXO A;  2ISO A;  3Q8K A;  4Y2Y A;  5EOZ A;  2K4I A;  2KJ8 A;  9ICJ A;  3SZ2 A;  5DGB A;  4F91 B;  1LVH A;  2KV2 A;  4KN7 A;  3IN5 A;  1XWL A;  2WHE A;  2ZIU A;  4MF2 A;  4RT3 A;  3LDA A;  1KN5 A;  4EZ6 A;  4KX5 A;  4NM1 A;  1URJ A;  3MGV A;  3IDW A;  4NLB A;  4M0A A;  3RJJ A;  4X5V A;  2B21 A;  9ICU A;  1SV0 A;  2MSN A;  3PW7 A;  2D8C A;  3AQF A;  5J0S A;  5CR0 A;  3ISC A;  4ACO A;  3TAN A;  1BPE A;  1UT5 A;  3EWA A;  2GWS A;  2Y0S F;  1ZQD A;  5DDM A;  2HOQ A;  2AHO B;  1L8L A;  3IM1 A;  3CYM A;  1ZD5 A;  1V97 A;  3SEN A;  4QZC A;  1BGX T;  2YB4 A;  3T5H A;  3D2Q A;  4ECV A;  4Y2J A;  2E1E A;  3SMV A;  2HHT A;  4US8 A;  3TAD C;  1ZQL A;  2JGA A;  4UB2 A;  4JUZ A;  2KZZ A;  4RNO A;  3ZD9 A;  4RZR A;  4Q44 A;  7ICU A;  1XU4 A;  4AP9 A;  9ICK A;  4O9M A;  3RAQ A;  1QQ7 A;  4F71 A;  4DL2 A;  4OJL A;  2W9M A;  4C8O A;  2GOL A;  5AHX A;  3HKZ C;  4O3P A;  4B9M A;  2F2A B;  5AI0 A;  5B66 U;  4A8E A;  2HSZ A;  4TUP A;  3LK9 A;  4C8N A;  5KAI U;  2XCA A;  2UVR A;  4GC6 A;  5JU5 A;  2BZF A;  4KLT A;  4NY8 A;  2F1I A;  3KD3 A;  2AGP A;  4UBC A;  2PMZ F;  3JPR A;  1ZQC A;  3BS5 B;  5GTH U;  4R63 A;  4JMU A;  1JIH A;  2H3F A;  4YQW A;  9ICN A;  2Y9U A;  2ZIW B;  1PK3 A;  3TAD A;  1N48 A;  3OJS A;  4O5C A;  4BDP A;  4C0Z A;  4F92 B;  4F50 A;  5CHG A;  1IG6 A;  2BCQ A;  2N1R A;  5KT2 A;  4GXI A;  3RJI A;  4O3N A;  2NRX A;  3IG5 A;  3E2E A;  4YR3 A;  5IIO A;  3RB3 A;  2W11 A;  1A76 A;  2O6K A;  1L3S A;  4NV0 A;  4DS5 A;  5CRX A;  2QAR A;  3C1Z A;  2BKE A;  5HMM A;  9ICT A;  3LWM A;  3MR6 A;  1D8B A;  1RZT A;  5KG1 A;  3ICX A;  4KLQ A;  2KN7 A;  3UPQ A;  4QIW F;  4QW9 A;  1NK8 A;  2CPR A;  1LB2 B;  3RBE A;  4JWN A;  4P0Q B;  4UQG A;  3RBD A;  2MU2 A;  5AIA A;  1XO1 A;  3Q8R B;  2F44 A;  4QZ8 A;  3HJE A;  3OHB A;  8ICG A;  2J6U A;  1S5L U;  5ALW A;  4RQ1 A;  3PSI A;  2NV3 A;  1U48 A;  3FDS A;  3KBB A;  1KKX A;  1SKR A;  5ALO A;  5JRT A;  4YXM A;  2BCS A;  1BPX A;  3MR5 A;  4DFK A;  4I2I A;  3L4P A;  3V6K A;  2LYA A;  1ZQZ A;  4J9S A;  4I2H A;  3UMB A;  5J2A A;  1QSL A;  4FO6 A;  1L7P A;  1BPZ A;  4J9N A;  4KLS A;  1ZXI A;  3WKB A;  3IRU A;  4I2B A;  3PNC A;  4JWM A;  4NLG A;  3T3F A;  4QZB A;  5B5E U;  7ICT A;  2NRW A;  4YD1 A;  1Q46 A;  2ZJ5 A;  3IP4 B;  5KFR A;  2H5X A;  1NJZ A;  2XY7 A;  2AGQ A;  4Y2Q A;  4EX6 A;  3RAX A;  3KOO A;  4BGD A;  5KFG A;  5L1J A;  3TAP A;  4R66 A;  3GFK B;  3DV9 A;  4BX9 C;  3SAH A;  1C20 A;  3C2K A;  1YZ7 A;  4RQN A;  5ALZ A;  1S0O A;  3MC1 A;  3ZDA A;  4DLE A;  3VCB A;  2OCE A;  5CA7 A;  8ICZ A;  5L1I A;  4DEZ A;  2BHN A;  2DFL A;  4QJF B;  3HPO A;  2KIW A;  3MR2 A;  4DWI A;  3U26 A;  4QWC A;  1RYS A;  3BS5 A;  3IV6 A;  3SR6 A;  4GLX A;  5AK6 A;  4RQ2 A;  3PV8 A;  2JEF A;  5KFH A;  3LVV A;  3SD7 A;  2C2D A;  2YX8 A;  3MFI A;  2FMP A;  1FEZ A;  1ZYQ A;  3WK4 A;  2K4H A;  4LZD A;  4XUS A;  5KT4 A;  9ICC A;  5J0P A;  3M9N B;  3NGD A;  1N5X A;  3AEV A;  4ED0 A;  4O5K A;  3H4D A;  4PPX A;  2KSO A;  2HHS A;  2WB1 F;  1QH9 A;  3RJK A;  1GO3 F;  1RQL A;  1S9F A;  1AQ6 A;  2JV3 A;  4DSK A;  4UB6 U;  1ZQK A;  3H8J A;  5TZV A;  3GV5 B;  1U49 A;  2FJ6 A;  4Y2X A;  5KG3 A;  1FFU A;  1WG8 A;  2A1A A;  5K4L A;  3PST A;  3JPP A;  2F1J A;  2VA3 A;  3ZD8 A;  4F4K A;  4TUR A;  5EWF A;  1J97 A;  3PML A;  1DGS A;  2CRX A;  4RQ4 A;  4ECW A;  2W8L A;  4KLF A;  3PMN A;  4ECS A;  2UVV A;  7ICJ A;  1TAM A;  4Q45 A;  8ICK A;  4GC7 A;  2I1Q A;  5DQI A;  3QZ8 A;  4PHE A;  3N4M B;  5AKE A;  3VC8 A;  2ESE A;  2KVC A;  4F5Q A;  3BS7 A;  3A0H U;  3B0Y A;  4PHP A;  1LKY B;  3ZI4 A;  3CNH A;  4RNM A;  4F2S A;  2EDU A;  2LMR A;  5KFJ A;  3PZP A;  1X9S A;  4US9 A;  8ICL A;  2BCU A;  3G6X A;  5ALP A;  1Z1V A;  2KG5 A;  2BDP A;  1NK0 A;  2NO5 A;  1RG6 A;  3PR5 B;  4KMO B;  2L5Y A;  3GV7 B;  1COK A;  3QU2 A;  4C8M A;  5J0Q A;  3QU4 A;  7ICG A;  5AKZ A;  5J2B A;  4YD2 A;  5AM1 A;  4IR1 A;  3HW8 A;  1XC9 A;  1BPD A;  1WUD A;  2WAQ C;  3M6K A;  8ICI A;  2LHT A;  4BJQ A;  7ICR A;  1O03 A;  1KFT A;  4Z6D A;  4I2C A;  1SGG A;  3QEB Z;  1SB3 C;  3PW4 A;  3F5A A;  4C4S A;  5KFY A;  5ALH A;  2W54 A;  3QU7 A;  4QZG A;  1K1S A;  3C29 A;  1S0N A;  3MFH A;  2DL0 A;  2P6U A;  3RJH A;  4Z6C A;  2YMM A;  4UB1 A;  1XS9 D;  3JPS A;  1QSY A;  2K4E A;  1XO0 A;  2YMQ A;  2JRZ A;  1X66 A;  5KG0 A;  3GU3 A;  4I2D A;  5DBC A;  3T5L A;  4PGX A;  2NRV A;  2RDJ A;  3KZX A;  3ORY A;  2R8G A;  4FS2 A;  4U6P A;  2E8P A;  1QQ5 A;  1HEK A;  1WWU A;  3QUQ A;  5AKI A;  4I2G A;  2EZZ A;  3HRD D;  5HHI A;  4DFD A;  5KT5 A;  8ICQ A;  3TAR A;  1B22 A;  3PY8 A;  2ZIX A;  2HHV A;  1EXN A;  1H38 A;  1KLN A;  4HAI A;  1RM6 C;  1FFV A;  1TKD A;  1KFD A;  2IMW P;  3N7P D;  5DBA A;  4ED3 A;  1X9W A;  2ZIX B;  4DL7 A;  4ECU A;  1Q3U A;  4M2Y A;  7ICE A;  8ICW A;  3BZC A;  2E5S A;  4DSE A;  3ZDC A;  1L7M A;  5DKW A;  2KE7 A;  4FBU A;  1HUZ A;  4QZA A;  3C5G A;  2W3R A;  3PSP A;  4P4O A;  3TAC B;  9ICP A;  1KW4 A;  3ONN A;  4PHD A;  3AU6 A;  5D4B A;  3JPO A;  2F8K A;  4YMM A;  4Y2S A;  2YML A;  3QU9 A;  4P4M A;  9ICL A;  4EBC A;  2YB1 A;  2R8H A;  5KT3 A;  1ED1 A;  5KFP A;  4P4P A;  3ZDD A;  2KIV A;  4DQQ A;  2XGP A;  4CCH A;  1S76 D;  3SV4 A;  2IOF K;  4BXO B;  3KKA C;  4YR0 A;  3TFS A;  3D2S A;  1CRX A;  4KLL A;  5KG6 A;  4Q43 A;  2P66 A;  2Y0S C;  2XC9 A;  1X9X A;  1ZQN A;  2KHV A;  5J2J A;  4J9R A;  4MFA A;  2VA8 A;  2WF9 A;  1A6S A;  3HP6 A;  3AM9 A;  3T5J A;  1B43 A;  2DF4 B;  4C7Y A;  4RT2 A;  2DGZ A;  4ED8 A;  2HVI A;  2RHF A;  3SEI A;  1M6Y A;  4DQS A;  5ALS A;  9ICQ A;  5F9N A;  3LWL A;  4Y2V A;  5KFZ A;  2ZIV A;  4DL5 A;  4B9N A;  1X42 A;  3QEA Z;  2VJ5 A;  3CW2 C;  3NS1 A;  1NOM A;  1J2M A;  2WF8 A;  3R9K A;  3MGI A;  1L7O A;  3WKE A;  2CXY A;  1ZQR A;  3UXP A;  5J2G A;  2FPK A;  4P0Q A;  1T94 A;  2F3N A;  2VKQ A;  3RJE A;  1N62 A;  2V4R A;  2XCP A;  7ICH A;  5KFO A;  2ZUB A;  4DCC A;  2ZIV B;  5AI4 A;  1N61 A;  2WTF A;  3T79 A;  3NVW A;  5EE0 A;  4O3S A;  4O3O A;  3PX4 A;  2OXO A;  3PSF A;  5AI5 A;  1ZQP A;  4CGZ A;  1Z00 A;  2EZX A;  5KFV A;  2EH9 A;  9ICO A;  5ALL A;  3N97 B;  2IA6 A;  1L8O A;  4I28 A;  4DFJ A;  3RTV A;  4RQ7 A;  2J6S A;  4JK1 A;  2KZ3 A;  1B4F A;  4O3M A;  2P35 A;  3NRZ A;  1FO4 A;  3HWT A;  3C23 A;  5EE1 A;  5C0Y A;  4DSL A;  2UVW A;  1WWV A;  4PGY A;  5BOM A;  1L5U A;  2F77 X;  5DGA A;  4B9L A;  4HYK A;  1F44 A;  2W9B A;  3GIK A;  1MQ2 A;  1KL9 A;  5AI6 A;  5KT6 A;  2ZTD A;  3LVW A;  1DGJ A;  5AIB A;  3RB6 A;  1XSL A;  3D6J A;  4J9P A;  4UAR A;  1UHU A;  4QZI A;  4F4X A;  3RF9 A;  1TFR A;  1V9P A;  2ZTE A;  5D49 A;  3G6V A;  4IQV A;  2FMS A;  4O0I A;  1U4B A;  1O08 A;  1PVR A;  5T14 A;  3RB4 A;  5KFE A;  4CNQ A;  1T7P A;  4F2R A;  1NJW A;  1F5S A;  4MF8 A;  4QZ9 A;  1K5O A;  5ALK A;  9ICE A;  3MDA A;  5L1M A;  4MHV A;  4Z6E A;  1ZQG A;  2DUY A;  4F8R A;  5AM3 A;  4WJ3 B;  9ICM A;  1LV5 A;  2A1J A;  3KHR A;  1T3N A;  4DFP A;  4G3I A;  3F53 A;  3EZ5 A;  2LKY A;  2PFN A;  4G9B A;  2HBL A;  1LKY A;  8ICA A;  3EYZ A;  8ICE A;  3HKZ F;  4JV2 A;  3ETL A;  5KFS A;  2W9B B;  3OPX A;  5GTI U;  2V4Q A;  2BCV A;  3N28 A;  3ETR A;  4RUC A;  3OSN A;  4KLH A;  3CP8 A;  4DQI A;  4UBB A;  2NRT A;  4NM2 A;  1OUQ A;  4QWE A;  1K1Q A;  4XQ8 A;  3V6H A;  5KL1 B;  8ICY A;  4GXJ A;  4YCX A;  1YT3 A;  1X2I A;  2ASL A;  1JRO A;  1N60 A;  4C4T A;  5AK3 A;  2ODG A;  4J9Q A;  1QTM A;  1UPH A;  3THV A;  4M47 A;  1XSP A;  3B0X A;  1PUZ A;  4C8L A;  2GLE A;  2LM1 A;  3E0F A;  9ICV A;  4Q8E A;  3AUO A;  5ALJ A;  4K4G A;  1A0P A;  3NVZ A;  3V7L A;  5IIK A;  2HVH A;  2FPM A;  1XNS A;  1S77 D;  1XSN A;  9ICA A;  1ZD3 A;  4TQR A;  2W9C B;  2ZXH A;  3UM9 A;  2RP5 A;  2W43 A;  3Q8L A;  2V9W A;  2RDI A;  2I6X A;  3PO5 A;  1BPY A;  3C21 A;  3PW5 A;  3TFR A;  5AKH A;  4KLE A;  2EAM A;  4QIW C;  2AU0 A;  5ALT A;  2XVT A;  5BPC A;  7ICI A;  1N63 A;  5HML A;  4NLN A;  2GO7 A;  4CF4 A;  2G08 A;  2KKP A;  2YTU A;  4EYH B;  2FDR A;  4B9V A;  4RQ8 A;  2ES6 A;  8ICS A;  2Q0Z X;  4QZF A;  2FE9 A;  5KFX A;  2G09 A;  4QNL A;  4PL1 A;  1NI3 A;  2W7P A;  4ICA A;  4ECQ A;  1MC8 A;  1WYG A;  2AQ0 A;  4DS4 A;  3M1Y A;  2WF5 A;  2ASJ A;  4GIB A;  4QWA A;  4QZD A;  4FFD A;  2VJ4 A;  2JZB B;  3MDC A;  5ALI A;  1T4G A;  3GIL A;  4KX3 A;  4NXZ A;  1VDV A;  4B6J A;  1Z00 B;  2JR5 A;  2W03 A;  4IRD A;  5CJ7 A;  4YMN A;  3AU2 A;  1CUK A;  5J2H A;  5KG5 A;  2XY6 A;  4IC9 A;  1FIQ A;  5CB1 A;  5ALE A;  2KFN A;  4YG2 A;  2R8J A;  4TUQ A;  2HMX A;  2RLT A;  3LYS A;  4YP3 A;  2KMD A;  4KLM A;  4OJP A;  4RUA A;  7ICQ A;  2A1J B;  5F3X B;  2LI6 A;  3MGH A;  1ZOL A;  1JRP A;  3WU2 U;  2JHD A;  4IQW A;  2ZXI A;  5H2F U;  1SV0 C;  4K4I A;  4EEY A;  1DK2 A;  5HNK A;  2KOB A;  3V7K A;  4UB4 A;  1BNO A;  2HCF A;  5L1K A;  3PX0 A;  4E0D A;  4XRH A;  4J9L A;  1TAU A;  5IIN A;  3OGU A;  1TE2 A;  2KSO B;  2KZM A;  2BQ3 A;  2RRD A;  4DLG A;  2HHX A;  4ELU A;  1PK1 A;  5J0Y A;  5DBB A;  4DL6 A;  8ICV A;  1NKE A;  5C5J A;  1Z3E B;  2WB1 C;  4OD0 A;  4Y2P A;  3KHH A;  9ICS A;  5KFW A;  5JTI A;  4YXJ A;  2IHM A;  1JMS A;  2FPL A;  2PI5 A;  2F8L A;  3F2B A;  1CI4 A;  4PGQ A;  4ED2 A;  1X6J A;  4B9U A;  5J2C A;  4NL9 C;  5AIC A;  3UXN A;  5KAF U;  5J2F A;  3B9J A;  3M9O B;  4J9O A;  2R8K A;  3K4G A;  2PXI A;  2HBM A;  4ED6 A;  2UVU A;  4RQ5 A;  3QUC A;  1JUD A;  3BQT A;  1QQ6 A;  4NLZ A;  3K75 D;  4O3Q A;  4FZL A;  2XI9 A;  5AK5 A;  2C2R A;  4K4H A;  4KTQ A;  2GH1 A;  4UAY A;  5J0R A;  4ECT A;  4M9N A;  4PL2 A;  4OO1 J;  5J8Y C;  4DFM A;  9ICG A;  4BWM A;  4DOB A;  3BDP A;  2KKV A;  3Q8M A;  4ECY A;  1RYU A;  3H8S A;  5ALD A;  4B9S A;  2KFZ A;  1OXJ A;  1ECW A;  4DOA A;  1F0M A;  3FAH A;  3ZDE A;  1IIP A;  2I9G A;  3PR4 A;  4O3R A;  2I5H A;  3H8M A;  3Q8Q B;  3GV8 B;  1UCV A;  2JH1 A;  1UA0 A;  3RH4 A;  5KG4 A;  1ZQQ A;  3QU5 A;  4RQ0 A;  3RJG A;  1Y88 A;  2IBK A;  2K60 A;  4QWD A;  9ICF A;  3H4B A;  1JXE A;  2FMQ A;  2MUT B;  2WF6 A;  4YN4 A;  4TUS A;  2QB1 A;  3H7I A;  3QXG A;  3M9M B;  3MAB A;  3J81 j;  4ECX A;  4FZN A;  4DL3 A;  4NLK A;  3PW0 A;  3RFA A;  4RPY A;  5E79 U;  3G6Y A;  4JV0 A;  3RH6 A;  2D6F C;  2LPE A;  1T3Q A;  2BR0 A;  4JV1 A;  1PVQ A;  2OM6 A;  2JEG A;  3EPG A;  2AQ4 A;  4KLG A;  3SV3 A;  1KRP A;  3UQ0 A;  1HJP A;  1X40 A;  2WF7 A;  3T5K A;  5FP0 A;  4DO9 A;  2F1H A;  2ATL A;  1N5W A;  7ICS A;  1ZQ1 C;  2LYH A;  1TV9 A;  2BPF A;  1Q8K A;  4ECR A;  2DQN B;  2KD1 A;  3IHQ B;  4J9M A;  2ALZ A;  3GQC A;  2Y1I A;  2F76 X;  5AM4 A;  4MEX A;  2HHU A;  4XA5 A;  5KFN A;  3GII A;  4JB3 A;  4KLO A;  4OJ5 A;  3KTQ A;  2G5H B;  2QKQ A;  2HDO A;  2DBY A;  2HI0 A;  4Y2R A;  5ALN A;  4I27 A;  3TQ1 A;  1COO A;  4MEY A;  1D8Y A;  8ICJ A;  2H3I A;  5AKL A;  5CEH A;  5KFM A;  4FS1 A;  4R65 A;  4R8U B;  3N7S C;  8ICR A;  5IIL A;  2Q4T A;  3F2C A;  3TI0 A;  3DDH A;  2KK0 A;  5AKY A;  3IG8 A;  1ZQE A;  5KFK A;  1U47 A;  3SQI A;  1TK5 A;  1KBU A;  1NK9 A;  3TKA A;  3C5F A;  2OH2 A;  4AYB F;  3V7J A;  7ICF A;  1JXL A; 
#chains in the Genus database with same CATH homology
 2KJ8 A;  2KNJ A;  3NRW A;  4C0Z A;  2ZXI A;  2G5I B;  1TAM A;  1NZB A;  4QIW C;  3NUQ A;  2N1R A;  4CDG A;  2KV2 A;  1HIW A;  2XVT A;  2ZIX A;  3IN5 A;  2WAQ F;  2ZIU A;  3VC8 A;  2KVC A;  4P0Q A;  4WJ3 B;  3GZF A;  4BX9 C;  1L6N A;  1T94 A;  3SAH A;  1P7D A;  2KOB A;  2HOF A;  4KX5 A;  2H3Z A;  3D2S A;  4FZN A;  3N7P D;  2VKQ A;  1URJ A;  2G08 A;  2KKP A;  3F53 A;  2LKY A;  3IG5 A;  3RFA A;  3MGV A;  2W7O A;  3KFU F;  2D6F C;  4NLB A;  2ZIX B;  3VCB A;  2ZIU B;  2HBJ A;  4NV0 A;  5KL8 B;  3PZP A;  1Q3U A;  2ZIW A;  2E5S A;  2E1F A;  2RRD A;  2ZIV B;  2G06 A;  2OM6 A;  2MA1 A;  2HBL A;  4BUG A;  4QJF B;  1PVQ A;  3M7D A;  2R18 A;  2XID A;  3AQF A;  3H0L B;  2KIW A;  2G09 A;  3T79 A;  4QNL A;  2M0N A;  3HKZ F;  4PL1 A;  2MRL A;  4P0P A;  4ACO A;  2OXO A;  2K89 A;  3PSF A;  2K8B B;  2K8C B;  3M6Z A;  1D8B A;  2LBO A;  2WB1 C;  2ZG6 A;  1ZQ1 C;  2KIC A;  2XIC A;  2Y0S F;  3OPX A;  3ICX A;  3PSP A;  2W7P A;  3H0M B;  4CGZ A;  2HOQ A;  4ICA A;  4NLC A;  2DQN B;  2KD1 A;  3CYM A;  4KMO B;  3ONN A;  2HBK A;  4QIW F;  3AL0 B;  2G0A A;  5CRX A;  3LVV A;  2F8L A;  2YB4 A;  3D2Q A;  2HOI A;  3SAG A;  2CPR A;  3C28 A;  3F2B A;  4P0Q B;  2PMZ C;  2F76 X;  2H3V A;  2E1E A;  3N7R C;  3SMV A;  2YX8 A;  2KHQ A;  2K8A A;  2JGA A;  3CP8 A;  1PVP A;  2YB1 A;  4O3M A;  1OUQ A;  4OJ5 A;  1ED1 A;  1WUD A;  2K4H A;  2G5H B;  2WAQ C;  3M6K A;  4FZM A;  5C0Y A;  2LHT A;  4BJQ A;  3PSI A;  2G07 A;  2H3Q A;  5KL1 B;  2KEY A;  2HBM A;  1Z19 A;  2VJ4 A;  2NV3 A;  1YT3 A;  2F77 X;  2OYY A;  4GFJ A;  1Z1B A;  1F44 A;  4AYB C;  2KJ9 A;  2W04 A;  5HR7 A;  4OJL A;  3F5E A;  2GOL A;  4CRX A;  2JMG A;  3HKZ C;  4KX3 A;  2H3I A;  1UPH A;  2CN1 A;  3F5A A;  3O0F A;  1CRX A;  2LYB A;  2XI9 A;  2F2A B;  3ALR A;  4FZL A;  3C29 A;  2W03 A;  1SZH A;  2GH1 A;  3D2N A;  2WB1 F;  2LYA A;  2Y0S C;  3CRX A;  3LVW A;  4A8E A;  2KHV A;  1GO3 F;  3E0F A;  4PL2 A;  5A0L A;  1Q3V A;  3N7S C;  4OJ6 A;  4OO1 J;  2VIX A;  3DEE A;  2KJ5 A;  1A0P A;  2Q4T A;  4IC9 A;  3F2C A;  2KKV A;  3K1Z A;  1A6S A;  3IG8 A;  1DRG A;  2PMZ F;  2HMX A;  3LYS A;  2DF4 B;  4FE3 A;  2A3V A;  2K4E A;  1XNS A;  2DGZ A;  3RF9 A;  3F2D A;  3SQI A;  1XO0 A;  2RHF A;  3AQE A;  4OJP A;  4P0P B;  4JMU A;  2H3F A;  1ECW A;  1KBU A;  3GU3 A;  3PST A;  4U7C A;  3IP4 B;  2ZXH A;  3SAF A;  4NWI A;  4OJO A;  2RP5 A;  3L3F X;  5HR6 A;  1MA7 A;  2JH7 A;  1IIP A;  1PVR A;  2Z7J A;  2ZIW B;  3KZX A;  2ZIV A;  2BDU A;  3H0R B;  5T14 A;  2CRX A;  4AYB F;  2JHD A;  2JH1 A;  2VJ5 A;  2OH2 A;  4U6P A;  1HEK A;  2K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...