1D9KB

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGQGRAEQFFGPGTRLTVLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 112
sequence length 112
chains with identical sequence F
ec nomenclature
pdb deposition date 1999-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kB00
4G8FA 1GGIL 4RFEB 5M94B 2QQNH 3HG1D 4KVCL 3BIKA 3FFCA 4ETQB 1IGYA 1FG2A 4AH2A 1I9IL 2IF7A 3SOBL 1RIVL 1CQYA 1JTPA 1BVZA 5T1LB 1GC1C 1HHIB 5DRNB 4MD4B 5H94B 1EEUA 1BQLH 1NFDE 4RA3A 1CS6A 4WNQB 3SE4C 3FZUD 3TC9A 3CSBA 3CPLB 3V5HA 4OGAD 4XRCA 3MA9H 4LAQL 4I18A 3NACH 2CLZA 4WUKH 4NSKB 2V2XB 3FCTB 4K7PL 2CO7B 1SJVA 3O45B 5FO8B 2HFTA 1QO3B 3LN5A 2Q1EA 3MLYH 2JK5A 1S5HB 2NLJA 5CLTA 4YBHA 1QFWM 4M3KB 4O4YL 5KSAA 3MV9A 3D39B 1ZT7A 5F6HJ 1IBGH 3QPXH 4OZIF 1FYTA 1PG7W 2NY4C 2HJKB 3OAYH 4UB0H 2QSCL 4OZGE 3SCMB 4OZFG 5DQJA 1PG7X 3EO0A 2VABB 4KI5F 4CVZB 5E2UH 5D6CA 1IAIM 1I1CA 4HAFA 2BY3A 1JZ2A 2VE6A 3OV6A 1Q9LB 2R69H 4FQHB 3KPSB 1L7IL 1KUMA 3GGWB 4IDLA 1HYSC 3UBXG 2E8ZA 5DJDA 2IPUK 4TUOB 1UKTA 1XAUA 5E6IA 4R7DA 1V7NL 1TJIL 1D5IL 5EOTB 4PJFE 4KUCF 4LDLB 1NMCB 1IE5A 2JJTA 1EV2E 1FNAA 2LQRA 2ZSWB 1EBPA 4XNQA 2HT4C 2BOCA 3PXJA 4Z76B 3VGGA 5JUEH 2WSKA 2DQTL 5JDJA 3NMEA 2FECI 4HF5L 2NX5D 1HHHA 1QLRA 3QEHB 4MNQA 2QR0A 4Y5XC 5L2KE 4J8RA 1OQXA 4KKLD 5JW3H 1EFQA 2C3GA 3HS0B 3D0LB 5HHMD 1H3TA 2D31A 2EYRB 4G80A 5F89B 5CBEB 2NY7L 3TA3C 1M6OA 4PJDA 1N8ZB 3Q6GH 5D7LD 3OXSB 1WVZA 5D71L 3VW3H 2M1KA 5I8CB 3E0GA 4LCIL 1QFWL 2B1HH 5KANG 2VXTH 1CXKA 3QFDB 4JHZA 5CKGA 4U7SA 1KV3A 4XPHL 2BMKA 1KYOJ 2VTFA 4JB9H 4NNPL 5DUBA 4X6CB 3N1FC 5TE6H 4NC0B 3O6FB 4KV5F 5INCB 1T20B 3U6RB 5T1MA 2NY6B 4PJCF 3HPJA 1WEJL 4NWUL 5E7BA 2A74A 5J1SC 3LEXB 4LP4A 3HTLX 1K5NB 2AKRB 3TVMC 2BJML 2R0LH 4J23A 1Q72L 2EO1A 4Z7UA 5C09A 1BWMA 4I9WD 1UACH 1RUKH 4OF6A 7CGTA 5J89A 4HPYH 4WV1A 1CF8H 2RHEA 1MRDH 1TVHB 3T4YB 3DIFA 2YXMA 4PJEB 5TE7H 3TBSA 1OW0A 1LP9F 4U31A 3HMWH 3ARBC 4OI7A 4R7NB 4R97C 5GS1C 3GMOB 4HPOH 4MXWH 4PRBA 4OLWL 1CBVL 5MEOB 1D5ZA 4FNLL 1MLCA 4OV6F 4NZJA 3MOAH 5EZLB 1CICC 5C3LD 3PNWA 1K8IA 2BNRB 1QG3A 1JYXA 1ZLSL 5FKAA 1G6RB 4UILH 4LCYA 3QQ4A 2AABL 3R1GL 5IG7B 2VLJB 3PWNA 5TE4H 4RMQA 5GGVY 4D0BA 5I2IB 5C86A 3QXUA 1NFIB 4L3ED 2E9JA 4PJXE 5E95B 5IWLC 3MRLB 3T4AA 1A7NH 1FSKC 5HHVH 4BA8A 2YK1H 5E8EA 4HIXH 5I1LA 5FF6A 1A6UL 3SKNB 1YEEH 1RJYB 2XG4A 3G5ZB 5K9OB 1KEMH 2R4RH 2JELL 5FB8B 1NGXA 3UTTE 1OAZH 4OD3H 3L3KB 2EDHA 5IBUB 3LKOA 1MFAL 1U8OA 3GIVB 5KVDH 1OTSD 3K80A 3IGAB 1UKQA 4P49A 2VDMH 1VFAB 4JKPH 4KRNA 4LVHC 3AROA 5JORB 1G7IA 3C08H 3VU2A 4X0KB 2ERJC 4IIQA 4XP1L 3NCEB 4PLJC 4UOW1 4Y1AE 3MRJA 1T7YA 1W72B 4NHCH 2H6PB 4NT6A 3A67H 1HEZA 1A1OB 4G43B 4DN4H 4W6YB 3JVGA 4NYLA 3G6AA 2UWEE 3LN4B 5AAMA 3RWDA 1R0AH 4YXLH 4P23B 4GRMB 5KVEH 1FHGA 1XR9B 4YO0B 5GSRB 4NZTL 1KJVA 5F8RC 1HN1A 4UTBL 1R6VA 3O4LD 3RNQA 5F88A 5TJWK 4TTDD 2Z93B 5ECJE 2BFVH 1MHHB 4K3DL 3CFEA 4AEEA 1ACZA 2GTZA 5I1HL 3LEYL 1UWXH 4HS3A 3QEUA 4X6DF 4JRYD 1X5XA 3DBXA 3N1PC 3ARWA 4Y4HD 3MNZB 4GRWE 3REWA 1KIRB 3SPVA 5LQBL 4WFHD 4XMKL 1VEPA 4XCCL 3RDTC 2B2XH 2DL2A 3ES6B 2HTLD 1WFOA 3OJDB 2IQAA 4P2QD 3PWJA 5BMFL 2D3VA 3IDIB 1MIMH 4FOMA 3DX6A 1MOEA 2YEZB 4OZGA 1VCAA 5J12B 2XQBL 3RI5K 3FT4A 1KBGL 5F44A 9CGTA 4NIKB 3NGBB 5LXGL 1CLYH 5JOFB 4XWGH 4PB0H 3WO3B 1XGQA 5KSBF 5DD1L 3BKJH 4OFVA 4F8QA 4BH7B 5SX5H 3EGSA 1H3WM 4HMCA 5EBLB 1GOHA 5B3JF 1HDMB 2B5IB 1A8JH 1OARH 3ULVC 4GRLC 5GS0H 2NX5B 4AEHL 5ENWB 3OJVC 4U1HB 4X80H 4KROD 1GGIH 1C08A 4A6YA 3IJHA 4HIJB 2VL5B 3DTXA 4KVCH 5IVXB 1X4XA 3VXOA 2ED7A 3E3QE 2OR9H 3FB7B 4MXVF 3L6FA 2DLIA 1I9IH 5BW7C 3SOBH 5L2KA 3I6KA 3T0XA 1RIVH 1T5WA 3CFJB 5K59E 3MUGB 4HUWB 5I76A 1VACB 4ONHB 5CINL 2VDLL 4OCSL 3FQNA 4ZUTB 1XCQB 3E6FA 4OF5A 1N59B 3AM8C 2H1PL 3RTQD 1MCLA 4ZUVA 4KPHL 4LAQH 5DD3L 4N1CA 4LBEA 3TBYA 5J1TC 1PKQB 2DM3A 5KZCB 3TN0C 4K7PH 1PLGL 4Z0XB 2NXYD 1FZMB 2UV3A 3MRGA 2CIKB 3SY0B 3C5ZC 4J6RH 2HN7A 2Z31A 4XAKE 3UTQA 1PYWA 3DURA 2VISB 4O4YH 4QRUA 3UO1H 5JLZA 3T08A 2GITA 2VSCA 3V4UH 35C8L 3QJHA 5F1NB 3CC5B 2QSCH 3ULVF 4LSDA 3KLAA 2PNDA 3DECA 1U8HB 4F37F 1X5AA 1RSFA 3BPOB 1QTYT 4JPIB 1B9ZA 2BC4B 2QHLA 3F7YB 4AIZA 4PRHA 4WW2A 5CILL 5TF1L 4ZFGL 2PYEE 4LHUA 1L7IH 4QHUA 4KWUA 2AEQL 4JFZL 1SMOA 2FYYA 1UT9A 3L3IA 5L9DL 2GCYA 3LKQB 3V0VA 2XWJA 1V7NH 2V17L 3QHTC 1TJIH 1D5IH 3ULSB 2FJFA 5CSZA 1N5AB 2EEAA 1JF6A 4APQC 2LVEA 3NZHL 5FDWB 1ZLUK 4HX1B 5DMGC 4LPWA 1S9YB 1GL4B 2ADGB 3IU4L 4HJGA 2J8UE 1QVOA 4JQVC 2DQTH 2ITDA 4GW5B 5KSVB 1HH9A 4HF5H 4J3XA 4NQEE 4X6FB 3SHSA 3FAXA 1BLNB 3T1FB 4JFPA 4UQ3A 1X44A 4U1GB 2O5XH 4P3DA 4MD0A 1KCVL 3P9WB 1U0QA 4M5YL 3HAEG 4HXAL 3BP7B 2NY7H 1LILA 3UTTA 2PO6A 3EKCA 3RWFA 3ZE0F 5DHXB 1RZIA 5D71H 5FA4B 2R39A 3F5WB 3WN5B 1I8MB 4BUHA 2LTQB 4AT6B 4B41A 4LCIH 3KPTA 1QFWH 4KRPC 2EECA 5DHYB 4XPHH 4ZOBA 4NNPH 5IIEB 4OLEA 5TQ2H 3V6ZB 3GMRA 3S34L 2UY6A 5F9WC 1BZ9A 5C08E 2FJHB 4Y1AA 3V7AE 4XVSL 1WEJH 3CH8A 2VLMD 1F97A 1T21B 1QBAA 1H9VA 3FT2A 3R06A 5JA8B 4LLQA 2EZ0C 1EDQA 1KPVA 2BJMH 4GBXA 1W8NA 4JPVL 3TZVC 1B2WH 3SDXA 1AFVL 1Q72H 3O4LB 5E03A 1AR1C 2UWEA 1PY9A 3C09B 2Z92A 4Y4KA 4DN3L 3C8KB 1TETL 4R96A 5IESH 3P40A 3QG6A 4NRYA 4NOFA 3UBXI 5IB4A 1QFWI 4QHMA 1FL5B 4JRYB 5F70A 4BH8B 1UZ6E 4OLWH 1J1PL 1CBVH 4XXDA 4N8CL 4N0CC 4NQCA 2DBLH 4FNLH 5IVOA 1GYAA 1XGYL 2GSGB 5JPMB 3U46B 2CUIA 3MNVB 4HV8A 5F97E 3GMLB 3WNLA 5JXAL 1R24B 3IETB 2AABH 1D6VL 3BGMB 3R1GH 4P2QB 2LABA 1IAII 4O2CA 5FYJD 4GS7C 3OSKA 4OIIL 1FV1B 4JM4H 5JPNB 1G7PA 4PRID 2VAAB 6FABL 4N8VA 3A6CH 4LLWB 4LLVA 5F7FA 4U2ZA 4BSJA 1U3YA 1A6UH 5AZEL 3TNMB 2JELH 1VGKB 3L9RB 2H26B 5I8KL 3MV8E 3WJLA 1YEDB 3HCVB 5DJYA 1I9EA 1EHNA 2CRIA 1MFAH 2YD4A 3PV6B 5ITFB 1QHOA 3I3EA 5HYFA 3FN0L 1LP9B 4Y5XB 5FGSA 3LQZA 3V6OE 4XP1H 4I0PC 5D7JC 2A6KA 2CGRL 3ZZ1A 4PBVC 4MXQD 3B8YA 3DMMD 3MLVL 4WDIA 3RIAK 1QBBA 3TA3B 3WLWC 4AJ0A 3X12B 5HYJA 4NQXA 5FUCC 1VKXB 1UM5L 3BXNB 3MRCB 2PXYA 3OR7B 2EE6A 1FYHB 3OF6D 3B2UC 1PAMA 1MJ8L 4P2YA 2P47B 1QD0A 4MX7A 1VERA 4Q2ZA 5IMMB 1JWSB 4NZTH 4UTBH 3RTQB 3WEXA 5JMOC 3GRWL 1S9WA 2BOBB 2EO9A 4ESKA 3TYFA 4ZPTB 4FXGB 4ZNCD 1JRHH 5CD5D 5I6XC 1NC4A 5IM7B 3GJFB 3UTSA 1LO0L 3VI4F 2DRUA 1OTUC 3LEYH 4F7CB 4E42A 5CZKA 3EJYD 4IRSC 1WBYA 3EYFA 4ZFZB 3EZJB 3G5VB 1F6FB 3UAJD 5LQBH 4XMKH 4XCCH 3KPNB 3S37X 4FQ1L 4H1LB 1Z6JT 1NAMB 4HWZA 2Y06L 3ARBB 1D5MA 3A0OA 3F58L 3RWCB 4EUPB 1QBLL 3EYQD 5BMFH 4N90D 5GS1B 5E8OA 1HILA 3O0RL 3EOBB 1KSRA 1NGPH 1UXSA 4FG6D 4AYFA 4J3VA 2XQBH 3RUGA 4QY8B 3S35L 3O6LL 2PR4L 1YEIL 4MDIB 5LXGH 2G5BA 3TBVA 3T0AA 4L8CA 3VD3A 1MI5E 1CFQA 2Q7NA 5C0FA 3N0PB 1OAKL 5DD1H 4TSBL 2WBKA 3ZTNL 2PYEA 1B4JL 3D0VB 3LKPB 4ZD3L 4Z7VF 3QAZC 4KGLA 2L0DA 3IU3B 1MJ7H 1NH6A 5B4MD 3DI3B 1GGTA 5F9OL 5ESAA 4Y19E 4M9PA 3KPMB 4I18C 2D7QA 4YHNA 3X3FL 4XBPA 4AEHH 3C6LA 4C55A 2R23A 4EEEA 2A0LD 3RX5A 4X6DB 3BZFB 2NY0D 4OKVB 1MELA 1JHLL 1OGAB 2J8UA 3BH9B 2CUMA 3VXMB 3IJSA 1R5WB 5DO2C 4C4KT 4KC3B 1YY9C 4NQEA 4GRWH 5EIVA 4OLZH 3L5XL 1QSVA 1RJLB 4UV7L 2VZ1A 1VFOA 4M9OA 3C5SA 5CINH 2C9AA 3ZT6A 1CT8B 2VDLH 4OCSH 3MV7A 5T3ZD 4NPYB 3ARVA 4MD5B 3OKDA 1KCUL 1GGYA 1Y6MR 5A2JH 4HH9B 3QDMD 4WEMB 1IQDB 3BP5A 2FZ3A 4FFWC 1VFBA 3ISWA 2GK0A 2AI0H 1JPGB 4KPHH 4KY1L 2LV4A 4Q74A 5H37G 5TGBB 4GW1A 1KTDB 1GPOL 3VD9A 1PLGH 1Y6NR 2W1NA 2EIBA 2XWTB 3U0PA 5I66B 4TSCL 3HKFA 4PJ5A 1A4KA 3ARSA 2E27L 1J9CT 5EZOL 2FCBA 4PRPE 1JI2A 2NTFA 35C8H 3LB6C 4PJBA 8CGTA 1JTTA 4JFYB 5FM5O 3SGDH 4Q9RH 1MAJA 3FO1A 1CXHA 3D2UD 3HZVA 5IEKB 3T3PF 5I8OL 4JZJC 2X70A 3VFTA 3RGHA 4XCEB 1DL7L 5CILH 5TF1H 3RL1A 4ZFGH 1YNTA 1M05B 2Z0BA 3JV6B 3T65A 2YD2A 1DUZB 3U9UB 2GSIB 3QWOA 2AEQH 2FATL 4JFZH 4C83B 5L9DH 4KI1A 5C8JB 2V17H 2GJ6D 4CADA 4S2SA 3MLRL 4PLNC 1HHGB 3SGEH 5I0DA 3MRHB 3NZHH 4L1HA 5HJ3B 1QLFB 1IEAA 2R1XA 4JM2C 4PRIB 2BZDA 1BQHA 5GSVB 3VRLF 3GSWA 4RGMC 2HLFC 4PJAA 2X44D 2V5SA 1JHTB 3GRWA 4GKOA 1FAKT 5M95B 4OCYL 2X1PA 4MYWB 3GSNB 3QI9C 3MJ7B 5CAYB 4CMMB 1PQZA 4LVOB 2E7HA 1BWWA 3C5JA 4QEGA 2X4OB 5HVWA 1G7QA 4ODHH 3K8LA 4M5YH 4HXAH 4KK5D 1OVZA 1IGCL 4WV1C 4MJID 1ZWIA 4MJ4A 3TIEB 1A6ZB 3SGEI 5E1HB 2MJWA 2XOTA 3GKZA 4JDVA 2A1WH 2ORBL 5GS0C 1MCEA 4HUVB 4PY8J 4O2FA 1RK1A 1Q0YL 3IJYB 3DMMB 3MRQB 3TIDA 3GBLA 3MRPB 1I1YA 3S34H 3V6OA 4NQTA 3HUJE 2CXKA 3JWDL 2W59A 4XVSH 3ZKMC 4WUUE 3CMOL 3MJ6A 2YD9A 2X4TA 4L4JA 2FIRT 4F7MA 2H2PC 4JPVH 1N6UA 1S7XB 3CFKA 4JM2F 5GGRA 2DYPD 2VUOA 4Z78A 3VXNA 4PJHE 2V9QA 4DN3H 3IFOA 1TETH 4M7LT 3C5ZB 4BQ8A 3ZHLA 2AK4E 1J1PH 4N8CH 4ZS7H 2XV6B 3ZDYF 4M1GL 1XGYH 4Z7UF 3RHWK 3EYUH 4PJ8A 2DICA 3WIFB 1X5GA 4C56D 1D6VH 4R4FL 4N5UA 2UYLB 1NDGA 3OAZH 2AEIT 3PHQA 5CHNA 5E70A 4F9LC 3MGTB 4XHJC 3CFDA 4YEEA 5T1KD 6FABH 2F54A 5J6GA 4OCLC 1DQDL 1NEZG 2C4FT 5ITBL 2AS5M 3LRSA 5CGMA 4M62L 3BH8A 1NCNA 1I85A 1SEBA 2R0KL 5AZEH 3JVGC 4H0IA 2WUBL 1NAKL 1KCKA 2NY2D 1SQ2N 4APQB 1MFDL 1G9ML 1ZGLB 5I8KH 4Q6IB 2CUHA 4JQXA 3D3VE 1TFHA 3LKRA 5BQ7A 4OQ1A 2NZ9D 4I3RL 3MRMB 4IBLT 3LQAL 1EJOL 3FN0H 1ZHLB 4QRRA 1KPUB 5MENE 3TM6A 4JFQA 1CFNB 1U6AL 4NHUB 5FOBA 3QDGA 1NCCL 1H0DB 2CGRH 4XXCA 3MPCA 3S7GA 1J5OL 4NOBA 3I6LE 3MLVH 2DMKA 4IJ3C 4ELME 4HKZA 5C0IB 3WO4C 1FBIH 2E9BA 1UM5H 3FTGA 1V7ML 4OD2A 1FZKB 4BSWB 2AJYL 3S3SA 1MJ8H 5C9JA 3FQTA 4KRPB 5I1AA 3BDBA 2ARWA 5D4QA 5D2NA 4RGND 2APVA 4XAWL 3RIFF 1LDSA 3GRWH 4JG1H 2YPLA 4TUKL 5GZNC 1WFUA 3VXRE 2MNUA 2JF1A 1KLGA 1M71A 3MV11 2QHRL 1NBQA 2Z35A 4QCIB 5F9AC 4RAVB 4GMSL 2QSQA 3GHEH 5DJ6B 4AG4L 4FQ1H 1QQDB 2UVEA 4JDZA 2ZSVA 3V4VH 1NFDF 2Y06H 3F58H 4HKJB 2BY2A 1D5XB 4OKDA 3OHXB 4PP2A 3WE6B 3O0RH 4HUNB 2WIIB 5JW4M 2ZUTA 5B38A 2PW2B 3S35H 1J1XL 3O6LH 2PR4H 3M8OL 2Q3AA 1YEIH 3DUUA 1AQKL 4FQXD 5ICZA 5I18L 1YECH 2C1OA 1OAKH 3NCFB 4AMKL 3T2OA 1X5ZA 4MNGE 4TSBH 3ZTNH 3O2DL 1B4JH 3OXRB 4ZD3H 2VR5A 4GS7B 5I16B 5D2LE 5DC0A 1A6TA 2NY1D 1S5IL 3NFNB 1AD9B 1DEEA 5BRZD 5BV7L 4N0YH 5C0ND 2RBLA 1AP2A 5C70A 1UWGL 1JHLH 2Z31C 3BX7C 4NCDA 4JFFE 2WQ8A 2COQA 3K81A 4HK0B 3PIQB 4NO0A 2GY5A 2I24N 4PGCB 1RHHB 1V5JA 4MJIB 3L5XH 4KJQC 1T1ZA 4PJFF 4UV7H 4GLRI 3HN3A 2ZUVA 4ZUSA 4JY5L 5TDNA 5HGDA 4I0PB 4G42B 4R3SB 1H5BB 3LDBB 4WW2C 3EJZC 4ISVA 1Y18A 3ZHDA 5E9DD 1F4YL 3KR3L 4P2RB 1UJ3A 1R5VB 1D5BB 3CJJA 1L7TL 3SKOB 2CLVB 1WCBA 3BZEA 1J88A 4Z7VB 4YBQD 4OF7A 4I5BA 4TSCH 5ISZD 4P9HC 2H8PA 1SJHB 4PLKC 2VLRE 1KT2A 2GYSA 3C9NA 4U1NA 5EZOH 2ZCLL 4CL7A 4WUUA 1RUMH 5D5ME 7FABL 2CR3A 2OR8A 5I6XB 1U58A 4YWGL 1JE6A 1ITCA 1ZS8B 4CNIB 5IEHB 1E28A 3CK0L 5EBWA 5I8OH 1J0YA 3IXAB 1RPQA 2WNGA 1DL7H 5ADPH 3C60D 3D69A 3RZWA 3SDDD 1DVFD 2K7PA 4S1SL 1CFSA 4E0RA 2FATH 3HRPA 4K2UL 2EDYA 1NDMA 2PO6C 2VITB 2CRMA 1KJMA 1FFRA 4RX4A 3STLB 3KPOA 3WCYA 5LBSL 5T1KB 3L5HA 4U7MA 2R2CA 2HTKC 1L6ZA 4WW2F 1N26A 4ZS6D 1ZEAL 1FL3B 1BOYA 1D7FA 5ABDE 2HAZA 1KJ2B 4LHJB 3DX7B 2VC2L 3VFSB 1XF2B 2ATPA 4U6HA 4WI3A 4HFUL 5A2KH 2NY2B 1UH3A 2BHYA 2IAMC 2H3NA 4KHTL 2EDOA 3NCYP 1IT9L 5DDHB 1OP3K 1IGCH 3NFPA 4YDKL 5E2WL 3V6FB 4Y4KC 4F7EB 4PJXF 4S0SD 4ZAKC 1KCLA 1DBAL 4YDJA 2ORBH 3V5KB 4KK6C 5F1OB 4AENB 3DO7B 1BZ7B 5MENA 1HNFA 2R29L 1J05A 3VGHA 2E6PA 3SJVE 2F8OA 5EG6C 1P7KB 3GMMB 2IJ0C 5BZWA 2YSSA 3CMOH 2ILLA 1RUAL 3LZFL 4KJWD 2VE6B 3OB0H 5ESQA 2X89D 4R6UA 3O2DA 1I7RA 5DTFA 2NCMA 5L8LB 3RWHB 4ONGH 3ME0A 4TVSa 2JB5L 1O0VA 1KENL 4LLUA 5I9QC 2XT1B 2VO5A 3QWRA 2XZQL 5AZ2L 4HGWA 4PG9B 2BSSB 3WJLC 4F3FA 3VXRA 4M1GH 4OFPA 4ZO8A 4H25A 4OZ4B 4MQSB 2IBBA 2UWEF 5JXED 3AREA 3F65A 3QNZB 1C7TA 2YWZA 3O3EA 3S88L 2DB8A 4R4FH 4JZJB 3SBWA 3LAFA 1OOAA 1ZA6A 4L4TE 4BFIA 4OIAA 5EZIL 1P53A 5I8EB 4U4BA 1MVUA 3WJJA 4KKNA 3DUSB 1DQDH 2A6IB 3LD8C 1R3LA 1WJ3A 5ITBH 4F33A 4M62H 2R0KH 5D7IA 2Q76B 4OZHA 5KAQG 1OAUH 2PXYC 1DN0A 2WUBH 4NQDB 3E3QC 5I1DB 1NAKH 1Z2KA 1MFDH 1G9MH 4JM2B 3KXFD 4GRWF 4R4BA 5D70L 5DJZB 3O3BA 3AC0A 3JV0A 2WZPD 2NY1B 5EOCL 2CLRB 4I3RH 4MNGA 3LQAH 1VENA 4XI5C 1EJOH 1FC1A 1YY8B 3CDCA 4JPWH 5BRZB 3QQ3A 5D2LA 2XY2A 3H7LA 2KH2B 4S11A 4YHYB 3QQ9D 4XWOD 3DRTB 3QI9B 1U6AH 3O8XD 1NCCH 2K3TA 1FCGA 1A2YA 1J5OH 3DETD 1WF5A 3QIUC 5JHDA 2I9LB 3SDAD 5HHPB 2ARJB 3RY5A 4LASH 4JRXD 2FX9L 1M1SA 3E2HC 1F5WA 3PGCA 5IGXL 4JFFA 1EXUB 2W9DL 5F7UA 1V7MH 3WV0A 4WJ5B 4HUKB 4HUMB 4Y0GA 4XVUD 2J4WL 5DS8B 3HZMA 4MCYB 4ZO9A 4FQQB 2WBJA 4XAWH 3I50L 1F4XL 1EAPA 4QRPA 2JB6B 1QSEE 2VDRL 3OQ3B 5E9DB 4OUUB 2Z91B 5TQ0H 1OWWA 2DI7A 1T22B 1DEDA 3J7HA 2B4CL 2J5LB 4GFTB 2BHUA 4D0BB 5DQ9B 3VXSE 4GQPH 5GHWL 3DOSA 4N9GA 4NN7B 5D96C 1P7QA 5DI8A 5KVGL 2X10A 3O4OB 3PHOA 5K59F 5E8EB 4GMSH 3PF2A 4G8GE 1KB9K 4AG4H 3IDMA 5HHNB 1CDUA 1QFHA 5FGCE 4HBCL 3C6LC 4RMTA 5CEXB 2CRYA 4NQVA 1AXTL 5K9QI 1MJJA 5D5MA 1F00I 3C60B 1DBML 3ROOA 4I48B 4I2XB 3NZ8B 1J1XH 3SDDB 1GOFA 4MNHA 1A7OL 3QHFL 3M8OH 3PP4L 4AL8L 3BJLA 1KB5A 1RMFL 1I7ZA 5I18H 5GRVL 4F8TA 4AMKH 2PCPB 4ALAL 3ECBA 3O2DH 3RWJB 3MCKA 3C6SA 2JCCE 3H42L 4YDVB 3QJFA 1F02I 1MREL 1IGTB 3CU7A 3TO4A 1HEZB 3RVXD 1S5IH 2QKIB 2R2BB 3SO3C 4OJFL 4XH2A 4TPRL 5I75C 3RWDB 4NKOA 4N9OB 4YIQB 1UWGH 4TVPE 1NUNB 5GGVL 3WHXB 2ZZUT 1T1XB 4S1DD 1KJVB 4XP9H 2J12B 3REVB 4KTYA 1I7UA 3IDGA 3EHBC 1WAAA 1NFDB 1BVLB 1J11A 3PV7A 2OTWB 2WUCL 4E5XB 5D1QD 4GG8B 1CL7L 2FJGB 4Y4FA 1A7QL 1IL1B 5C0CA 1MHEA 2F5AL 3MZGB 3D9AL 1DANT 3O9WA 2J8UF 5KS9A 3I6GA 4G6FD 4IJ3B 4MCZA 5F9DC 4P3CL 1ZOXA 2XZZA 1F4YH 3P77A 2OJEB 5DD6A 1HE7A 5C0RL 4LOUC 5EA0L 1L7TH 4EI6A 3F7VA 1A64A 1IGML 1Q9OA 1JPTL 1XF4B 1FZOB 2DMCA 3LPWA 3DX6B 2P7TA 3TCLB 3SJVA 4RMRA 3ABZA 3D6GA 4FFZL 3GSUA 1L9NA 3R0NA 2FEEL 2BVOA 4KXZI 7FABH 5J9PA 4OFIA 1BBJA 1IEBA 2Q8AL 1EEYB 2BCKA 4GXUN 4YWGH 1U92A 3CK0H 3D39E 4YHZL 4JFED 3VXQA 4QHKI 2IH1A 4CVWA 3Q0HA 3WNPA 4YPGA 4Y5VB 4G6MH 5DRZB 4S1SH 4PJFB 2HJFA 4DCQA 4X6BA 2FH8A 4K2UH 4F9PC 3GSQA 4N0FA 5FA3A 1FVDB 1FFOA 3T0ED 1ZV5A 4RAUA 2X4QA 4KTEL 4PD4J 3WIIL 3KPSE 1UZ8B 4A6YB 4X5LA 5LBSH 2IFGA 4UI2A 1T89A 3H9ZA 5J11B 2VQTA 3FRPG 3H3KA 4HH8A 2HRPL 4LPYA 2EDDA 1ZEAH 2BK8A 1DQJB 2ICWA 3V6OC 4L4TA 5DYOA 1Y6KR 1XR8A 4HFUH 3QUZD 1UZ6F 2BNQA 1QBMH 3FQNB 1FRGL 3E6FB 3KXFB 3QR2A 4KHTH 4M7JH 1J0KA 4LCWA 4KFZC 5IK3A 1I3GL 4L5FL 1I9RL 1IT9H 5F21B 1U8MA 4KMTL 4LBEB 1WGOA 2OSLA 3VH8G 4YDKH 2RFXB 5E2WH 3MBXL 3QUYD 4FXKB 1WC7A 3O3UN 2Z31B 3O8XB 4XMLL 1DBAH 3U0TA 3BUYB 4ONFL 1KB5H 3ZKND 1CTNA 1PYWB 3MRIA 1BAFL 4XP4H 3QNXB 1HXYA 1ZT4A 3SDAB 5IQ9B 5LWYH 2GITB 3U2SB 1T04A 1FNLA 3TNNB 4G6AC 3ILPB 5JOEA 5DJ0B 4PJ8C 2AJVH 3RQ3A 2D03L 1KOAA 2AQ2A 1U91B 1RUAH 3NABL 3LZFH 3OKMB 2R1YA 1ZANL 4WIQA 4DKEH 2CDGB 4CJ0A 4JJ5B 5ACZB 5CWSA 1CYGA 5F6HI 5JDSB 4RBPH 3VCLA 2F53D 3BZ4B 3BP4A 4K7FB 2JB5H 1I85C 2GCYB 2ZNWA 4U1KB 2ED9A 1KENH 1A7RH 2IGFL 4JG0L 1NJ9B 2GAZB 5ID0A 3K2MC 2XZQH 2NW3A 4I13B 1J87A 5AZ2H 4YHKL 3FQRB 2L4OA 3W0WD 5KW9L 5EU3B 4MVBD 2R0WL 5T3XE 1F58L 1JWMB 1ZHBA 3GMPB 3VXUE 2AQ1A 2WLZA 4PJXB 3S88H 3EDDA 1D6EA 4P5MB 3TH4T 3UDWC 1TCRB 3UTPE 3BPCA 5EZIH 5GQBA 4ZXBC 4XXCC 1A7BA 1AC0A 2GTWA 3CUPB 5GGSB 1U93A 4DZBA 4GAJL 5CSBA 2VLJE 3WS3A 3K7UA 2H9GB 3TV3H 1BIIA 2BY1A 2KZ1B 3QG7L 1JBJA 3B9KC 3RWEA 4BQ9A 3GZKA 2PN5A 4P2OD 3QO0A 1FQ9C 1MAML 3MJ8A 4V1DA 1AIFB 3IVKA 3K1DA 4RDQG 5D2NC 1IGJA 5DHVA 5EOCH 3RPIA 3WDJA 5CD3B 4LMQE 1AI1H 1JGUL 1GZPA 2JCCA 2NZIA 4WEBL 1OT2A 4GKSB 4XPGL 1EUUA 1A9BB 4UDUA 1Q1JL 5GZOC 2IAMB 3QIWD 3X14A 3JSSA 4O2EB 4L9LA 4XGZA 2XPGB 2X41A 5J13C 1CE6B 4MLSA 4IMLB 4Z5RA 1JGDB 3QA3B 3D25B 2XY1A 3BDYL 2ID5A 4L4VD 1YQVL 4RFNC 4YHIB 3QISA 2FX9H 2Z92B 4FQ2H 4PY7B 3JV5A 4H20L 3CCHA 5IBUG 5IGXH 5D1QB 5CFHA 2W9DH 3HG1E 1WFTA 2AJZB 4QXTB 1ND0B 4ZAKB 4YZFE 2VKXA 3FONA 1URLA 4WTXA 2Y6SC 2J4WH 4JY6A 4EDXA 1JUFB 4OF3A 4XXDB 2X4UB 4G6FB 1OSZA 4G8IA 3I50H 1F4XH 2VH5H 4RFEA 1JPSL 2VDRH 3VRJB 2HT2D 4O00A 2OK0L 4ETQA 1G6RL 4MB3A 5CLWA 2XTJD 1S7UB 3CSGA 3U9PL 5GHWH 5T1LA 1HHIA 5IBTL 5DRNA 4MD4A 5KVGH 5H94A 2K7QA 5T33L 4WNQA 5EU5B 5E2JA 4BK5A 3CPLA 4DZ8B 1S78C 2B39A 5E5RB 3L7EB 1KTRL 4HBCH 4PBXA 1BFSA 4HGMA 1T0PB 4IRJD 4JFEB 1BX2B 2V2XA 4NSKA 5BZDB 1AXTH 3FCTA 5IJKC 3O45A 5FO8A 1DBMH 1QO3A 3Q3GB 5IQ7H 1S5HA 5CGYC 4NO2B 1QOKA 1A7OH 3QHFH 1TPXC 1U8IB 4AL8H 3KYNB 1RMFH 3SGJA 4W70A 3D39A 3BPNC 1JZ6A 1K3IA 3T0EB 1AJ7L 4ALAH 3LQZB 2HJKA 5DVKA 1FJ1A 1XZ0B 5B8CB 3SCMA 3H42H 4OCXL 3RY4A 4F2MB 1IM3B 3QIBD 1ZE3C 2VABA 2P42B 1W72L 1MREH 4DQOL 2EIZB 3TYGH 4CVZA 2Q20A 2GHWB 4IMKC 1A1MB 3MXVL 3B6SB 1Q9LA 2UZXB 4OJFH 4FQHA 4LPXA 3KPSA 4TPRH 3TH3T 1AHWC 1UJ3C 2AGJL 2RQ8A 3GGWA 2VXUL 3G5XB 3DGGB 5DVNA 2Q6WB 4HLZH 4ODSL 1VSCA 1XGUB 2GT9B 4WTZG 3Q1SL 3ULUL 4TUOA 5GGVH 2DQCL 5EOTA 3PWVB 3G08B 4CBPA 2ZOKB 1TCMA 2ZSWA 4F15C 3E1F1 1G9MC 3FHAA 3EO9L 1P84J 4G5ZL 4TNWK 4Z76A 3KYOA 3QUYB 4JO1L 5HPOA 1CL7H 1A7QH 5IVXE 2XA8L 4DOHE 2Y4SA 3SDYL 3T0DA 4G9FE 4QRQB 5HHME 3D9AH 1UEMA 2P4AB 5DURB 3QEHA 3IKCB 3VFOB 3QIUB 3SE9L 3AFLA 4H26B 4ODTL 4P3CH 4RFOL 5D7LE 4ZTOL 3HS0A 5C0RH 3D0LA 4XNZC 5EA0H 2EYRA 3O3AB 1TIUA 1IGMH 1YYML 4UAOC 1JPTH 5DHVH 5F89A 5CBEA 5DFVC 3ARYA 1N8ZA 3OXSA 4NM4L 4FFZH 5I8CA 2MQ0A 1KJ3L 2F53B 1JNJA 1ZKAA 3QFDA 1S7WB 4Y2OA 3HE6D 2Q8AH 4XX1G 1CL7I 4X6CA 3FAWA 2VYRE 3O6FA 5CMAB 5INCA 1T20A 4XPAL 2NNAB 3U6RA 3ZYZA 5IB1B 1AH1A 1KEGH 3RVWC 1EH9A 3LEXA 5E94B 1K5NA 3HUJF 2AKRA 4JJHA 1UA6L 1TLKA 2EH7L 2GJJA 4YGVB 4ZFFB 2EH8L 3C6LB 2O93L 3BDXA 2EYTA 1W0VA 2EIEA 2E9IA 1QKZL 4KTEH 3WIIH 1TVHA 4Y19D 3EYSH 3T4YA 4PJEA 2IPTL 2X40A 3OGCB 4R7NA 1C1EH 5C0AD 2FEEI 4OI8A 1DCLA 3GMOA 4PJHF 1FL6B 2HRPH 4JFXB 5MEOA 3HZKB 4MJ6B 4L3EE 1AO7D 1MFCH 2LAAA 4M7LL 5EZLA 1X5JA 4P5TD 3EOTL 2BNRA 4P2OB 2ZG1A 1FRGH 1MRFL 5D7SH 5IG7A 1TQBB 2VLJA 3BVNB 5I2IA 4LCCB 1I3GH 3N1MC 1NFIA 4L5FH 5BS0D 1RI8A 1PDKA 3SO3B 2WWMC 3MRLA 5F8QC 1MCPL 3P9MB 3T2NL 4OV5B 3MBXH 2O61B 1VDGA 3P4NB 2A9NH 3QIWB 1BJ1J 3SKNA 3DGCR 4OF0A 1RJYA 3QP3A 2DQEH 4ONFH 1NEUA 3G5ZA 4RZCB 5K9OA 1BAFH 1JCKA 5GGSY 1DDHB 4MQ7B 3TLRA 5FB8A 1N6QL 4ZTPL 3RZCC 5C08B 1AXIB 5DMYA 3L3KA 1B0WA 3S96B 3GDBA 1EVUA 1Q0XH 5HYSG 4U6YA 3FO1B 3AREC 1YN7B 3ALXA 3GIVA 2D03H 3G6JE 3SBWC 3QCTL 3NABH 3IGAA 5EN2B 1ZANH 1VFAA 2OP4L 3E8UL 5J3HC 1FLRL 1FVCB 5A3IC 5JORA 3GB7B 4FTVE 3WJJC 1IMHC 4X0KA 5DR5L 4OLYL 2EICA 4H8WL 1YMHB 5I1CL 5FYJU 1W72A 5D1ZD 2H6PA 3M07A 4ZSOB 3BESR 4V2CB 2IGFH 4JG0H 2G9HB 5IR1B 1CDYA 1A1OA 2XTJB 4G43A 2VQ1B 4S10A 4BZ2L 2NW2B 3LN4A 4YHKH 1NGZB 1N3NB 5KW9H 2NY5C 4ELMF 4P23A 3O6KH 4GRMA 1XR9A 4YO0A 2NY3C 5GSRA 1EHXA 2RCSL 1O7VA 5GIRB 1N0LA 1BEYL 2Z93A 2WP3T 4QHLB 1GH7A 1MHHA 1EIBA 4HIEB 4WFHE 5DEFB 3V79C 5B21A 4WY7L 3AS3A 5C2BL 2YZ1A 4GAJH 4YBLB 4B50A 4P2QE 1F3RB 4NC1C 5T1DH 3MNZA 4FQPA 4XCYB 5DK0B 5LAXB 1KIRA 3QG7H 3MV8B 5EU6D 1Q94B 1MAMH 5JW4Q 4HJ0C 3WHE1 1K4DB 3IXTB 2OI9C 3OJDA 1U8NB 2WBJC 5E2TL 1GGBL 3IDIA 3NCBB 4ENEC 2YEZA 4I3SL 1GC1L 4LEXL 4XPGH 1MWAB 4YC2C 5JOFA 3O41B 4R0LB 4RSVA 5DSCB 5C1MB 4I1NB 1OCWH 3BDYH 4MJ5B 1YQVH 4BH7A 4NZDA 1FFPB 2E7LA 5EBLA 4H20H 2EXWC 5D2LF 2P24B 2NX5A 3QDHA 4P5KB 3RGVC 4MQXD 2AEWA 5ENWA 5HGBB 3NA4A 1MY7A 2VRAA 4Z7QE 1JPSH 4HIJA 2VL5A 5IVXA 2OK0H 3FB7A 3CAFA 1FO0L 1G6RH 2AK4D 5TPWH 2V5TA 1T83A 4ZUWB 4F7PB 1CLCA 3CFJA 2NMSA 2X4SB 3MUGA 5DJ2B 3U9PH 4HUWA 3WFCL 1VACA 1JMZA 3PWUB 3Q5YA 4K3JL 1EUTA 3HE7D 1LDPL 4ZUTA 1XCQA 3TO4C 5HHXL 3RBSA 5E56A 4LGRB 3HE6B 3IAPA 2X9YA 5KSAD 4U1IB 3MV9D 5IB5B 1PKQA 2IANE 2QJDA 5C6WH 4Z0XA 1FZMA 2YZ8A 1MI5B 3U1SL 2CIKA 3SY0A 5LGJB 1U8PB 4JLRB 4ZDHB 2VISA 3QDJE 2VUYA 5B39B 4NFDA 1CDCA 3MREB 1AJ7H 1MCDA 1OGTA 3MCLL 4Y4FC 3QZWG 5F1NA 3CC5A 2D7TL 1V8HA 1LO2L 4Y19B 1QPXA 3MV01 4OCXH 4ZXBB 1U8HA 3O9WC 4PP1D 3AUVA 2YOCA 1JGLL 1W72H 4JPIA 4DQOH 3IFNL 5D5MF 5E6ID 4MJ2A 2BC4A 3F7YA 4LPCA 3MXVH 2HVJB 4OTXH 4PS4L 4ODUB 1KNOB 5EWIL 5HI5D 5ACMA 5FGBA 1GCFA 1YPZE 2VXUH 1NC2D 3B9KB 4L29B 5FKPB 4FZ8L 3Q1SH 3LKQA 2DQCH 1ZLVH 1KFAH 1J0IA 3BWAA 1SYSB 3ULSA 1KG0A 1AQDB 2D7NA 1OTTC 4L3EA 1N5AA 4MNQD 5FDWA 2WWMD 4X7TB 3EO9H 1QUNA 4LF3B 1S9YA 2ADGA 2I9TB 1OPGL 4JO1H 2YC1B 1M71B 2XA8H 3SDYH 4GW5A 2O5YH 4YR6B 5I73C 2VJXA 1KIUA 4X6FA 5EUOB 2HYMA 5J13B 3MLSL 1EBAA 4H0GA 2IBZX 3SE9H 1BLNA 4RFNB 3T1FA 4QF1B 4ODTH 4RFOH 4ZTOH 1NAML 1S7TB 3RVUC 4N8PA 4MHHI 4M93C 3BP7A 4QRSB 1SY6L 4JKMA 5CJOL 4PRPB 2DMBA 1TMCB 3THML 2LAGB 4P9ML 5FA4A 3F5WA 4MS8C 5F7DB 1T89C 4KUZL 3WN5A 1I1RA 1I8MA 1KJ3H 4AT6A 5C92A 3CFIC 2MOVA 4L8SA 2VLME 5DHYA 2HG5B 3G6JA 4KRMB 5D1ZB 4YH6A 3PDGA 2GW5A 2AV7B 1T80A 5IIEA 4HG4J 3V6ZA 2YRZA 3EAKA 4XPAH 1TENA 2FJHA 1BFOB 5TH2B 1T21A 3SE4A 2AVGA 3UPCA 4R8WL 1UA6H 1M7IB 2EH7H 3O4LA 1TVBB 2CK2A 2EH8H 1DLFL 3DLQR 2VXQL 3WS6C 1QKZH 1IC4L 1LQSR 2C3XA 3C8KA 1PZUB 3OJMB 2IPTH 4NJ9L 5INDB 1TPXB 1FL5A 4JRYA 4BH8A 4GXUM 2DM2A 1U3ZA 2OZ4L 3WLBB 1UWEL 5EU6B 2GSGA 5JPMA 5FYJE 4M7LH 4YX2L 3U46A 5F7HA 3MNVA 2LU7A 3W39B 5MI0C 3EOTH 4KKAC 8FABB 1MFBL 3GMLA 3MRKB 1R24A 3IETA 1MRFH 3BGMA 3S5LB 4ZYKB 3LN9A 4P2QA 1IC7H 1E4KC 4QWWC 2YMXL 3WUWG 1FV1A 5JPNA 2HVKA 2VAAA 1MCPH 5HPMB 1AHWB 1UJ3B 3T2NH 1MHPL 2DOCA 4LLWA 4WRLA 4NGHL 4MB4A 4JO3L 3HR5B 3S4SB 3TNMA 3L5WB 3HUJB 1N6QH 1KT2B 4ZTPH 4DVRH 1VGKA 3L9RA 2H26A 4WUUB 4F15B 1U3HD 2IMNA 1YEDA 3HCVA 1B0GB 3PV6A 5ITFA 1E28B 3QCTH 4AIOA 1LP9A 5L2JB 5IV2B 4BQ6A 3E8UH 2OP4H 1FLRH 2FB4L 5C0GB 4PJHB 2QV2A 2NPLX 5DR5H 4RWYL 1CFSB 1ZA3B 4QOKD 5DD5L 2AK4B 3GSVB 1RZ7L 5DRXB 3NCYS 4BKLB 3TA3A 2F8VA 5JMRA 4AEFA 2W0FB 3LOWA 4BZ2H 4HZLB 1VKXA 3BXNA 3MRCA 1BD2E 1IKFL 1LGVA 3OR7A 3BIAX 4GKZA 3HE7B 3KWWB 1IC5L 1ZT1B 5CS7A 5IMMA 1HKLH 1JWSA 5MERB 2IALB 3RTQA 2BOBA 2RCSH 5AYUL 4ZPTA 4FXGA 5KJRL 1OAYL 1BEYH 1NKOA 3ARTA 1E4WL 5IM7A 3GJFA 4JFHD 3P4MB 4Q9BA 3NIGE 1T2XA 3IDJB 4X99B 4L9LC 4KK8C 2APXA 4WY7H 1A9EB 4F7CA 3ULVL 2E5EA 5C2BH 2A77L 4X5XB 3TJHD 3ZDZE 3P9LB 1I8KB 2VZVA 1MAKA 4ZFZA 4N90E 5I71B 2XXMB 2E7CA 3G5VA 5F3HB 3D3VB 3KPNA 4F80A 4H1LA 1NAMA 4OAWB 3F7PC 3HR6A 1HSBB 1B0RB 1ZGLM 3H7BB 3ARBA 3FQUB 3EDKA 2CMRH 3RWCA 4EUPA 5E2TH 1GGBH 5GS1A 2V7NB 1MEXL 3UC0L 2E9WA 3ZDXE 4TRPH 4DW2L 3EOBA 4YDLC 4I3SH 2DM7A 2R56L 4QY8A 1NC2B 3RWGB 4MDIA 4JVPA 1ITBB 3DROB 4BM7A 3DI2B 1JJUA 4ELMB 5BVPH 1WITA 4TULL 5BOZG 1JF1B 1LEGB 1HXMB 3D0VA 2YD6A 3LKPA 4P2CG 5AUMB 2F19L 3RI5F 3IS0X 4LKCB 4ODXB 2EEDA 3IU3A 4M02A 3E6HA 2DLGA 1NBYB 4Z7OE 3LEVH 3PDOB 3WUZA 5JA9A 3KPMA 3B83A 1N4XL 2DWDB 3STBA 3C8HA 2HH0L 2MQ3A 4KVNL 3FOLB 4F3FB 3O6ML 3RZCB 4X6DA 3BZFA 4OKVA 1OGAA 1FFNB 2BP3A 2ZCKL 5HI3D 2IMMA 3BH9A 1N6VA 1D3CA 3VXMA 4HGKC 5T3ZE 3ORJA 3SGJC 1R5WA 2ZCHL 3QDME 1JWUB 4YE4L 4AIXA 2OZ4A 3WFCH 3MCG1 5EZJB 3U7YL 1RJLA 3CXDH 3IFLL 1CTOA 4U3CA 3VWKD 3DV6B 1CT8A 1F11B 2FD6L 4P99A 2KL6A 4NPYA 2X7LB 4MD5A 4D8PB 4WGVB 5HHXH 4HH9A 1IQDA 3GJEB 4CN6A 1JPGA 3ZT5A 3GEWB 3PXHA 4C58B 3SE8L 5TGBA 1KTDA 1S9KC 3EYOB 3MR9B 3U1SH 1IFHL 1IAOB 4UBDC 2BHZA 1G6VK 2XWTA 5C0DB 1FN4B 5I66A 1OP5H 3D48R 4GAGH 2BXYA 5D2LB 4PRHD 5LCVL 2A6DB 4KJYB 4JFYA 2D7TH 3DX9B 1LO2H 1CXEA 3U4AA 3RVTD 3QFJD 5IEKA 3UJJL 1JGLH 4IOIB 3V9FA 1NFKA 3IDYC 1KTLB 3IFNH 5CJ5A 2GJ6E 1GOGA 4XCEA 4M1DL 4PS4H 3KNBB 4X4ZA 5EWIH 3JV6A 4QKXB 5F9JB 1DUZA 4M8VA 3U9UA 2GSIA 3NFSL 5T3ZL 2YPVL 1PSKL 3RU8L 1DZBA 4FZ8H 4C83A 5C8JA 2XKSA 4U3HA 5IT2L 4KZEL 2ENYA 5JIHA 1JZ8A 1HHGA 3WNNA 4AZ8A 3S6CA 2VZTA 3Q5OA 5HJ3A 1QLFA 4PRIA 1LNUB 3GJFH 3M1BB 5GSVA 1OPGH 3O6FC 3L3HB 4MA1B 2AK1L 1R3JB 2BSTB 1JHTA 4J3WA 1QSED 2NY6C 5EULV 1BOGB 5H35B 3MLWL 3GSNA 4MJIE 5D9SB 3MJ7A 1U3HB 1F2QA 4CMMA 2JTDA 1CCZA 4H1LH 4EN3D 1NAMH 2X4OA 3HNVH 2ZJSL 3EW3B 3T2QA 4EUPH 2ZG3A 2VLRB 3OAYK 3RGVB 1P6FA 2XXCB 1FZJB 3THMH 4G8GD 3TIEA 4P9MH 5FECB 5C07D 4KUZH 3K1KC 1EZVX 4QOKB 5BXFB 4HUVA 3MBED 4WHYH 1T7WA 3IJYA 3LSOB 1ODAA 3DMMA 4GBXD 3MRQA 3ECBB 3MRPA 2VDKH 5D93C 2OYPA 5CEZL 3C6SB 3MRBB 1FNEB 4NWTL 5A16A 3KJ4B 1YEFH 3OF6A 3EFDL 1BF8A 4NUJB 5SWSD 4R8WH 4WFGD 1G0YR 3BEVB 4OB5H 1S7XA 5ICXB 4WI8A 3RRQA 1DLFH 4NQCD 2VXQH 4M4PA 3SDCC 2EXYD 2A9MH 1HQRB 1IC4H 3SKJL 1ETZB 4OZFB 1UB6B 1XFPA 4NJ9H 3P11L 3C5ZA 1NANH 1T4KB 1G7JB 3QNYB 3UTOA 2C1PB 4L8BB 3MTRA 3TGXA 4C56E 2QQQA 4M61B 3TT1H 4MAYC 2OZ4H 5KG9B 5JUEL 4Y4FB 4YQXL 1MFBH 3DYPA 3UBXB 2EKJA 1UQSB 1PEZA 4KQ3L 5FFLA 3WIFA 3ZYIA 5LG1A 4S0TD 2UYLA 5IB3B 3FMGH 3VFMB 4K94C 4DKDC 4JN1L 2YMXH 3MGTA 2G5RA 1RHFA 3KAAA 4TUJB 1MHPH 4KAQL 4CDHA 3S3JA 4EI5D 4NRZB 5E8DL 4NGHH 4J3OC 5FYKD 1WBZB 4HSQA 4PD4K 1LO4L 3W9DB 2BSRB 5I1JL 3GSUB 3KS0H 4APQA 2C3HA 3FZUC 4Q6IA 4X7EC 2Z8SA 4RRPA 4K7PX 2YPKB 4OGAC 3QH3B 3OWEA 4JQVA 3PQYE 3MRMA 3LKSA 5FV2A 1U92B 3TFKD 1ZHLA 1KPUA 3VWJD 2FB4H 4DUVA 1CFNA 5HYJD 4NHUA 1NLDL 1AKJD 4RWYH 1H0DA 2IH3B 3ARGD 3BEWB 5DD5H 5HDOA 1WUNT 3U36B 1RZ7H 3MLXL 1ZVSB 4M93B 4N5ED 5C0IA 1YC8A 3LY6A 4RAUB 4RGNE 1CF8L 1MRDL 4HFWB 2DBJA 1IKFH 3VWKB 3PWPE 1FZKA 4BSWA 4LNRB 5C0BD 1Z9MA 4OM0L 1IC5H 3UTSD 1FG9C 2NXZD 1F13A 3RIAF 3T77B 2DL9A 2C4FU 1KJ2L 1PX3A 5J12C 4YZFF 3HNSL 4M8QB 5AYUH 3ARFD 5KJRH 1OAYH 3NGBC 3I84A 3GSNH 1A22B 1E4WH 1KTKE 1LVEA 4XZUB 2NR6D 4CVUA 1EZVY 2ITCB 1ZHNB 4FQCH 4Y16D 5C3TA 3ULVH 2FGWL 2A77H 1AGEB 3CX2A 4QCIA 2E7LC 5A2IH 2F58L 4RAVA 2B5IC 4K8RD 5DJ6A 1HHKB 1QQDA 3QFJB 3QULB 4GXVH 1JZ7A 4DAGL 1F8TL 1D5XA 4CU6A 3ARDD 3OHXA 1ZT4B 4XC1L 1HH6B 3WE6A 1MEXH 5TDPA 2OTUB 3UC0H 4KKLC 4DW2H 2WIIA 5AAWA 2PW2A 2R56H 2FL5B 1G1CA 1T83C 5EO9B 4EBQL 4W4NA 3I9GH 2X05A 1NCDL 1KF9B 4N0UB 3RKDD 4TULH 2HMID 1EFXB 3OXRA 2F19H 5I16A 1GZQB 3BP4B 3PABB 4NHCL 1XF3B 1CGXA 4HIIB 2X1WL 4CGTA 3ZDYE 1N4XH 3NFNA 1IVLA 5DK2B 5HVHB 1Z0MA 5ID0B 2YXFA 2HH0H 1NGQL 1QSEB 1EA9C 5CBAB 4KVNH 4IOSD 1TZIB 4F57L 3O6MH 2X4PB 4TSAL 2ZCKH 3MV7D 1UWXK 1UKSA 4HK0A 3VXSB 3PIQA 5EUKB 4TYUA 1FNSL 1S7VB 1INQB 2ZCHH 1SYVB 4POYA 4PGCA 4GAYA 1RHHA 4MJIA 4XTRD 5T3XD 3U7YH 3IFLH 4G8GB 2NYYD 1DN2A 1RZKH 5E9DE 5C07B 2FD6H 4NRXB 3T0WA 1T03L 4I0PA 3U79A 4G42A 4R3SA 1H5BA 2MMXA 2JIXD 2EDBA 1BVKA 5IVXF 3UTPD 4HHAB 1QEWB 5ISZE 3MA7B 3SE8H 3B9VA 1B3JA 2J3SA 4P2RA 1R5VA 1D5BA 3SKOA 2CLVA 2H2SD 2ZUSA 1IFHH 1RZGB 2YA2A 4Z7VA 5IFHH 4QHKJ 5SWSB 3VXPB 5HD8D 3SGKA 5HI4D 2HFGL 1UM4L 1SJHA 5SX5K 1ACYL 2FO4B 2DN7A 5DZOA 4R2GD 4PUBL 2VLLB 4W81A 3UJJH 4XGZB 1UC6A 1ZS8A 4BFEA 4CNIA 5IEHA 3P3YA 1S7SB 3IXAA 2FHCA 1OD7A 1P9MC 1XGTB 1CVRA 1MCJA 2DD8L 3QRGL 5T3ZH 2YPVH 1PSKH 1V3KA 1OTSC 4NKIH 1JN6B 3DO3A 4C56A 4EJ1C 5IT2H 2VITA 4YUEL 4LP5A 2R0ZL 4X80L 5EU4B 3STLA 3CSPA 3WKML 3WN5C 3Q6FB 2LTQC 4YDLB 1ERNA 3FQWB 4L8SC 5T1KA 1X4YA 2OR9L 2HKHL 3H3BC 3KPLB 4EI5B 2BVPB 1NUFA 1FL3A 2AK1H 2P49B 1KJ2A 4OCMC 3DX7A 3VFSA 1XF2A 1L9MA 1KLUB 3MLWH 3MO1B 3MC0A 2ZJSH 4KK9D 3BE1L 5DDHA 3V6BR 3AXLB 3FRPA 4FFVD 4DK6A 4TTDC 3C09C 1MH5B 3V6FA 4NNYB 1NGWB 3VWJB 4F7EA 2CRZA 5JO5A 3RIFK 4G7VL 4J6RL 1K4CB 4JVWA 4P0DA 4UT9H 4X6EB 3ARGB 3H0TB 3V5KA 4ZO6A 4S1QL 3QO1B 4AENA 4Y4HC 3UO1L 2AXHA 5KOVC 1BZ7A 4GJTB 3DO7A 1VA9A 1P84K 1DFBH 2Y07L 3V4UL 1XF1A 5CEZH 1FJ1B 3DWTA 3GI8L 3L3OB 1P7KA 4NWTH 2N56A 3GMMA 2HTLC 5C0BB 3EFDH 5F7WC 1I8LA 3IF1B 2ATKB 2R9HD 1G7MB 4LRIC 4I8DA 3G6JF 1WWAX 3RWHA 3ARFB 1ZVHA 1JZ4A 2VNCA 3SKJH 1CXIA 3P11H 4X98B 3BYTA 1AGFA 4Y16B 4O5LL 2DJ4A 1H3UA 4K3EL 3G9VA 4PG9A 2BSSA 4OI9A 2W92A 3EFFA 4XX1E 3KYOB 3VFGL 1NBVL 2XN9D 4OZ4A 2F54D 3PGDB 4YQXH 4KMLB 4KQ3H 3QNZA 4W6WB 3IDYB 3ARDB 4JZJA 4KROC 4FABL 4JN1H 1MCCA 3RHWF 5I8EA 2UZIL 2O5XL 5DMKB 4G9FD 3DUSA 2IBGA 3NIFF 4KAQH 2A6IA 3BMWA 1UYWL 3KXFE 1MSPA 1Z5LB 5E8DH 3B9EA 4XPTH 3KYKL 2Q76A 5GJTH 3B9AA 5F7YC 4QRRD 4U6TA 4NQDA 5I1DA 2YWYA 1LO4H 5I1JH 3N9GL 1RZ8B 1WWWX 4JM2A 3NOIA 2XZAL 3LPFA 5DJZA 3RTQC 4XNXL 2CLRA 5TQ2L 4FS0A 4P48A 1F4HA 2MHAB 3HAEB 4IDJL 1YY8A 5BRZA 4DGIL 3I85A 3U48A 2NXYC 4JRXE 4NNXB 5JOPD 3DRTA 3ZYOA 3QI9A 4P4KD 1NLDH 3K74B 4GW4B 4OBRA 4BSVB 5CJXA 1B2WL 4CUCA 3KDMB 5EOCJ 3MLXH 2I9LA 4YAQB 5HHPA 4UIMB 2ARJA 4JHAL 4B53A 2EYTB 3WSQL 1W0VB 4OT1L 1KACB 4A6YL 3B5TA 2YPLD 1RK0B 1EXUA 2I60L 3K0WA 5IESL 4IRZL 1B88A 4WJ5A 3VXUB 5I0ZA 1FIGL 4OM0H 1DBBH 5EOQL 1UVQB 1EVTC 2JIXB 5DS8A 3AB0B 5FHAL 4MCYA 2EC9U 4FQQA 2DBLL 1KJ2H 1MNUL 3VFRB 2JE8A 4LHUG 2J6EL 1DUYB 3FO9A 2JB6A 5D93B 3HNSH 5E9DA 4OUUA 2Z91A 3OKNB 3HI5H 1T22A 5ACLA 3BN9D 4Z7QF 1HOCB 1XF5B 5DQ9A 3WXWL 2FH6A 1VFUA 2FGWH 2ICWJ 2BDNL 3P2TA 4JM4L 4NN6C 3A6CL 3L3DB 2F58H 3SDCB 4R2GB 1R3IH 5E2VL 5HHNA 2Z8VC 4U0QB 4DAGH 5CEXA 1F8TH 1X7QB 2DDQL 4XC1H 1II4E 3K8MA 4MAYB 3C60A 5FCSH 4RMUA 4U6YB 4BK4A 2BVYA 1RJCA 4I48A 3B9DA 4I2XA 3W11D 3NZ8A 3SDDA 3UYOD 5GPRA 2A38A 4EBQH 4EDWL 1NCDH 3TCXA 3UPRB 2PCPA 4MA7L 3RWJA 5JIPA 2Z4QB 4F9LA 4YDVA 1WT5A 3HG1B 2NQCA 4JO2L 5I15L 3QYCA 5IROA 2FLBT 3TO2B 5F1KC 4HWNA 1A6VL 1IGTA 2CKBB 1UG9A 3FB5B 5DFTA 2QKIA 2R2BA 4FTVD 4UDTB 3HB3D 1NGQH 4P9HL 3VG9B 1UCTA 4F57H 4YIQA 1JPFB 3KPRD 4RNRB 4TSAH 2ENSA 3WHXA 1T1XA 4G7YL 1YPZF 3REVA 5F6IC 2H32B 3KJ6L 5DJ8B 3NVQA 1FPTH 1FNSH 4FHBD 1SJXA 3TJEL 1JRHL 5LJYH 5IP4A 1NFDA 1JV5B 1I8IA 1BVLA 2OTWA 5IKCB 1BIHA 5E1AB 2VQUA 4E5XA 4GG8A 2FJGA 1IL1A 4FXLA 4X9GA 2VZOA 1T03H 3QEQD 2YD8A 3T09A 1C5CL 4JREC 2K9UA 3IT8D 3I02B 1OAXH 5GRJL 5ALBL 1H3PL 2VZUA 1CDGA 1XIWD 2OJEA 1IILE 2QADD 5IBLD 1FE8L 3VFUB 1XF4A 1FZOA 1PW3A 5FGRA 4MDJB 3P0VL 4MWFB 2I26N 2YKLL 4UV4L 3TCLA 1NGPL 2AXGB 2HFGH 4WHTB 1UM4H 4L1DA 3RA7L 5HYQB 4N8VG 1ACYH 4JFEE 4FQIL 1CXLA 3L3JB 5CIPA 3B5HA 5HHOD 4PUBH 1EEYA 4YXKL 5JZ7D 4LARL 4DUWA 4WCYL 4RX4D 2B20A 4UQ2B 3T0EE 2X9WA 4QTIL 4QXWA 4HT1L 2AXJA 1MJ7L 1MCHA 4LVOC 2ZPKL 2XN9B 4Y5VA 2DD8H 5DRZA 3QRGH 4ZUUB 2V6HA 1QHPA 4PJFA 5JXEA 2N1KA 2WWKO 1FVDA 2AJXL 3O81A 4YUEH 1DANU 5D1XD 4U33A 2R0ZH 3TH2T 1N5YL 5CZXD 3WKMH 4PLOB 1I3RB 1UZ8A 1CE1L 3WXVL 5TFSL 2BY0A 4DOHB 4K3HA 2HKHH 4G9FB 2W9EL 4KRLB 5GGQL 5HHMB 4MXQC 3DMMC 3L3GB 5E4IA 1DQJA 4OLZL 3FRUB 3LVEA 2WLYA 4KDTC 2J6EA 5D7LB 5E8NB 4LL9A 4URTB 1PX4A 3KXFA 2XYCA 5F1SA 3RVVD 1I7TB 1QFOA 4X4XB 2AI0L 3BE1H 3W82A 4Y89A 1I75A 5CD5C 1VGEL 3CZJA 3CVHB 2RFXA 4YFLF 3FN9A 43CAA 4FXKA 1J8HD 2XKNB 2DAVA 4YNYB 4G7VH 4P4KB 3O8XA 3BUYA 3EJYC 5BCAA 5FUOL 4S1QH 3UX9B 4Z8FL 3QNXA 2IAND 1JF5A 3SDAA 1AGDB 5IQ9A 1OGTB 2Y07H 3UAJC 3U2SA 4Q9RL 1MF2L 3GI8H 3TNNA 5GXBB 1BGXL 3ILPA 2XFXB 3IDUA 1P1ZB 4QTHB 5DJ0A 1WZMA 2DQFB 2F53E 3ALPA 2AW2A 3S35X 3QDJD 1U91A 1ZLWH 3EYQC 4FA8A 4FN0A 3OKMA 3L1OL 3WL9B 2CDGA 4JJ5A 5ACZA 1LO5B 3QWRD 1RZKC 4FG6C 5FOJA 4D0CA 4X8XA 5JDSA 4LSPL 3BZ4A 5GS2D 3BKML 4K7FA 5ID1B 1YDPB 3W0WE 4U1KA 5J06A 3BWAB 1PGRB 1KG0B 1T7ZA 1NJ9A 4L3EB 4O5LH 2GAZA 2ZG2A 4K3EH 1RZJC 1P4IH 4Q6IC 4KKCC 5B4MC 3FQRA 3EOYG 5EU3A 3VFGH 1NBVH 2EDLA 2W65B 1JWMA 4ZMAT 3BKCL 3GMPA 5F7KC 1I4FB 4GT7A 2VXSL 5ADOL 4JZOB 4HG4K 4PJXA 2APFA 1MPAL 4WU7B 4JANB 4P5MA 2A0LC 2NY0C 4FABH 1TCRA 3BQUD 2BVQB 1LE9A 2UZIH 1MJUL 2J88H 3GSXB 4D2NA 2K1MA 5L8JB 3SKMB 2AQ3A 4WFEE 4ODHL 2D4FA 3CUPA 1MFEL 5GGSA 1UYWH 5ETUB 4PV8B 3LS4L 5E08L 3VJ6B 3NIGF 2H9GA 3KYKH 3LV3B 1ES0B 1QSFD 3EO1B 3N9GH 3ZDZF 1D9KD 2A1WL 3BPLC 4L8SB 1AIFA 3K4DA 4LLDB 2XZAH 3G6JB 1A3LH 4LPUA 3G04B 4OGXL 4KJPD 4XNXH 5CD3A 4IOFD 4FTVB 4IDJH 1OB1B 3A6OA 1L0QA 2V9TA 4DGIH 1CI5A 4L4VE 2X42A 3KLHD 4GKSA 1QA9B 4HK3N 3ZDXF 1A9BA 3KPRB 2RB8A 2IAMA 4JZNB 4O2EA 4LDOB 2XPGA 1CE6A 4IMLA 5EO0B 2AJ3B 1JGDA 3QA3A 3D25A 4YHIA 4JHAH 2Y72A 3V7AG 3WSQH 4Q9CA 3NTCL 1W2KT 4PY7A 4OT1H 4QRPD 4A6YH 5D1QA 2Z8WC 2I60H 4RGOL 3T2PA 3K4AA 2AJZA 4IRZH 1YN6B 1UH2A 1ND0A 4QXTA 4ZAKA 1FIGH 3O2VL 2P8MB 3DYOA 3OAZK 2IPKB 4EOWL 5EOQH 3QEQB 4Z7OF 5A43C 4H0HB 4ZSOE 1K2DB 4ZG1A 3S9DB 2OLDA 5FHAH 1JUFA 4Y4HB 1W0WB 2X4UA 4ZS7L 2XTJE 5EORL 1K6QL 1MNUH 1EHLL 2VIRB 4YJZL 2J6EH 1T5XA 2BERA 3N1GC 1P7QD 3VRJA 3EYUL 4UNTA 5IMOB 2VMFA 1XIWB 2W9LA 1K8DB 2QADB 3M17B 2VN7A 1BJ1H 4B7IA 4P46D 3R4DA 3WXWH 1S7UA 3KPQA 2BDNH 4UT7L 1A3RL 4PJGB 2HVKB 1BQHG 1IEHA 5EU5A 5F3BB 4XNUH 1AGBB 5E2VH 5M7QA 4DZ8A 5HHOB 1L0YA 3NPZB 2FHFA 3L7EA 4ERSL 4CW1B 4X83A 1CG9B 4NZRH 2DDQH 5BZDA 4JFEA 1BX2A 4LSUL 3WFDL 1LHZA 3QXDB 3GUTB 3Q3GA 4NO2A 4FRWA 1HQ4B 3NH7L 1U8IA 5ILTL 4KK5C 3KYNA 1NEZB 4EDWH 3RWIB 4OGZA 1E4JA 3DV4B 3OKOB 3T0EA 4MA7H 5D1XB 5IF0A 4KROB 4PJ7E 2HLAA 1XZ0A 2UUDH 5B8CA 4F2MA 4JO2H 1IM3A 5GISL 1QP1A 5I15H 1H5BC 2ZOLB 2EIZA 3LDBC 4D3CH 1A6VH 1SEQL 2XICA 1A1MA 1XGPB 2JJVA 3B6SA 1FBIL 2HKFL 4P9HH 3G5XA 3DGGA 2Q6WA 1DQML 1XGUA 4GKZB 2GT9A 4GMTH 3JWNC 5C0CD 4G7YH 1LEIB 3SGKC 5E7FA 3PWVA 3G08A 3KJ6H 3ZSTA 4EKXA 3Q48A 2ZOKA 4JG1L 3VFVB 4ACPA 2I07B 1BD2D 3TJEH 2EDXA 2VXVL 2N7AA 3QUXC 1CN4A 1G7HB 1I1AD 3QUYA 2NXYB 1J8HB 5AG9A 3ZKXB 1A6AB 1NUDA 4QRQA 1JNNL 2Q87A 3I75B 1MVFA 1C5CH 2V9RA 4FFYH 2HFEB 1CGSL 3IKCA 4WWKD 5K9KB 2IANB 3PGFL 3RP1A 3VFOA 3QIUA 5GRJH 2W91A 4H26A 4XCNB 5ALBH 1H3PH 5ESVB 2RJMA 1RU9L 1CZ8L 3GHEL 2WBWB 3G9AB 1FE8H 3O3AA 3V4VL 4DFHA 3QDJB 1NCBL 4ZOCA 5F1IB 1B6UA 3P0VH 1WZKA 1FORL 4JO4L 5KSUB 4HLJA 2YKLH 4UV4H 2F5BL 3PP3H 1U3JA 3RA7H 4QXGL 3U30C 5BV7B 4FQIH 2F53A 5C71A 1JRHI 4MAUH 1MWAL 5AWNL 1S7WA 3FB8B 5F72S 5MEQB 1UJTA 1YECL 4PB9L 4YXKH 1MCFA 3OAUL 5CMAA 4ZPVA 1YNLH 4LARH 5CJQH 2NNAA 2NY2C 4WCYH 1YPZB 5IB1A 4DKAA 4QTIH 4HT1H 4KKCD 3E6HB 4HS8L 4NN6B 1M7DB 2ZPKH 5E94A 2NZ9C 1JPST 3VGDA 2Y5EA 4PREB 4YGVA 5C0AE 4ZFFA 1FNGB 2AJXH 4NKMB 4N0YL 1OD9A 2CK0H 1N5YH 3VDCA 2E8YA 3BQUB 3ILQD 3CX5J 1AO7E 1CE1H 3WXVH 4CVXB 5TFSH 3OGCA 4JEGB 2BNQD 5HGAB 2W9EH 5GGQH 4X5WB 5EB9A 4LCWD 1FL6A 3OKKB 4QYOB 4JFXA 5LGKA 3HZKA 4MJ6A 4NCC1 2KUTA 1QSFB 2VZ3A 2VKWA 2HP4A 5BS0E 3JTTB 4GG6B 4P2OA 1D9KB 1I8LC 5I30L 4ONOA 3BVNA 3BT2L 3MNWB 4LCCA 4RGNC 5JR1L 1NGYB 5EUOE 1VGEH 3P9MA 4OV5A 4HAGA 2O61A 5CUSL 1SHMA 3P4NA 3QIWA 1IZJA 4RZCA 1KGCD 2XIDA 5FUOH 5F6IB 4Z8FH 3BP6B 1DDHA 4MQ7A 3IB4A 5C08A 3S96A 1RUML 4NO3B 1MF2H 1U8LB 1BGXH 5FO9B 3VGAB 5BVJB 1YN7A 1AXSB 1F3JB 3MRFB 1EEZB 1BQUA 1JZ3A 4Q9QL 1NL0L 5EN2A 4JREB 3L1OH 3MLTB 5ADPL 2XA3A 1FVCA 3ZE2E 3GB7A 1KC5L 5B38G 2A6JB 5J8OA 4LSPH 3BKMH 1YMHA 4DGYL 3OTTA 2DQIL 4FQXC 5ICYB 4ZSOA 1WSST 5C6PB 4P46B 3IDXH 2G9HA 5IR1A 4ETYA 2VQ1A 4JN2B 2NW2A 5J7CC 4JFDD 3AAZB 1NGZA 1N3NA 1EO8L 2FHBA 2NY1C 5DVLA 3VDAA 3BKCH 5ERWB 3SGDI 2VXSH 3HC0B 5ADOH 3BMVA 1XH3B 5GIRA 1MPAH 4YHYC 2P5ED 5C0NC 4IRJA 4OCRL 4LSSL 5J6HB 4QHLA 5EU6E 1S3KL 4HIEA 4KKBD 2FECL 1MJUH 5DUMH 1DQQB 5CJXC 5DEFA 3OX8B 4V1DD 1MFEH 2EE3A 1KIQB 3LS4H 5E08H 3BJ91 4F9PA 1O5DT 5DK0A 4XCYA 2BRRL 4UTAH 5LAXA 2LU3A 3MV8A 3QDAA 1Q94A 3HLAB 1MRCL 1I1FB 1K4DA 3IXTA 5DJCB 3H6JA 1KCRH 1U8NA 3OB0K 4JQIL 4OGXH 2Y5TB 5EBGA 2D0HA 3UP1A 3QB7C 4DEPB 5A16B 2ARJQ 3GMNB 4HS6B 2J5LC 2EDRA 1MWAA 4OQTL 3O41A 4R0LA 4YBQC 5C0EA 4LLYA 4HWBL 5DSCA 4QRTB 4NN7C 3W2DL 4MA8L 3O4OC 1BD2B 4MJ5A 4ONGL 5DC4B 4UNUA 5I17B 3NTCH 3MGOB 4PTTA 1PBYA 1FFPA 3QUXD 1JGVL 1I1AB 1MCSA 3MJ9L 4RGOH 2AJSL 2P24A 3O2VH 1A0QL 4EOWH 4P5KA 3MZTA 4R4ND 4WWKB 5DXWA 3C60C 5HGBA 5EORH 5DVMA 1K6QH 2YHGA 1EHLH 1S7QB 5ALCL 3F6LA 3SDDC 1DVFC 1T2QL 1JP5A 3N50A 3BFOA 1OAQL 4PPTA 1U8QB 4ZUWA 4F7PA 2OQJB 3CD4A 2X4SA 1JNHB 3GNML 5D8JH 5DJ2A 4YPJA 4D9QD 1WT5C 3MV9E 4HQQL 3PWUA 1A3RH 4UT7H 5IROC 3MUY1 3ZMRA 1J18A 1FYTE 3P4LA 2F9BT 1INEH 4ZS6C 2R15A 1BMGA 3HE6A 5K9QG 1OSPL 5DT1L 3GIZL 1R5IB 3STZB 4ERSH 4PTUB 4U1IA 1OAUL 1FVEB 2R2HB 4LQFL 5IB5A 1YNKL 1N2RB 4LSUH 4AM0B 3WFDH 1X5KA 3BW9B 1J0ZA 3BWUC 3SCMD 1MI5A 1QSZA 2FNBA 1MY5A 5LGJA 1U8PA 4JLRA 4BFGA 3NH7H 4ZQKB 4ZDHA 2QEJA 3LKSB 3BHBB 5ILTH 5EDXA 4JPWL 1FLTX 3S36L 5B39A 4JGUA 3MREA 1DSFL 2P5WD 3MFFB 3MMEB 3UDWA 2NY0B 4ZODA 2X1OA 4Y19A 1UENA 4ZXBA 3PQYD 5GISH 4LCUB 3WFHB 1SEQH 3DVGB 4D0DB 2G2RB 4LASL 4NKDA 2HVJA 1OM3H 3OR6B 1N7ML 2HKFH 4M00A 4ODUA 1KNOA 1ZK9A 5TF0A 1IM9D 1LO3L 4MNQE 4OFYA 5EC2B 1LK3L 3B9KA 4L29A 2SEBB 1DQMH 5FKPA 4PYHA 3BPLB 4KJWC 3QDMB 2L7JA 1SYSA 4LHQB 1W8OA 1AQDA 1E4XL 4PRDB 4XBGB 5FM5M 2VB5A 1T6VN 2P45B 1C16B 1G84A 3I3BA 3OL2A 1R3KB 3PWPD 3QQNA 5TQ0L 4X7TA 2VXVH 4PJDE 4LF3A 5E4EB 1LK2B 4J4PD 2I9TA 2MTPA 1U41A 2YC1A 1JGEB 12E8H 3LRHA 3AS1A 5DJAA 4L8DB 4M1CD 4TNVK 1JNNH 4YR6A 3G5YB 4XPBL 5EUOA 1CGSH 3U7AA 3PGFH 1X5HA 4TNWF 2CQVA 1CD0A 4Y5VC 2OMNA 4QF1A 1RU9H 1CZ8H 3O2WL 4YFDB 5JXEC 1JK8B 1S7TA 3D2UB 1U95B 3QUMB 3NAAL 1CQKA 2P43B 4QRSA 4X7SL 5L8KB 1NCBH 2D0GA 3QT2A 5T5FL 1FORH 4JO4H 2VWEE 3PUCA 4M6ML 4PRPA 4N1EA 5TDPB 5C09E 4PGJA 2F5BH 3CFBB 4QXGH 5H2BB 5F7DA 3PJSB 5J11C 4LLMB 1AGCB 5KN5B 1MWAH 5AWNH 3PWLB 32C2B 2HG5A 3BI9X 3CSYB 5CSGA 5D1ZA 3DX8B 2GJ6B 3PE9A 2AV7A 4PB9H 4WI4A 1LD9B 3OAUH 1INDL 1HCVA 4OLUL 1GRWA 1WZLA 3F12B 4JFDB 1BFOA 1ZMYA 5TH2A 1CGTA 4HS8H 5JQ6L 4RISL 3V4PL 2GUOB 4OQTA 3S97C 2GEEA 4HWBA 4Y5YB 1M7IA 2ZP0T 3GSRB 1TVBA 2Q86B 2P5EB 3QQ9C 4BJLA 4X9HA 4XWOC 2XNAB 4OCNC 4X7CC 5IJKA 3O8XC 2EDNA 3IDNB 1RZFL 4XP9L 3MJ9A 1LEKB 4QGTA 3FOMB 2FR4A 3D5OF 3DETC 3N1QC 4NN5C 5INDA 3SDAC 3ROLB 3JUYA 4O02L 4GAYB 5E6YA 3WLBA 5EU6A 2WW8A 3WDIA 1CR9L 3W39A 2UY7A 8FABA 4JCMA 3FL7A 3MRKA 4XVUC 1MCKA 1U8KB 5IVZB 5I30H 3S5LA 4ZYKA 4R26L 3BT2H 5JR1H 1BVKB 2XZCL 4IMKA 1UM6L 4D9LL 3KGRA 4Q7DA 5HPMA 1AHWA 4Y2DD 4JGJA 2HT3D 5CUSH 1OQOA 2NY5L 4DUXA 3L95B 1MHCB 3HR5A 3S4SA 4PJ9D 3OKLB 1X3DA 3L5WA 4ELKB 1N64L 3HUJA 3KHOA 1BP3B 4DJMA 3GM8A 3O11B 4POZD 1K9TA 3GBMH 2DYPB 1QRND 4IM8A 1CFVL 3QUXB 1B0GA 2W0KA 2B7DT 1WLHA 4JAMA 3X11B 4F58L 2CJUL 4QOKE 3TBWB 4Q9QH 1NL0H 5L2JA 1NSNL 1JYWA 5EU7E 3IRPX 5IV2A 5C0GA 4PJHA 1KC5H 3KS0J 4HIHB 2WV3A 5FCUL 4G6ML 3D85D 1ZA3A 3JV4B 4P23D 4DGYH 3ULUD 2AK4A 2DQIH 3GSVA 4CDGC 5J1AB 5DRXA 5EIQA 4C56B 1T3FB 1NCWL 3QXAB 4BKLA 2R1WB 4ORGB 2W0FA 5CZVL 1WISA 4HZLA 1V3MA 2X4NB 5FYKU 3U30B 1EO8H 4NC2B 3HE7A 3KWWA 4JFHE 4LSRH 1ZT1A 2ZUQC 2IPUG 1MIEL 3RVXC 5MERA 2IALA 3S3PA 2X4RB 4M48L 5IW1B 1HSAB 1QR1B 5DWUH 4OCRH 1F42A 4LSSH 1QBML 5I1KL 3FFDB 1S3KH 5L6YL 1FDLH 3P4MA 4S1DC 3IDJA 4X99A 1CD1B 2WM0A 4M7JL 1A9EA 4X5XA 4JCLA 3P9LA 1I8KA 4NFBA 2BRRH 1CDHA 2P5WB 5F3HA 1ZVYA 5D1QC 5JO5B 3D3VA 4A2MA 1S9VB 2HJLB 3T1WA 1WQVT 1MRCH 3PQYB 4OAWA 1KB5L 1HSBA 1B0RA 3H7BA 2ZUXA 3FQUA 4XP4L 5IMKB 4Q6YA 5DQDL 3NPSC 4JQIH 2V7NA 5LWYL 4RBPK 3JUZA 2YBRB 3VH8B 1IM9B 2F74B 1NC2A 4P57B 3MODL 2AJVL 3RWGA 3VGBA 1GVIA 3DROA 4OQTH 4M7KL 4Y8AA 4HWBH 3L7FA 4ELMA 1GIGL 5LKNA 4DKEL 1PFCA 1JF1A 4RGNB 1LEGA 1HXMA 3W2DH 4MA8H 5AUMA 3PWPB 4LKCA 4ODXA 1WCQA 4D9RE 1ORSB 1NBYA 1JGVH 3DVNB 3PDOA 3MJ9H 1A7RL 1HKFA 1KN2L 2AJSH 1ZSDB 2DWDA 2N7BA 1AGFB 1A0QH 4PYGA 5KBNC 4KDVA 3EFFB 2EKSA 3FOLA 3RZCA 5ALCH 3DARA 1FFNA 3K3QA 1SBSL 1T2QH 1KYOK 2G75B 1CDJA 3LIZL 4HUUB 2MSPA 1OAQH 3UYPA 2DLFL 3T0EC 1JWUA 1BZQK 3GNMH 5B8CC 2Q7YB 5EZJA 4GAFB 3W5MA 4HQQH 1HNGA 2YD3A 5KZCD 3DV6A 1J1OL 1F11A 2CDEB 2BNUB 2YD7A 1PY4A 2X7LA 2M2DA 4OCWL 4D8PA 3MOBL 4WO4D 5EIIB 5MEPB 2DQDL 1IAIL 4FQXB 1OSPH 3GJEA 5DT1H 3GIZH 3TV3L 2ADIB 3D18B 4LKXB 4V2BA 1WK0A 5FK9B 2O5ZH 4LQFH 3QUZC 1YNKH 2OX5A 3V2AR 4BFBD 3AMKA 2JJUA 4PRHE 3EYOA 3MR9A 5GGTA 1MLBB 1IAOA 2ESVD 5C0DA 1FN4A 3QFJE 1AI1L 1HHJB 4M6NL 3S36H 5FHBH 5CCKL 1JYVA 1UXWB 1DSFH 3QUYC 2FEDD 4HUXA 4XNYL 2NTSP 2A6DA 3GSOB 4KJYA 3DX9A 4NQSB 3ZKNC 2R4SL 4IOIA 1P4BL 1KTLA 3BRFA 3T8XB 1SMAA 1T66D 3TT3L 4N0UE 5JNYB 5E00B 3PL6D 1N0XL 4FQ2L 1N7MH 3H9SD 3KNBA 5F9JA 1LO3H 2ZNXA 1LK3H 1JHKL 3WNMA 3NBNA 2F8XC 4YGAB 4NKQB 3CLFL 4WW1B 1E4XH 5GRWA 4JHBA 4YLQT 2VH5L 3WFZA 3FO9B 1LNUA 3KPPB 3M1BA 4Y2DB 2C3VB 3S98A 3QPQD 4HW6A 5GRUL 4QGYA 4YDIH 2LE9A 3L3HA 3RL2B 1R3JA 4PJ9B 2BSTA 5ISZB 4WU5B 1CGVA 4XPBH 1BOGA 3Q2CA 3VD4A 5H35A 4KI5D 4HLZG 5D9SA 4MVBC 2P8LB 1U3HA 3KYAA 5CJ8A 1QRNB 3QSKB 5C07E 3O2WH 2OL3B 3NAAH 5GRVK 2WANA 4PJIB 4X7SH 1KB9J 2DTML 3H9HB 2VLRA 2EDWA 2QBWA 5T5FH 1PD6A 3RGVA 1REIA 2V5YA 4M6MH 3SDXE 1FZJA 2ADFL 4CRPA 1E4XI 3UJTL 5FECA 3EDEA 5IQ7L 4JY4B 4KUCD 2Y1VA 5IVNA 5SV4A 1DVFB 3D85B 1JNLL 4QOKA 1PKOA 2OJZH 5BXFA 2WAHA 5E8PB 5I1IL 1HWGB 3LSOA 3MYJB 5SWSE 4WFGE 1INDH 4OLUH 1YUHB 5FUZL 4QHNB 3X17A 3MRBA 4O51B 3OG6B 4P2OC 5JW4N 1WFNA 1FNEA 1T0NB 1FP5A 4NQCE 5HHQB 1TQBC 2MCG1 4OLVL 1XCTB 5JQ6H 4RISH 3TYGL 4CJ1A 4LCCC 3V4PH 1T1YB 4NUJA 5HY9B 3BSZH 5EPMB 2MKWA 3BEVA 3ESUF 5ICXA 2DIJA 4D94A 5B22A 3SQOL 2KPNA 1C7SA 3BUTA 4BELD 1HQRA 2NY4D 4U1LB 5C2UB 1C5DB 3QIWC 4HULB 43C9B 4LQ1A 1ETZA 4OZFA 1RZFH 1UB6A 1VFMA 2YR3A 3GHBL 1T4KA 1G7JA 3QNYA 2C1PA 2CDFB 4L8BA 1E27B 4M61A 1KXVC 4O02H 1CWVA 1I8IB 5KG9A 3GI9L 4CMHB 1CR9H 1PG7L 2E6JA 3SN6N 5IB2B 3P0GB 3UBXA 1X6NA 1HYSD 1UQSA 3AU1B 5IB3A 4XP5L 4R26H 3VFMA 2XZCH 5C6TL 1UM6H 5FYKE 4D9LH 2HT2C 5D7KE 3BD4A 4TUJA 2HT4D 5GGTH 2NY5H 4NRZA 3VFNB 2D7PA 2XTJC 1TQCB 1WBZA 1NMAH 2P48B 2QTEA 1N64H 3GM0A 4EXPX 3W9DA 2BSRA 5CIPB 1CFVH 5HYJE 2YPKA 3QH3A 1G7LB 5F96L 3MLPA 3RKPA 4F58H 2CJUH 4DWHA 3EIFA 3W5NA 4U0RB 2WINB 3K46A 4IRJC 1NSNH 2Y23A 3TA3D 1KEGL 1MCWW 4TVPL 1UFUA 2HWZL 3DNKA 4X4YB 1T1WB 5FCUH 2IH3A 3BEWA 4MSWA 4YBLC 5C0BE 3U36A 3UTSE 1ZVSA 1NCWH 3OG4B 3X3GL 4NFCA 2P1YA 5CZVH 3SKUD 4HFWA 3EYSL 3QIBC 4U1MB 3VGFA 5C9KA 1DP0A 3VWKA 4LNRA 4U6VL 5DMIL 5FAAA 1C1EL 4WO4B 5AD0B 3SO5A 2QL1A 1MIEH 2IEPA 3T77A 5FYKL 3TVMD 1OF2B 1GAFL 1MFCL 4M48H 4ODWB 4JFOB 4M8QA 3V5DB 1L6XA 4XZUA 4R0LC 5I1KH 5L6YH 5D7SL 4Z95L 3WMSA 1MUJA 3RUGE 2ESVB 2ITCA 3VXTB 1ZHNA 2YA1A 5J0BA 3ARBD 5E0QA 3OPZL 3R0MA 1AGEA 3EDJA 2VDOL 5DRWB 43CAB 1FCCA 2FSEB 3WS6A 4RAHA 5EFIB 3O3DB 1CICD 4PGBB 2A9NL 4CAGA 2PF6A 1HHKA 2Y25A 2DQEL 3QFJA 3BO8B 3QULA 4NN5B 5DQDH 1NBZB 1HH6A 2HFFB 2OTUA 3PL6B 2DKMA 4JRXB 3B4NA 3H9SB 1Q0XL 5B3NA 2D7OA 3JWOC 2FL5A 4XP6L 3DSFL 1MCBA 3MODH 5EO9A 1YMMD 1VB9A 4M7KH 4N0UA 1GIGH 1Y0LB 1EFXA 4D0CB 2Y36L 1E4KA 3DXAD 5TDOB 2DI9A 1GZQA