1D8BA

Nmr structure of the hrdc domain from saccharomyces cerevisiae recq helicase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
ELNNLRMTYERLRELSLNLGNRMVPPVGNFMPDSILKKMAAILPMNDSAFATLGTVEDKYRRRFKYFKATIADLSKKRSSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of the HRDC domain and implications for the Werner and Bloom syndrome proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords SGS1 RECQ HELICASE
total genus 27
structure length 81
sequence length 81
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11408 Helicase_Sgs1 Sgs1 RecQ helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1d8bA00
3SAGA 4NLCA 4O3MA 2E1EA 2RHFA 2KV2A 2HBMA 4CDGA 2MA1A 5C0YA 2DGZA 2E1FA 2CPRA 3SAHA 1GO3F 4QJFB 1WUDA 4CGZA 4OO1J 4QIWF 2HBKA 1YT3A 4NLBA 1D8BA 2HBJA 2RRDA 3CYMA 2HBLA 3SAFA
chains in the Genus database with same CATH superfamily
7ICTA 1J2NA 5BPCA 4UARA 1RQNA 4UAZA 2ISOA 4J9KA 1JX4A 5J2CA 3GDXA 1UCVA 3K4GA 1T8EA 2DQNB 3WK4A 1ECWA 2KOBA 4ECZA 1NZPA 4KMUA 3Q8PB 1X40A 2ZXHA 5AI8A 5AKXA 3PSIA 3ZDEA 3UPQA 5IIKA 4F3OA 2HHUA 2XO7A 2KKVA 2KN7A 4P0PA 2W11A 1A6SA 7ICSA 4P2HA 2B6GA 2J6UA 4QZ8A 4F5NA 1KEJA 3NUQA 1ZETA 2NRTA 5ALLA 9ICEA 4Y2VA 1LV5A 1TFRA 2YMMA 4JB3A 2AJQA 4U7CA 4C8MA 7ICIA 4Y2TA 4R8UA 2W9BB 2XY5A 1ZJMA 2K89A 4PGQA 3ONNA 1NK9A 2WF9A 3JPNA 2WF7A 1B0XA 4DSIA 8ICNA 3BQ1A 5E79U 5D4BA 4CF3A 4KLUA 1B4FA 2DUYA 1XWLA 2E8MA 3OPXA 4NLCA 8ICSA 2W7PA 1ZQKA 1QSSA 2C2DA 4NLGA 2G08A 3UXOA 4RQ3A 2FPMA 1TAMA 5CWRA 5KFBA 2VANA 3KHRA 4I2CA 4TQSA 3OGUA 1RZTA 7ICOA 2ZJAA 3QZ7A 2FPLA 4Q44A 4Y2XA 1LKYB 1FIQA 5KFAA 8ICAA 2KEYA 4RQMA 2YX8A 2KV2A 1NJXA 1KFTA 3C2MA 3WK8A 1CI4A 4RQ2A 5KFKA 3UM9A 3DV9A 3JPSA 2CRXA 2YY6A 3T79A 5KFJA 3QUQA 2F44A 4K4IA 5AI5A 2JRZA 5CA7A 9ICOA 5J2KA 3F5EA 1Q3VA 1Z00B 1U49A 4IQWA 4JMUA 1U9LA 2J6SA 1SZPA 4R63A 2J6TA 2PFNA 3EYZA 2KJ8A 5ALFA 2KJ9A 4J9SA 2PFOA 4QW9A 2DWQA 5FP0A 3V6JA 2QARA 2PFPA 1PK1A 4I2IA 2DFLA 5KL8B 8ICXA 1ZQFA 3D2SA 3THVA 1WCLA 1NK6A 2DKZA 3QU4A 5J2AA 4PHAA 4MEXA 5F9NA 2FLNA 1H38A 1CEZA 2V9WA 1XC9A 9ICKA 9ICFA 2H3ZA 3MBYA 4I29A 2WAQC 4F71A 1TAQA 5ALQA 4KLSA 5HP4A 1BNPA 3RJEA 4ZOHC 1L7OA 5C0YA 5KFYA 4O5CA 5KFSA 5KFIA 1ZQNA 2HHXA 2JV3A 1Z1VA 2P66A 2A19A 3PVXA 4YN4A 5J0PA 5KT5A 1U4BA 4QZBA 2RRDA 3PR5B 4IL6U 3JPTA 4UB6U 4UAVA 3JPOA 4CF5A 7ICQA 5AK5A 2JXJA 2A1JB 4ECWA 2XC9A 2AXTU 2P6RA 5AI9A 1KFSA 4ZH4A 1KKXA 3GIMA 4M9NA 3TFRA 1NOMA 5IILA 3MGHA 3S6JA 2PKEA 5D46A 3I1YA 4RT3A 3RB6A 3PSFA 4ECYA 1ZD4A 4PL2A 2VJ4A 2AQ0A 3RH6A 3H8JA 3BDPA 2MU2A 1PVQA 2F77X 3IRUA 2YB4A 4DL2A 2JMGA 3KHHA 4LZDA 3C29A 4RQ0A 1BPZA 4EZ9A 2RLTA 2BHNA 2HCFA 5AKGA 1TK8A 2F1HA 4I2JA 4C8NA 2KZ3A 1JUDA 2DF4B 4B9SA 4M0AA 4RT2A 1JROA 3M8RA 4YG2A 4DFPA 4FE3A 2C22A 4JK1A 3A0BU 1UA1A 3F53A 4F5PA 4JV0A 5CEHA 4KLIA 2W43A 3M6KA 1X9MA 2JEIA 2HSZA 2AU0A 1S97A 3NRWA 4ECRA 3B9JA 1NK5A 1D9FA 1JXEA 5DQIA 3NVVA 2MA1A 1LKYA 2EAPA 4QNLA 1GO3F 3MGVA 4XQ8A 4BWJA 4FFDA 4F72A 5EWEA 2F2AB 3IV6A 4M6WA 1ZQXA 2YQEA 4RQ8A 1SIJA 4C80A 5IIJA 2KNJA 2AH5A 2OCEA 3UQ0A 3ALRA 3H0LB 4QWAA 4QZDA 3H8SA 1X9SA 4NM2A 4RQ1A 3SYZA 4YFKA 5AI4A 4ECTA 3QEBZ 1WUDA 2EZYA 3QU7A 2MUTB 5J2BA 4IS7A 4IC9A 5J0WA 3SAFA 3H8MA 4X5VA 3MDCA 3HILA 2M9NA 2KE7A 2KKPA 3WK5A 5AM4A 1V38A 4DSFA 2NO4A 1BPXA 5J2HA 4O3NA 8ICQA 3HPOA 2BCUA 2IOFK 4OJPA 2PI4A 8ICHA 1B43A 1D9DA 4O3QA 2LM4A 1UPHA 5DB8A 2P35A 4C4SA 2NV3A 2BGWA 2HOQA 1FFVA 2Y1JA 2KICA 3R9KA 1NK8A 2F1JA 5DBAA 2RDIA 5KFEA 5AIAA 3HW8A 2WFAA 9ICNA 1LVHA 5AKLA 1FEZA 2W04A 5CB1A 2I6XA 4KLEA 1COOA 5AKHA 3M1YA 4UATA 2E1FA 5AI6A 4RQ4A 4F2SA 1L3VA 2W9BA 4Y2PA 3V7JA 4RQ7A 4FBUA 3N7PD 4IQVA 3NTUA 4OCZA 4DOCA 1ZQ1C 4RUCA 5ALDA 3D6JA 1QLNA 4C4RA 3M9MB 3CP8A 3KFUF 2W54A 2FJ6A 1QQ7A 3TKAA 1NK7A 3V6HA 1LB2B 2IOFA 5AKIA 1QSYA 1ZQOA 3IM1A 3N28A 5ALVA 4IR9A 2AHOB 1RM6C 3ICXA 2HBJA 8ICLA 3ETRA 4F4XA 1ZQSA 2I9GA 4UB4A 2HI0A 8ICUA 1SKRA 3RJHA 4PZNA 2DPIA 2PMZF 5KFDA 2AQ4A 3QEAZ 1KRPA 3GIJA 5J0RA 1ZQMA 3Q8KA 2F8KA 2Y9UA 4P0QB 4DQIA 3AQEA 3M8SA 1N61A 2HBLA 4K4HA 5KAIU 3PMNA 1ZQVA 4MHVA 5GTHU 2LHTA 2KK0A 1X66A 5L1JA 3GIKA 4R64A 4DF4A 2H3FA 1ZXIA 2ZTCA 3GV5B 1SXEA 4ECQA 9ICTA 3RH4A 2LM1A 1L7NA 3HWTA 2JZBA 2K60A 3QU2A 1DGSA 1HJPA 3U26A 5KFOA 2KHVA 4EZ6A 3GFKB 4UB5A 2YMLA 7ICGA 2JH7A 4O3RA 4I28A 1JMSA 5ALKA 3C1ZA 4KMOB 4DQPA 2VJ5A 2QARB 1HUOA 3PY8A 1KQQA 3PW0A 3TADC 1PK1B 3I28A 1D8BA 4B9MA 3M6ZA 3CW2C 2GOLA 1L6NA 4Y2RA 8ICZA 2A1AA 3E0FA 3SAGA 3UXNA 1PZNA 4GC7A 3TADA 1N5WA 1JI7A 1ZQHA 5ALIA 3BJYA 1ZQJA 2E8OA 3RJJA 2HMXA 1SV0C 4ED2A 5JRTA 4PH5A 3CRXA 2W3SA 1SL0A 2ATLA 2MAXA 3LWMA 1XNSA 2BPCA 2W8KA 2BCSA 2QB0A 4NLBA 1U47A 4F4WA 4M2YA 3L4PA 2LBOA 3GV8B 4EENA 1N56A 4F4ZA 4J03A 1S0VA 5ALPA 3Q8LA 1DXSA 1WYGA 5KL1B 4QWCA 4F8RA 4RUAA 3LYSA 4RPZA 3NVWA 4B9VA 2ZIUB 2XY7A 4YR2A 3OSNA 2HOIA 1ZRNA 4GLXA 2G07A 4G9BA 5HHHA 2Y0SC 3PO5A 1X9XA 2GLEA 4J9MA 4OJ5A 2HHTA 5J2DA 3QU9A 4RNNA 4M9LA 2KJ5A 5HMLA 1TAUA 3RF9A 1MA7A 1TKDA 2UVWA 2VIXA 1L3TA 5KG2A 3Q8QB 1CRXA 2W7OA 3PW2A 3AU2A 3V7KA 2Y0SF 4DQRA 2ZIVA 4A8EA 3TI0A 7ICLA 3Q8MA 1WG8A 2ZIWA 1AROP 2LPEA 3GQCA 4DOAA 4U6PA 4RQ6A 4QZGA 4O3SA 2B0CA 1ZD3A 3WK6A 3C21A 1N60A 2XCPA 9ICIA 4EELA 4C7YA 5ALOA 5CHGA 4CGZA 1T3QA 3I76A 5IIMA 4DL3A 4PHDA 4O5KA 9ICCA 4IRDA 2GH1A 1DGJA 3NVYA 2E1EA 1K5OA 1HUZA 4K4GA 5L1MA 2XICA 3KBBA 4DO9A 1JXLA 3K75D 5AKKA 3GZFA 4UB3A 5J2EA 8ICRA 8ICTA 1M6YA 3C28A 4JWMA 5DB9A 2MSNA 1K1SA 2PXIA 1FO4A 2QB1A 3J81j 4MFCA 4DL6A 3L3FX 2W9CA 4KITB 5HR6A 3MDAA 5ALMA 5TISU 4CNQA 2R8KA 3WK9A 4US9A 1Q46A 2W55A 1YZ7A 3FYHA 3GV7B 5ALGA 3C1YA 1SKWA 1NI3A 3PX4A 3IG8A 4NY8A 9ICXA 3QXGA 3QU5A 3PO4A 3KZIU 2C2RA 5K4LA 4QZEA 1ZQUA 2WHEA 5J0TA 4QZFA 1L3SA 3UMCA 5DDYA 2BQUA 8ICOA 4GIBA 5AM1A 4QZ9A 1ZQEA 4MEYA 4UASA 2HHWA 5ALUA 4F50A 5J0UA 1ZQYA 3AM9A 5DB7A 3IP4B 1C20A 4RPYA 3ISBA 3PSTA 4EEKA 1NKCA 3B0YA 2HHQA 1Z4NA 2GO7A 3RAQA 2OWOA 2K4IA 3PW5A 2HDOA 2IOHA 5EWFA 5J0SA 3N4MB 2MRLA 1V97A 1X42A 2ZTDA 2JGAA 4GXKA 4GFJA 4I2AA 4USAA 5G5HA 2FMPA 4ICAA 2OYYA 4TQRA 3KHLA 4Z6DA 2K8BB 3H7IA 3LVWA 2AGPA 1S10A 1P7DA 5CP2A 3ORYA 2R8HA 1T94A 1S8OA 1QQ6A 5IIIA 1V85A 3WKAA 1PK3A 1L3UA 4MFFA 1V9PA 5AI0A 5CR0A 7ICMA 3ZD8A 5KFGA 1DRGA 5ALNA 2PFQA 5DGAA 1SWVA 3H0RB 2D3DA 4RPXA 2ZG6A 2BPFA 1N5XA 3PW7A 1RG6A 4YMOA 4ED6A 2F3NA 2ZIXA 4DF8A 1L5UA 2DBYA 3IHQB 4Z6FA 4Q8FA 4R66A 4LZGA 1HIWA 3JPPA 4KLQA 5KT2A 1IG6A 3FDSA 3QYPA 4QWEA 2AGOA 4DSEA 2CN1A 2XCAA 1TK5A 3TQ1A 4F5QA 2KMDA 5KFWA 3GILA 1DK3A 3F2BA 4PHEA 5AK6A 4NLZA 1XS9D 8ICEA 2K8AA 3WKEA 4DWIA 4QIWF 1ED1A 3BQ2A 2IHNA 2CXYA 3T5KA 2XI9A 4J9RA 4DCCA 4NLKA 3Q8RB 1F44A 2BCRA 1PVPA 3RBDA 4FBTA 4YMNA 3K1ZA 3PV8A 1IIPA 2F1IA 4EBDA 4BGDA 4DLGA 1ZYQA 1BGXT 2OM6A 3JPRA 7ICEA 1SWWA 3MABA 3BS5A 5AICA 1VLBA 9ICBA 4JV1A 2Q0ZX 3EPGA 4DFJA 9ICGA 2EH9A 3MR5A 5AM3A 2EDUA 3NVZA 3JPQA 4B9LA 2W3RA 1Z1BA 2WF6A 4C8LA 4B9UA 8ICKA 4E0DA 2FMQA 4UAWA 3PR4A 4Y2JA 4IQTA 2K4HA 3N7SC 2F8LA 1Z3EB 5KFTA 1S76D 3M9NB 4ACOA 1IXRA 3AMZA 1COKA 5JU5A 1ZQDA 1RXVA 3TFSA 1MC8A 1ZQGA 1NK4A 5G5GA 3TAPA 9ICRA 4I2BA 3EUB2 4NJ8A 4KLMA 5EE1A 5KT6A 1T3NA 2D6FC 2E8NA 3Q8SB 3PNCA 2BCQA 1QTMA 4F5RA 1L7PA 5ALJA 8ICGA 2FI1A 3FM9A 3PSPA 1X9WA 1ZQQA 1UT5A 5JUMA 3V72A 5IIOA 7ICNA 2KIVA 3WKDA 4EBCA 3OHAA 1ZQLA 2BCVA 4DSJA 8ICMA 5KG5A 3T5JA 1UHUA 4P0PB 2EZXA 5C5JA 1MSWD 3LWLA 3CYMA 4KLFA 3C23A 5AM2A 4Q45A 4J9NA 5DLGA 3V6KA 1X6IA 2NRVA 9ICJA 5AK4A 4GC6A 4NXZA 1RDFA 3BQ7A 1QH9A 1TE2A 4IR1A 4ED1A 4QZIA 2ASDA 5KT3A 3SV3A 8ICVA 3SD7A 4R8UB 2DL0A 7ICPA 4P4MA 4YD1A 3KOOA 1X6JA 3C5FA 5AKJA 2G06A 4NV0A 5DG8A 3TANA 3RH5A 4J9QA 5KTQA 3ED5A 4C4TA 5ALRA 4DSKA 2V4QA 4Y2UA 4LVSA 4ELUA 1CUKA 2UVVA 4ELTA 2ZIXB 1U48A 4ED7A 5AKZA 2NRXA 1KBUA 3WU2U 3HP6A 4F4YA 3SI8A 9ICPA 4JV2A 3ZDDA 5HHIA 2KTQA 3FAHA 5KFHA 4KX5A 1KSPA 4XUSA 1Y88A 2P6UA 2UVRA 3KTQA 4P4PA 2JEGA 2EANA 3GIIA 4RQ5A 1N63A 4O3PA 4I2EA 2ZTEA 4OJ6A 4M9HA 5DQHA 5KG0A 1ZQRA 3RR7A 2C28A 4KLLA 8ICBA 3OHBA 3QUBA 4BJQA 5ALHA 2YTUA 5GTIU 4Y2QA 5J2GA 2LYHA 2HHVA 7ICFA 4QZAA 4UB8U 1D8LA 2KP7A 3QNMA 9ICSA 4FZNA 3T5HA 4CCHA 5AM5A 1SV0A 2ES6A 4FS2A 1YZ6A 3IG5A 4EBEA 4B9NA 5KT4A 2KZZA 2W8LA 4ECUA 2ZXIA 1ZQZA 2LI6A 1F0MA 1XSPA 2EQYA 4ED8A 5DGBA 3RR8A 4M47A 8ICWA 4M9GA 2NRWA 3E58A 3RB3A 5IINA 4EX7A 2HBMA 4UAUA 3C2LA 5KFNA 2K4PA 1WWVA 2FPKA 2V4RA 4PL1A 2VA8A 3G6XA 1ZQCA 1JN3A 2YMPA 4UB2A 1U45A 9ICWA 5JTIA 9ICLA 1KW4A 1ZQIA 2AGQA 3QE9Y 2R8GA 3UMGA 3N7RC 3C5GA 1S0MA 2ZUDA 1XO1A 5T14A 3RJGA 4TURA 5J8YC 2E5SA 1F5SA 4YVZA 2K8CB 2HVHA 1VDVA 1N2XA 9ICAA 5J0YA 4ED0A 4Y2SA 3DEEA 5DDMA 5DKWA 2DPJA 1NJWA 3KZXA 4ECXA 4F4KA 3NGDA 1T4GA 2K4EA 3PW4A 3MR3A 1SV4A 2WB1C 3EZ5A 1AQ6A 2H3VA 3HKZF 4BUGA 5KG1A 3AEVA 4PGXA 5KG3A 1PVRA 1MQ2A 4DS4A 4JWNA 4YMMA 1X2IA 2OH2A 3HT3A 1JRPA 1SGGA 5J2IA 1SZHA 2JEFA 3HKZC 1OUQA 1BVSA 9ICVA 1O08A 4Q43A 3LVVA 4QJFB 2ASLA 1MQ3A 4I2FA 8ICJA 4UW9A 9ICQA 3ZDBA 2RP5A 3EW9A 1UQVA 5D49A 5ALTA 2WTFA 2EAOA 1URJA 1O03A 4DL4A 2QB0B 1HEKA 2YN4A 5DBBA 3RJIA 3MFHA 2B21A 2BDPA 5KT7A 5EE9A 4BXOB 3UXPA 4BDPA 2ZIUA 4YCXA 2Q4TA 3F2DA 2N1RA 3TACB 1SL2A 1XSLA 1OW5A 1XO0A 2NRZA 4AP9A 2RHFA 1S5LU 3BZKA 1Z4OA 4PGYA 4PHPA 1QSLA 2KVCA 1L7MA 9ICMA 5KAFU 2XY6A 4UBBA 4DS5A 4M9JA 3BS5B 3TARA 5AKEA 1PUZA 1RPLA 5A0LA 2QLTA 5B5EU 2ZJ5A 3KD3A 2H3IA 5KFVA 2W9AA 4ELVA 5ALEA 2R18A 4CF4A 2ZIVB 3H4BA 1FFUA 2PI5A 4IRKA 2NO5A 1XU4A 1YT3A 3BQTA 3WK7A 4QWBA 3IN5A 2VA2A 4TUPA 4DEZA 4YP3A 4G3IA 3AQFA 1KL9A 3H40A 4F5OA 4EX6A 3RTVA 3O0FA 3K1RB 4QIWC 2HHSA 1A76A 2G0AA 3RJKA 3QUCA 3T5LA 7ICKA 2W03A 5KNIA 2KHQA 4I2DA 1C7YA 4FZMA 4MFAA 5DLFA 3D2NA 2W9MA 2OHFA 5AK3A 2JZBB 5J29A 3PZPA 4I2HA 2GWSA 4US8A 5BOLA 3HJEA 3MGIA 5ALYA 3SR6A 1ZQAA 2ASJA 8ICCA 2W9CB 1UT8A 5EE0A 3TAQA 3RBEA 4XA5A 4C0ZA 2A1JA 7ICHA 2WF8A 5KFUA 3OTQA 1RYSA 4DFKA 4GXJA 4Z6CA 2BKEA 3F2CA 5KFQA 1K1QA 4RNMA 2KD1A 2XVTA 2ZUCA 5L9XA 1RQLA 5KFFA 1TK0A 3A0HU 1SB3C 4KLGA 4DFMA 1RYRA 4Y2YA 4ED3A 5L1KA 1S0NA 2JHDA 5ALWA 3SV4A 9ICUA 4O9MA 2HW3A 2JR5A 5KFPA 5DB6A 4JUZA 1L8OA 1KFDA 2LYBA 2Z7JA 2EAMA 2DKXA 2DGZA 5ALXA 5EE3A 3ZDCA 4KN4A 5KFXA 4OJLA 3L5KA 4P4OA 3UMBA 7ICJA 1NKBA 5KFZA 4F93B 3BZCA 5J0OA 2E3TA 2BR0A 1ZD5A 2D8CA 4EYHB 2UVUA 3B0XA 2C2EA 3RRHA 4WJ3B 3HX0A 3PX0A 1NKEA 4IRCA 3OJUA 5EWGA 2PMZC 3NASA 1RXWA 2Y9TA 1OXJA 9ICHA 5EOZA 1J2MA 5AIBA 4M04A 1L8LA 4F91B 3M7DA 2L5YA 4AYBC 2VA3A 1KTQA 4XRHA 2FDRA 5J8YA 2I1QA 1SL1A 2H3QA 8ICIA 3ISCA 2BPGA 1JALA 3PMLA 3D2QA 4DQSA 1DOQA 4B9TA 2KZMA 4BXOA 2KFZA 4P0QA 4CDGA 3CNHA 2JEJA 3SAHA 3BQ0A 4AYBF 3LDAA 4PZOA 3PX6A 3OJSA 4B6JA 3H4DA 1JIHA 1T7PA 3QX7A 4NLNA 4RNOA 5KFLA 1BPYA 3KKAA 1TV9A 3OSPA 5ALZA 4OJOA 5KFMA 2NYVA 2MUTA 1TVAA 2FE9A 2RDJA 5J0XA 4QWDA 4QZHA 4EYIB 1ZQWA 2XGPA 4FO6A 2G5HB 3G6YA 4DOBA 5L1LA 1ZD2P 4LJXA 3H0MB 8ICFA 2FLLA 2BQ3A 4MF2A 4YXJA 3C2KA 4UAYA 5DQGA 1ZQBA 4PJ0U 4YXMA 3M9OB 4KLTA 2VKQA 1S9FA 4QW8A 1WWUA 1QQ5A 4TUQA 3KKAC 3NRZA 2ESEA 3AL0B 3KHGA 2ODGA 3SENA 1UA0A 1J97A 2WF5A 3SEIA 3MR2A 5KG7A 4I2GA 4ECVA 5BOMA 2WAQF 4CE6A 5AKYA 2A3VA 3FC4A 5HNKA 4NL9A 7ICVA 2M0NA 5DBCA 4BWMA 3VC8A 1Z00A 4C8KA 2IMWP 1QCKA 3ZDAA 2IHMA 2KSOB 3BS7A 3WKCA 1NZBA 1DK2A 2HOFA 4KLDA 4O5EA 4HYKA 2IBKA 3RAXA 2OEHA 1SKSA 5CRXA 8ICYA 3EPIA 4BX9C 3RRGA 4DFDA 5J2FA 3RB0A 5CJ7A 4FS1A 1BPBA 2F76X 3DDHA 4TUSA 4PPXA 3MC1A 4YR3A 3F5AA 2XIDA 5H2FU 1D8YA 5DG7A 2Y1IA 5L1IA 4UBCA 4QZCA 7ICRA 4YR0A 1SXDA 1IM4A 3ZI4A 3NS1A 4MF8A 1N48A 2ZIWB 2ISPA 2KIWA 1N62A 4J9PA 1ZQTA 2R8JA 2YB1A 2LKYA 3RJFA 1A77A 3RB4A 4Z6EA 3ISDA 7ICUA 3MR6A 4RZRA 4YQWA 5J0QA 2QKQA 1Q8KA 3AUOA 2EZZA 1ZQPA 5J2JA 3AU6A 2HBKA 3MFIA 5AM0A 1EXNA 4O3OA 4KN7A 1NJZA 1VJ5A 1S77D 2RQ5A 2FLPA 5HMMA 8ICPA 1KLNA 2ZUBA 4CRXA 3HRDD 4O3MA 3H8WA 3N97B 1Q3UA 4I27A 3ZD9A 4C8OA 4NL9C 2BZFA 1XSNA 4ECSA 4RU9A 4O0IA 1NK0A 3UQ2A 2YMQA 3EWAA 4J9LA 2O6KA 1NNLA 5DG9A 1BPDA 4NM1A 4KLHA 2IA6A 3G6VA 1KN5A 3IDWA 3AN1A 4F2RA 2G5IB 2KVSA 2E8PA 2JH1A 2ALZA 1NJYA 4R65A 3SZ2A 4FZLA 3WKBA 5KFRA 1ZOLA 3QZ8A 5KG4A 5AHXA 3SQIA 4F92B 4DQQA 4EEYA 2CPRA 5F9LA 2LMRA 2ZJ8A 4KLJA 1BNOA 1KDHA 2WB1F 1RYUA 1S0OA 4UQGA 1B22A 4HAIA 2HVIA 3T3FA 3QUTA 4DL5A 5KG6A 2OXOA 5HR7A 4J9OA 4UB1A 1IV8A 2XGQA 5B66U 4M6WB 5ALSA 4KTQA 3V7LA 2G09A 4DSLA 4Q8EA 2LYAA 1ZRMA 4NWIA 4KLOA 3LK9A 4IQUA 1BPEA 5F3XB 1MN8A 2KFNA 2BQRA 2FMSA 2I5HA 3VCBA 4DLEA 4KX3A 2KG5A 3E2EA 3ETLA 3GU3A 2KSOA 3RFAA 1A0PA 4YD2A 4GXIA 2BDUA 2R8IA 4OO1J 4OD0A 4RQNA 4DL7A 5KFCA 1ZJNA 1WCNA 1Z19A 2H5XA 5TZVA 3SMVA 4C7ZA
chains in the Genus database with same CATH topology
2H3QA 1PVPA 2GH1A 2JGAA 3E0FA 2KNJA 4GFJA 3SAGA 1NZBA 3CP8A 3KFUF 3K1ZA 1URJA 2KEYA 4ICAA 3ALRA 2E1EA 3D2QA 1IIPA 2YX8A 2OYYA 2KV2A 3H0LB 2HOFA 3PZPA 1HEKA 2HBMA 4P0QA 4CDGA 2XICA 2OM6A 5CRXA 2K8BB 3GZFA 2HMXA 3LVWA 4BX9C 3SAHA 1P7DA 2DQNB 1WUDA 2CRXA 3CRXA 3T79A 1ECWA 2KOBA 4AYBF 1XNSA 1T94A 2G5IB 3C28A 2F76X 2ZXHA 4PL1A 4NLBA 3PSIA 3ICXA 2HBJA 2JH1A 4IC9A 1Z1BA 4C0ZA 2ZIUA 2G06A 2Q4TA 2KKVA 3F5AA 2XIDA 4NV0A 2N1RA 2LBOA 3SAFA 3F2DA 4P0PA 4FZLA 4P0PB 1A6SA 2KKPA 1XO0A 3F2CA 1DRGA 2K4HA 2RHFA 3L3FX 2PMZF 3N7SC 3PSFA 4OJOA 2F8LA 3F5EA 4PL2A 2VJ4A 5KL1B 1Q3VA 5HR6A 2KD1A 3N7RC 2XVTA 3LYSA 5T14A 3SQIA 4JMUA 2E5SA 2KVCA 2ZIUB 2ZIXB 2K8CB 2CPRA 2ZIWB 4ACOA 2HOIA 2G07A 2KIWA 3H0RB 3NUQA 1KBUA 1PVQA 2F77X 2Y0SC 2YB4A 2YB1A 4OJPA 2ZG6A 3DEEA 4P0QB 2JHDA 2LKYA 2KJ8A 2WB1F 2JMGA 3AQEA 2KJ9A 2G5HB 3KZXA 2HBLA 4OJ5A 3C29A 1UPHA 3IG8A 4KX5A 4U7CA 2K4EA 5A0LA 2LHTA 2ZIXA 2KJ5A 3H0MB 2H3IA 2NV3A 3RF9A 1MA7A 2OXOA 2R18A 1HIWA 2HOQA 2ZIVB 2DF4B 2H3FA 5HR7A 2KICA 2VIXA 2WB1C 2D6FC 5KL8B 2H3VA 2K89A 3HKZF 4BUGA 2LYBA 3ONNA 2Z7JA 4FE3A 2DGZA 1PVRA 1CRXA 2W7OA 3D2SA 3F53A 4OJ6A 1L6NA 4OJLA 2G09A 2CN1A 2LYAA 2HBKA 2Y0SF 3PSPA 2VKQA 4NWIA 1YT3A 3M6KA 1F44A 2ZIVA 4A8EA 4BJQA 3IN5A 2OH2A 3NRWA 3AL0B 2KHVA 2ZIWA 3AQFA 2JH7A 4WJ3B 3OPXA 3F2BA 2H3ZA 4U6PA 2W04A 3O0FA 4NLCA 2WAQC 4QIWC 4CRXA 4O3MA 2G0AA 2PMZC 3VCBA 2W7PA 1SZHA 3IP4B 4KX3A 4FZNA 2MA1A 4KMOB 3HKZC 1Q3UA 1OUQA 5C0YA 3PSTA 2G08A 2K8AA 2E1FA 3GU3A 4QNLA 3LVVA 1GO3F 3MGVA 2W03A 4QJFB 1TAMA 3M7DA 2VJ5A 3RFAA 1A0PA 3SMVA 4AYBC 2BDUA 4CGZA 4OO1J 2WAQF 1ED1A 2K4IA 3N7PD 4QIWF 2KHQA 2A3VA 3IG5A 2XI9A 2RP5A 1Z19A 1ZQ1C 1D8BA 2M0NA 2RRDA 2ZXIA 3CYMA 2F2AB 2MRLA 3M6ZA 4FZMA 3VC8A 3D2NA 2GOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAG A;  4NLC A;  4O3M A;  2E1E A;  2RHF A;  2KV2 A;  2HBM A;  4CDG A;  2MA1 A;  5C0Y A;  2DGZ A;  2E1F A;  2CPR A;  3SAH A;  1GO3 F;  4QJF B;  1WUD A;  4CGZ A;  4OO1 J;  4QIW F;  2HBK A;  1YT3 A;  4NLB A;  1D8B A;  2HBJ A;  2RRD A;  3CYM A;  2HBL A;  3SAF A; 
#chains in the Genus database with same CATH topology
 7ICT A;  1J2N A;  5BPC A;  4UAR A;  1RQN A;  4UAZ A;  2ISO A;  4J9K A;  1JX4 A;  5J2C A;  3GDX A;  1UCV A;  3K4G A;  1T8E A;  2DQN B;  3WK4 A;  1ECW A;  2KOB A;  4ECZ A;  1NZP A;  4KMU A;  3Q8P B;  1X40 A;  2ZXH A;  5AI8 A;  5AKX A;  3PSI A;  3ZDE A;  3UPQ A;  5IIK A;  4F3O A;  2HHU A;  2XO7 A;  2KKV A;  2KN7 A;  4P0P A;  2W11 A;  1A6S A;  7ICS A;  4P2H A;  2B6G A;  2J6U A;  4QZ8 A;  4F5N A;  1KEJ A;  3NUQ A;  1ZET A;  2NRT A;  5ALL A;  9ICE A;  4Y2V A;  1LV5 A;  1TFR A;  2YMM A;  4JB3 A;  2AJQ A;  4U7C A;  4C8M A;  7ICI A;  4Y2T A;  4R8U A;  2W9B B;  2XY5 A;  1ZJM A;  2K89 A;  4PGQ A;  3ONN A;  1NK9 A;  2WF9 A;  3JPN A;  2WF7 A;  1B0X A;  4DSI A;  8ICN A;  3BQ1 A;  5E79 U;  5D4B A;  4CF3 A;  4KLU A;  1B4F A;  2DUY A;  1XWL A;  2E8M A;  3OPX A;  4NLC A;  8ICS A;  2W7P A;  1ZQK A;  1QSS A;  2C2D A;  4NLG A;  2G08 A;  3UXO A;  4RQ3 A;  2FPM A;  1TAM A;  5CWR A;  5KFB A;  2VAN A;  3KHR A;  4I2C A;  4TQS A;  3OGU A;  1RZT A;  7ICO A;  2ZJA A;  3QZ7 A;  2FPL A;  4Q44 A;  4Y2X A;  1LKY B;  1FIQ A;  5KFA A;  8ICA A;  2KEY A;  4RQM A;  2YX8 A;  2KV2 A;  1NJX A;  1KFT A;  3C2M A;  3WK8 A;  1CI4 A;  4RQ2 A;  5KFK A;  3UM9 A;  3DV9 A;  3JPS A;  2CRX A;  2YY6 A;  3T79 A;  5KFJ A;  3QUQ A;  2F44 A;  4K4I A;  5AI5 A;  2JRZ A;  5CA7 A;  9ICO A;  5J2K A;  3F5E A;  1Q3V A;  1Z00 B;  1U49 A;  4IQW A;  4JMU A;  1U9L A;  2J6S A;  1SZP A;  4R63 A;  2J6T A;  2PFN A;  3EYZ A;  2KJ8 A;  5ALF A;  2KJ9 A;  4J9S A;  2PFO A;  4QW9 A;  2DWQ A;  5FP0 A;  3V6J A;  2QAR A;  2PFP A;  1PK1 A;  4I2I A;  2DFL A;  5KL8 B;  8ICX A;  1ZQF A;  3D2S A;  3THV A;  1WCL A;  1NK6 A;  2DKZ A;  3QU4 A;  5J2A A;  4PHA A;  4MEX A;  5F9N A;  2FLN A;  1H38 A;  1CEZ A;  2V9W A;  1XC9 A;  9ICK A;  9ICF A;  2H3Z A;  3MBY A;  4I29 A;  2WAQ C;  4F71 A;  1TAQ A;  5ALQ A;  4KLS A;  5HP4 A;  1BNP A;  3RJE A;  4ZOH C;  1L7O A;  5C0Y A;  5KFY A;  4O5C A;  5KFS A;  5KFI A;  1ZQN A;  2HHX A;  2JV3 A;  1Z1V A;  2P66 A;  2A19 A;  3PVX A;  4YN4 A;  5J0P A;  5KT5 A;  1U4B A;  4QZB A;  2RRD A;  3PR5 B;  4IL6 U;  3JPT A;  4UB6 U;  4UAV A;  3JPO A;  4CF5 A;  7ICQ A;  5AK5 A;  2JXJ A;  2A1J B;  4ECW A;  2XC9 A;  2AXT U;  2P6R A;  5AI9 A;  1KFS A;  4ZH4 A;  1KKX A;  3GIM A;  4M9N A;  3TFR A;  1NOM A;  5IIL A;  3MGH A;  3S6J A;  2PKE A;  5D46 A;  3I1Y A;  4RT3 A;  3RB6 A;  3PSF A;  4ECY A;  1ZD4 A;  4PL2 A;  2VJ4 A;  2AQ0 A;  3RH6 A;  3H8J A;  3BDP A;  2MU2 A;  1PVQ A;  2F77 X;  3IRU A;  2YB4 A;  4DL2 A;  2JMG A;  3KHH A;  4LZD A;  3C29 A;  4RQ0 A;  1BPZ A;  4EZ9 A;  2RLT A;  2BHN A;  2HCF A;  5AKG A;  1TK8 A;  2F1H A;  4I2J A;  4C8N A;  2KZ3 A;  1JUD A;  2DF4 B;  4B9S A;  4M0A A;  4RT2 A;  1JRO A;  3M8R A;  4YG2 A;  4DFP A;  4FE3 A;  2C22 A;  4JK1 A;  3A0B U;  1UA1 A;  3F53 A;  4F5P A;  4JV0 A;  5CEH A;  4KLI A;  2W43 A;  3M6K A;  1X9M A;  2JEI A;  2HSZ A;  2AU0 A;  1S97 A;  3NRW A;  4ECR A;  3B9J A;  1NK5 A;  1D9F A;  1JXE A;  5DQI A;  3NVV A;  2MA1 A;  1LKY A;  2EAP A;  4QNL A;  1GO3 F;  3MGV A;  4XQ8 A;  4BWJ A;  4FFD A;  4F72 A;  5EWE A;  2F2A B;  3IV6 A;  4M6W A;  1ZQX A;  2YQE A;  4RQ8 A;  1SIJ A;  4C80 A;  5IIJ A;  2KNJ A;  2AH5 A;  2OCE A;  3UQ0 A;  3ALR A;  3H0L B;  4QWA A;  4QZD A;  3H8S A;  1X9S A;  4NM2 A;  4RQ1 A;  3SYZ A;  4YFK A;  5AI4 A;  4ECT A;  3QEB Z;  1WUD A;  2EZY A;  3QU7 A;  2MUT B;  5J2B A;  4IS7 A;  4IC9 A;  5J0W A;  3SAF A;  3H8M A;  4X5V A;  3MDC A;  3HIL A;  2M9N A;  2KE7 A;  2KKP A;  3WK5 A;  5AM4 A;  1V38 A;  4DSF A;  2NO4 A;  1BPX A;  5J2H A;  4O3N A;  8ICQ A;  3HPO A;  2BCU A;  2IOF K;  4OJP A;  2PI4 A;  8ICH A;  1B43 A;  1D9D A;  4O3Q A;  2LM4 A;  1UPH A;  5DB8 A;  2P35 A;  4C4S A;  2NV3 A;  2BGW A;  2HOQ A;  1FFV A;  2Y1J A;  2KIC A;  3R9K A;  1NK8 A;  2F1J A;  5DBA A;  2RDI A;  5KFE A;  5AIA A;  3HW8 A;  2WFA A;  9ICN A;  1LVH A;  5AKL A;  1FEZ A;  2W04 A;  5CB1 A;  2I6X A;  4KLE A;  1COO A;  5AKH A;  3M1Y A;  4UAT A;  2E1F A;  5AI6 A;  4RQ4 A;  4F2S A;  1L3V A;  2W9B A;  4Y2P A;  3V7J A;  4RQ7 A;  4FBU A;  3N7P D;  4IQV A;  3NTU A;  4OCZ A;  4DOC A;  1ZQ1 C;  4RUC A;  5ALD A;  3D6J A;  1QLN A;  4C4R A;  3M9M B;  3CP8 A;  3KFU F;  2W54 A;  2FJ6 A;  1QQ7 A;  3TKA A;  1NK7 A;  3V6H A;  1LB2 B;  2IOF A;  5AKI A;  1QSY A;  1ZQO A;  3IM1 A;  3N28 A;  5ALV A;  4IR9 A;  2AHO B;  1RM6 C;  3ICX A;  2HBJ A;  8ICL A;  3ETR A;  4F4X A;  1ZQS A;  2I9G A;  4UB4 A;  2HI0 A;  8ICU A;  1SKR A;  3RJH A;  4PZN A;  2DPI A;  2PMZ F;  5KFD A;  2AQ4 A;  3QEA Z;  1KRP A;  3GIJ A;  5J0R A;  1ZQM A;  3Q8K A;  2F8K A;  2Y9U A;  4P0Q B;  4DQI A;  3AQE A;  3M8S A;  1N61 A;  2HBL A;  4K4H A;  5KAI U;  3PMN A;  1ZQV A;  4MHV A;  5GTH U;  2LHT A;  2KK0 A;  1X66 A;  5L1J A;  3GIK A;  4R64 A;  4DF4 A;  2H3F A;  1ZXI A;  2ZTC A;  3GV5 B;  1SXE A;  4ECQ A;  9ICT A;  3RH4 A;  2LM1 A;  1L7N A;  3HWT A;  2JZB A;  2K60 A;  3QU2 A;  1DGS A;  1HJP A;  3U26 A;  5KFO A;  2KHV A;  4EZ6 A;  3GFK B;  4UB5 A;  2YML A;  7ICG A;  2JH7 A;  4O3R A;  4I28 A;  1JMS A;  5ALK A;  3C1Z A;  4KMO B;  4DQP A;  2VJ5 A;  2QAR B;  1HUO A;  3PY8 A;  1KQQ A;  3PW0 A;  3TAD C;  1PK1 B;  3I28 A;  1D8B A;  4B9M A;  3M6Z A;  3CW2 C;  2GOL A;  1L6N A;  4Y2R A;  8ICZ A;  2A1A A;  3E0F A;  3SAG A;  3UXN A;  1PZN A;  4GC7 A;  3TAD A;  1N5W A;  1JI7 A;  1ZQH A;  5ALI A;  3BJY A;  1ZQJ A;  2E8O A;  3RJJ A;  2HMX A;  1SV0 C;  4ED2 A;  5JRT A;  4PH5 A;  3CRX A;  2W3S A;  1SL0 A;  2ATL A;  2MAX A;  3LWM A;  1XNS A;  2BPC A;  2W8K A;  2BCS A;  2QB0 A;  4NLB A;  1U47 A;  4F4W A;  4M2Y A;  3L4P A;  2LBO A;  3GV8 B;  4EEN A;  1N56 A;  4F4Z A;  4J03 A;  1S0V A;  5ALP A;  3Q8L A;  1DXS A;  1WYG A;  5KL1 B;  4QWC A;  4F8R A;  4RUA A;  3LYS A;  4RPZ A;  3NVW A;  4B9V A;  2ZIU B;  2XY7 A;  4YR2 A;  3OSN A;  2HOI A;  1ZRN A;  4GLX A;  2G07 A;  4G9B A;  5HHH A;  2Y0S C;  3PO5 A;  1X9X A;  2GLE A;  4J9M A;  4OJ5 A;  2HHT A;  5J2D A;  3QU9 A;  4RNN A;  4M9L A;  2KJ5 A;  5HML A;  1TAU A;  3RF9 A;  1MA7 A;  1TKD A;  2UVW A;  2VIX A;  1L3T A;  5KG2 A;  3Q8Q B;  1CRX A;  2W7O A;  3PW2 A;  3AU2 A;  3V7K A;  2Y0S F;  4DQR A;  2ZIV A;  4A8E A;  3TI0 A;  7ICL A;  3Q8M A;  1WG8 A;  2ZIW A;  1ARO P;  2LPE A;  3GQC A;  4DOA A;  4U6P A;  4RQ6 A;  4QZG A;  4O3S A;  2B0C A;  1ZD3 A;  3WK6 A;  3C21 A;  1N60 A;  2XCP A;  9ICI A;  4EEL A;  4C7Y A;  5ALO A;  5CHG A;  4CGZ A;  1T3Q A;  3I76 A;  5IIM A;  4DL3 A;  4PHD A;  4O5K A;  9ICC A;  4IRD A;  2GH1 A;  1DGJ A;  3NVY A;  2E1E A;  1K5O A;  1HUZ A;  4K4G A;  5L1M A;  2XIC A;  3KBB A;  4DO9 A;  1JXL A;  3K75 D;  5AKK A;  3GZF A;  4UB3 A;  5J2E A;  8ICR A;  8ICT A;  1M6Y A;  3C28 A;  4JWM A;  5DB9 A;  2MSN A;  1K1S A;  2PXI A;  1FO4 A;  2QB1 A;  3J81 j;  4MFC A;  4DL6 A;  3L3F X;  2W9C A;  4KIT B;  5HR6 A;  3MDA A;  5ALM A;  5TIS U;  4CNQ A;  2R8K A;  3WK9 A;  4US9 A;  1Q46 A;  2W55 A;  1YZ7 A;  3FYH A;  3GV7 B;  5ALG A;  3C1Y A;  1SKW A;  1NI3 A;  3PX4 A;  3IG8 A;  4NY8 A;  9ICX A;  3QXG A;  3QU5 A;  3PO4 A;  3KZI U;  2C2R A;  5K4L A;  4QZE A;  1ZQU A;  2WHE A;  5J0T A;  4QZF A;  1L3S A;  3UMC A;  5DDY A;  2BQU A;  8ICO A;  4GIB A;  5AM1 A;  4QZ9 A;  1ZQE A;  4MEY A;  4UAS A;  2HHW A;  5ALU A;  4F50 A;  5J0U A;  1ZQY A;  3AM9 A;  5DB7 A;  3IP4 B;  1C20 A;  4RPY A;  3ISB A;  3PST A;  4EEK A;  1NKC A;  3B0Y A;  2HHQ A;  1Z4N A;  2GO7 A;  3RAQ A;  2OWO A;  2K4I A;  3PW5 A;  2HDO A;  2IOH A;  5EWF A;  5J0S A;  3N4M B;  2MRL A;  1V97 A;  1X42 A;  2ZTD A;  2JGA A;  4GXK A;  4GFJ A;  4I2A A;  4USA A;  5G5H A;  2FMP A;  4ICA A;  2OYY A;  4TQR A;  3KHL A;  4Z6D A;  2K8B B;  3H7I A;  3LVW A;  2AGP A;  1S10 A;  1P7D A;  5CP2 A;  3ORY A;  2R8H A;  1T94 A;  1S8O A;  1QQ6 A;  5III A;  1V85 A;  3WKA A;  1PK3 A;  1L3U A;  4MFF A;  1V9P A;  5AI0 A;  5CR0 A;  7ICM A;  3ZD8 A;  5KFG A;  1DRG A;  5ALN A;  2PFQ A;  5DGA A;  1SWV A;  3H0R B;  2D3D A;  4RPX A;  2ZG6 A;  2BPF A;  1N5X A;  3PW7 A;  1RG6 A;  4YMO A;  4ED6 A;  2F3N A;  2ZIX A;  4DF8 A;  1L5U A;  2DBY A;  3IHQ B;  4Z6F A;  4Q8F A;  4R66 A;  4LZG A;  1HIW A;  3JPP A;  4KLQ A;  5KT2 A;  1IG6 A;  3FDS A;  3QYP A;  4QWE A;  2AGO A;  4DSE A;  2CN1 A;  2XCA A;  1TK5 A;  3TQ1 A;  4F5Q A;  2KMD A;  5KFW A;  3GIL A;  1DK3 A;  3F2B A;  4PHE A;  5AK6 A;  4NLZ A;  1XS9 D;  8ICE A;  2K8A A;  3WKE A;  4DWI A;  4QIW F;  1ED1 A;  3BQ2 A;  2IHN A;  2CXY A;  3T5K A;  2XI9 A;  4J9R A;  4DCC A;  4NLK A;  3Q8R B;  1F44 A;  2BCR A;  1PVP A;  3RBD A;  4FBT A;  4YMN A;  3K1Z A;  3PV8 A;  1IIP A;  2F1I A;  4EBD A;  4BGD A;  4DLG A;  1ZYQ A;  1BGX T;  2OM6 A;  3JPR A;  7ICE A;  1SWW A;  3MAB A;  3BS5 A;  5AIC A;  1VLB A;  9ICB A;  4JV1 A;  2Q0Z X;  3EPG A;  4DFJ A;  9ICG A;  2EH9 A;  3MR5 A;  5AM3 A;  2EDU A;  3NVZ A;  3JPQ A;  4B9L A;  2W3R A;  1Z1B A;  2WF6 A;  4C8L A;  4B9U A;  8ICK A;  4E0D A;  2FMQ A;  4UAW A;  3PR4 A;  4Y2J A;  4IQT A;  2K4H A;  3N7S C;  2F8L A;  1Z3E B;  5KFT A;  1S76 D;  3M9N B;  4ACO A;  1IXR A;  3AMZ A;  1COK A;  5JU5 A;  1ZQD A;  1RXV A;  3TFS A;  1MC8 A;  1ZQG A;  1NK4 A;  5G5G A;  3TAP A;  9ICR A;  4I2B A;  3EUB 2;  4NJ8 A;  4KLM A;  5EE1 A;  5KT6 A;  1T3N A;  2D6F C;  2E8N A;  3Q8S B;  3PNC A;  2BCQ A;  1QTM A;  4F5R A;  1L7P A;  5ALJ A;  8ICG A;  2FI1 A;  3FM9 A;  3PSP A;  1X9W A;  1ZQQ A;  1UT5 A;  5JUM A;  3V72 A;  5IIO A;  7ICN A;  2KIV A;  3WKD A;  4EBC A;  3OHA A;  1ZQL A;  2BCV A;  4DSJ A;  8ICM A;  5KG5 A;  3T5J A;  1UHU A;  4P0P B;  2EZX A;  5C5J A;  1MSW D;  3LWL A;  3CYM A;  4KLF A;  3C23 A;  5AM2 A;  4Q45 A;  4J9N A;  5DLG A;  3V6K A;  1X6I A;  2NRV A;  9ICJ A;  5AK4 A;  4GC6 A;  4NXZ A;  1RDF A;  3BQ7 A;  1QH9 A;  1TE2 A;  4IR1 A;  4ED1 A;  4QZI A;  2ASD A;  5KT3 A;  3SV3 A;  8ICV A;  3SD7 A;  4R8U B;  2DL0 A;  7ICP A;  4P4M A;  4YD1 A;  3KOO A;  1X6J A;  3C5F A;  5AKJ A;  2G06 A;  4NV0 A;  5DG8 A;  3TAN A;  3RH5 A;  4J9Q A;  5KTQ A;  3ED5 A;  4C4T A;  5ALR A;  4DSK A;  2V4Q A;  4Y2U A;  4LVS A;  4ELU A;  1CUK A;  2UVV A;  4ELT A;  2ZIX B;  1U48 A;  4ED7 A;  5AKZ A;  2NRX A;  1KBU A;  3WU2 U;  3HP6 A;  4F4Y A;  3SI8 A;  9ICP A;  4JV2 A;  3ZDD A;  5HHI A;  2KTQ A;  3FAH A;  5KFH A;  4KX5 A;  1KSP A;  4XUS A;  1Y88 A;  2P6U A;  2UVR A;  3KTQ A;  4P4P A;  2JEG A;  2EAN A;  3GII A;  4RQ5 A;  1N63 A;  4O3P A;  4I2E A;  2ZTE A;  4OJ6 A;  4M9H A;  5DQH A;  5KG0 A;  1ZQR A;  3RR7 A;  2C28 A;  4KLL A;  8ICB A;  3OHB A;  3QUB A;  4BJQ A;  5ALH A;  2YTU A;  5GTI U;  4Y2Q A;  5J2G A;  2LYH A;  2HHV A;  7ICF A;  4QZA A;  4UB8 U;  1D8L A;  2KP7 A;  3QNM A;  9ICS A;  4FZN A;  3T5H A;  4CCH A;  5AM5 A;  1SV0 A;  2ES6 A;  4FS2 A;  1YZ6 A;  3IG5 A;  4EBE A;  4B9N A;  5KT4 A;  2KZZ A;  2W8L A;  4ECU A;  2ZXI A;  1ZQZ A;  2LI6 A;  1F0M A;  1XSP A;  2EQY A;  4ED8 A;  5DGB A;  3RR8 A;  4M47 A;  8ICW A;  4M9G A;  2NRW A;  3E58 A;  3RB3 A;  5IIN A;  4EX7 A;  2HBM A;  4UAU A;  3C2L A;  5KFN A;  2K4P A;  1WWV A;  2FPK A;  2V4R A;  4PL1 A;  2VA8 A;  3G6X A;  1ZQC A;  1JN3 A;  2YMP A;  4UB2 A;  1U45 A;  9ICW A;  5JTI A;  9ICL A;  1KW4 A;  1ZQI A;  2AGQ A;  3QE9 Y;  2R8G A;  3UMG A;  3N7R C;  3C5G A;  1S0M A;  2ZUD A;  1XO1 A;  5T14 A;  3RJG A;  4TUR A;  5J8Y C;  2E5S A;  1F5S A;  4YVZ A;  2K8C B;  2HVH A;  1VDV A;  1N2X A;  9ICA A;  5J0Y A;  4ED0 A;  4Y2S A;  3DEE A;  5DDM A;  5DKW A;  2DPJ A;  1NJW A;  3KZX A;  4ECX A;  4F4K A;  3NGD A;  1T4G A;  2K4E A;  3PW4 A;  3MR3 A;  1SV4 A;  2WB1 C;  3EZ5 A;  1AQ6 A;  2H3V A;  3HKZ F;  4BUG A;  5KG1 A;  3AEV A;  4PGX A;  5KG3 A;  1PVR A;  1MQ2 A;  4DS4 A;  4JWN A;  4YMM A;  1X2I A;  2OH2 A;  3HT3 A;  1JRP A;  1SGG A;  5J2I A;  1SZH A;  2JEF A;  3HKZ C;  1OUQ A;  1BVS A;  9ICV A;  1O08 A;  4Q43 A;  3LVV A;  4QJF B;  2ASL A;  1MQ3 A;  4I2F A;  8ICJ A;  4UW9 A;  9ICQ A;  3ZDB A;  2RP5 A;  3EW9 A;  1UQV A;  5D49 A;  5ALT A;  2WTF A;  2EAO A;  1URJ A;  1O03 A;  4DL4 A;  2QB0 B;  1HEK A;  2YN4 A;  5DBB A;  3RJI A;  3MFH A;  2B21 A;  2BDP A;  5KT7 A;  5EE9 A;  4BXO B;  3UXP A;  4BDP A;  2ZIU A;  4YCX A;  2Q4T A;  3F2D A;  2N1R A;  3TAC B;  1SL2 A;  1XSL A;  1OW5 A;  1XO0 A;  2NRZ A;  4AP9 A;  2RHF A;  1S5L U;  3BZK A;  1Z4O A;  4PGY A;  4PHP A;  1QSL A;  2KVC A;  1L7M A;  9ICM A;  5KAF U;  2XY6 A;  4UBB A;  4DS5 A;  4M9J A;  3BS5 B;  3TAR A;  5AKE A;  1PUZ A;  1RPL A;  5A0L A;  2QLT A;  5B5E U;  2ZJ5 A;  3KD3 A;  2H3I A;  5KFV A;  2W9A A;  4ELV A;  5ALE A;  2R18 A;  4CF4 A;  2ZIV B;  3H4B A;  1FFU A;  2PI5 A;  4IRK A;  2NO5 A;  1XU4 A;  1YT3 A;  3BQT A;  3WK7 A;  4QWB A;  3IN5 A;  2VA2 A;  4TUP A;  4DEZ A;  4YP3 A;  4G3I A;  3AQF A;  1KL9 A;  3H40 A;  4F5O A;  4EX6 A;  3RTV A;  3O0F A;  3K1R B;  4QIW C;  2HHS A;  1A76 A;  2G0A A;  3RJK A;  3QUC A;  3T5L A;  7ICK A;  2W03 A;  5KNI A;  2KHQ A;  4I2D A;  1C7Y A;  4FZM A;  4MFA A;  5DLF A;  3D2N A;  2W9M A;  2OHF A;  5AK3 A;  2JZB B;  5J29 A;  3PZP A;  4I2H A;  2GWS A;  4US8 A;  5BOL A;  3HJE A;  3MGI A;  5ALY A;  3SR6 A;  1ZQA A;  2ASJ A;  8ICC A;  2W9C B;  1UT8 A;  5EE0 A;  3TAQ A;  3RBE A;  4XA5 A;  4C0Z A;  2A1J A;  7ICH A;  2WF8 A;  5KFU A;  3OTQ A;  1RYS A;  4DFK A;  4GXJ A;  4Z6C A;  2BKE A;  3F2C A;  5KFQ A;  1K1Q A;  4RNM A;  2KD1 A;  2XVT A;  2ZUC A;  5L9X A;  1RQL A;  5KFF A;  1TK0 A;  3A0H U;  1SB3 C;  4KLG A;  4DFM A;  1RYR A;  4Y2Y A;  4ED3 A;  5L1K A;  1S0N A;  2JHD A;  5ALW A;  3SV4 A;  9ICU A;  4O9M A;  2HW3 A;  2JR5 A;  5KFP A;  5DB6 A;  4JUZ A;  1L8O A;  1KFD A;  2LYB A;  2Z7J A;  2EAM A;  2DKX A;  2DGZ A;  5ALX A;  5EE3 A;  3ZDC A;  4KN4 A;  5KFX A;  4OJL A;  3L5K A;  4P4O A;  3UMB A;  7ICJ A;  1NKB A;  5KFZ A;  4F93 B;  3BZC A;  5J0O A;  2E3T A;  2BR0 A;  1ZD5 A;  2D8C A;  4EYH B;  2UVU A;  3B0X A;  2C2E A;  3RRH A;  4WJ3 B;  3HX0 A;  3PX0 A;  1NKE A;  4IRC A;  3OJU A;  5EWG A;  2PMZ C;  3NAS A;  1RXW A;  2Y9T A;  1OXJ A;  9ICH A;  5EOZ A;  1J2M A;  5AIB A;  4M04 A;  1L8L A;  4F91 B;  3M7D A;  2L5Y A;  4AYB C;  2VA3 A;  1KTQ A;  4XRH A;  2FDR A;  5J8Y A;  2I1Q A;  1SL1 A;  2H3Q A;  8ICI A;  3ISC A;  2BPG A;  1JAL A;  3PML A;  3D2Q A;  4DQS A;  1DOQ A;  4B9T A;  2KZM A;  4BXO A;  2KFZ A;  4P0Q A;  4CDG A;  3CNH A;  2JEJ A;  3SAH A;  3BQ0 A;  4AYB F;  3LDA A;  4PZO A;  3PX6 A;  3OJS A;  4B6J A;  3H4D A;  1JIH A;  1T7P A;  3QX7 A;  4NLN A;  4RNO A;  5KFL A;  1BPY A;  3KKA A;  1TV9 A;  3OSP A;  5ALZ A;  4OJO A;  5KFM A;  2NYV A;  2MUT A;  1TVA A;  2FE9 A;  2RDJ A;  5J0X A;  4QWD A;  4QZH A;  4EYI B;  1ZQW A;  2XGP A;  4FO6 A;  2G5H B;  3G6Y A;  4DOB A;  5L1L A;  1ZD2 P;  4LJX A;  3H0M B;  8ICF A;  2FLL A;  2BQ3 A;  4MF2 A;  4YXJ A;  3C2K A;  4UAY A;  5DQG A;  1ZQB A;  4PJ0 U;  4YXM A;  3M9O B;  4KLT A;  2VKQ A;  1S9F A;  4QW8 A;  1WWU A;  1QQ5 A;  4TUQ A;  3KKA C;  3NRZ A;  2ESE A;  3AL0 B;  3KHG A;  2ODG A;  3SEN A;  1UA0 A;  1J97 A;  2WF5 A;  3SEI A;  3MR2 A;  5KG7 A;  4I2G A;  4ECV A;  5BOM A;  2WAQ F;  4CE6 A;  5AKY A;  2A3V A;  3FC4 A;  5HNK A;  4NL9 A;  7ICV A;  2M0N A;  5DBC A;  4BWM A;  3VC8 A;  1Z00 A;  4C8K A;  2IMW P;  1QCK A;  3ZDA A;  2IHM A;  2KSO B;  3BS7 A;  3WKC A;  1NZB A;  1DK2 A;  2HOF A;  4KLD A;  4O5E A;  4HYK A;  2IBK A;  3RAX A;  2OEH A;  1SKS A;  5CRX A;  8ICY A;  3EPI A;  4BX9 C;  3RRG A;  4DFD A;  5J2F A;  3RB0 A;  5CJ7 A;  4FS1 A;  1BPB A;  2F76 X;  3DDH A;  4TUS A;  4PPX A;  3MC1 A;  4YR3 A;  3F5A A;  2XID A;  5H2F U;  1D8Y A;  5DG7 A;  2Y1I A;  5L1I A;  4UBC A;  4QZC A;  7ICR A;  4YR0 A;  1SXD A;  1IM4 A;  3ZI4 A;  3NS1 A;  4MF8 A;  1N48 A;  2ZIW B;  2ISP A;  2KIW A;  1N62 A;  4J9P A;  1ZQT A;  2R8J A;  2YB1 A;  2LKY A;  3RJF A;  1A77 A;  3RB4 A;  4Z6E A;  3ISD A;  7ICU A;  3MR6 A;  4RZR A;  4YQW A;  5J0Q A;  2QKQ A;  1Q8K A;  3AUO A;  2EZZ A;  1ZQP A;  5J2J A;  3AU6 A;  2HBK A;  3MFI A;  5AM0 A;  1EXN A;  4O3O A;  4KN7 A;  1NJZ A;  1VJ5 A;  1S77 D;  2RQ5 A;  2FLP A;  5HMM A;  8ICP A;  1KLN A;  2ZUB A;  4CRX A;  3HRD D;  4O3M A;  3H8W A;  3N97 B;  1Q3U A;  4I27 A;  3ZD9 A;  4C8O A;  4NL9 C;  2BZF A;  1XSN A;  4ECS A;  4RU9 A;  4O0I A;  1NK0 A;  3UQ2 A;  2YMQ A;  3EWA A;  4J9L A;  2O6K A;  1NNL A;  5DG9 A;  1BPD A;  4NM1 A;  4KLH A;  2IA6 A;  3G6V A;  1KN5 A;  3IDW A;  3AN1 A;  4F2R A;  2G5I B;  2KVS A;  2E8P A;  2JH1 A;  2ALZ A;  1NJY A;  4R65 A;  3SZ2 A;  4FZL A;  3WKB A;  5KFR A;  1ZOL A;  3QZ8 A;  5KG4 A;  5AHX A;  3SQI A;  4F92 B;  4DQQ A;  4EEY A;  2CPR A;  5F9L A;  2LMR A;  2ZJ8 A;  4KLJ A;  1BNO A;  1KDH A;  2WB1 F;  1RYU A;  1S0O A;  4UQG A;  1B22 A;  4HAI A;  2HVI A;  3T3F A;  3QUT A;  4DL5 A;  5KG6 A;  2OXO A;  5HR7 A;  4J9O A;  4UB1 A;  1IV8 A;  2XGQ A;  5B66 U;  4M6W B;  5ALS A;  4KTQ A;  3V7L A;  2G09 A;  4DSL A;  4Q8E A;  2LYA A;  1ZRM A;  4NWI A;  4KLO A;  3LK9 A;  4IQU A;  1BPE A;  5F3X B;  1MN8 A;  2KFN A;  2BQR A;  2FMS A;  2I5H A;  3VCB A;  4DLE A;  4KX3 A;  2KG5 A;  3E2E A;  3ETL A;  3GU3 A;  2KSO A;  3RFA A;  1A0P A;  4YD2 A;  4GXI A;  2BDU A;  2R8I A;  4OO1 J;  4OD0 A;  4RQN A;  4DL7 A;  5KFC A;  1ZJN A;  1WCN A;  1Z19 A;  2H5X A;  5TZV A;  3SMV A;  4C7Z A; 
#chains in the Genus database with same CATH homology
 2H3Q A;  1PVP A;  2GH1 A;  2JGA A;  3E0F A;  2KNJ A;  4GFJ A;  3SAG A;  1NZB A;  3CP8 A;  3KFU F;  3K1Z A;  1URJ A;  2KEY A;  4ICA A;  3ALR A;  2E1E A;  3D2Q A;  1IIP A;  2YX8 A;  2OYY A;  2KV2 A;  3H0L B;  2HOF A;  3PZP A;  1HEK A;  2HBM A;  4P0Q A;  4CDG A;  2XIC A;  2OM6 A;  5CRX A;  2K8B B;  3GZF A;  2HMX A;  3LVW A;  4BX9 C;  3SAH A;  1P7D A;  2DQN B;  1WUD A;  2CRX A;  3CRX A;  3T79 A;  1ECW A;  2KOB A;  4AYB F;  1XNS A;  1T94 A;  2G5I B;  3C28 A;  2F76 X;  2ZXH A;  4PL1 A;  4NLB A;  3PSI A;  3ICX A;  2HBJ A;  2JH1 A;  4IC9 A;  1Z1B A;  4C0Z A;  2ZIU A;  2G06 A;  2Q4T A;  2KKV A;  3F5A A;  2XID A;  4NV0 A;  2N1R A;  2LBO A;  3SAF A;  3F2D A;  4P0P A;  4FZL A;  4P0P B;  1A6S A;  2KKP A;  1XO0 A;  3F2C A;  1DRG A;  2K4H A;  2RHF A;  3L3F X;  2PMZ F;  3N7S C;  3PSF A;  4OJO A;  2F8L A;  3F5E A;  4PL2 A;  2VJ4 A;  5KL1 B;  1Q3V A;  5HR6 A;  2KD1 A;  3N7R C;  2XVT A;  3LYS A;  5T14 A;  3SQI A;  4JMU A;  2E5S A;  2KVC A;  2ZIU B;  2ZIX B;  2K8C B;  2CPR A;  2ZIW B;  4ACO A;  2HOI A;  2G07 A;  2KIW A;  3H0R B;  3NUQ A;  1KBU A;  1PVQ A;  2F77 X;  2Y0S C;  2YB4 A;  2YB1 A;  4OJP A;  2ZG6 A;  3DEE A;  4P0Q B;  2JHD A;  2LKY A;  2KJ8 A;  2WB1 F;  2JMG A;  3AQE A;  2KJ9 A;  2G5H B;  3KZX A;  2HBL A;  4OJ5 A;  3C29 A;  1UPH A;  3IG8 A;  4KX5 A;  4U7C A;  2K4E A;  5A0L A;  2LHT A;  2ZIX A;  2KJ5 A;  3H0M B;  2H3I A;  2NV3 A;  3RF9 A;  1MA7 A;  2OXO A;  2R18 A;  1HIW A;  2HOQ A;  2ZIV B;  2DF4 B;  2H3F A;  5HR7 A;  2KIC A;  2VIX A;  2WB1 C;  2D6F C;  5KL8 B;  2H3V A;  2K89 A;  3HKZ F;  4BUG A;  2LYB A;  3ONN A;  2Z7J A;  4FE3 A;  2DGZ A;  1PVR A;  1CRX A;  2W7O A;  3D2S A;  3F53 A;  4OJ6 A;  1L6N A;  4OJL A;  2G09 A;  2CN1 A;  2LYA A;  2HBK A;  2Y0S F;  3PSP A;  2VKQ A;  4NWI A;  1YT3 A;  3M6K A;  1F44 A;  2ZIV A;  4A8E A;  4BJQ A;  3IN5 A;  2OH2 A;  3NRW A;  3AL0 B;  2KHV A;  2ZIW A;  3AQF A;  2JH7 A;  4WJ3 B;  3OPX A;  3F2B A;  2H3Z A;  4U6P A;  2W04 A;  3O0F A;  4NLC A;  2WAQ C;  4QIW C;  4CRX A;  4O3M A;  2G0A A;  2PMZ C;  3VCB A;  2W7P A;  1SZH A;  3IP4 B;  4KX3 A;  4FZN A;  2MA1 A;  4KMO B;  3HKZ C;  1Q3U A;  1OUQ A;  5C0Y A;  3PST A;  2G08 A;  2K8A A;  2E1F A;  3GU3 A;  4QNL A;  3LVV A;  1GO3 F;  3MGV A;  2W03 A;  4QJF B;  1TAM A;  3M7D A;  2VJ5 A;  3RFA A;  1A0P A;  3SMV A;  4AYB C;  2BDU A;  4CGZ A;  4OO1 J;  2WAQ F;  1ED1 A;  2K4I A;  3N7P D;  4QIW F;  2KHQ A;  2A3V A;  3IG5 A;  2XI9 A;  2RP5 A;  1Z19 A;  1ZQ1 C;  1D8B A;  2M0N A;  2RRD A;  2ZXI A;  3CYM A;  2F2A B;  2MRL A;  3M6Z A;  4FZM A;  3VC8 A;  3D2N A;  2GOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...