1D9KB

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
b'AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGQGRAEQFFGPGTRLTVLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 112
sequence length 112
chains with identical sequence F
ec nomenclature
pdb deposition date 1999-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kB00
2CDFA 3HE6D 5GS0C 1KB5H 3C6SA 1GL4B 5EC2B 1RUKL 1YEHH 3D39E 4PJGF 1IM9B 3FO1A 5ESAB 4ZAKC 1LMKA 4M5ZH 4O02L 2JJWA 2VH5L 4M6MH 5HI5D 4R0LC 3M17A 3SDXE 1IT9L 5J4MA 2CKBH 3I6GA 2VIRB 4PREB 2IH3A 3WKMH 3BQUC 3ORJA 2YKLL 4Z9KB 3RVVC 5DC0A 4FXGA 3WSQL 1DQQA 5F7EL 1MHEA 4P2CG 5IQ9A 3DGCR 3IRZA 1GAFH 3CFDA 4GMSL 4U31A 1IAOB 3ZE0E 5E2TH 3VI3F 1YNTA 2CLVB 1MI5D 3F12B 2VDML 3TN0A 2IANE 3UXFA 1A14H 1WCBA 1A1OA 1E4WL 1KPVB 3CSYA 4PYGA 1Q9OA 3MJ9L 3WN5B 4DOHE 1FZJA 1T21A 3QUML 4XNMB 4OF0A 1PSKH 3VFOB 3MLVL 2A6IB 3BPOB 1EEZA 3MV9D 3T1FA 4L3ED 3LQAL 1BX2A 5LGHH 1YEGL 5A16A 1SJXA 1H5BC 1HHJB 1SQ2N 3O3DB 3AU1A 3MMEB 3GHEL 4ZS7L 5IB4B 1FV1B 4JRYB 4WTZG 5D7IF 5E2JA 1A4KA 2W07A 5I66B 3U9UA 3FQTA 1U91A 5DJDA 4LSRL 5C0GA 2H8PB 3MRLB 2AK4D 3VFPA 2CXGA 3KPSA 3ULUE 3REVA 1BP3B 1F58L 2KH2B 5HGGS 2XN9B 2NTSP 3P0VH 4X7SH 1AQKL 1NBVH 1C16B 3BUTA 4DTGH 3MRDB 4HH9B 1ZK9A 3LVEA 2V7NA 4RFOH 5BOPA 5HYJB 4LCCC 2X4SB 5EU4A 4HX1B 4HS8L 2ZKHL 2PTTB 5L6YH 3MFFA 4YDLB 1XZ0A 2FR4B 3N85L 2WAHA 4ONGH 3OKMA 4NUJB 5CKAA 5JIIA 1XF3B 4QNPF 3VWKD 5BRZA 2Y1VA 3U0WH 3O6LL 1TJHH 4IHOB 3GKWL 1DSFL 1R5WB 2QADB 2XA8L 4NC2B 1UB6B 3WYRA 3P3YA 1S8DB 2X42A 1OTTC 2CDGB 4V1DD 5FYKD 3L3DA 1KJ2L 2AI0H 5IG7A 1KACB 4PJ9D 5DD5L 1OAZL 2VLJB 3HS0A 3MTRA 3L5JA 4LEXH 2Y36L 1NC4A 4PJAB 5LGJB 4MD4A 2WV3A 1KG0B 4X6EB 1HKLL 1L7IH 2Z93A 1MJ8L 3C6LB 4ODUB 4P3DA 3HTLX 2MCG1 4TNWK 1UG9A 4LP5A 1NAML 1GHFL 3O2WL 4Y2OA 4YHIA 1CIDA 4XNQB 3S3JA 4APQC 1A02N 1YUHB 1I3GH 4LLVB 4AG4H 3VXUB 3CFCH 3SY0A 1VFAB 4M4PA 2HT3D 4LQFH 2V9QA 4DKFH 4LSUL 5AWNH 2QR0A 1N6QH 5HGDA 1IBGL 1G7JB 3CGTA 3P73A 3OSKA 2A77L 2XWJA 1GVIA 4UB0H 3GZKA 3V95A 4N90E 4U0RB 3BZFA 2FRGP 1MRDH 5H8DA 1TVBB 3I9GH 1HHHB 1I4FA 1OF2B 1S5HA 5FDWA 3ES6A 3TBYA 4XNZB 3C87A 1KCUL 2DICA 5BV7H 5E95B 4GBXD 3QULA 4UIMA 1G9ML 1FL3A 2DIAA 2CIKA 3KDMA 5ICXB 5JXAL 3DIFB 2RBLA 2MJWA 35C8L 4U1MB 1I8IA 1MNUH 5LXGH 4HWZA 5F7FA 1BF2A 1NGZA 1ZOXA 3R0NA 4NM4H 2OK0H 3NTCH 1U8NB 1HXMA 1I8LA 3VXQB 2ZSWA 3LEXB 3OJ2C 4X0KB 1KPRB 5T3XD 2QTEA 1VESA 2P8LA 3MRRA 1KEGH 4NSKA 4B7IA 5B3JE 4ONFL 5I19H 3D85B 5DEFB 3NA9H 1MCWW 3ULVD 4F7EB 3GIZH 2OMBA 5I75C 2M2DA 1UH3A 1IAKA 2BSTB 4BSJA 5ICYB 2DI8A 3Q0HA 4XP5L 3TCXA 3PQYE 2YRZA 1XR8B 3SE9H 4LVNB 3AM8A 2VXVH 3WFCL 4QLRA 1N6VA 4NWUL 2P24A 4LCIH 2P42B 5TDPA 5KVFL 4UILH 1FSKB 4PJGB 3FQXB 4XPFH 4YGAB 5IW1B 4DAGH 4N8VB 2QQLH 1DN2A 1A8JH 2VDPL 4G8GD 1UM6L 2GAZA 4FZEL 4X83A 1JYWA 1AGCB 3JUYA 3MV8E 2I60H 3G08A 4YHPA 2Y7QB 5C0RH 5ITFB 1Q9WA 2JJSA 5BXFA 3IFPA 5FKAA 3QRGL 3V5HA 4WI9A 5E8OA 5I6XB 4H1LG 1C12A 5JHDA 1B0RB 4KGLA 4P59L 1A9BB 1T1YA 1T5WA 1Z9LA 3V5KA 1G0DA 1ZA3A 2IEPA 2X4PA 4K2UL 3KLHC 4WFGD 4Y19B 4R9HA 4FXLA 3ZKMC 5KOMC 2AGJL 4P2QB 2CQVA 1UJ3C 4FNLL 3P11L 5CIPA 2NXYD 4HWBH 4S1QH 4Y89A 5L2JB 2E6JA 5IJVA 3OJMB 1I1YA 3MYJB 4X98A 4CVZB 3FOMB 1XMWA 1T03L 4G6FB 2FD6H 3RWFA 3OX8A 2BVOA 2V9RA 5HD8D 3GHBH 3KAAA 2YN3A 3RGVD 5B8CB 3O8XB 4GRMA 4JPKL 4P4RA 5E8EB 3RWIA 5DQJA 4Y1AB 4ZPVA 3TIDA 2W9EL 1JF1B 4PJHF 1QR4A 4WHYG 3TO4D 2F53A 1D9KC 5F88A 1RK1A 3QNZA 4F33B 4ONOA 5KANI 1KN4H 3EO0B 5EA0L 5D7IB 1KCKA 4L9DA 1NMBH 1ZKAA 1M1SA 2EXWD 1AGFA 3MRJB 4KKAC 5E2VL 3AS1A 1R24B 1RZFL 3A67H 3BISA 2EKJA 1J10A 1EFXA 3PV6A 2VAAB 3KYOA 5D7LD 1W72H 3B9KD 1S3KL 1E4XH 2FHBA 2IMNA 3C2AL 3D6GA 4JFYB 1ZHNB 4Z7UF 1X44A 4NQEB 2JELL 1G9NC 1F4XL 3BJ91 2UYLB 2Q87A 2DJSA 3KPRE 5DK2B 1JK8B 5J7CC 4XH2A 5IMLA 4JFFB 3ARGA 5INDB 4YBLB 1YMMA 4NNPH 4OQTA 2DIJA 4Y16C 5GS1C 3S5LB 5C71A 4BH8A 3PDDA 1T83A 4MA3B 5ESQA 1YEFL 4FQIH 5FFLA 4BFIA 2HN7A 1YQVH 4RQQA 1HILA 4UUJA 2GT9A 2OTWA 3UX9B 4N9GB 3C60B 1YN6B 4ZUUA 2BNRA 4NYLA 1CBVL 3QHFH 1DCLA 4X4ME 4NZUL 4RGNE 1HHGA 3GI8L 1NGXB 1CD8A 3ARUA 5CZXD 4XCYA 4G3YH 3UO1H 4I18C 3WFBH 4MB5A 4WUUB 2XKSA 1G7IB 4KQ4H 4G8EB 5CEYA 5DZLA 5JLZB 2PETA 4F57H 2RJMA 1JGLL 5T1LD 3RZCB 4EUPA 4JN1L 3DYMA 4POUB 4ODXA 2AQ1A 5C2UB 3QUKA 3TNNB 3VFVA 4HCRA 3DHMA 4UQ3B 3ALWA 3O6KH 4LAQH 4Q9QH 2R69H 5KVGL 1RJYB 3UYRH 1ORSA 4ORZC 1TVHA 1NMCC 2LU3A 5ID0B 4X6DE 4FQXA 1AXIB 4E41B 2Y23A 5TDOA 1MVFA 1MVUB 1A7NH 3ZTNL 5EO1A 5D6CB 3T08A 1JE6A 2EDYA 1QRNA 4P9MH 4G5ZL 3W9EA 2HKFL 5C08B 4PJ8B 2FX8H 3D18A 4ZFFB 1K4DB 1N3NA 2XQBL 1R3KA 1T3FA 4JFZL 4KPHH 5CBEA 3QA3A 2EH7H 3UTTB 1FAIL 1ONQB 4NP4H 1NCCH 1NUNB 5CJ8A 5ANME 3LKPB 1OGAD 1WBXB 1T1ZB 3SKNB 2H3NB 4LDEB 5D2NB 1CQKA 2DM4A 1AIFB 4M7JH 3SEPA 1TQBC 2PNDA 2C3GA 3G5ZA 4NUGL 5I8CB 4AZ8A 3MGTB 1FL5B 4G8IB 3BKCH 4EVNB 2R1YB 2AV1A 1CZ8H 4M4RA 5F3BB 4ODVH 4OT1H 2VUYA 4UIKH 2C1PB 3LQZA 3FTGA 3INUH 3HG1B 4F2MA 2QQQA 4N1EA 5GRYA 3T1WA 3DURB 5DMIH 3QNXB 4O5LH 2X89A 5H2BA 2O5ZL 1J8HB 1SJHB 2XQYK 5TFSL 4HKBB 1WEJH 4EBQH 4HG4J 1CYGA 1UM5H 1DE4B 3KR3L 4WFFE 3HZMB 4L8DB 3BHBA 5SWSB 1RPQA 3V4PH 4R7DB 5JIPA 3QO1B 2X70A 1R5IB 4GG6F 3EUUA 1CDGA 4FTVD 4DGIL 4G42A 4EDXB 4KK5C 2XXCB 3DROB 4Y4KA 1UJTA 3PP4L 4XNXH 1QLEH 5L0QC 3HI5L 5F89B 4PJIB 3TH3T 3FT4A 1U8JA 4ERSH 1CK0H 2F74B 2P5EB 3ZL4L 5KVEL 2ZG1A 5F7DA 4AEHL 5ITBH 3ARFB 3L95A 5D72L 3K74B 5FO7B 4JN2B 2IAMC 3DXAB 1R3LA 1FYTB 4ZYKA 1MFDH 4K3GA 5I8EA 2JB5H 3TIEA 1QFWL 4KQ3H 3QWOB 2GYSA 3QUZA 4YHOH 4U6VL 1DQDH 4JAMB 3S4SA 1MCIA 4M1GL 3O41B 4F58L 1JYVA 2VC2H 1Q72L 1ERNA 2EC9T 4KI5C 1B0GB 4JFOA 3VFUB 1F2XK 2ADJA 2BRRL 4Y5YA 1WZKA 4RISH 2YA2A 4HS3A 2W60B 4UV7L 2A9NL 3WDHA 5KBNC 1XF5A 1SM3L 1G7LB 3GJFB 3S35L 1A3LL 4CMMB 3VFGH 1E4XI 4HIHB 1PLGL 4LIQE 3BUYA 3BDYH 5J56B 1ZVSA 1YEIL 5J11C 5DWUL 1RVFL 3ARDC 3PDOA 4ZDHA 1BD2B 4NQTA 2L4OA 2PYED 3KPSE 3LSOB 5E08L 3BIKA 1U6AL 1AR1C 2OXHA 3TN0D 4EXKA 3VDCA 5IVXF 3X3FH 5IEKB 3CAFA 4BFGA 5J12C 4NPYA 1HCVA 1RZ7H 1ORQA 2DQHL 3KPOB 4NKOB 2VL4A 3H7BA 4BUHA 4G6JH 3LRSA 4I8DA 4P49A 4EI5B 1MCOL 2DQCL 5MENB 2ZP0T 1SJVA 3RWEA 3U7AA 1A6AA 4HIEA 1AY1H 1MY5A 5BRZE 3OF6A 3CLEH 1FGVL 1J7VR 2IADA 1IARB 2FWOB 2GFBA 2MQCA 4IDJL 1RFDL 4XCNB 3L5HA 1VEPA 2QQNH 3TYFA 2W9LA 1UKQA 4PRAA 1FFPB 1OGTA 2IWGA 5E8PA 1HXYB 1QACA 5BZDB 2G2RA 4XVTL 5F9DC 2DWEA 1C8PA 4XPGL 1LE9A 3KPSD 3EGSA 3G6AB 4KRPC 1Z9OA 1MLBB 3IU4L 3QCUH 4HPYH 1ZANL 2DQJH 3IDIB 5FOJA 5DYOB 1NBZA 1CF8L 2IPTL 2ZSVA 2A83B 3QEUA 3MZTA 2CK2A 4M61A 1SMAA 1B4JL 1IEAA 1FCGA 2D9QB 4LSPH 4G43A 1CDYA 1A7QH 2FLBT 2X4UB 3F7YA 3PUCA 5DI8B 5LKNA 1A6WH 1DP0A 1NMAH 5BRZD 4OLUL 1EHLH 2CRIA 1TJGL 3VD3A 1A6TA 1UENA 4NNYA 3BQUB 4O2EB 4UV4L 5F7NC 1ZLVK 1CR9L 2A2QT 1X4YA 1YPZA 3W5NA 3IS1X 5CLTA 3AROA 5FUZL 2UVFA 2NW3B 4IRSC 1RY7B 3MUJA 1LILA 5D4QA 2ZJSH 2HTLD 5J1SC 4H26A 4ZUTA 4FMFA 4PGCA 4PJ7F 2D7PA 4HFWB 3GIVA 1G7HB 2DN7A 3BSZH 3O3EA 3QI9C 5EU6A 4GXUM 3WIHA 1JI1A 3PP3K 2Q8AL 1GGTA 3TZVD 3ULUC 1NC4D 1GZPB 1QSFA 2R9HC 5D1ZA 4CRPA 2J6EL 3JV4A 5D9SA 5DHXB 4OZFA 4FFYL 3ZKSD 1SYVB 2WWKO 3VXOB 4N0CD 1BOYA 3D87B 5TF0A 4F9LC 4MNQA 3AMLA 2AXGB 3QEQB 1QSZA 1H5BB 5AUMA 3QFJA 2E6QA 2GJZA 2R2HA 5MERB 4RBPK 5CINH 3LKOB 4G6MH 1QSEA 3RBSA 3RWHB 15C8H 3BZ4B 2WBKA 3SBWA 1F3DJ 5F44A 3KJ4C 3FRPA 3IRPX 1Z6JT 3AUVA 4L4VB 3IDXL 2OZ4L 1YDPA 3WIIH 3G9VA 3HKFA 1WWBX 1NDGA 3S9DB 1F02I 4LCCB 1Y6NR 3HZYA 3MJ9A 1QA9B 2VR9A 2BOCA 1KB9J 2PR4L 1KC5H 4J1UA 5FUOL 3FB7B 3UJJL 3PWUB 4U1NB 5EO0A 4XCFH 1YJDL 4PY7B 1K3ZA 4QRSB 3MLSH 4NHCH 1QR1B 3PWLA 1IGJA 4DGYH 3VXTA 1I9RH 1BAFL 3VH8G 5JHDE 3IFOA 3EDJA 5ACZB 3HRPA 2VABA 4WO4D 1U95B 3VRIA 5TE4H 1PVHA 1DEDA 3MRHA 5I1GH 5E9DB 4MMZC 5DO2C 3MR9B 4OCXL 1MCSA 4RA0C 1F6LL 1XGPB 5CBAA 1FO0H 1EEYB 4OB5H 2MOVA 2CLZA 2R2BA 4PGBA 2EE3A 5DS8A 2CIIB 1Q9LA 2Z0BA 4X5XB 2WBWB 3FO2B 3N1FC 2LFGA 4YDKL 5HHPA 3E2HB 3JWOH 3DX6B 1S78D 4TUOB 4CKVX 1YEHL 4TUJA 1WISA 3RVXC 4WW2C 4PP1D 5IMKB 3EYVA 4HIIB 4M5ZL 4M9OA 2EYRB 4QXTA 5F3HB 4LSVH 4M6ML 5L9DH 1MEXH 2CSPA 2DB8A 4YX2L 4APQB 5C2BL 3QUYC 4OGYL 2F53E 4LLYB 3BVNB 3K1DA 4FFWC 4YUEH 5FV2A 2OR9L 3OQ3B 1C5DB 2J4WL 1HQ4B 4R4BA 2OLDA 4PB0H 4XPAH 4QRRB 1VEMA 5C0JA 3G6DH 3ARYA 2NR6C 3QH3B 5E2TL 2N4IA 1KJ2A 3SCMD 2A6JB 5IVXB 3KPPB 4WTXA 5C0BB 2FIKA 5F9OH 1T7WA 1DLHA 3LB6C 2A0LD 5L88L 1B6UA 4YDJA 2YPLD 3X14A 1SEQH 2XTJE 3DMMC 3OKKB 2GIYA 3OGCA 3KPLB 3L3HA 3D3VA 4S1RH 4OZHF 1GOHA 3RPKA 1W8OA 1FHGA 1NGQL 2NY4C 2B2XH 2MFNA 4F7PA 2AK1L 2DQIH 4MXVE 2VISB 4OV5A 4D9RE 2BNRE 3GMLA 1NH6A 5ETUA 1S7TB 2WBJA 2VZOA 2VZ1A 2GJ6D 4Y2DA 3O4LD 4D9QE 1XF4B 3U46A 3JWNC 1OSPH 1ZSDA 1RZIB 5E1AA 1VCAA 4OZ4A 5EN2B 1EFXD 5I75B 4PJCF 1Z9SA 1U8OA 4LLWB 4ELME 3VJ6A 1ETZA 4X7SL 3MOBH 1NBVL 4N0RA 3PWVB 1FL6A 4RFOL 2R23B 1AXSB 4QHUA 1AGEB 2AJYH 2AV7B 2XNAA 3IXTA 4OF7A 4ZPTB 5IB3B 5L6YL 3AS2A 3LN4B 1FNLA 4NNXB 3H9HB 3IFLH 4YFDB 2XTJD 4ONGL 1F5WA 3DTXB 2EYTA 1YMMD 1U8PB 1CT8A 1WJ3A 2HYMA 1CG9A 3RPIB 3VXNA 1W8NA 3UTSB 3BP5B 3U0WL 2N1KA 3BZEB 3HI6L 2D7TL 5DJ6B 5C07B 1X5GA 4UNTA 4YE4H 5GRZA 4JDZB 2FX9H 3AREB 4CVUA 1QFUH 2BNRD 4G9DB 2EYSB 3U30C 3ZDYF 1BF8A 4D9QD 4PJ7B 3H2WA 4IMLA 4LSDA 4PRBB 2D03H 2FO4B 4MSWB 1U3HA 1U58A 1P4LA 1A7PH 1J18A 4NC0B 3DBXA 1UJ3B 4NO2A 5I1KL 3IJHA 3G5XB 3ARBA 4OGAC 3N9GL 4RAVA 5DRWA 5F93C 3B6SB 1CFSB 4C54A 1L7IL 1HSAA 2Y07L 1XF2B 3LQMA 4LRNL 2YPKB 3SKJL 4UU9B 4NN7C 4MAUH 2OL3A 4GXUN 4MAYD 5T3XH 3IAPA 4NQUA 1QFHA 1CL7L 3NCFB 4YFLF 4MCYB 5DJYB 2ZNXA 1D9KB 5AWNL 2IQAA 4Z7QF 4AIZB 4HZLA 4OCSL 5JW4R 5IMOA 1GGUA 3ULVH 1WBYB 4UB0L 3UYPA 4C83B 1XT5A 2AJVL 3K2UL 4QTHA 3TBSB 2CUMA 1H3TA 4M9PA 3V8CA 4ODBD 3MLTA 1YECL 4I5BA 1QRND 1N2RB 3UAJC 4RGNC 5IJKC 3QQ9C 1JPFB 2MCPH 2P45B 4JM2C 4RRPA 2P7TA 2C3HA 3ZKQD 3P4MB 5CS7A 5EZLB 3OBAA 3MV11 4ZUVA 1S7VA 1ROWA 4PRPA 4YLQT 2K7QA 5LXGL 4YHNB 3MGOB 4LK4A 2WWKT 1JF5A 5KSAA 3SDXF 3I02B 4RCAA 4M6OH 1JPSL 4Y16B 5GS1B 3O2DA 4XC3H 5AD0A 4Z0BH 5GGQL 4MQTB 1NLDL 3MRFA 1H15B 2VXSH 2X89D 2VWEE 1G6RB 1FNSL 5C7XL 2OP4H 1T0NB 4XGZB 5KN5B 2DQTH 4GXVH 4AMKH 3UPRB 1IGIH 1JWSA 2ZOKB 3EFFA 3GIZL 5ADPH 3W0WB 3ZE0F 2BY0A 1B6DA 3CK0H 4I18B 3SGKC 2K1MA 1IZKA 1TCMA 4LOUC 1N64H 4Y4KD 4OF3A 1RJZB 3SKMA 4O2FB 4UILL 2KQMA 1YEDB 4XPFL 4DAGL 2QQLL 3WXWH 2DYPA 4GOSA 3QCTL 4K94C 3K4DA 4HLZH 5EPMB 2XOTA 4RGOL 5T1KD 4N8CH 4JO4L 4LCUA 2BDNL 3C5SA 2UUDK 3I84A 5FYJE 4I3RH 5B38A 1WZ1H 4JRXE 4KTDH 2GSIA 4O51A 4R4FL 1XGRA 1NMCB 5BS0E 1M05B 3QXAB 2AJ3B 1FZOA 3NAAH 3RU8L 3RIAF 1KV3A 2HFFA 1WC7B 1MHPL 1AGBA 1PKQA 1VSCA 4C56B 4LSSL 3QUZD 5DLMH 3DETC 2R0WH 4PV9B 3ULUF 1KTKE 5GHWH 4HWBL 4S1QL 1HH9B 3S88L 5GISH 1OP3K 5HHNA 3DNKA 4I2XA 5IFAL 5DEGA 1T1XB 5EZJA 3B9AA 1IQDA 4ONHB 3CLFL 3GMOA 3AAZB 5F1IA 4F37K 4XP9L 3QQNA 5JHLH 4YPGA 4QYOA 1CI5A 4PGDB 2I5YH 5HY9A 1TQBB 2NNAA 4OZHB 1RUPH 4OD2A 5I2IB 5C09B 4AL8H 2HFGL 2P8MB 2WIIB 1HINL 2HG5B 2J8OA 4J6RL 2EDLA 4HUWB 3NFSH 4PJFA 3PWJB 1BBDL 1WAAA 5GIRB 4P9HH 1WFUA 1NMBL 3DOSA 1PQZA 3F5WA 1FGNH 1INDH 5JTWA 5EU3B 2GSGB 4X6CB 3A67L 4PG2A 4MNGA 2VE6B 3AFLA 5JOFB 3SDAA 3VFTA 3QDJB 5DSCB 4PJCB 4WHYH 1FLRL 4UTBH 3G6JA 1HHKA 4H8WH 2QSVA 3TT1L 1S9YA 3REWA 3DV6A 1A1MB 1KUMA 2OS7A 3GJEB 5HDBF 4OD3H 2RFXA 3OF6D 3T0EA 5L0QB 2VDRH 2AQ3A 1M4KA 4XX1E 5FK9A 2VLRB 4NFCA 3NPZB 4JY4B 4GAYA 3RWCA 5L2KB 1CICA 1U8QA 4OZFG 1HWHB 1MLCB 1ZMYA 1QPPA 1NCWL 3GBMH 4X4XA 3T0AA 5F1NA 4PJBE 2R1WA 2HRPL 2G75B 2ZZUT 4EDWH 2IAMB 2DQFA 4NGHH 43C9A 1KENL 1ADQL 5DJ2B 25C8L 4TVPE 4HPOH 2MHAA 2XZQH 4XZUB 1XH3A 5EU7E 1K6QL 1QSFE 3FCTA 4KTYA 2B1AL 4G3YL 2E9BA 1JV5B 5HHQA 2AJSH 4HAGA 3Q6GH 3PL6C 5DRZB 4XHJC 1GGCH 1KIPB 4WW2F 1O7SA 3QXTA 3FRPG 4A6YA 2Q7YA 3BX7C 4GSDH 5T1MA 4F57L 4NQXA 4MNQE 1XIWD 2XRAH 3V8OA 2CPCA 1ODAA 1MIML 1A6ZB 4YDVB 1RSFA 3DVNB 4I9WE 5C92A 3QQ4A 5IB2B 2CMRH 5FB8A 1QSEE 3FHAA 2NZIA 2DWDB 3C8KB 3H42H 1INQA 5J11B 2VDLH 4KVNH 3MRIA 3ARDB 4DVBA 4MA8H 2NYYD 4OFIA 1AQDA 2HT2C 2PN5A 3EYUL 4RFEA 5EU6D 4XWGH 1A7NL 1LP9B 4QHMA 1BM3L 1QBLL 1U3JA 4GKSB 1I8MB 4AEIL 4UOW0 2NTFB 3KJ6L 4PJEA 2PW2B 4F3FB 1QSFD 1XGUB 3BJLA 1WWCA 4EQ3A 5J12B 3C9NB 1ACYL 5ADOH 4P5TD 3FO0L 5DMKB 5F7MC 1KNOB 4YXKL 4BUGA 3STBA 3BDXA 3SQOH 1NCCL 4QXGL 4UT9H 1P7QB 5GJSH 3D39B 2XYCA 5KJRH 1CFVL 3B2VL 2VLLB 4JGUA 3MNWB 1R5VA 4MNQD 4M7JL 3G5YB 4B7LA 1LEIB 3NIFF 4IS6B 3QFJD 4G7YL 4PY8J 3SDXB 3MRMB 2KPNA 2VZVA 2X4OB 1CZ8L 3EJYC 1UB5B 4J8RA 1FG2B 4OT1L 1JHKL 2I9LA 4UIKL 4S2SA 4XTRC 3A6BH 3KXFA 3WD5L 3INUL 3IFNH 1A9EA 5C0AA 3PHQB 5FGBA 4RMRA 1FN4A 1M7DB 4I3SL 4KRPB 4M7KH 5GGTL 5TH2B 4EBQL 1UM5L 5LWYL 1RZGB 1JCKA 3AVEA 1ES0A 4JHZA 5TQ0H 2HKHL 4AENB 5DK0A 2IANB 3L3KB 4MJ6B 3MUGB 2ZUQC 3FFCA 3F62A 1BFOB 3SGJA 3MQIA 4DOHB 3GNMH 2VLMD 5FHBH 4LDOB 3VG9C 4WU7A 4JJHA 4E5XA 1KELL 2APXA 1I8LC 2XZAL 4ERSL 3I3DA 2YRLA 2VZSA 1TZIA 4Z7WE 5D1QA 2BFVH 5DUPH 3THMH 1GPOL 1MCPL 3QXDB 1MHCA 2Y6SD 4IRSB 3L9RB 3TA3A 4YJZL 4LASH 1MRCL 1OM3H 1PX4A 4U1SB 4RIRB 5EC1B 3RI5F 5EWIH 2JB5L 2XIDA 3QI9B 5HGAA 2E7LA 5I1JH 4YEEA 3QHZH 1F3JA 4ZTPL 1CXEA 1DQDL 1ZHLA 2D9CA 3L6FA 3U4BH 5J0BA 3GRWH 4PRIA 4PLJD 3HAEA 3P4LA 4KUZH 1Q9KA 1UFUA 3FT3A 3QDMD 4KKBC 4DUVA 3D3VE 4U1KB 3CZFA 4O4YL 4JKWA 3HB3C 1E4KA 5EBMA 1BOGB 1LNUB 1TCRB 2X1QA 3EW3B 1E27B 4LGPB 4YZFF 4N0YL 3M07A 2FJFB 4QT5B 2Q3AA 2C7UB 2DQUH 5DQ9A 3HPJB 5KZCB 4KTEH 4Y8DC 3KJ4B 3DO7B 1Q94A 5IROC 2H32B 2JK5B 1EAPB 5JO5A 2YK1L 5C0ND 4YQXH 5SX5H 1S7QA 4YBQC 3X3FL 1DBKH 4JM2F 2PO6A 5EULV 1SVCP 4O9HL 3MLPA 4U1HB 2EECA 4M7LL 5CJOL 1AD0B 1HKFA 1IVLA 3O0RL 1LEKA 1F8TH 3JTSA 3D3VD 3GI9H 3QIUC 1VADA 3V0AC 2NW2B 4JZOA 3S3SA 2NY0C 5IW6A 3RUGE 2Z91A 2Z35B 3CXDH 4WY7L 2QQNL 4ZFOB 1QRKA 4UINH 1I3UA 4NT6B 1BZ7A 4WEBH 2HH0H 4CN6A 3ETBF 4J3WA 3RNQA 3H3PH 1OAQH 3E6FB 2YUVA 5DD1L 1BLNA 4MJIE 3TGXA 1IGTA 3JTTB 4OTXH 3WNLA 2NY1D 4X6DF 1F6FB 2OQJB 1IAIM 2FZ3A 3GMQB 3STZB 4P46A 2ZPKH 4HPYL 2DQJL 4ALAL 4XB8A 2VZUA 1IGFH 3MRNA 2F54A 2X4QB 4D8PB 3K8LA 4JZJB 1JGDA 2IG2H 4P23A 3BAEL 5J9PB 3S36H 2ARJB 4LSPL 3O9WD 2GQHA 2YXMA 2XICA 5F9JB 1A7QL 4JKKA 4U6XA 4TSCH 3CU1A 1NGYA 2CLRB 1EHLL 3QUYB 3ARGC 4X6FA 2JB6B 3QJFB 3IF1B 4OFVA 2GTWA 1T83C 3WLBB 2K3TA 4HUUB 1T4KA 1KT2A 1RAMA 3I6LD 3O3BB 3QWRD 2ZJSL 1F3DH 2ZUTA 2X4RA 2XT1B 3RWGB 1C08A 1NLBH 1ZT4B 4F7TB 1U3HD 3BSZL 1XFPA 2BVYA 5HJ3A 3TFKC 3MRBA 3Q48A 3ARBD 4JE4B 3HZVB 4MDIB 1KB5A 3TVMC 2MKWA 3MJ7B 3PQYB 2NY3C 1HEZB 1J87A 1PBYA 1DDHB 3DMMB 5IBLC 3RHWK 2CKBA 3BKJH 3GKZA 3CH8A 2NY4B 4MWFB 3MV8B 4HIJA 3L5XL 5DVNA 3EFDL 3VFNB 5I16B 1DTUA 3MV7A 3KHQA 3D69B 3OXSA 3EZ8A 3BO8A 1T7YA 4AM0B 4WCYH 4G6KH 4M3JA 1WGOA 1JF6A 4P4KA 1J5OL 5J6GA 1PYWA 4Q6IA 4NM8L 1A3RL 4X80L 2AQ2A 4FQXC 2YUWA 5ILTL 1G7MB 5BQ7A 3T65A 1T2JA 3LCYA 3WIIL 3GBNL 4OCWL 3CIQA 4NQDD 1IAII 3IAGC 4Q9RL 2PXYA 3TBTA 5IEHA 4GRLD 3VGAC 5DJCB 4X6BA 1MJJB 3U4AA 1A1NB 2FB4H 4PRPD 4L8SC 3SO3C 5FO9A 1Z2KA 4JLRB 2BY1A 3K3QA 3BW9B 4EN3A 3VXPB 4HUVB 3IJYB 4LHUB 1OP5K 5M95B 2HFTA 3FN9A 2DKUA 1FNGB 2MSPA 1OPGH 2VAJA 3MREA 4DKDC 4CVWA 3NZ8A 4OLYL 2VDKL 1I1FA 3U30B 4KDVA 5I1GL 4JDVA 5JA8B 5ENWA 4GKZA 4F7CB 1PKQE 2FYYA 1FO0L 2ESVD 1IILE 3EOBB 3GSNL 1OB1B 3D2UB 5E94A 2VXQH 1QBMH 9CGTA 4AH2A 4I2XE 1UZ8B 4BQ9A 1MF2H 3CDGA 1DL7H 3TO2B 1HOCA 1UWEH 2X7LB 3CC5A 2OJZL 2WINB 5IQ7H 2ITDA 4NN7B 4XCEB 2DYPD 4LSVL 2VXUH 5T1LB 1MWAL 5FAAA 5SWQA 3KPRB 4G8FB 1Z0MA 3J7HA 3EZJB 2H1PL 1NPUA 2C3XA 4M1DH 2ZUWA 1NC2B 4YUEL 1J1PH 1WAAE 4NRXA 1FDLH 1KJVA 1AI1H 1DEEB 2B5IC 3UC0H 3OR7A 2J12B 3W2DH 1LO2H 3IS0X 5F1KC 2HJKB 4NRYA 4MNGE 4H25A 3N0PB 3G6DL 2VWEC 4GG8B 3FQNB 4MDJB 3W82A 1EXUB 3G6JE 1ZLWH 4RGNB 1G9NH 1DVFA 1NFKA 1S7SB 4JM2B 2C4FU 1HSBB 3L5IA 1OVZA 4PJDF 3T0EE 2IPKB 3K8MA 5K9KB 4P0DA 5B39G 2CGRH 4ESKA 3DYOA 4Y5YC 1HYSC 4S1RL 3IDJB 2Y5TA 5IB5A 1S7UB 4QGTA 1NUFA 5DUBB 3DRQB 4WFHE 1G6RH 5LCVL 3BKYH 3GO1L 4EIGB 3FQWA 4MGXA 4L8CA 3MRCB 1KLFA 3WFHB 1PG7X 3DVGB 4OZIF 2D7NA 1CE1H 1S7RA 4BH7A 3GFUA 5JUEL 5T3ZH 3MRGB 4X4YA 5FYKL 1FYHB 5IT2H 1CGTA 3HE7A 4OIBA 3SDAD 3UDWA 4IOSD 2IBZX 2K7PA 1YEEH 1JMXA 2PCPB 3NFNA 3QPXH 2BXZA 4GJTB 4X6DB 2ORBL 3GMNB 3JUZA 1P2CA 2FCBA 2OCFD 3MOBL 2FIRT 4BM7A 4X8JB 4DZ8A 3ARVA 5ISZB 3IJSA 3T0BA 5ELIA 4CADA 2X6MA 2AJYL 3I75B 1Q0XH 2R56L 3V7MA 5IWLA 4K8RD 1MCKA 2H2SD 3QDGD 5D8JH 5C0CA 1W0YT 1MCLA 3IFLL 1UWXH 3WUZA 1F45A 5ANMB 1IC5L 1CICD 4HH8A 4WFHD 3DUHA 3PWNB 4F9PA 3SGEH 1HYRC 3HMXH 1YMHA 3GSUB 1T04A 2ZUSA 2XG4A 2XTLA 4JPIB 3LEVL 3IDNA 5LVEA 5ALBL 5JW3H 4DKEL 4GRWE 1K8IA 4PJEE 4Z77A 4G7VL 2D0FA 3NA4A 5DZNA 1FFOA 1A7PL 5HYQB 3NCJL 4PRDB 3JVGA 3FKUS 2R0KL 1I8KB 1E6OH 2BVQA 4AIOA 1GC1C 1UVQA 1P84K 3C6SB 4I0KA 1U8KA 4LCWE 2V17H 1NCUA 4IOFC 4MAUL 5CFHA 3M17B 5T3XL 3I6GB 2IH3B 5IFJB 4ZUWB 4XPBH 2ID5A 4KC3B 5CEZE 4OLXL 3FOLB 2BY3A 2Q76A 3QUXC 4FXGB 4GW1B 5EZOL 5C0AE 1JHTA 3RA7H 4LVEA 5J6HB 3ULVL 5FECA 3SE4A 5DQDH 1IC7H 1OCWL 3CFDB 3EYQC 5D70H 3TYGH 1RMFH 2C26A 4MXQD 4J3VA 1P1ZA 4YHKL 1YNTB 3HNVL 3MO1A 2VN7A 4BELD 1MAKA 3CH1A 3TN0B 5I18L 2NZ9C 3D9AL 5GRVL 4P5MA 2RAMA 4LVOC 2ICWB 2DLIA 4HWBA 3FFCE 4MS8C 1WCBB 1A1OB 4WV1C 5EU7C 5JOPE 2FJGA 1TFHA 5FM5O 2NY5L 2W0LA 5D1ZC 5I1IH 1FZJB 1T21B 5D2LF 4MLSA 1HHIA 1VFBA 2B4CH 5D96C 3MODH 1MQKL 1ITCA 4X9IA 3E1F1 3FB8A 1X5AA 1EEZB 4JO1H 3R8QA 3T1FB 2FECL 3WUWB 2I27N 3T2NL 3DECA 3LKNA 3OKNA 3AU1B 3JZ7A 3PGCA 3QEHA 3KXFD 4Z0BL 5C0AD 3VW3L 2Z8VC 1XGTA 1GGBH 5F8RC 1UM4H 2KDGA 2RGSA 5E4EC 3T77A 1D5BA 3V6BR 1ZS8A 3FRUA 3U9UB 3FQTB 1U91B 2LTQC 5DJDB 1WSST 1Z5LA 2W9DL 3VFPB 4G6AD 3KYKH 4P2RD 2DI9A 3NIGE 5GGVY 3M8OH 3CK0L 1W72A 4N8PA 4MQXD 1NBQA 3OG4B 4JFEE 3EO9H 4OBSA 2NLJA 4XVJH 5FHAL 1Y0LA 5LBSL 4OLWH 1OLZA 3FQRA 1Z3GL 1D7FA 1EEUA 2VQTA 3H3KA 3KWWB 3QT2A 4KJQD 1XZ0B 3VXSA 2V5RA 4ZXBD 4JHWL 1QNZL 5CD3B 3LQAC 5BRZB 5TE7H 4YBHA 4WJ5A 4Y4FC 4J3XA 1NANI 2AKRB 3ILPA 4EOWL 4N9OB 4GH7B 4IMKC 4W4OC 3BWAB 3MCG1 5T1DL 4CBPA 1CDUA 1P69B 2EKSA 2HAZA 3NPSC 3LKQA 3OAYK 4N1HB 1G0YR 4HKZA 3DGGB 3SOBH 4CU7A 2P48B 2R0WL 4OM1L 4ELMF 5GHWL 4PRID 4K3EH 3QIBC 1J1XH 3HS0B 4WI6A 4GMTH 3S6CA 3CVHL 5FEBA 5C6TH 1NC4B 3HUJF 1C5BH 4MD4B 3ABZA 1ZHBA 2FEDD 3C08L 1VPOH 5HGHB 4JQXC 2Z93B 4P3DB 3CMGA 1GJIA 2N7BA 3QO0A 2E3VA 2NXZD 3RL1B 3MFGB 1WWAX 3QEGH 3EYOB 5DJ0B 3MRKB 4JFDA 4YHIB 1OAXL 1NDMB 1DZBA 2I5YL 1RUPL 3PG2A 5CSGA 1FBIH 5DURB 3SY0B 5SX4H 4AL8L 3TWCH 1UA6H 1NCDH 4GQ9L 3EAKA 3BRGC 4YXLH 5HGDB 2NY2C 4BFBD 2XZCH 5HDQH 4HQQL 1MCCA 4P9HL 5EBLA 1C5CL 1INDL 1ZHKA 3BZFB 2APTA 2NX5A 4HK0A 1LE5A 1I4FB 2FH6A 3ES6B 5DEZA 3RKDC 3TBYB 1NCBH 2F54E 2PO6D 3IETB 4UTBL 1UYWL 1UZ6F 3QULB 4H8WL 4UIMB 1E0OB 2AJXL 4HJJH 2Z31D 3RVUC 2ZUQB 1FL3B 1RUQL 5K9QI 3KDMB 5ICZA 4HKXB 1I8IB 5I1CH 4HWZB 3VG9B 2VDRL 1T22A 1IGCH 3KS0J 4JG1H 1TJIL 5AZ2H 2I9TA 1HXMB 2ZSWB 2F58H 3H0TA 1FNEA 3SDDD 2FBOJ 5IF0A 1Q1JL 2A73A 1HZHL 4YH6A 2P8LB 3MRRB 4NSKB 4PJXA 1KXTB 2WBJC 5E6ID 5HHMD 4EDWL 2WUCL 2F15A 4Y2DC 1P6AB 3ULUH 2IMMA 5KSBA 3LV3A 4P46D 2P49B 1IAKB 2DQDH 3X13A 6CGTA 1H3PL 1I3RB 1D6EB 3LN5B 4LSQH 2WZPD 4FFVD 5TQ2H 1G9MC 1LEGA 3V6OA 1WBZA 4IRJA 4ZOBA 5TDPB 3QSKB 2GTZA 2GAZB 4YHZL 5EH1A 5JPMA 4JVPA 1BGXL 5LAXA 2QQKH 4Y4HA 1P5UA 5DMGC 4B50A 5BXFB 1MCDA 2HT4D 3MV7E 4XP4L 3V5HB 3VXRE 1QSVA 4KZDL 3EYFA 2M26A 4XNUH 2NY6D 2EZ0D 2OX5A 2J8UA 1C12B 5JHDB 2JCCA 4KJWD 3H42L 1JN6A 1T5WB 1T1YB 3HC3L 4KVNL 1U42A 3V5KB 1J0IA 2VL5A 1ZA3B 2Q3ZA 1QP1A 1YEJL 4XWGL 4WI2A 1NGPL 1DANU 5T33L 5DD6B 3C5ZA 1KTLB 1CDIA 3OXRB 5CIPB 4M6NH 4DZBA 5IJVB 2A6KB 4PG9B 1JNLH 4XPTH 3QFDA 4K94L 2DL9A 3SQOL 4DW2L 5GQBA 3RWFB 4FQJH 4XBGA 5D1XD 4P3WA 3QIUB 4GRMB 3GGWB 4P4RB 3KPMA 2NY0B 2JF1A 3O2VH 2AJUH 1PGRB 4ZPVB 5DQJB 5KANG 3MBEA 4GUPA 2F53B 3L3GB 5F88B 1RK1B 1PZUB 3QNZB 5C9KA 3T8XA 4LLDB 2WWMC 1AGFB 1CGXA 3HNTH 2XPGA 4KKLC 4GKNB 2R4RH 1LO0H 4X9GA 4HULB 1RURH 5DD0H 5IBUB 4U49A 1KLUA 3PV6B 5F1OB 3KYOB 2PXYD 3GBLA 5H94A 1QQDA 3O11A 1JYNA 3TC9A 4G9FA 3LN9A 2E6PA 1HDMA 3DYPA 3ZZ1A 3UCRA 2QHRH 4ZFGH 5FHBL 5JNYA 3NFPB 3TEUA 1KIRB 2ZUUA 3AC0A 2XTJB 3ARGB 5KSAC 3QXVA 5DVMA 2XWBB 4QRPD 4YHML 4JHBA 5EORL 4BH8B 4OCRH 2BFVL 3Q1SL 5T5FH 3EOAA 2HN7B 4RQQB 2GT9B 1UEYA 4ZUUB 4LASL 5IIEA 2BNRB 3K7UA 2CRZA 3AXLA 3UJIL 4QXWA 1IAMA 4BQ8A 5EWIL 4XAKD 4WNQA 4KDWA 3LS5H 1TQCC 3CX5J 5EC2A 2EIZA 5I1JL 4JFXA 1IM9A 3QHZL 4NJ9H 4XCYB 1MUJB 4NHUA 5DVLA 3MXVH 4PTUB 3T09A 4LEOA 3U4BL 4ELMB 4XBPA 3GRWL 3BIAX 3RNKA 4BZ1H 5CEYB 3TVMB 2VIRA 4O00A 4U4BA 4L8BA 4TTDD 2NY3B 3E0GA 1KPUB 4QCIB 2R4SH 3LAFA 2NCMA 1EJOH 3BGMA 4RMVA 4NKMB 4EUPB 4JQIL 1ZWIB 4J4PA 4OGZA 1N7MH 1T80A 4ODXB 2EDRA 5TE6H 3QUKB 5IGXL 1AKJD 3VFVB 3CFEB 3OKLA 2DLGA 1NAKL 3H9ZA 5GXBB 3RY6A 5FDYA 5D7JA 2CLVA 1B4RA 4PJBF 1TVHB 3GM0A 2HTKD 3GB7A 4FQXB 5TDOB 5KTEH 1NEZA 5EO1B 1DVFD 5J3HD 4Z6AT 5FGCE 4YQXL 3WFDL 3W9EB 1DBKL 2OTUA 1I85A 2VO5A 5GGSA 3J8F7 3D18B 5IP4A 3VGAB 3O4OC 1EJ6A 3U7YH 1N3NB 1R3KB 5CBEB 1QFPA 3TV3L 5CUSL 2C9AA 3SO3B 4L8SB 3O6FA 1F8TL 3MMEA 1ZLUH 2X4NA 3GI9L 3ZKNC 1VACA 3UTPE 4GW4B 4M8QB 4LMQE 4XMLL 4D3CH 3G5ZB 2AEQH 4ZUSB 3CXDL 2EE9A 2FEEL 3MRLA 2XKUA 3E8UL 3LQZB 3FTGB 4TNVF 3Q3GA 5B4MD 3UYOD 3H3PL 1OAQL 5D5MF 5C9JB 1C16A 1CXKA 3MRDA 3RWJA 5HYJA 2HMIC 1RI8A 4OTXL 1X5KA 6FABL 5I30H 4HX1A 2VDOH 1E4JA 2PTTA 1I9IH 3BHBB 2DBLH 1RJCA 4MX7A 2X70B 1R0AL 3ZE2F 3C09B 2BSRA 1B2WH 1NGWA 3E6HB 4G42B 3S36L 2ED7A 1KCVL 5DJ8B 5C0CD 2X1PA 3W81A 4KROC 4Y4KB 3T0EC 4K23H 1PX3A 8CGTA 4JQVC 3MUZ1 5LGKA 4FP8H 1S8DA 4MVBC 1U8JB 3MLYH 3EKCA 2P5WD 3F7QA 4POZD 3BXNA 1X4XA 5F7DB 2B5IB 4M5YL 4HK3N 3Q5OA 2VLJA 2BNQD 1MSPA 3HLAA 1FO0A 1R3LB 3U4EB 4FQCH 4ZYKB 4N0UE 3R8BB 5LGJA 3WO4C 3TIEB 2X5PA 3F7VA 5C0EA 3ZYZA 3O6MH 3L7EA 3QUZB 1KGCE 3S4SB 2G60H 2VKXA 4DK6A 5J1AA 4Q97A 5GSVA 3VXUA 5H37H 4L3EA 1BMGA 4FFZH 4JFOB 1RU9H 2ADJB 3BH8B 4Y5YB 2ATPA 3BKJL 4RDQG 3WKNA 4LQ1A 3T3MF 5C86A 2DLFH 4HUNB 1MHHA 3LOWA 3SJVA 4AT6A 1U41A 3WIFA 1HHHA 4U0RC 1OF2A 5C0DA 3SE8L 3WLWD 3BUYB 4EZMA 4Z7WF 2A74A 2HLAA 1ZVSB 4XNZC 1WIOA 2AK4A 3PDOB 1T2XA 3OTTA 4JRXB 4ZDHB 2FECI 2F19H 4K3DH 4Q74A 5BS0B 2UWEA 1IFHL 4OJFL 1LK3H 4U1MA 5IHLB 1S7WB 2GITB 4NPYB 1KGCD 2H9GA 5C0IA 3RL2A 1A3QA 3VXSE 1A47A 3LRSB 3DSFH 2FB4L 3GSOA 1E6JL 3GEWB 4OCYH 2AS5M 1JBJA 3RWEB 4OGXL 1R3IH 1A6AB 4HIEB 1LO4H 2QSTA 4KK8C 2IADB 5BW7A 4Y7MA 3QNYA 1EDQA 5DEFA 3T4AA 5EOCL 1OPGL 4M43H 2J88H 2VLKD 4ZO6A 4NKIH 4ZS6C 3TYFB 3KPNA 4QXUH 1FCCA 3F7RA 2Q86A 4KAQH 5EUKB 4PRAB 1OGTB 2B1HH 1MPAH 5ICYA 3DX8A 5EB9A 5E8PB 1U8LB 2G2RB 2DWEB 1XR8A 3BE1H 3BESR 2E8ZA 1P53A 1CFQA 4TOYH 3L3JB 1BQHA 3FQXA 1QBML 4MQ7B 3IYLW 1RV6X 5DC9B 3RX7A 7FABH 2A9MH 1GZQA 3QEUB 1UWEL 4NN6C 4M61B 5IQ7L 5DGRA 4LLMA 3VXSD 1P4IH 4G43B 4PRHA 4HJ0C 2OJEA 2YA1A 5J1TC 1U0QA 3F7YB 1QOKA 4NFDA 4QWWC 2UUDH 2WNGA 4NNYB 3RUGF 3QXWA 3RTQD 1QO3B 3QUXB 4JG0H 1ZGLM 5D1QC 1ZA6A 4WFED 4Y19A 3JV6B 3PWPD 2DM2A 2ZWLT 4X7DC 5FA3A 2NX5E 3TA3C 4PJBB 4X5LA 3U0TB 4HIXL 3EBAA 4H26B 4PD4J 5L2JA 1C7SA 4PGCB 4GBXA 3GIVB 5IHBA 3O3EB 4WUKL 2E7LC 1BECA 3K4AA 4Y5VA 3V4VL 1CGSL 5I1HL 4LVOB 3RVWD 2ITCA 4WHTB 4ENED 1DUZA 1QSFB 5E5MA 1GOGA 3KVQA 1H3UA 5D1ZB 1T66C 3QR2A 3W11C 2K9UA 5B8CC 5D9SB 1T2QH 3HFML 4GAJH 2E5EA 5HHXH 5D96B 1OTSC 1OAKH 2CGRL 4JFDD 5HYIA 1KULA 4OSUL 5GRJL 4DQOL 4F33A 1JRHL 3F65A 3D0LB 3S37H 1G84A 1NBYA 4ZNEA 3MRJA 1ZEAH 5AUMB 3WV0A 2IALA 2VQ1A 4M1CC 1RIUH 2GJZB 4KKCD 2YD2A 4PJXE 2R2HB 1CE1L 1QSEB 4MA1C 3TJHD 5KSBE 2F5AH 5E4EB 2VAAA 4Z7VF 1JZ4A 5IT2L 3DV4B 4ZTOH 2LTQB 4OKDA 1ZHNA 2QJDA 2CH8A 3QPXL 1MFBL 4PLKD 5CGYC 2D3VA 3VRLE 4YAQB 5HBBA 4Q2ZB 3F58L 3LRGA 3V6OE 1CLYH 5JR1L 1IKFH 2R0ZL 5DK2A 3HZYB 1KSRA 4JFFA 2BOCB 2DTML 2DQGL 5INDA 1J05A 3RAJH 1S5IL 4J1UB 2APFA 5BVJA 4RWYL 2Z8SA 1L9NA 5AZEH 2AXHA 3WDJA 3HZKA 1UH2A 1KFAL 1T0MB 5GGSY 3X12A 4GFTB 3PWLB 5J57B 5F96L 1KYOJ 5DDHA 3IFOB 2JCCE 4K71C 1AFVH 1NGXA 2HFEA 2VABB 4OAWA 4XAWL 3CVIH 4HBCH 4JFHD 3MRHB 1OW0A 1X6NA 1C1EH 2HWZH 3OG6B 5CBAB 1G7IA 5JW3L 2R2CA 1N26A 3NPSB 3DHJA 1Q8MA 1TPXC 3NGBC 5KVDH 2R2BB 4PGBB 4U33A 5SWZD 4LSTL 5I1EH 1DQMH 1JNNH 1Q9LB 5ERWA 1OTUC 3ECBB 4PR5B 3WS3B 3RZCC 4ZO7A 3V6FA 5ECJE 5HHPB 4I0PD 1UKSA 2NY7L 4OD1H 5CJXA 3HR6A 3FZUC 3RGVA 4P23C 3N50A 4TUJB 2DDQL 2O5YH 1SVZA 3EYVB 3WNMA 4UQ3A 1YJDC 5CMAA 3TO4A 4Y4HD 1P9MA 1RJYA 3VMNA 1CD0A 2HLFC 5EUOE 3V6ZA 4NZRH 1U92A 5IHUH 1X5XA 1W2KT 4XPBL 3BEVA 3ZSSA 3H9SE 4NBZB 5FV1L 3LIZH 2NY2B 1S9XA 3RA7L 4Z7WB 5JW4Q 4R4BB 1MOEA 3B2UC 4F8TA 4M00A 1NCNA 5JQ6H 5D70L 5C0JB 2M8XA 1RUAL 3KPQA 4PJ8C 4URTB 1RMFL 3MOAH 3WL9B 1KJ2B 1BWMA 3NH7H 1AO7A 4GLRI 5CJQH 1ONQA 1WBXA 1OWRM 1T1ZA 2H3NA 3EHBC 2FIKB 1IRAY 4G9FE 5L7XH 2V2XA 3ZDXE 4OIIH 3IDMB 4FG6C 3VWJC 5I1IL 5AAWA 1DLHB 1UCTA 5I8CA 4P3CH 3MGTA 3QG7H 1FL5A 2B4CL 2R0LL 4G8IA 3MODL 5BOZG 4EVNA 4YDJB 2R1YA 1QD0A 3X14B 1INEL 5F3BA 3OGCB 3L3HB 5KVMC 2CDEA 4XP1H 2EH8L 4FZ8H 4FOMA 3DURA 3MBED 4AYFA 1UT9A 4U1IA 4JPWL 2MPAH 4K3JL 3M1BA 4OV5B 1WAAF 3GMLB 4U2ZA 5ETUB 4XXCC 2WBJB 1GGBL 1DE4A 4P4KC 4Y2DB 5CSZA 1BIHA 1YQ2A 3U46B 3QIWC 1ZSDB 3VFSA 3U2SA 5E1AB 4OZ4B 3U1SL 1U8OB 2X4TA 3MJ8A 4FXKA 5GRUH 3VJ6B 2ADIA 4EDXA 5H35A 3OL2A 1IGMH 1NL0L 2IF7A 4U2YA 1FL6B 1YEKH 4Z95H 1JMZA 4QHUB 4HJGA 4ODHH 5A2JH 3HN3A 4RX4A 2N56A 3ILQD 2XNAB 5A3ID 5HYSB 2APBA 3SDCD 1CVSC 1NEZG 2ICWI 1MIEH 1LO3H 3RDTD 1JZ8A 4EN3C 1HNFA 2EYTB 2QHLA 4IJ3C 3NCEB 1KEMH 3P2TA 5TE7L 5I15H 1BJ1J 3MA9L 3MLRH 3RUGB 1DBJL 4XI5D 3ZMRA 5DHVB 3BN9C 1DQLH 3RX8A 1FNHA 1M71A 3LZFH 1CXIA 4MHHG 3U82B 1CGWA 4L4TB 4NWTH 1D3CA 1KXVC 1P4BL 2YEZA 3O41A 5KSUA 1HI6A 4IMLB 1ITBB 1IM9D 1QHPA 4MJIB 1U3HB 1XGYH 1U58B 1P4LB 4ELKA 1RIVH 1JPGA 4NO2B 3IJHB 3BT2H 4GMTL 4KWUA 1F90H 3LHPL 4RAVB 3OKEA 5C6TL 3HCVB 5DRWB 1OGAA 1MREH 1G7LA 2RCSH 3TF7C 1HSAB 1NKRA 4IDLA 3EDEA 1PZ5A 4JHAL 4PJHA 4TQEH 2SEBA 3QEGL 4R4ND 4HIHA 3WHE0 3VA6A 1X5IA 3KS0H 1CLZL 2H2PD 4QHKI 3EOTH 4V2BA 1PFCA 5DHYB 2PTVA 1BD2A 4RAHA 1H8NA 1T1WA 4NQVA 4HZLB 5IMOB 2KBGA 4LFHG 2XZCL 5IEKA 4WW1B 4NKQB 3OAUL 4QTHB 3UROR 1CTNA 5E56A 1MJ7H 1GC1L 4I5BB 1DR9A 1G6VK 4Z7UA 3ZE1E 1A64A 4JY5L 2O5XL 5E2WL 5CZVL 5HGBA 1VERA 4PS4L 3OB0H 5D71H 1N4XH 4L5FH 2P7TB 1Q0YL 1NUDA 4ZUVB 1JNHB 4KK6C 4F7MA 3M45A 2DMKA 2ZOLB 3JWDL 2FATL 1D5XB 4JO3H 4U1JA 1GGIH 4PV8A 5KSAB 1DQJA 5I0DA 3K46A 4CL7A 1X7QA 1QYGH 5DRXA 3ROLA 4BZ2H 5AD0B 4BFEA 3G6AA 1MI5E 1OARH 2XN9D 3MRFB 4GAGL 2Y06H 4Y5XA 1JPST 2DD8H 3IDIA 5HYJD 4TVPL 3HC4H 2VXTL 3HE7C 2EO1A 3UDWC 1QHOA 1JWSB 2A83A 3EFFB 4P57A 4XP6L 1TQCB 1I7UA 4JGJA 4XVUC 4ODSH 5ESVA 1VB9A 4ZAKA 2AJZA 5IFHL 3MV9E 2DJ4A 4R0LA 2X4UA 2FJHB 4QGYA 5DI8A 1FVEA 4YIQA 4HXAH 4L3EE 5IWLC 4W68A 4BSWA 4LFHD 1S9VB 1A7RL 2QADD 4YR6A 1BJ8A 4TUKL 3LMJL 2QQKL 3SJVE 2DOCA 3T2OA 4HWEH 1FIGL 2FDBP 3MRPA 5IVZA 1CU4H 3U6RA 4LCUB 3BD5A 3C5SB 2AK4E 5B38B 2PYEA 2VLJD 3MBXL 4O51B 3TH2T 1XGRB 4O2CB 3TP4A 2UWEE 4Z5RB 5DC4B 4RAUA 2HFFB 1DBAH 2E8YA 4KMTH 1AGBB 3C6LD 4KJPC 1GIGL 4XMKH 1PKQB 4Z8FH 4M62H 4UT6H 4U6YB 5DTFA 2JIXB 2YZ8A 3GRWA 1YNKH 5F1SA 4M6NL 3VXOA 3O4OB 3ARWA 3EIFA 3VXUD 5HHNB 5DUMH 4XPTL 4I2XB 5DMYA 5DEGB 2AXGA 4LRIA 1H5BA 3GMOB 3PE9A 4JKPL 4OLZL 4D9LL 3MROB 1A7OH 5F1IB 2E9JA 4YPGB 1BQHG 5JW4N 1X4ZA 1MAJA 2NNAB 3LEYH 2AJUL 3O2VL 5EOQH 3SJVD 1KN2H 2QBWA 2YZ1A 4XWOD 4LLQB 1N0XH 4JB9L 4V1DE 5FYKE 1RK0A 3VD7A 3VE0A 5DD3L 3F5WB 3SE4C 3DO3A 4BSVA 2Z92B 1LO0L 3P77B 5DMJB 3BP4B 4MNGB 1RURL 2W65B 3VFTB 4GG6A 5E8DL 3FB7A 1RULH 3G6JB 1HHKB 3F7PC 3KLDA 4PY7A 1ZTXL 4PRHE 1FJ1B 1AHWA 2J1KA 3BD3A 4DN4L 1OSZB 3ELAT 4ZFGL 4UOW1 4KROB 2F5BH 2RFXB 3T0EB 2ATKB 1VGKB 4HW6A 1U95A 4KY1H 3D85D 1H9VA 3RWDA 4YNYA 4N5ED 5E9DA 3RWCB 1AD9A 1GSMA 1XGPA 3VI3E 1U8QB 1EEYA 3BGAA 3K80A 1AJ7H 3UJTL 1QKZH 5T5FL 5KW9H 2R1WB 5DT1H 3NCYS 3WS6C 2DQFB 2R39A 4LNRA 4NCC1 43C9B 5IESL 3IGAB 4X5XA 4WWKC 3FO2A 2DM7A 4PD4K 3TZVA 3WO4B 1F4WH 4X5WA 2KZWA 2LAGB 4TUOA 3E2HC 4QY8B 3OWEA 3FCTB 3KNBA 1BVLA 3O3AA 2EYRA 5F3HA 3F6LA 3HNSH 2FH8A 4X8XA 3AS3A 3ARRA 4BZ1L 3IVKB 4Z76A 4LLYA 3BVNA 4PRHD 2Q7YB 2YD4A 5T3XE 5T1MB 4ZNEE 4NQXB 5E8NA 1I7TB 1BQUA 1JFQH 4HGWB 5ALCL 1RIHH 5JDSA 5TE6L 3DARA 3MACL 5HYFA 1ULVA 3GSRA 3QQ4B 3WJJA 5E00B 4Y19D 3S5LG 3FN0L 3ULVE 5EBWA 1KOAA 4P2QD 4JPVH 4BQ6A 2WIMA 1INQB 3V4UH 3HI1A 1A0QH 3MRIB 2Q20A 4Q0XL 4DVBB 3KPPA 3HMWL 1JRHI 5CD5D 3OPZH 1AQDB 1V3JA 5HHVH 4RFEB 4QHMB 3MNVB 4G6FD 4GRWB 1V7ML 4XHQA 4ODWA 1KIQB 4PJEB 3OB8A 1JZ7A 4JFFE 3O8XD 4G8GE 3KPLA 4QNPE 3VI4E 4ETYA 4Y1AD 2FGWH 1P7KA 4EIZC 5BZWA 2IQ9H 1KIUA 1RZJH 2FBJH 4DVRH 4LCWB 4UNUA 4M6AA 2FHCA 4R96B 5TDNA 5F6IB 4WO4A 2IGFL 3UEZA 5FA4A 1JWUA 4WFGE 4NQCB 1DBBL 3LPWA 5EN2A 2I9LB 2VMFA 4S2SB 1A9EB 3L3IB 3JV5A 4NOFA 1YY8A 2O93L 4HLZG 1J0JA 1FN4B 1MFNA 5MEOA 2R23A 5DJXA 5I17B 2W0KA 1AGEA 2AV7A 3I2CH 2WW8A 1DUYA 3GSXB 3W9DB 3WNOA 5KS9E 4XNYL 2A1WH 4R2GD 1ES0B 4BJLA 4PJ5A 1YY9D 3CMOL 2BOBA 3DX7B 5DK0B 4XPHL 3ISWA 4JFFD 3DTXA 5D7KD 2X9YA 2BC4A 4PJIF 2OL3L 4DGVH 3FFCB 4NN6B 1B2WL 3V7AG 1K2DB 2ARWA 1UH4A 3OR6B 4QRUA 3D0VB 3BP5A 4KVCL 2NMSA 2VDNL 3ZT5A 3VG0H 5C07A 3L7FA 4PGEB 4E5XB 5GZOD 3C60D 2GY5A 3AREC 4DK3A 3R1GH 2ADGA 4JDTH 3VD4A 4XC1H 3MLYL 4PTTB 1TZIB 4PJ7A 5D1QB 4I77H 4WU5B 5K9OA 2FO4A 1MHCB 4MSWA 3QDAA 2L7JA 4FQ1H 3TA3B 5D7LE 3SCMA 3V7AE 1XCTA 1AO7E 2VR4A 5E6YA 4AY0A 3B6SA 2VRAA 4QKXB 1RUKH 3VH8A 3DPBA 2BNUA 1F3JB 2YPKA 4ZOCA 5EIIA 3L6FB 1ZHLB 4O02H 2VH5H 1IJ9A 3HAEB 2YPLA 1KJ3L 1IT9H 4Z0XB 4JFEB 3G5VB 4UZGA 2YMXL 5HI3C 4IRJC 5DFVC 3FT3B 5E5UB 1WQVT 1A5FL 2OSLA 3MLUH 4TTGA 3O2DL 1RU9L 4QRQB 4NDMA 3CFKA 3CZFB 2OYPA 1DBML 3WSQH 3DUUB 5E70A 5CHNA 5EBMB 1WBYA 1ZVHA 1FVCB 4E41D 1MJUH 3TBSA 1KCSL 2GJ6A 4H20L 3O4LA 4LARL 4ORGB 1N2RA 1JNJA 2VDMH 4MA1B 5CAYB 1JPFA 1HIML 1SJEA 5DQ9B 1H8OA 2F19L 3OJVC 4K3DL 1FC1A 1AO7D 5EZLA 3UTTD 1F00I 1QG3A 3QUMH 1EUUA 3C5ZC 3MLVH 1S7QB 1AXTH 4TSBL 5LG1A 1FVDB 1WICA 3MGOA 1Y18B 3TT3H 1XEDA 4S1DC 2CO6B 3HRZA 1XCQA 3LQAH 1AR2A 1WVZA 1LEKB 1EHNA 3JTSB 2QKIA 2EXYD 4ZS7H 3TPUB 1BZQK 4W81A 3HG1D 4UTAL 3VFMA 4M7LT 3SDYH 1H15A 4Z78B 3EJZD 1F11A 2Z91B 1G6RA 1MCEA 2I07A 3QCVL 1J8HD 3ZT6A 4K71B 4LSRH 2C1OA 4QXUL 1BZ7B 3OKDA 4XMPL 5SWSD 1F58H 3IT8D 4I3GA 3RNQB 1MPAL 1ZXQA 1AQKH 5FOBA 4M93C 4H5SA 1IGTB 3NGBB 1TPXB 3BE1L 4LHJB 1G7QA 5JZ7C 4PP2B 4HS8H 1H0DB 2ZKHH 5EIVA 2J2ZA 4O2FA 4TOYL 2EEBA 1OGAE 4ZFZB 2F54B 5EZIH 1QVOB 7FABL 4RX4D 1JGDB 4PBXA 2A9ML 4YHLH 4UT7H 4PJHE 4YGVB 4D94A 1XGQA 4P23B 5EPMA 4MAYA 4KHXL 4PLOB 3RVTC 2P5ED 1P4IL 4TRPL 3PIQA 3ARFD 4O58L 3WMSA 4U6XB 2XA8H 2FL5B 5C3TA 1FYTD 4X6FB 3QPQD 1M05A 1U8IB 4ISVA 3L1OL 2GTWB 5TPWL 3GK8L 2UZIL 1JYXA 3HMXA 3TBVA 1T4KB 4LHQB 1KT2B 1KJ2H 2J5LC 2DS4A 3P9LA 4Z7OE 5F9AC 4PV9A 32C2A 4ZSOA 2X4RB 1FRGL 1JZ3A 1C08B 4Z7UE 2XY2A 1T7VA 5I9QC 4WIQA 1RHHA 4FTVE 1HKLH 1AE6L 1MJ8H 2ED8A 3B83A 5GJTL 1NAMH 3O2WH 4X4ZA 1KB5B 2ZUVA 4K8RL 5INCA 3VWJB 3LH2H 1BFVH 4OZHA 5HDOA 4HBQA 1FORL 2EDEA 2HP4A 2ICEA 5C09A 4K9EL 2P8MA 1OAKL 4CVXA 4HUMB 1L6ZA 3MLWL 4J4PC 1IBGH 3S37L 2A77H 1A6VL 1HN1A 1BD2D 5EOTA 1J0ZA 4NCC2 1ZEAL 4HIJB 1L7TL 3H6JA 4OUUA 3T2PA 3MV7B 3VXRB 5GZNC 3OXSB 3JBG7 5D7JC 3QDJA 1KCUH 3VGEA 4P4KB 2F5AL 5JXEC 4P2OC 2VSDA 2VTFA 4ZTOL 3KYMB 3QIWB 4XRCB 4NO0B 5MEND 4EI5D 3LS4H 1A1MA 5JXAH 2XKNB 4UBDD 35C8H 1CS6A 1I1AC 4A6YL 1I85C 1IKFL 2R8SL 2CJUL 3TBTB 5IEHB 1CE6A 5I1AB 5FO8A 2DLTA 1JGVL 4JY4A 2DKMA 3QZWB 43CAB 3O6FC 1SBSL 1FAKT 1ZT1A 1U8MA 3D5OF 5FO9B 1MLCA 5AZEL 4MJ5B 4EN3B 5BMFH 4LCYA 5T1KA 4WDIB 4IJ3B 4LLAA 5DHVH 5FXCH 4LL9A 5HI4D 3WJLC 4OZGA 3RFZC 3AMKA 4KK9D 5DJ2A 2PYEE 3I50L 3MREB 2MQ0A 3U9PH 1AFVL 1P6FA 3NZ8B 4MA7L 3S96A 1CFNB 3SGDI 3CVIL 3W39A 4HBCL 3A6OA 5CILL 3X3GH 4EI6B 3P40A 3V9FA 1JI2A 5ENWB 3Q6FB 1A2YA 5GS0D 2FYYB 2R2EA 4FABH 2Q7NA 4NWUH 4ZAKD 5I1EL 3HE6C 4PUBL 1JNNL 2R1XA 5E94B 1FFNA 2HVJA 2W1NA 4AH2B 1IKNC 1RJLA 4LU5L 3CDGB 1A6ZA 1HOCB 1O7VA 3BQUD 5HI5C 4DJMA 2ITDB 3RVVD 5IB2A 2IBZY 2JKXA 4NJAH 2HJLA 5SWQB 5CEZL 5FF6A 1OWWA 5IHUL 4N0FB 5E2UH 4J2XA 4HZAA 1JUFA 1KJVB 2ERJC 2YD8A 3LIZL 2WLYA 3OR7B 3IU3A 4KDTC 2AGJH 1RHFA 2NTFA 2PW2A 4F3FA 2APWA 4M03A 2OTPA 4NRYB 2UZYB 3P11H 4H25B 2ZG2A 3NZHL 4GG6E 1A21A 3NCYP 1B3JA 4CN4A 1BQSA 1T03H 1KNOA 3RJDA 5F21B 2CUHA 1WITA 4D0CA 3D39A 1IC4H 5L7XL 1EPFA 3D25B 3MNWA 4JPKH 3QEQD 4OIIL 4TNWF 3WCYA 1LEIA 4IS6A 3QG7L 3SDXA 5CP7A 2GUOA 5CSBA 1UB5A 4R7NB 1J9CT 5EA0H 1KCRL 5TF1H 2VYRE 4NN5C 3UPAA 2V2TB 4LBEA 5E2VH 1M7IA 1BJ1H 4L4VD 1RZFH 1M7DA 4L8CB 4OBRA 4BH7B 4CAGA 4X4YB 4X9FA 1S3KH 1T20A 2X9XA 2LVCA 2IANA 3HE7B 3L3KA 2ZCLL 4MJ6A 2Q8BL 3C2AH 3NFNB 2JELH 2GCYB 3V2AR 5GRUL 1N5AA 1U3YA 1F4XH 5BV7B 1V05A 3T0VA 4DZ8B 2G9HA 5FGCB 4Z95L 1A4JA 1XIWA 1MIEL 2YRPA 1LO3L 3VWKC 1YEFH 4IRSA 2DJUA 3PABA 5E9DD 5BW7C 5I15L 1OTTD 1IQWL 3ZTJH 4RIRA 4NZUH 3GI8H 5EC1A 5KAQF 4TYUA 2YUZA 3QI9A 1YMHB 2DIBA 5FYLD 1IL1A 1NJ9A 1ND0B 2YSSA 1T04B 1DQLL 1XF1A 4KZEH 4NWTL 5KSBF 1RZKH 1D5MA 5IOPA 1VGEH 4PJ9C 4H88H 1K8IB 4HGMA 3CCHB 4Z77B 3NCCB 3BZDA 1FFOB 4P5TA 1BWWA 5I71C 1JGLH 4APQD 3MCLH 2BVQB 1UVQB 3PJSA 2EEAA 1U8KB 4F9LA 1LNUA 1EZVX 1MREL 2RCSL 1TCRA 1E27A 4HLJA 2HT3C 4QT5A 5DRNA 4ZD3L 5KVGH 1L9MA 1KLGA 4CW1A 4FQ2L 3EOTL 4QF1A 3ZTNH 2JK5A 1EAPA 4XCCL 5C0BD 5FECB 2HKFH 3ZKXC 2MNUA 2C4XA 5GRVK 2RHEA 2MQ3A 4GBXC 1P1ZB 4JANA 1BQLH 4JFZH 3MO1B 1AD0A 5KAQG 4PJ5E 3MPCA 1OAUH 4N0UB 4S0TD 2DRUA 3CH1B 4Y5VC 1A6UH 5FM5M 3BRDA 5GRXG 1QBBA 2FJGB 2NW2A 3CFJB 1WTGT 2EDQA 1HHIB 1FE8H 1VFBB 4CNIB 4HDIA 1WIUA 4JO3L 4ZFOA 4DKAA 2AXFB 2R15A 5IKCB 1V7NL 3FMGH 1MAML 3LKNB 3OKNB 3IKCA 3E6FA 5EUOF 4GT7A 2H6PA 3PGCB 1IMHC 3QEHB 5MP6H 4S1SL 2LU4A 2OQJA 4JR9H 1JWMA 4ZQKA 5TFSH 2Y72A 3GMQA 3U36A 1XGTB 3ULVC 2LQRA 2OI9B 3T77B 4NOBA 1ZS8B 3HC4L 3FRUB 4WWKB 1PY9A 2AERT 1Z5LB 3MSPA 4JZJC 1KB5L 4DGIH 5J9PA 4WW2A 5C6WH 4PJ5D 1ED3A 2YPLE 1S7XB 3PP4H 3MUY1 5F9JA 3QDMA 2NLJB 1Y0LB 1UACH 2NY5C 3QUYA 4DCQA 2CKBL 4PBVC 3FQRB 3UTSD 4GQPH 4HFUH 3WKML 5C07D 5CEXA 2G5BB 4AEHH 4ZMAT 5C8JA 4HUUA 5I0ZA 5MEQA 1AGDA 5D72H 1Y6MR 3MJGX 4HWEL 2GJ6E 1CFTA 3KLHD 3O4LE 1CU4L 3RWGA 4D0BA 1GAFL 3KPTA 4FQQA 4WJ5B 1FZMA 4F7TA 3ZKMD 3ILPB 1T5XB 4KUCF 2WP3O 4U6VH 1OW0C 4TPRH 3GUTA 4M1GH 1A14L 4MDIA 5L8KB 3LKQB 4F58H 1DBAL 4NZDA 3FB6B 4KMTL 4U05A 3WEXA 4XMKL 4Z8FL 2NXYC 1Q72H 3PQYA 4HKZB 2LAAA 1PSKL 1NQBA 2BRRH 3N1QC 4QHNB 4ZO8A 5DVKA 1YMME 4UV7H 1ZHBB 5HD8C 4MWFA 5CJXC 3RGVC 4J7RA 5IB1A 3S35H 1D9KD 4YO0B 3CUPB 5LGHL 2V7HA 3QO0B 3WNNA 1A7OL 1VENA 1PLGH 2B0SH 5C0FB 4RMSA 3D69A 3BPNC 3U0PB 3TO4C 5DWUH 4KKAD 1BZ9A 3LEYL 3ALXA 3RY4A 3S7GA 2FGZA 4X6CF 3BFOA 2EXWC 4FHBD 2BHZA 5E08H 2IC2A 1U6AH 5CCKH 4JY6A 1J12A 3CPLB 4NKDB 3P0VL 1K8DA 1ZHKB 1JL8A 2FHFA 4DTGL 2NX5B 3BP7B 4LF3B 4HK0B 4B5EA 5DJCA 4QTIH 3B9KC 4FMKA 1MJJA 1AP2A 2X10A 1TMCB 2DQCH 5CP3H 1RULL 5K9QG 4JLRA 3BW9A 1JZ2A 4L3CA 4HUVA 4NRZB 3O9WA 1KJMB 1FGVH 1FH5H 4Y16D 1HWGB 2C3WA 5ICZB 2GK2A 5JPNA 1MCFA 1FNGA 4IDJH 3KYNB 4DEPB 1T22B 1TJHL 4K7PH 5DJZA 2I9TB 5KSVA 3NN8A 2GHWB 2V2WA 4F7CA 1FNEB 3FL7A 2X05A 3QWRA 2A73B 1IEBB 1QRNE 5T3ZD 4ZSOE 3EOBA 4F15C 4P9HC 1OB1A 2AI0L 3D2UA 4PJXB 1E28A 5F9WC 5CZXC 1QLFB 4S11A 5KSBB 2JTDA 1CF8H 2IPTH 4LEXL 3LV3B 3QXUA 2X7LA 1QFWM 3MRQA 1B4JH 4KI5F 2J8HA 4XCEA 1N59B 4KKNA 4H8WC 3HNSL 5C09E 1T89A 4OLUH 1I3GL 1TJGH 4JKMA 4IRJB 4AG4L 4NIKB 3CFCL 3MA7A 4LQFL 4DKFL 4R26H 3LKSA 5FUZH 2EDOA 1N6QL 5JPMB 3RBGA 4U3HA 2VUOA 4PFEA 5DZOA 1VKXA 3EYFB 3FONA 3VGHA 3IXAA 1MRDL 3FQNA 1LP9F 4C56D 3I9GL 4UNVA 4KI1A 1PDKA 2JCCB 1EXUA 5B22A 1YN7A 1JN6B 5IJKA 1A0QL 1S7SA 1T0PB 2Q8AH 3VFRA 4HG4K 5BV7L 1PW3A 5IHZA 4NQDA 2J6EH 3ZDZF 1HSBA 4CJ0A 4U3CA 1BVKA 3F6IA 4GRLA 4IOIA 2IPKA 2DQEH 3C5ZB 2XACC 4FFYH 1MNUL 1KCLA 4RFNC 4OF5A 1F6AB 3IDJA 3ZYOA 1CD1B 5C09D 4NM4L 3DRQA 1SHMA 3NTCL 2OK0L 1G1CA 1RZJL 3WFHA 1WF5A 2ZUYA 3DVGA 4OZGE 1YC8A 1KEGL 3T0DA 3KPMB 4HKJA 3EDKA 4JFPB 2BRQA 2E27H 3C8HA 1P5VA 5I19L 3IDGA 5EUOB 4GUPB 3NA9L 4JFQA 3TM6A 3QDJD 1L4IA 4X6DA 3H9SB 2OZ4H 4X7FC 3ZHLA 3GMNA 4WHCA 4XBEH 5ID1B 2ESVA 4M93B 2XPGB 3ESVF 3Q5YA 5ISZA 3SGKA 5K59E 4IBLT 3QG6A 3SE9L 4KK5D 2HJFA 2PR4H 2VXVL 3I2CL 1BBJA 1KLUB 2ADFH 4LCIL 2A1WL 3UJJH 3WHXA 5BVPH 1NEUA 3GMRB 2VLRD 1QFWI 5IMMA 5ANMA 4YWGH 5TGBA 3O11B 2I60L 4G9FB 3JSSA 3X11A 5L2KD 5C0RL 1HDMB 3VXMA 1U2HA 4K7PX 3SPVA 5JNYB 3VG0L 1SYSA 2BCKA 3H7LA 3GSUA 2IAMD 4J3SA 4I48A 4OCXH 4XC1L 1WWWX 5FIEA 4I77L 4J23A 5C1MB 1MELA 2J5LB 4PRNB 4U7SA 4Q58C 4MCZA 4OV6F 2YUXA 4Y5XC 1QPXA 5IIEB 1U8HA 4ZO9A 3OAZH 5IW3A 2W38A 5I9QB 4YDKH 4WNQB 5LJYH 4KI5D 2EIZB 4JFXB 2C5DC 4NHUB 2FD6L 4LEOB 4XBPB 1OLLA 2DAVA 3RNKB 3H9YA 4YX2H 1LQSR 1LK2A 3GHBL 5C2BH 4OGYH 4L8BB 5IFJA 4ZUWA 1I1CA 3MLUL 2YC1A 2OR9H 3FOLA 3BGMB 3E3QE 4GW1A 3NACH 3GMPA 4DN3H 5GGVH 3ARDD 2J4WH 1KN4L 3DSNA 5J6HA 1L0YA 4LKCB 1MJUL 3OKLB 2XWTA 4G80B 2JJUA 1PG7W 4GO6B 1JGEB 1AR1D 5D7JB 2D7OA 5E5RB 3RJQB 3DX9A 4HK3J 4P2OB 3TN0C 2ICWA 5GGRA 1W72L 3ARPA 3GB7B 2WP3T 5SX5K 1E4XL 3K4ZA 1NEZB 4IIQA 1TETH 1WUNT 5L88H 1P7QD 3G04A 3D39D 1I1AB 1AXTL 2B8OT 2OTUB 2D31A 5GGSB 4OCLC 3WUWA 3TT3L 3QDGA 1NGQH 1CVRA 4BKLB 4LRIC 1YPZE 4L29B 3O6FB 3O45A 5EG6C 2AK1H 4NNPL 2X4NB 2LV4A 1KTDA 1N8ZB 1QLRB 1VACB 3SDYL 4FQIL 4K7FB 4WRLA 3DRTA 1YQVL 5JORA 1I3VA 3QHFL 4KRPD 3MNZA 3HHRB 5EU6E 1S9WA 2Z9TA 3ULVF 5B39A 3Q3GB 3NCMA 3WNKA 2IAND 3RWJB 3UO1L 3WFBL 1X5FA 1X5JA 1HK6A 1L0XA 4KMLB 4UQ2A 4KQ4L 3PL6A 2VQUA 4RGMC 3V52H 3HE6B 3KWWA 2IPUG 3SN6N 3GJFH 4XT1C 4MX7B 5EZIL 4OI8A 4OFYD 2BSRB 4YHLL 4UT7L 1J0KA 5CD3A 3VI4F 1NGWB 1I7ZA 3ARQA 3QFJE 1AHWC 3HI6H 4IRSD 2D7TH 4R6UA 1CIUA 2AKRA 3O6KL 1ZGLP 3UBXA 3IKKA 4LAQL 4Q9QL 2R69L 3UYRL 3BWAA 4JCMA 4HV8A 1EO8H 3NIDE 4ZG1A 5B3JF 3QI9D 2EDHA 3BXNB 2YWZA 2HTLC 2ERJB 4DUXA 3UP1A 3DGGA 3SHSA 3ULUD 4P9ML 2EDKA 1ZLSH 4KRNA 5I1KH 1MI5B 2R9HD 3HLAB 1IM3B 5FM4A 1FO0B 3N9GH 3MYZA 3GMMA 2FX8L 1RZ8A 4HWUA 3TZVC 3GSNB 5HGHA 4KPHL 3F7VB 5HDBE 5C0EB 2Y07H 4LRNH 4PJDA 2EH7L 3SKJH 2E7CA 3RL1A 1KB9K 2VLME 3L7EB 4NP4L 5KS9F 3EYOA 3RQ3A 5DJ0A 3MRKA 5J1AB 1NDMA 4P48A 3WXVH 3LH2L 1BFVL 1LWRA 3MV9B 5F97E 5GSVB 4N0CC 4GS7C 3HR5B 1CL7H 3OHXA 4L3EB 3BKCL 4GW5A 4EEEA 1UXWA 2ATPB 3VMOA 4OCSH 1MWAB 4NQSB 1I1RA 4OCMC 4MB4A 1BIIB 3HC0A 4ODVL 4NN5B 4OZIA 3EDDA 5KZCD 4QOKA 2AJVH 3K2UH 3WE6A 1MHHB 2X09A 5DMIL 3WJJC 3SJVB 4O5LL 4AT6B 3WIFB 5C0DB 1YECH 5T5NF 5GS0H 2A74B 2HLAB 1H8SA 3N1GC 5GSRA 1WEJL 3IETA 2AK4B 2WQ8A 4P2RA 3UTZA 3V4PL 3EO1A 2XXMB 4WTWA 5D7SH 1K85A 2UWEB 3LS4L 1V5JA 3MJ6A 3QDME 4HKXA 3DUSA 2DMBA 2FLRT 5MEPA 1V8HA 4XNXL 4L9LA 2H9GB 1QLEL 5C0IB 3RL2B 4RNRA 2ICES 4ZXBA 1JPSH 3GSOB 1IEHA 4OIAA 1AC0A 3VWKB 1CK0L 2OMNA 4KV5E 5BMFL 1IAIH 3PNWA 5GGQH 5ITBL 1NLDH 5IR1A 3FO9A 4OF6A 2VR5A 5DO2D 1NFDA 2VOTA 1FNSH 5C7XH 3QNYB 2VNCA 4WO4C 1TZHA 3T4AB 3U9PL 4N90D 1CTOA 1MFDL 3KPNB 2Q86B 5CGMA 2PF6A 1SY6H 4KQ3L 3X3GL 4V1DB 4H0GA 1I3RA 1D6EA 3DX8B 3LN5A 5K93A 4U1LA 4YHOL 3QQ3B 4PJ9B 4FABL 3VCLA 3RVXD 3AM8C 2VC2L 1CFQB 3SE3A 5T5NG 5I71B 2V5MA 1BQHB 1FNFA 1S78C 1WZLA 4PP1C 3QUYD 3QCTH 4P2YA 4RISL 3NIFE 1GZQB 4FFWD 4JGMA 5EIQA 4LLMB 1EV2E 5JIHA 2JJSC 4RGOH 5HPOA 4JO4H 4PRHB 3VFGL 1VFUA 2BDNH 2OJEB 2UV3A 2BMKA 4NJAL 1RUMH 3BDYL 3BH9B 4R4FH 4LHUG 2NR6D 1EGJH 1GOFA 2DLHA 3RU8H 5E2UL 5EO9A 1UXSB 1ZA6B 1MHPH 5IROA 4LSSH 5I74C 2C3VA 3P9WB 5DD6A 3B3IA 5FA3B 1KTLA 5CWSA 3SCMC 4HWNA 3ZKXB 1CDCA 1YNLH 3OXRA 1ZLWK 4ODTH 3STLA 5IV2A 4HEME 1RZ7L 2A6KA 3LB6D 3PQYD 4GBXB 4PG9A 4UMGA 4C4KO 3S88H 5D93C 5IFAH 4D2NA 2Z31A 5D2LA 5EBGA 3DMMD 3CLFH 4G6JL 4M02A 4Y5VB 2BVPB 2ITCB 4XP9H 1IC4L 2A0LC 2ZCKH 1DUZB 5E5MB 3QIUA 1AY1L 3GGWA 2NY4D 3CLEL 3MV8D 2P1YA 1N0LA 4MNHB 1F4AA 1R3HA 2HFGH 4NO5B 3ZSTA 1HINH 3L3GA 4J6RH 3B9DA 1NCAH 2P4AB 3SDDA 3I6LE 1BBDH 1NBYB 5AYQA 5TF1L 5HPMA 4LLDA 2HVKA 3CXHJ 5FYLH 5L8LB 2IALB 5E6IA 4GKNA 2APVA 2VQ1B 1F4HA 2YA0A 2A6DA 3MC0A 1LO5A 4CMHC 2CRMA 1FLRH 3QCUL 4Z7OF 2Z4QB 3TT1H 3BPCB 1CDBA 5SV4A 4L4JA 4W6XB 4EKXA 3A6CH 5IM7B 3NFPA 4R2GB 1KIRA 4LHUD 4R90H 5GGRY 2BSSB 4PLNC 4G8GB 1J05B 1A6WL 1NMAL 2XTJC 3FQUB 4YZFE 3NOIA 1NUGA 1UWXK 3RKPA 2XWBA 3G9AB 2VITB 5FM8A 5BVJB 1EHAA 2ILLA 1NCWH 3S34H 2FO1A 3HZKB 3X12B 3GDBA 3VGBA 1OD9A 2HRPH 3UTOA 5F6HI 5E7FA 1II4E 4I4WB 5DDHB 2RQ8A 5DJAB 1KENH 5H37G 1ADQH 25C8H 2HFEB 4M8VA 3D2UD 4OAWB 2PYFA 1CL7I 3ULSB 1K6QH 1MUJA 2KUTA 2B1AH 4OGAD 1R3JA 1KBGH 3RY5A 2PTUA 1DLFH 4NQDE 4KZEL 4PTUA 4ELMA 1RZKL 1VGEL 4H88L 3TVMA 3ZYJA 3HUJA 2NXYB 3QWQB 4PRPE 1KPUA 4QCIA 4IRZH 3GSVB 4NKMA 5ERWB 3MCLL 4E42A 4R97C 5KS9B 1ZWIA 3L3OB 3KPRD 3V6FB 1G7PB 5D1XA 1MIMH 3B8SA 3FT2B 1NC2D 3RGVB 4MAYC 4MJ2A 2GK0B 3CFEA 3OKOA 4I0CC 2UY7A 2D7MA 4MJ4A 4E0RA 5CMAB 3BPNB 3TBWA 3TO4B 5CINL 1FQ9C 4LKXA 3V6ZB 3PGDA 4G6ML 1U92B 4PIRF 3AS0A 15C8L 1QUNA 3BEVB 4RMWA 3EYUH 3UAJD 5FKPA 4LPTA 4RGND 2O61A 1BM3H 1QBLH 2ESVE 1S9XB 1XR9A 3QQ9D 4S0SD 5ISZE 4AEIH 4JM2D 3KJ6H 1QEWA 4LMQI 1JGUH 1MCJA 1ACYH 3P4NB 4POYA 3KPQB 5D7LB 3B9KB 5F7UA 1BQLL 3OGOE 3FO0H 1AO7B 4YXKH 1OAUL 4L8SA 1KC5L 4QXGH 1A6UL 4H1LB 1CFVH 3B2VH 3CVHB 4XCFL 2V2XB 4GW4A 4M8QA 3VXME 4F37F 3MLSL 4NHCL 3LPGA 4MZ3A 4G7YH 4DGYL 1FE8L 3GSQA 1I9RL 2UVEA 4ZUSA 2EO9A 3B9EA 4QRPA 1Z0NA 1JHKH 2CDEB 3WD5H 3FMGL 1MCQA 2CO7B 5TE4L 5C9JA 4WHDA 3CFBA 4U1IB 4C58B 4X9BA 5MP6L 4I3SH 3WHE1 3M1BB 4OB5L 4JR9L 5GS2D 4X99A 5GGTH 4F15B 5LWYH 5ISZD 1CLOH 5F9WB 1OT2A 3LKRB 2HKHH 5CSZB 5E24E 3VFSB