1D9KC

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
183
structure length
183
Chain Sequence
IEADHVGSYGITVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFAQLRRFEPQGGLQNIATGKHNLEILTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 183
sequence length 183
chains with identical sequence G
ec nomenclature
pdb deposition date 1999-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kC02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d9kC01
3OG4B 5BQ7A 2YPLA 3NMEA 2JELH 2E8YA 1D5ZB 1K85A 2WM0A 5DWUL 5DJCA 2FWOB 3BGAA 3CXDL 4J4PD 3ZKMD 5ENWB 2VNCA 1EV2E 5JHDB 3DRTB 3DVFA 1QBLL 4HXAL 4M7LT 1K4DB 4HFWB 4G9FE 1C1EL 2HVJA 5CGMA 3LPGA 4HFUL 1FL5A 5TE7H 4FQQA 1X5YA 5LGHL 2ZUXA 4LRNL 2VR9A 1DANU 3P40A 3OPZH 5HPOA 3QWRA 2EYTB 1C5DB 43CAB 3F65A 2BDNH 3T0VA 1I1AB 2WAHA 4R2GB 5HPMA 4PJ7E 3KR3L 4UOW1 3B2UD 4RGOH 2D7OA 4GS7B 4OGZA 4YDJA 4UT9H 3KLAB 1RMFL 4ZSOE 3HE7D 4JB9L 3AU1B 4NNPL 1KB5H 3NIGE 4XP4L 1TQCB 3BO8A 2KBGA 3LN5B 4JKLA 4E5XA 3VCLB 4YFEA 2O61A 2E7LA 2V17L 1H3PH 5KSBE 1MAJA 4TSBH 1NFIB 2IANE 1QP1A 1L7IL 4X5LA 2VLRB 2B5IB 4P2QA 5SWZA 1OT1A 4XNYL 1A6UH 1NFDF 4CVUA 3MGOB 4ZFFB 3KPSB 2P5ED 3OX8A 1UYWH 4XH2A 1MCPH 1RSFA 2J8UA 4K23L 4P2CG 4L4VD 2NY2D 1BZ7A 4LVHC 5IBUG 3DSFL 4XBEL 4IM8A 1QLEL 4LIQH 4CGTA 2QADB 1T0PB 5FEBA 5HGHB 4H26B 3W0WB 1R5WA 1J9CT 4J3UA 5HHOB 5KW9L 2O5ZL 3BWUC 4K7PL 3LIZL 4BKLA 1K5NA 2VXQH 5I17B 5ICYA 5DJAB 3HR5B 5HD8D 5KSAA 2K7QA 3C09B 5I1HH 4YHPA 3CFEB 5ETUB 2FHFA 1FAKT 4PGCB 4CADA 1JRHL 2XA8L 2IFFL 3CFKA 2OX5A 1NBZB 3LH2L 1KIRB 2Y1VA 3HUJE 3H9HB 1QO3B 2G2RB 1ZGLB 3VDBA 4L3ED 5I1DB 3JWOC 2YWYA 4MA3B 1BOGB 3CU1A 3IU3B 3O3UN 1U0QA 4YWGH 4TQEL 4BFGA 4LARH 5DMGD 1YEJL 1T7WA 4QRQA 5ISZA 4R3SB 3GSWA 3O4LE 2UY6A 2CO7B 4TSAH 2DD8L 2I9TA 3BZDA 5MENE 1BP3B 3EGSB 3Q5YA 3SJVB 5AG8A 5DEFB 1CXIA 1Z9OA 4XWGL 4N5ED 4IJ3B 4QXTB 4Z8FL 2R8SH 1E4KA 1HQ4A 1KJ2H 3U6RA 4O9HL 4UI2A 4R9HA 1NLDH 5C1MB 4YAQB 4YZFE 3RI5K 4OZ4B 1UACH 1CFTA 1D5XA 1P5VA 4OLYL 4PRPA 5I1AA 3AFLA 3TA3B 1VPOL 4KTYA 3UPCA 5KSVB 2BVYA 4KJPC 3L3HA 5J11B 3OB0K 4TTDD 5LXGL 4U7SA 3BZEB 1KLGB 1NC4A 1KN2L 2HJKB 5IFJB 4J3WA 4J3VA 2BMKB 2HRPL 4DQOL 5IW6B 2AEIT 4OV5A 4L8SC 3HB3C 5DJ6A 2AW2A 2ERJB 4HIEA 1S7XB 4FZ8H 2XZZA 1RU9L 4JY6B 5GRUL 2VXUH 2YD3A 4URTB 4DKDC 4H8WC 3MCLH 4Z77B 4JJ5B 4NJ9L 5J0BA 5D2LB 3UJTH 1FIGH 5D5ME 3LKSB 4LDOB 4ODSL 2XG4A 2R23B 3FQWB 2XWJA 3U7WL 1QBMH 3S35L 4FTVD 3CH8A 5EBGA 3N9GL 1JWSA 4XNXL 2DLEA 4C57C 2CDGA 1IAIM 1OTSD 5HDBF 3UJIH 1CE6A 5F96L 1JHKL 2H32B 1N5YL 5D2NC 2GAZB 1H3WM 3BVNA 3MROA 5D7SL 4WU5A 4OUUB 5T3ZL 2EDTA 3UTSA 4JLRA 1RJZB 3BMVA 1CGTA 5DMKB 4UOJA 2ZUTA 3TBYB 4X9IA 1QSED 4N1CA 4DVBA 1NGWB 4FFYH 4BUGA 2SEBA 5DJXB 1IKFH 1TVDA 5D1XD 4KI1A 1FVCA 3L5JA 1UKTA 4EUPB 1WFNA 4JHAH 4JM2B 4D0BB 1X4ZA 2ICEA 4XX1E 4G8GA 1TTGA 2EDJA 1MVUA 3CSYB 4HMCA 3O8XD 4BZ1H 1H0DB 2XKNA 3MXWL 3T2OA 1F45A 1JPTH 1EXUB 3TCXA 1A7OL 1FNAA 3S96A 2V9QA 5LGHH 4LRNH 3G5XB 3LEVH 4AIZB 3E0GA 4D9QE 4EEEA 1G7HB 4RWHA 4WW2C 1EBPA 1ADQH 3VFPB 5DUML 2V2XA 5TF1L 3IDIA 3P0VL 1WBYA 3FTGA 3BPCB 5B4MD 2R0WH 4HQQL 2NNAB 3PNWA 1Y18A 1S78C 2HTLD 1FVEA 1CK0L 3D0LA 4QXGL 4QRUB 2E7LC 1NEUA 1AFVL 5I73C 4XP4H 1NLBH 2GTWB 1AGBB 4PPTA 3HCVA 1KFAL 1T1WA 3NZHL 2QR0A 4O58H 4PJBF 5FECA 3AREB 2GY5A 3BD4A 2OP4L 5B3NA 4QTIH 1AXSA 1I7UB 2ICWA 1T66C 5JW4N 1CFQA 1KJMB 3MACL 3P0GB 2VXSL 5JDSB 2HT3D 4XNYH 5I1LB 5LQBH 4LLVB 1PEWA 4OD1H 2I07A 3RY6A 1U3HD 4PG2A 4GMSL 5FHBL 4E0RA 4K23H 4CJ1A 2E9WA 5DJ0B 4ZUTA 2ADIB 3KJ4B 4I48A 4YPGA 1DQMH 1U8OB 5C0AB 4ZQKB 4XB8A 3WEXB 5E08L 3SBWA 3CX2A 3FCTA 5K59F 1FFRA 5GRYA 1AKJB 3RVWD 2O5ZH 2ZSWA 4K7PH 4MA7L 4MNQD 4XRCB 3HPLA 4EBQH 4DZ8B 3GHBL 1PYWA 1NMAH 1T6VN 5CD5D 1LE5B 1T7XA 3VGGA 4G80A 1RD6A 3B6SB 1JRHH 4P3CL 2XA8H 5D7IB 1KCRH 5GS0C 4OZHA 3CVHL 4F2MA 3E3QC 5E9DD 2UVFA 3WIIH 1DDHB 1I3VA 3S8WA 1IC7L 2HFGL 3IDJB 5CD3A 3DWTA 5JW4M 4YBLC 5DHVB 4TQEH 4HXBH 3VRJB 1XZ0B 2ATKA 1YEJH 3F7QA 3O41A 4IIQA 1DSFL 4ZAKB 5GGRY 4DGVL 1N64L 1KLUA 5DURB 4GW5B 4UU9A 1GZQA 1B2WH 1E4KC 1M6OA 2W38A 4LLMB 1WWAX 2L7JA 1Y6NR 4JFQA 4XWGH 2YKLL 1MCJA 4RCAA 3HNVL 5FYLL 4DFHA 3JWOL 3TJHC 3H42L 3FB7B 4KRPB 3BGMA 4LMQE 4XPFH 4O9HH 4X0KA 1DBML 2OXGA 3BQUC 2W60A 4JFPA 2VDNH 3DRQA 3PL6D 5JO5A 2RHEA 1JZ7A 4OCRL 4OLYH 1H3VA 3IFNH 4P2RB 1OAXL 3SDCD 3LRHA 4NHUA 5C0CB 2NQCA 4MQTB 3FT2B 4V2BA 1NQBA 3HKFA 1ND0B 2XN9D 1CXHA 2YD4A 3L5WB 1NAML 3GSXA 1DBAH 5EIIA 5FM5O 1D3CA 5C7XH 1PSKH 3P4MA 4XPTL 1EIBA 1KN2H 3D87B 4RAVB 4YR6A 4HWBH 1VFAB 2DI9A 4ODHL 4PJFF 2V5YA 4DQOH 2CKBL 1A1MB 1ZSDA 1ZVYA 5GRUH 5FAAA 5CGYD 1AR1D 1JTPA 1XIWC 5BVJB 2HFEB 2NY3D 5CBAB 4BQ9A 2XNAA 2ORBL 4ODSH 2P48B 1V3KA 1MAKA 5DO2D 3HE6D 2P5EE 4Z7UF 1MI5B 1N7ML 3SCMC 4L4VE 4N0UA 3N9GH 3R1GL 4NN5B 1RUAH 4QRRD 4ZUSB 3VFRA 3T1WA 5HDQL 1YEHH 2YBRB 4Z7WE 3WNNA 4H8WL 3CLEL 4E41A 3FZUC 1JHKH 4KKCD 1JZ2A 5JIKA 3AB0B 5C3TA 4PFEA 5T3ZH 1J0JA 5F1IA 3BD3A 3ES6A 4CVZB 3O3EA 1KB9K 2X4RB 5I76B 2D0GA 5C0RL 4Y1AA 4UILL 1YN7A 2BHUA 3IJHB 3RX5A 3KLSA 4HJJH 3D3VA 1H8OA 2PW2A 3VFWB 4ZMAT 3DGGA 4HS8H 1A9BA 1L7TL 4XC1H 3LD8C 5C9KA 4JZJA 3W39A 4WWKD 4WNQB 3MLYH 4JZNB 2VR5A 5KSUA 4PJ5B 5T3XD 1MWAL 4WV1B 1EZVY 1RZ8B 1T89C 4FXGB 4WDIB 5IV2A 3FT4B 2AJZB 1X44A 5GZOD 1QFUL 3P3YA 2IFGA 5INDB 1NUNB 1PKQE 2AS5M 4HUMB 2LU7A 3TESA 1BZ9A 4PJCA 4L4JA 1JN6A 1P4BH 4TVSa 5DUMH 5D1ZD 1T4KB 3G6DH 3P0VH 3B83A 1T5WB 5GS1A 1QRND 1FFPA 4N9GB 2CK0H 3LKPB 3VFOB 4AEIH 1CIUA 3EZJB 5J6HA 1CK0H 4R97B 4QXGH 1QLRA 5B8CA 1IGML 1AFVH 2RFXB 4ZFOB 4OAWA 4OCXL 4PJ9B 5BJTA 4WUUB 1KFAH 3VRLE 4GG8A 3KXFA 2VABB 1BJ8A 4MMZC 1JTTA 1BWMA 4OFYA 3EJJX 3RY6C 2AK1L 3CDFA 1CE1L 1RUKL 3TWCL 4L1HA 3MACH 4FQXD 3MLUL 4KVCL 4HH8A 4RRPG 3DECA 3RWFA 2UYLA 1KELL 3SE4A 4FTVE 5I30H 4GMSH 3LSOB 5FHBH 3WN5B 1CFBA 5MEOB 3BPOB 3PHOA 4P3DA 5IR1A 4Z0BL 5CILL 2W0KA 5IQ7L 3KPNB 1OCWL 3BKYH 3CZJA 1E4XH 1VFBA 1BIHA 4Z7QE 3MRHB 1IEBA 2C3VB 2FSEB 5IVXF 3NAAL 1Y0LB 4MA7H 1LD9B 2X4UB 3T0XA 5B39B 1XH3B 1QSFA 2IBZX 3GHBH 3BEWB 3TT1L 1QSEE 3T0DA 5FB8A 4YC2B 4FFVC 3IDMB 2H9GB 3UAJC 2GY7B 2BHZA 2P5WA 2R0KL 3EDKA 4XTRC 3CSBA 3UTOA 3CVHH 4RZCB 1OHQA 5I8KH 4JPVL 4OT1H 5E70A 1IC7H 5CUSL 2KZWA 2A0LD 1G7PA 4KU1A 4CVXB 2HFGH 3RWCA 1AGEA 1OGAB 4HUKB 3VI4E 3RHWK 4CMMA 1NMBL 2YPVL 5GRJH 3JTSB 2W91A 3RJDA 5K9OB 4YK4C 3L3IB 4Z7VF 3MR9B 1DSFH 1QFOA 1N64H 2N7BA 4NT6A 2MCG1 5GS0L 2BVQB 2J6EH 1G7QB 4APQD 4P3WA 4C83B 2OM5A 4GSDL 5AWNL 4BQBA 1CDUA 4I1NB 4D3CL 4GW4A 3VFNB 5EU6B 3S37H 5F1OB 3STZA 3TVMC 5FYLH 3SE8H 2R2BA 4PRBA 3JWOH 5HHQA 3SQOL 4U6VL 2UWEA 3TBWA 3FO9A 4LNRB 2QQKL 5A2LH 1FN4A 5H94A 4WI3A 3ULSB 1WK0A 4LLUA 1NGPL 3MV9A 1XF3B 5B21A 3EHBD 4K71B 1BBJA 1WF5A 3ESVF 4PJGB 4RSVA 4GQ9H 4MS8C 4PJEB 4W68A 4XZUA 3G5YB 3D2UD 1OAZL 4W70A 1D7FA 1I9IL 1KIUA 4NKIH 5IG7B 4F9PC 5L2KA 1BBDH 5MEPA 1EERB 4V1DA 2Q3ZA 2AABH 1G7IA 2CKBH 2H26A 4J3XA 4U1JA 5K9QI 2EXYC 2Z31B 3HMXH 4GQPH 2DB8A 5BO1L 3P0YH 5F9OH 3LKRA 1CXFA 4L8BA 2WNGA 2WQ8A 2GJ6B 3QRFM 1MFAH 1DBJL 1HHGA 5EOQH 1YEFH 4K94L 1TDQA 1MHEA 4O2CB 4L1DA 3EYOA 5EORL 3R1GH 3AMKA 3JZ7A 4OLWL 2P49B 2BNUA 2A6IB 3REWA 3E6FA 4XGZB 2X9XA 5EN2B 3LOWA 4PJHF 4H8WH 3ZTNL 4IRSB 1EFQA 1M7DA 4M6NL 3TC9A 1NL0H 3C5ZD 4E42B 4NUJB 4KMTH 4UILH 3SE3A 4OV6F 4RISH 2DQFB 1HHJB 4JDZB 5E6IB 3MX0A 4X80L 5E9DE 3FOLA 4Q6IB 5FDWA 1NBQA 5E2UL 3TO4D 1L7TH 4LEXL 4U7MA 5EZJB 4DTGH 1L4IA 4JN1H 3IT8D 4HZLB 3QG6A 4LVNC 5D1QA 4OZGF 4PUBL 3L3DA 1JZ8A 4LHUB 3I6GA 1ACYH 3NCCB 1AO7E 1UXWA 3CXHJ 1YEGL 2P8MA 3GMOA 4MLSA 3W9DA 3V6OA 2EZ0D 4X6DB 3QIWD 4MAYA 2CLZB 2LV4A 4RGMC 3ULUH 2B20A 2NYYC 2DICA 1QKZH 3X14A 5DC0A 5ESVA 3O2DA 4RBPH 3STLA 2VZVA 1X3DA 2DTSA 2EDLA 5GS1C 1LDSA 2X89D 4LAQH 2XQYK 3TBTA 2EO1A 4OI9A 1HXMA 2Y07L 4LHQB 1M71A 4X5XB 3FO2B 2B1AL 3DARA 3ILPB 2HJFB 2YUXA 3K80A 5EPMA 3F6IA 2LVCA 4XVSL 4NBYB 4R4BA 2IPUK 3QUZB 3OG6B 2AAVA 3HC0B 4JRXB 4DN4L 2DYPB 3ROLB 1J1OH 1IGMH 5C0GA 4X6EB 1W8NA 3DX9A 1FNGB 1NUDA 2QL1A 4OCXH 4OI8A 1S9XB 2ARJA 4JFDD 4ODTL 1JF5A 3RUGA 4L3AA 3WMSA 3EOBA 2NZ9C 1K8IB 3GSOA 4JKPL 4X98A 1QR1A 1JPGA 3BEVA 3FQTB 1YQVH 5IEHB 1VENA 5J13B 1RUKH 4I2XA 3V79C 2ZSVA 3MLUH 4KVCH 4Y16C 3RVUC 3EYSL 3MMEA 1Q72H 2HFTA 3H3BC 3IXTA 5T3ZD 2E3VA 4JVUA 4QRRE 5TDOA 3I84A 3OHXA 3LZFH 4QRPB 4K3JL 3HS0A 1K3ZA 3FT3A 3O6FD 1XGUB 4Y2OA 4ZXBD 3O9WB 2NY1D 1A6TB 4EQ3A 4GRLD 4PRHB 1YMME 4HIHB 1GHFL 2E6QA 1C5BL 1GIGH 2R0KH 3ULUF 2P4AB 3ORJA 4G7VH 5TDNA 5ALCH 3S97C 4LCIH 3N50A 1TVHA 4JPWL 1IM9D 1HHHA 1KACB 5CUSH 3UTTA 2FIKB 3U9PH 4KK9D 4DGYL 3O45A 3L95A 1HXYB 3W9EB 1CL7H 2M26A 4HGMA 4LSTL 3L1OL 4G5ZL 2RIKA 4QHKJ 5T3XE 1IFHL 5FCSH 2Z0BA 3NVQA 4WU7A 4HBCL 5A16B 3RTQA 3M17A 4EJ1C 4NO2B 4GKSB 5FYKH 1ZE3C 1NCAL 3PP3K 2ADJB 5LGJB 4PB0L 5ID0B 1BVKA 1FE8H 4KROC 1SJEB 2BERA 2DI8A 4G43A 4IOIA 2QQKH 4PP2B 2YWZA 1MLCB 1Y6MR 5IP4A 1B4RA 3MJ6A 5C6PB 2BXYA 4LQFL 7FABH 3BW9A 1QRNE 2DLTA 3QI9B 1W0VA 1OARH 1QG3A 4EUPG 1LMKA 2DAVA 1ZKAA 3OKOB 5J1AA 1RFDL 1OAZH 2QSVA 5F1SA 3ZT5A 5E94B 5DJDA 2VC2H 3ZDZE 2ICCA 4LCYB 3KAAA 4KI5F 1V8HA 3HMWL 3LKNA 1N59B 5JOPD 1ODAA 4IHOA 5C2UB 3BH9B 4KMQA 4YHNA 1ZT7A 1TITA 1MFEL 3V6FB 1KEGH 1DBJH 1N0XH 4NM8L 3Q3GA 5M95B 1BFVL 1T2QL 5BZDB 4M3KB 3DUHA 4K94H 3AY4C 2XTJB 4Y0GA 1VGEH 4OLWH 3RKPA 4DKFH 4XMKL 2Z8SA 1OAQH 4M1DL 1C7TA 2X4OA 1UJ3C 3SEPA 5DTFB 4ZUVB 3ZDXE 1UM4H 3MRKB 4X5WB 2Y4SA 4FXLA 3GMNB 5SV4A 1KENL 1YEKL 5E4EB 5IKCA 3ZKNC 1MFBH 1F2XK 2MOVA 3BAEL 2HKHH 1E6OH 4X80H 1EH9A 4PLJC 1LO5A 4ZPVB 5CSGA 5C09B 2EYTA 5I0DA 3RVXC 43CAA 3RPIB 2V2TB 1S7WA 4S1DC 3MRLA 1I1AA 1UJTA 3WJJC 3PWJA 1IGJB 1B6DA 2FGWH 5FYLD 4KFZC 1E4WH 4JQVC 3QUXA 5LKNA 3EO1B 2MQ0A 2IALA 1JMXA 1KCLA 4X7SL 1GVIA 1IGYB 1DEEB 3AU1A 4NZUH 1WIUA 4CU8A 2J8HA 3DI3B 4HW6A 5JTWA 5BV7C 4X8JB 4P4KB 5HI5C 2ZP0T 4XP5H 4IMKA 3MA9L 3GKWL 4UNUA 5C0IB 5I18H 2Y07H 1KCKA 3QXDB 2B1AH 4U1MB 4FZEL 3FQUB 2CLVA 3ZO0A 4HIIB 4M62L 5J56B 3QQ3A 4DN4H 2FATL 3U79A 4MNGE 1YNKL 3MA7A 3KPSA 1KSRA 4KJPD 4OLXH 3LS5L 5JW5B 2BVPB 3UO1H 4ODTH 3SKNB 2BC4B 5ALBL 3AC0A 5HGHA 2V7NA 1IM3B 4H26A 3K4DA 5KS9E 4KKLC 4CNIA 4OZIE 3VXRB 4GKZA 2IMMA 4RMQA 5JQ6L 1SM3H 2QBWA 4JKPH 3EYQC 3HB3D 1FG2B 1JNHB 3QEUB 3G5VB 5HY9A 3DURB 3FQRB 1DP0A 3OKKB 4M6MH 3UJJL 2X41A 4NQCB 2C7UB 3WXWL 2YRZA 3FONB 3AAZB 3T2QA 3GMLB 4OFKA 2AEWA 1MF2L 4R7DB 1BD2B 2RCSL 3BP6A 2F58H 4I0PA 4HWZB 4TSCL 1SHMA 4PRAA 4MA3A 1BOGA 2HH0H 2FBJL 5DD1L 3LKOB 4I13B 2QTEA 2P43B 4N0FB 1GHFH 4RFNC 4DW2H 2FNBA 5HYSB 3RDTB 4XNZC 4XPGL 3L3OA 4WHTA 5IVOA 3SJVA 5FOBB 3R06B 5DEFA 5H35B 4Y4FA 4AIOA 5E8PB 2YPLD 4MD5A 4QXTA 3U4EA 1MQ8A 3NABH 1WCBB 5L7XL 4DGYH 3WO4B 3C2AL 3T09A 3U30C 2D0HA 3ARQA 1FZJA 3L1OH 3V6ZB 4YAQA 4GRWH 2F54D 2E9JA 4LSSL 4OZ4A 4PY7B 3MFGB 2VN4A 5KSVA 4M61B 3MYZA 4HBCH 3PWPD 1OP3K 1XF1A 2FLBT 3BZEA 1IAOB 1B4JL 3MJ9A 1I9EA 1KLGA 3ARTA 3QWRD 1FPTL 2KUTA 4OD3H 4ELMA 2FZ3A 3CPLA 1A3LL 2NX5B 3GZKA 3N1QC 1R0AL 1U6AH 3K7UA 4YDVB 4LQFH 1GGUA 1MJ7L 2H6PA 5F9WC 3GRWA 1O7SA 3LKSA 2EKJA 1JNJA 4EKXA 1U2CA 1O5DT 4YDLC 4WI7A 2CDEA 1I9RH 5HSFA 2FBOJ 4DVRH 1S78D 2HP4A 2LU3A 4RDQG 3WSQL 3DX6B 1I8LA 4RDQF 25C8H 4JFDE 4CBPA 3VXUD 4OF3A 2GAZA 5BMFH 1QLFB 1S7UB 2GW5A 3QWOA 1LHZA 4EOWL 4OBRA 1RJZA 3F7YB 3X3FL 4TOYH 3FOMA 2VLKD 2R1YA 3NFSL 4G42A 5ITFB 3ARBC 2O5XH 1T66D 5I2IB 5DJXA 5CEXB 1AO7B 2NR6C 2VQUA 2NY4B 2BNRA 4HT1H 4OCMC 3MLXL 1S9WB 4HKJA 4X6FA 4Y4KB 2FL5A 3P73A 5C07A 5SWSD 1F02I 4YEFA 4EIZC 3B8SA 4JM2A 2XWTB 2ENSA 3D69B 4OZHF 5KOVC 1EFXA 1HOCB 5EBLA 1QNZH 1Z2KA 4HKXA 5GHWL 3QZWB 4UIMB 3QQ4B 4RQQA 3SGEI 5C2BL 1E6JH 1LO3L 1R5VA 1VEOA 4R8WL 3QEQD 5C0EA 3BAEH 4GAYB 3EIFA 2EIEA 1MHHB 3LDBB 2JJSA 3MGAA 2P1YA 1I1AC 3KPMA 2IBZY 2IC2A 4R2GC 4AIZA 3DGCR 4DOHE 4QKXB 3C6LA 1MQKH 2QHRL 5GS0D 4U0RB 1ZVHA 1WBXB 2CO6B 1G7HA 4LASH 4U7KA 1FJ1A 4GS7C 4O2FA 4AYFA 3VFPA 2YSSB 1KCVL 2BVTA 4LFHD 4XCYA 1NGZA 4KDWA 4MQ7B 1TQCC 3QG7H 1MRDL 3L7FA 4WTZG 2XKSA 4X7SH 1LEGA 1R3KB 32C2A 4MDIA 4IMKC 1CD8A 4QRUA 3WHE0 4YFLI 1A9EA 1AY1L 2GTWA 1H8NA 4F9LA 3MFFA 1OTTC 2JK5B 5DK3A 1ZS8B 5B39G 2IGFL 5EA0H 3CDGB 2B5IC 1IGTA 3GKWH 5FA4B 5B3JE 3TJHD 1AGDA 3KPPB 4PRPD 3O2DL 4OF0A 4GAJL 1LEIA 3F8UB 5F1NB 3GMMB 1RZ7L 3GSRA 2VTFA 4YUEL 3V4PH 4JY4B 2DOCA 4FZEH 1LQSR 1CD9B 5ACMA 3VFGL 4MD0A 4M62H 4LLVA 2NTSP 4MCZB 3RZCB 4YHIA 1YNKH 1A5FL 5BV7L 2QADC 3HAEB 2BOBA 5EO1A 3HC3L 1XF5A 4PJIE 2F5AL 3LS5H 1XCQA 3MUY1 1YMMB 4ZODA 3ZE2E 3CMOH 1R5IB 5JOPE 3B9KB 4L4TB 3C09C 3MJ7B 2C4XA 4YXHL 2Z8RA 5GGQH 4DZ8A 1XIWD 3UJJH 2AEPL 4OSUL 3WXWH 2NXZB 5JW3H 3WS6C 4NC1C 4HUNB 5MP6L 3REVB 1PAMA 1HH6B 1GC1H 1MF2H 3SCMD 3D39A 5DJ2B 2EDHA 3TN0B 2GJZA 4OIAA 4N8PA 4LLYA 3UTSD 2EYRA 5DHVA 2MKLC 3FZUD 1HCFX 1QHOA 1XZ0A 5BZWB 3FO0L 4DN3L 4LPWA 1MJ8H 3TP4A 1WFTA 1TVBB 4IJ3C 4TUJB 9CGTA 3LAFA 5JA9A 1NBVH 3JTTB 4PGDA 4BSJA 3RWJB 3VDAA 1J87A 1JHTA 2VLJA 4HH9B 4GXVH 5HGAB 4Y5XA 5D7JA 2V9TA 2PYFA 1WT5A 1Q0XL 4U3HA 4O4YH 3TA3C 4G8GD 5ACZA 2AK4A 4DFIA 1I7TA 5EBMB 1BFSA 4PRIB 5J11C 5FO7B 4LSSH 5DK2A 5CIPA 3MRNA 1F4WH 4PJCF 3VWJA 3C60C 4OCLC 5IFHH 2GIYA 1M7IB 1LK2B 4PD4J 3DXAA 4PJDB 5E95B 2ERJC 3MOBL 5I1IH 3G6JF 3R0MA 2UZXB 1RURH 1VFAA 3QUML 4L29A 1OF2B 3MLRH 4YX2H 3DUSA 1A1MA 3D9AL 4JFEB 1OWRM 1WGOA 4X7CC 4YLQT 2OL3B 1BIIA 1BREA 3NPZB 2HFEA 2ZUVA 5CBAA 3JVGC 5CJOL 2NY7L 3ZHLA 4LP4A 5F7HA 1QVOB 3MSPA 4MJIB 3FFCD 2IQ9H 3MLTB 4JO1H 3CZFA 4LHUG 4WCYH 1P4LB 5KTEL 3QXAB 4HUXB 4G9FA 2P45B 4HIJB 1BJ1J 1NGQH 1YEEH 2C1PB 4PJXF 4JFXB 1J86A 2DDQL 4EOWH 2DLFH 4XHJC 4N0YL 4CVZA 1P7QB 2X4RA 5JXAH 1BQSA 1CLYL 1G6RB 3NFSH 4AH2B 1FC2D 1U8KA 4NKDA 5BS0B 2YUVA 3M45A 1HIML 4PJ7A 2VE6A 3CFIC 4RFOH 2IPUG 1MIML 1RZKC 3L7EB 4L5FH 4P99A 4PGJA 1A7QL 2UZYB 4QOKD 4ZSOA 2A2QT 2I60H 3VXPA 2PTUA 3FQNA 5GHWH 4MD4B 4ODUA 5C2BH 4X7TA 2XTLA 2J4WL 1NDMB 3ZTJH 4RIRB 4WDIA 5KSBA 2NY5H 2ITCB 3MUJA 2IANA 1A14H 3MRCB 3BRDA 1JWUA 4FFVD 3UAJD 3HHRB 3IJSA 5INDA 4XTRD 1SMAA 1B0GB 1DLHB 2H2PC 4WHYG 2F54E 5LGKA 1KCVH 4K9EC 1T4KA 4D0DA 3QFJB 3BP4B 4H88H 4ETQA 1DCLA 4PB9L 3IF1A 1ZLSH 4JFHD 1MRDH 3PWPE 5JHLL 2FH8A 3LKPA 3QJFB 4KZDH 1ZT1B 3VFOA 3A0OA 4M7ZB 3T8XA 4XCCL 4JG1L 1A7PH 3AREC 4FRWA 1EAPB 4Y2DB 2RFXA 1AY1H 4HBQA 2IQAB 1JGDB 4NNYA 3PGCA 1ZHKB 4U1IA 2EDXA 3EBAA 1KIQA 4D9LH 2XRAL 3B9AA 3OQ3B 1OSZB 4U1KB 1MEXL 3TVMD 1U42A 2BRRH 2WWKO 3U9UA 3S88H 4ZYKB 4MXQC 4PV9B 3O2DH 1ZTXL 2AJYH 3HUJA 3RWGA 3FB5A 3KYMA 4I3SL 1UH4A 2DM2A 4UT6L 3KJ4C 3HI1A 3VFGH 4BELD 4ERSL 4ONGL 4OBSA 5L88L 4H25B 2HKFH 5T5NG 3UZEA 5T5NF 1RZJC 3LSOA 4HCRA 3HC3H 2FX7L 4UUJB 2D9CA 4NSKB 4MS8D 1S7RB 3UROR 1UZ6F 3KS0H 3KPNA 3O4LA 2YMXL 1EJOL 4JRWA 1MY5A 3VXUE 3V52L 5MENA 1WBZA 3QH3B 4KPHL 3U0WH 1DQJB 4NKMB 5T33H 2C3VA 3SE9L 4D0CA 2FSEA 4BFBD 4LKCB 2YEZA 2FCBA 1LD9A 5D72L 5B39A 2EXYD 1BLNB 2VLKE 3EYFB 2XA3A 3OJDA 3EW3B 2QQNH 5GGUB 1WAAE 4NUGL 4XNMB 1WVZA 1S5IH 4RZCA 5DK0B 5TDPB 1J05B 4M4PA 5SWSE 2G5BA 3SGDI 3PHSA 3KVQA 5TE6H 4G6AD 5E2TL 4ZAKC 5FF6A 4CVXA 3VXOB 1OWWA 3NZ8B 3S3JA 3BH8B 3RPKA 4PGEB 3HTLX 5DYOA 4ODVL 4MLIA 3N1MC 3MR9A 4DN3H 4YIQB 5I1JH 3QEQE 5ILTH 2FEEL 4KRPC 2BY0A 3LPWA 4RA0C 1JGEB 1S7VB 4MZ2A 5D5MA 3E3QE 5EWIL 2AV7B 2V7HA 1Q0YH 5AG9A 3KYAA 4JFFD 2A73A 4OCYL 3GSNB 1Q0XH 1IQDB 1AQDA 2VSDA 5FK9A 2R9HD 5JXEA 4FN0A 1HHIB 4MB4A 3ULSA 1JUFB 3U2SB 5B38B 5AYUL 2VL4A 3QIUB 5F6IB 4P48A 4PJGA 1JPFA 3O3BB 4X4ZA 4PY8J 5MERA 4FQLL 4LF3A 2D2OA 2H3NA 1VFOA 2NYYD 4OLZL 4HKBB 4Y7MA 1Z9MA 5FUZH 2DQDL 5FO9B 2VN7A 3PJSB 3ZE0F 3PHQB 2QQQA 3BDYL 5DD3L 2KQMA 1TJIL 3UTPE 4P5MB 4NN5C 2NY6B 1OAYH 1R3IH 1OM3L 3MLVL 2YRPA 5F9JB 1FGNH 1JGLH 5I1GL 5DUBB 1R6VA 3AB0C 2A6IA 4ONFH 5E99L 4PP1C 1MY7A 4KHXL 1U8LB 1LVEA 3HZYA 2ZG1A 2DDQH 3HNSH 4AK1A 2EDWA 4E42A 4N0YH 4NUJA 2BK8A 3OKMA 5T1LA 2OTUB 4JCLA 1CLYH 5EC1A 2NZ9D 3WUWA 4F7TA 2NY0B 2DQFA 4XPAL 1UB5A 3LMJL 4LMQI 2R2HB 1CGYA 1EDQA 3G5ZA 2VAAA 2VQTA 3RVUD 4Y16D 3O81A 4UDUB 1Q9OA 5KJRL 4HUVB 5EZJA 4Y5VA 5F6HI 4HZLA 4MCYA 3UTSE 1U8JA 1UFUA 3VFSB 3VI3E 3KDMA 1DQLL 4WV1C 3MRPB 5J12B 1QSFD 2NW3B 4X4XB 3TNMB 5IHLB 3FO1B 1CR9L 1HQRB 1TZHB 3OGCB 1BX2A 4MHHG 5D93B 3ZSTA 2J4WH 2X1XR 1HI6B 4C4KT 1IAII 4JHWL 1RZKL 2PYED 2A1WL 2CLZA 1QBAA 1B88A 1Q38A 2CUIA 3T04D 4NJAL 3TV3L 4EQ2A 1I9JH 2IPKA 4N5UA 2IF7A 2JCCE 4J1UB 4S10A 5IW1A 1AD0B 3K4AA 1FNSH 3QUKB 3BP5A 4I18B 3HC4L 4XCNB 1X5IA 4OCNC 3K46A 2Q1EA 2GUOB 4X5XA 4CL7A 1P7KA 3ULVF 2VOTA 3CFJB 4XAKE 4FFZH 5IJVA 4PJ9C 4JZOA 3JUZA 5GRWA 4NP4L 1CLCA 2DYPA 1IBGL 4XCCH 4UNTA 1DUZB 2IG2L 3O2VH 2OSLA 5E1HB 2EDDA 1TXKA 4K9EL 3V4UH 2BNQB 3B3IB 1MEXH 5JORA 4DKAA 5FYJL 4YGVA 3UCRA 2E7MA 5HYSG 3BUYB 5IMKA 1KCSL 3MV9D 1KPVB 4GBXB 5HYJB 1I3GL 4I3SH 4HKZB 3SKMB 3WN5C 5IEHA 3BPOC 4OGYH 1LO4H 3WCYA 4LVHB 1FGVH 3VXSD 1G7MA 4ERSH 1FV1A 4NWUH 5TF0A 1RVFL 1MFCL 3QDJD 4N8CL 4J4PA 3PWLB 3FFCE 3L6FA 2D7TL 5L2KD 2FX7H 3DLQR 4V1DD 5HHPA 2YMXH 4IOFC 4QRPA 5D7LB 4XT1C 5AAMA 1D5MB 4F57L 5C0BD 5KVGH 1S7QB 4LGPB 3O9WA 3QWQB 1A6TA 4YC2C 5I1CL 5ADPH 5TGBB 2YC1A 2G60H 3CIQA 3WLBA 4Q0XH 3MLPA 4MVBD 1FO0B 1OSPH 1RZJL 5HYEA 4HIHA 4TPRL 4UINH 5EG6C 1LDPH 1GRWA 3EJZC 3KLHC 5DD5L 2ZOKB 3QIBC 3GI8L 1I1RA 4QOKE 4H5SB 1XF2B 2FIKA 4W81A 3VFVA 1OP9A 1HXYA 3D5OF 4OLVH 2GITA 3E6HB 5FGCE 4UTBL 3OF6A 4XMPL 3S36X 3ME0A 2R4RH 5DRXA 5CFHA 5K9JL 4CU6A 1NFDE 2ZPKL 4BH8B 5EBWA 2BFVH 4FABH 4YXLL 1OOAA 1JYNA 2QQLL 2G75A 5ESQA 3U4AA 5JXEC 2E7CA 4PLJD 4JY5H 1SYVB 4OCYH 2P5EA 3BIBX 2X70B 4XI5C 4K71C 3RVXD 3UTQA 4J3SA 2DKSA 1NMCB 4FQJH 3LKQB 4S1DD 4XPBL 2YXFA 2PKDA 5I19L 1UA6L 4JFHE 3QI9A 4Z7WA 1UADC 3ZSSA 3VW3H 5DZLA 4AIXA 5D6CB 4U3CA 4NNXB 3QXTA 1U8QB 5KG9B 3QR2A 1UZ8A 5ANME 1JI2A 5DQDL 5FGBC 4C54A 1MCNA 1DBBH 1WEJL 2Z31C 4WFFD 4D8PA 4DEPB 5DHYB 4N0RA 5IIEB 5JUEL 3QZWG 4PTTA 2FGZA 4K7FA 4P5TB 1N59A 5FKPB 3MJ9H 2DQDH 4X6CB 1PDKA 1EO8L 1F3DH 1F4HA 3NFPA 4AEEA 3MJ8B 2YD1A 4IS6B 1IQWH 3MV7B 2FO4A 1TJIH 4WFGD 5BZDA 2OR7A 3MLVH 4NQTA 4Z78B 4IRSC 3MRGA 3GRWH 2Z93B 4IBLT 4D9RD 1EJ6A 1N5AA 1DN0B 1RJCA 2FB4H 1W8OA 2VDML 8FABA 1UWGL 1OTUD 1PBYA 1WC7A 2HFFB 3MRKA 5GGVY 2ITDB 5E6IC 4KKLD 1PKQA 3GMNA 4Q6IC 1UQSA 1YNTB 2LFGA 3EYQD 1LEKB 4ELKA 3HZKB 4XPAH 3LMJH 5EU7C 3J7HA 4M8QB 1QFHA 4M6AA 3MV8B 4NKQB 2Y7QB 5EOCH 2V2TA 3RPIA 4JR9H 2ZUYA 3KPQB 3DBXB 2PXYB 5EOTA 5CS7A 4XBGB 3HAEG 3GIVB 3H9SB 4MZ3A 4QYOB 2R15A 5DJZB 3VD5A 4ONHB 5E8NA 1YJDH 5AD0B 4XBPA 4L9LB 1IGYA 4N90D 5DS8A 1CICB 1ONQB 4O00A 1RIVH 1XT5A 5LWYH 2V5MA 5CCKL 4RMVA 5DFTA 3V7AG 1C5CL 4JFFE 1JK8B 1Q9LA 4KRNA 4X8JA 4P4KA 3NA4A 4BFIB 5F7DB 1FZMB 5CAYB 3MGTA 5IB5A 2OQJB 1IAKB 4FTVA 4N0CC 1Q9KB 3QUZC 1RJYB 3MRJB 1ZEAL 5I1EL 1BPVA 4Q74A 3N1GC 3V9FA 2APWA 4ELMF 3MV01 3OAYK 4LSUL 3QCVL 5EUKA 3VRIA 4HIIA 1A3QA 4FQIH 1SQ2N 4A2MA 4LLDA 5T5FH 3L3JA 1IBGH 2FLRT 4OM0L 2X4QB 3BZFB 2R0ZL 3H2WA 1MPAH 4KY1L 1QSEA 2BVPA 3F12B 5AUMA 5BRZB 4K9EH 1UM5H 4RMWA 3PXHA 3BZ4B 4RFEB 2E27L 2BC4A 5J13C 5D1XA 1G9NH 4ZFOL 3VXRA 2ZOLB 1KCSH 1NCBL 1I8MB 1I3GH 1FG2A 2VDPH 1JNHA 1P5UA 4FA8A 5EZIL 1Q1JL 3WD5L 4I0KA 3FQRA 1FFOB 3VH8A 4K55A 2VL5A 4QHLB 4UDTB 3TIDB 1U8IB 3O8XA 3O9WC 1VESA 4R7DA 1BD2A 1RUPL 2BXZA 3AVEA 5H2BB 2C1OB 4LCCB 2ZUQB 4K3EL 2AVGA 1JCKA 1YUHA 5I1CH 1P2CB 1H9VA 3LKOA 5DLMH 4MXWH 2R2EB 5EU5A 5GQBA 3INUH 5GIRB 3LQAL 1T0NB 1ZOXA 4L8DB 1RZJH 4N0FA 4I3RL 4KUCF 5HYSA 4BSWA 3RDTA 3P4NA 1E28A 3ARBD 1IVLA 4QHNB 1KCUL 1HE7A 4JO3L 4GG6B 4QY8B 2NR6D 3BIAX 5IOPB 5JOEA 1WCBA 4TNVF 3UXFA 1I8KB 3OAZK 5JHDD 4Q97A 1HEZA 2AQ2A 3IAPA 4PY7A 5SWQB 2X4TA 1MCWM 2PYEE 1OP5K 1A0QL 3LRGA 3DVNB 4HK0A 5DHVH 2ZPKH 3MLZL 3SGEH 3BQUB 3OXRA 5E8OA 3X11A 4IRJB 4FFWC 2O5YH 1E4JA 1I1AD 1U3HA 4R2GD 4NZRH 5CHNA 3T3PF 5K59E 4P9HC 4YDVA 4XPBH 3V0VA 1CGUA 1MCLA 4DJMA 2VZ3A 2EH7H 3SDXB 4J12A 3T2PA 2NLJB 2Y25A 5CIPH 5DQDH 4W4OA 1MCEA 2BRQA 4HPYL 1P4IH 3S5LB 3L3KA 1I3UA 3O6KH 4XVUC 1OTTD 4NQUA 5E9DA 3MV9E 4HV8A 1U8NB 1TFHA 2VLRD 4O02H 3F7YA 4NKOA 2GI7A 2XTJC 4NHCL 4QF1A 3VXSE 4XP1H 3QDJE 1ZT4A 3KPSD 2JIXB 4DAGL 1P69B 1UCBL 5I2IA 2GSGA 1AO7A 3DV4A 4NOBA 4V1DE 1YPZF 2PO6B 2CRIA 1RIUL 2XOTA 3QQ9C 1SBSL 4R90H 4Y4KA 4WEBH 2QADD 2IAMB 3KPOA 1WJ3A 5C0BE 3W0WD 1KBGH 1RZIA 2VDMH 5HHOD 3TIEA 1N8ZB 5DQ9A 1L9NA 2HLAB 3ARYA 5E4EC 3I02B 5E7BA 3WNKA 2OTWA 5EUOB 5GGRB 5F7KC 4HUUB 3EFFB 1FVDB 3IJYB 3PL6A 1HKFA 2R1XB 1MHHA 2NXYB 1IC5H 4WO4B 3SDCA 1LK3H 5IHZA 3IETA 1FG9C 5IBTL 3EFDH 3ARGB 1XEDA 1CZ8L 3ECBB 1HINL 5IF0A 4QGYA 1QSVA 5LBSL 4IDJL 2FJHB 1MCWW 1LP9F 2YSSA 4UV4L 3ROOA 1S7SB 5D6DC 4RWYL 4NZDA 1J12A 4P57B 4MQ7A 5HI4C 4M03A 3SJVD 5DD6A 1R3KA 4P4KC 3OR7B 5E56A 4WI2A 5DMIL 3TBSB 1EO7A 4HK3N 4LCWB 2VISA 5CCKH 2WBJB 5DGRA 4BK5A 2JK5A 3HE6A 4EDXA 5C0FB 4YFLF 1AXIB 1JP5A 2VERN 4YNYB 2H1PH 4JVPA 4TUKL 4Y5YB 1TETH 3KPPA 4QRRA 3TGXA 4UNVA 1QYGL 3CCHB 5JA8B 3GMMA 2BVEA 2JJTA 1XF4A 3G9VA 4LSUH 3K8MA 2A6DB 4PYHA 3DO7B 4J3TA 5K9KB 4QLRA 4WFFE 4O51A 3ZHKA 2PW1B 4AL8H 3HRZB 1YMMA 3MXVL 4ORGB 1H3XA 4NRZA 3WIHA 3B9KA 1AHWA 1ZA3B 4FHBD 2E27H 2WUCL 2LABA 3PUCA 1U91B 4L4TA 3MJ7A 1NJ9B 4NPYB 3HPJA 4YH6A 3WS3B 1PEZA 3F7VB 2CSPA 4WFGE 3NCYP 4NC2B 2I9LB 5EB9A 3KWWA 1H5BB 1XGQB 2VKWA 1XFPA 1N3NA 4MB5A 4X6BB 5IWLC 4PJ8B 4ZOCA 5TQ0L 4KV5E 4MA8H 3REVA 1BFOB 4M8VA 4D9RE 1KG0B 2CMRL 5B38G 3ABZA 1RUPH 3ARRA 4MAUL 2V2WB 5DJ2A 5HGBB 1NFDB 3S4SA 4HCRH 4K3EH 1YY8B 4U3XA 4DUVA 3LQAH 1FQ9C 2YN5A 3QHZL 4LSRL 1ZLWH 2HTKC 5GGVL 4I3RH 4XHJD 5D1ZA 3MTRA 1T03H 5JPMB 2YHGA 1CU4L 2CIIB 3PGDB 4J6RH 5EO9B 3WO4C 3MBXH 5L2JB 1AI1H 1DTUA 1QRNA 4HS6B 5C86A 5FM5M 3H3PL 5DGQA 4MNHB 5HGAA 3VWKC 4JM2D 3WIFA 1RV6X 5EFIB 5BW7C 1BQLH 3BMWA 4XAWL 2EICA 2P7TB 5EBMA 5LG1A 2X4NB 4G6FB 3RAJH 2YS4A 1UGNA 1A7BA 5ERWA 3CVIL 2HN7A 1VGKB 3KPLB 4KK8C 2JKXA 1NCCL 4YHZL 6CGTA 1FYTB 1CDJA 2VDRL 3MLZH 1AGCA 1LK2A 2Q7YA 4WRLA 5MI0B 5E03A 4FQXA 1SEQL 1ZGLM 3GDBA 2OJEB 1OF2A 1U8MA 3QFDA 3TPUB 2ZCHH 1MFNA 2WV3A 3WKML 4KVNL 4FQCH 3GK8L 1KB5B 1QEWA 2H2PD 1VEPA 3RGVB 4FQ2L 1HSBA 4KDVA 1CDIA 1LNUA 1PY4A 1CCZA 1YYML 3DX8B 1QVOA 5FYJD 1MFDH 1F00I 1KTDA 3HUJF 3MLTA 3MYJA 1HILB 4PRDA 1EK3A 1P4LA 3OKEA 3ARED 4HUXA 1M05A 3T65A 4P9HL 3UDWC 4TULL 4MJ6A 4JFXA 1ZHNB 3MRRB 2WANA 4KJWC 5IM7A 1BFTA 4OQTL 1LO0L 4MXQD 2EIZA 2NY4C 2VDOL 3IU4H 1UH2A 1G6RA 4AH2A 4Y4KC 2EDKA 4DAGH 3RWIB 4FQHB 5C0AD 1UB6B 1FL6A 3P2TA 3WNMA 3QPQC 1W0WA 1SBSH 3E8UL 2DQCL 2ZJSH 4KHTH 4APQA 1J88A 1WICA 5F3BB 4HIXL 4WHDA 1AKJD 5EU3A 4YZFF 4TRPH 4YE4L 1I4FA 1CF8L 1KNOB 3WFEH 4AM0B 4NYLB 2CLRA 3KPRE 3TNNB 4LKXB 3LDBC 3DVIA 4LEOB 5F7EH 2VXVH 2AQ1A 1NDMA 4XC3H 2GSIA 4U0RC 4HHAA 3GO1L 1CIDA 2WQRA 5L6YL 1JV5A 4F7PB 5IBTH 3LQZA 4OIIL 4TNWK 1CZ8H 3D2UA 1HINH 3QJHA 4M43L 3RA7L 5J1SC 4MNGA 3SGDH 3HLAA 1JFQH 5JHDE 3WFCH 4BH7B 1CFSA 4WWKB 4ZAKD 3QFJA 1FH5L 3TF7C 5D5MF 4U1HA 4I3GA 5DURD 5HHXH 2JTDA 2HG5A 5KS9A 1EGJA 4OZIA 1BQHA 3ILQC 3PQYB 2AJSH 3K3QA 4Y2DA 3RVTC 2W9EL 2IQAA 4KRPD 5D7JD 2CRYA 4M7KL 4YEEA 5CEZL 5JOFB 2DI7A 1DE4B 4U1KA 1OSZA 2VXTH 3EYUL 3SY0A 2CDFB 4EXPX 4DZBB 2IH3A 4P2RD 1MIEH 3RZCC 1QYGH 5ICXB 3SHSA 5C0CD 4OGAC 3RNKA 1K4CB 3V5DB 4UT7L 1MJUL 3UYRL 3C5ZA 4H25A 5IROC 4KJQC 5F70A 3SDDB 3B9KC 1TJGL 1S7RA 1A4JB 1A6ZB 2BX5A 4LRIA 3T77B 2HLFC 3BIKB 1XR9A 4HUWB 3SGKC 4F15B 3UBXI 1QBBA 2R2CA 1XGPA 2QLVB 2VLRE 4U1SB 1J7VR 4LKCA 3RGHA 1YNLH 4LPVA 5TH2B 3P30L 1WUNT 3TZVB 1NUGA 4I4WB 3BDBA 2D03L 1INEL 3K8LA 3UC0L 3I3BA 2X4PB 3KPSE 3QNYB 4PJBB 1MI5D 5ID1A 4OJFL 3GI9H 2UUDH 2X4SA 5CINH 4B7IA 3IAGC 4XNMA 5IT2H 2W9DH 3DIFA 3TN0C 3P4LA 5F9AC 5TDPA 1J05A 4LSQH 3MLSH 1R3HB 5IQ9A 1SMOA 2CMRH 3MCKB 3C9NB 3W0WE 5DI8B 4POUB 3BHBB 1FZOB 5HHOE 4OLUL 2F53B 3NZ8A 5I0ZA 1JE6A 3IGAA 4M6OH 4UB0H 4PP1D 1HYRC 4XWOC 2APTA 2GTZA 3U0TA 5DJ8B 2P47B 3IFOB 4YIQA 3L5XL 3SKJH 2X89A 4YBHA 1D9KB 3Q6GL 5DDHB 3BYTA 3VMOA 3T1FB 1LO2L 5TPWL 1JGEA 1EBAA 5ESAA 1ORQA 5GSVB 3FRUB 4NC1E 1I3RB 2D7PA 3GGWA 2AJXL 5GSRA 1WWWX 3H3PH 2HJLB 3GJFB 4L9DA 5IJKC 1T5XB 4XAWH 2JB6A 3GSVA 3O3AA 4HX1A 43C9B 3AM8A 2WP3T 2GT9B 1HHIA 3BN3B 3MRIB 4P2YA 5AZEL 4PJ5D 3V8CA 1UM6L 4JFDA 2F15A 3Q6FA 2CK2A 1NCCH 3O3BA 4KROB 5C0NC 5JLZB 5E2VH 1B9ZA 1WZ1H 2VDRH 3MOAL 4XPHL 1RK0A 1IAIH 3SPVA 1SEQH 1CD1A 2A83B 4HLZG 4QNPE 1BQUA 3P77B 4K3GA 2FR4B 3T0EB 4ZOAA 1YECL 1KTLB 4F3FB 4YQXH 3EO0A 3PJSA 3PWVB 2VLLB 1AGFB 2X5PA 2KKQA 1X5HA 5GJSL 3AMLA 3O6FA 1PD6A 1EEZA 2IADB 4P5MA 5IVZA 3QO1A 3OXSA 1T7VA 1WIOA 2FX9L 4PJ9D 4WUUD 4YHOH 1A7NL 1H8SA 5GZNC 1FZKA 3NA9H 5DJYB 4P9HH 3L3GB 1G7LB 1TCRA 1EAJA 5D2LE 5KN5B 3SGJA 4XCEB 1IM9A 2BOCB 4XNQA 2OTUA 3GMPA 4PJFB 5BXFA 3L9RA 5DRWB 1SY6A 3KNBA 1EA9C 2Z8WC 4R0LB 2W9LA 5IB1A 3QHFL 5F7WC 1L6XA 3U0PB 2Z92A 1EEUA 2UVEA 3AUVA 4NBXB 4G9DA 3HG1B 2HT4C 4XNUL 3E8UH 1FNFA 4DGIL 3MRDA 3QEHB 4YBQC 4HUVA 4M5YL 3VFMB 3TYFB 2F5BH 4HIXH 1A47A 1MCFA 4S1SL 1V3LA 4YE4H 4Z7UB 3VFSA 4IOFD 4OFIA 3OZ9L 1P9MC 1P84J 2ESVB 1JZ4A 3TNMA 2WINB 5F8QC 3QO0B 3RL1A 2Z9TA 1KJ3L 2I25N 4NFDA 4P2OB 2Q8AL 3ISWA 1F3RB 1XCTB 5ICZA 2UZIL 3GO1H 3PWUA 4JM4H 4OCWH 1SJHB 1C12A 5BOZG 5L6YH 4W4NA 1Z3GL 3VJ6B 3TO4B 3EJZD 3KLHD 1JWMB 1FIEA 1OGAD 3KGRA 4OIIH 4J1UA 4M43H 4BYHA 3RA7H 1TCMA 3QDME 5EU4A 5FV2A 4PJIA 2P42B 3RL2A 2AEQL 4M7ZC 2AXFB 4WEMB 2GUOA 3O3DB 5C08E 4G7YH 4Y2DC 1WV7T 5E4IA 3R8QA 3G9AB 4S1QL 1ERNA 4EZMA 2JJWA 5IMMB 3C8KA 4S2SA 4W6WB 5EU6D 3LY6A 4WY7L 2XQBL 3IDNA 3VFTA 2W9EH 3N85L 1I1YB 3GBNL 5CEZH 2L0DA 3LN4B 3EYUH 5JXED 1CQYA 4PGZA 3T3ME 1D5BB 1JZ5A 4LLQA 5HYJA 4XI5D 4HF5L 3DVGA 3WFHB 2XFXB 2X6MA 4UT7H 3X3GL 5FYJE 1F4YL 3MPCA 1CLOL 4P5KA 3P9WB 5FO8A 4JO4H 1S7TB 2LQRA 4JFYB 1YC8A 1ZHLB 3CLFH 1GAFL 2DRUA 1X5XA 2WLYA 1HDMB 3VD4A 4FS0A 1S5HB 1NH6A 5D7LA 5E5MA 2Z31D 3HZMB 1D5MA 3WHXA 1S7QA 4RMTA 3UPRA 1YZZA 1MRCH 4LDEB 1UXSA 4U2YA 3GNMH 4NQDB 3WIHL 1EZVX 1FO0A 3WUZA 2XPGB 1G9ML 3QNZB 4OJFH 3AROA 3D0VB 4ZFZA 1B6UA 5C0AE 3I75A 1H15A 4M7JH 1I1FB 3NIFE 5HGGS 3DX7B 5DUPL 1JHLH 4U6YB 1MHPL 4IRSD 1KT2A 4JFOB 4QXUL 1XF2A 1QA9A 4BQCA 1CDYA 5J8OA 4U6HB 1T1ZB 4NRXB 3U46B 1A8JH 3X13B 2A9NL 1NAMA 4KQ4H 5D96B 4MWFA 5D7IE 3S5LG 5E6ID 4LCUA 1CLZH 2VITA 3UTZB 5IVXB 3VRLF 2HVKA 3A6CL 4L8CA 3C6SA 3DUUA 1N6VA 5DSCB 1A4KB 2BSSB 2FHBA 4LHUD 5FYJU 3OB8A 3ARDB 3QIUC 1JF1B 3K8KA 5F6IC 3SDYL 3SKOA 3HNTL 1I85C 1RHHB 5AZEH 2HA1A 4JAMB 4LPTA 4PRNA 2APFA 1W72H 1V3JA 5FV1L 1UWEH 4QWWC 5D71H 4NNXA 4L8SA 1ACZA 2E8ZA 4XPHH 1NEZG 1UWXH 4WGWB 4Z7VB 1FFNB 4U1LB 1YEIL 1A6WL 1ES0B 4AENA 3OKDB 4Z7QF 1KF9B 3S36L 1R24A 4UV7L 4U1NA 1YECH 4OGXL 5HHNA 1U58B 3MRQA 4P2RE 2NY6C 5C0CE 3FB8B 4N0CD 5GJSH 2RAMA 3MV7A 3QUZD 3IFPB 4JRXD 2A6KB 2DYPD 1CVRA 2EKSB 2RGSA 2OL3L 4KKAC 1MRFL 1U92B 3HR6A 1KPRB 2G9HB 3SGJC 3VI4F 3T2NL 3NFNB 1PG7L 1INDH 2IBBA 2ATPB 1JNLH 1INQB 2NY0C 2VH5L 1T0MB 2DQJL 1MWAA 2ITDA 1X7QA 2OJZH 4KJYB 1TNNA 1YNTA 1MI5E 3OL2A 4Z7OE 3QCUL 1PFCA 1D5IH 3EZ8A 3HZKA 2F54A 1KB9J 4M5ZL 4HWUA 1GGIL 1WLHA 1ZWIB 3MV8A 4MMXC 5HJ3A 4QRPD 2R69H 2M1KA 1G6RL 3R0NA 4DGIH 1U8HB 5J12C 2Y7QA 4M5YH 3PWPA 4JANA 3OKNB 2ZNWA 4RAHA 3TT3L 3AS2A 3I50L 3O9WD 4DWHA 4S1SH 1XR8B 5D93C 3C5SB 1DANT 1NANI 3GMQB 3OZ9H 4RMSA 3OJVC 3LB6C 3U1SH 4PRHD 2AJUL 4XBGA 5B22A 3GIVA 1KYOK 3QUYB 1KJ3H 1KJVB 1RUQH 3WFDH 4PJHB 3W11C 3BKCL 5FGRA 1DBKL 2VR4A 5AD0A 4L9LA 4JFZL 4WW2A 2AXGA 1CQKA 3TYGH 5D8JH 4I18C 2HRLA 3T4YA 2AERT 1JK8A 3LCYA 3IVKA 1IARB 3K81A 1AE6H 5F7DA 2DQTL 2OQJA 4FNLL 1FBIL 4R6UA 3M07A 4PJ5E 3OF6D 1F8TH 3MRJA 3ARFB 4G3YL 4WI9A 2A9MH 4PS4L 4QHMA 5IFAH 1L9MA 4JREB 4O2EA 5I8CA 3BESR 3VXUA 2GFBB 1DN2A 2QHLA 1NAKL 4N68A 2DWDB 4OZGB 1BF2A 4GUPB 2X4QA 3RZWA 4QEGA 5CEYB 2O93L 1KXVC 2VLKA 5DRZB 2A6JB 2XWBA 5BRZA 5FKAB 3F12A 4GBXC 1EGJL 1OPGL 3O2WL 3BZ4A 1WAAA 3IAQA 5EO0B 4QRSA 1YEDA 1IL1B 4FFWD 2ZOLA 1II4E 1KIPB 1T04B 5LCVL 3QI9D 5SWSA 1MCOH 2J7LA 4NQEB 4M7LL 2X42A 3GJEB 3KLDA 5F7UA 5E5RB 3X3GH 3F58L 1B90A 3IS1X 2ZCKL 4ZPTB 1XGTA 1M4KA 4JVWA 4NBZB 3BKMH 2PTTB 4WUUE 3SOBL 4N8VA 4ZUWB 3RWEA 2X44D 1WITA 3QEQA 4K2UL 3GSQB 2D0FA 5LAXB 2F9BT 4LU5L 1CFVL 4G8IB 4V2CB 4CN1A 5IESH 2VDLH 3BE1L 1A6AB 5CSZB 4XVUD 3FN9A 5F1KC 5GIRA 3RNQB 3WIHH 4HJ0C 1G9MH 3U7YH 5DT1L 1ED3A 3P4OB 1MH5A 2XTJD 2EXWC 4Z76B 2Z91A 3FMGL 2W92A 1IGFH 1DUYB 3CDYA 4PG9A 5DUPH 3DV6B 2VDKH 5DVLA 4GG6A 4MA1B 2FX8H 3DTXA 2D7NA 3QQ9D 1ZA6B 5T3XH 1EPFA 2GK0B 1DQDH 3WL9B 3VFUB 1ZVSB 1RZFL 5J9PB 4HC1A 4JO2L 2DQHL 5E00B 5I8OL 1MUJA 1TJHL 3BQUA 1AP2B 3OSKA 4OF5A 5C09D 4PBVC 4ODXA 3V5KA 3AXLB 1DQQB 1OGAE 1NMCC 5BQ7B 2YPLB 2QSCL 3WE6A 3C60B 2FD6L 2XKUA 4GXUN 5DJCB 3PGFL 2XACC 3HNTH 4HLJA 3TCLA 1QQDB 3IDXL 3ET9F 4K8RC 4LSVL 5FIEA 1P53A 3GSNL 1OL0A 5CEZD 4DEPC 4FQQB 4KK5C 4HD9A 4XHQA 5EU6E 3V0AC 4WFED 5HI4D 4XP6H 4P5TC 4RBPK 1OQOA 3A6BL 2ICWI 4UOW0 1XIWA 4P4KD 5IK3A 5TFSH 1A6WH 4XXDA 4WVRA 5BCAA 3R4DA 4JQIL 3K2UH 5DVNA 5HPMB 1GGBL 2F74B 5CKAA 3SCMA 4LOUC 3GBMH 4PJGE 4TNWF 5DR5L 4AMKL 4PJEE 4YDJB 3OAUH 4KTEL 4NM4H 3U36A 2XY1A 4AEHH 1GGCH 4K7PX 3O6LL 3C87A 2K3TA 1RULH 5T1KB 3V4VH 1UT9A 3BO8B 3MNVA 4Z5RA 3C08L 3U83A 4E5XB 5I1KH 1DLFL 5DXWA 2MPAL 1MHCA 4GXUM 2O61B 1PG7H 3PDOB 3OJMB 5T1DL 3VXRD 2AJVL 2DQUH 1AQKH 1N8ZA 1P84K 2GJ6E 2HWZL 4QHUA 2DQJH 4X99A 1CXLA 1K9TA 1U8PB 2FJFA 5IHBA 4P2QB 5SWZB 2A77L 5DWUH 2JCCA 4NQCD 3CXDH 4JKWA 3QDMB 5J6GA 1I7ZB 3C2SA 3OX8B 1QBLH 4HXAH 2J8UB 2MHAB 4PV8A 4RGNB 1BZ7B 5C08B 1C1EH 1BD2D 4WO4A 3BISA 2PXYC 3M1BA 3IB4A 4HFUH 1NBYB 1CGVA 1G6RH 4OB5L 4TYUA 3B5HA 1SY6L 2ZCLL 5HYFA 3DHMA 3TT3H 3ARGA 3I50H 3EOAA 2AI0L 3NH7L 1R5WB 1ZHBA 1T89A 2FJHA 1YMHB 4UIKL 1K5NB 5ICYB 4L9LC 5KSAB 5D9SA 4JRYB 1M7XA 4J2XA 1CICC 1MCRA 4XCFL 3RDTD 5CBEA 4YHPB 1IEAB 2Q20A 3KR3H 4CADB 5HDOA 3VGHA 3VXTA 1DBKH 3QCTL 2HTKD 3ZL4L 3TBSA 1B0WA 1P6AB 5EU7E 3NN8A 5ITBL 1RMFH 4JB9H 3KJ6L 4GW1A 4HPOL 3LV3A 4NNPH 3TPKA 3CH1B 4DKEL 4I77L 5C0JA 3CX5J 2DBJA 5C0FA 4YNYA 2M8XA 3FFCA 4FNLH 1FBIH 4PJXE 4BA8A 3FB6B 4X4YA 5ISZB 2V17H 4QRQB 1RUML 4X6DE 4PS4H 3HE7C 3BFOA 3P11L 2I9TB 4L3CA 2A6DA 1L7IH 5AAWA 5F44A 2OK0L 4KK8D 4HDIB 1NDGA 4P23B 4H20L 2AKRA 1HQ4B 1BM3L 1EGJH 2R1WA 4WTWA 3U6RB 3O2WH 1WSST 5E6YA 2NX5D 3ZDXF 1KGCD 3DSFH 1U91A 1NJ9A 2WBWB 3FHAA 3I85A 4XBEH 3RP1A 1QLEH 1CFTB 1D5XB 5I1AB 5C6TL 1A3RL 4QOKA 4TUOA 5KW9H 4JRXE 2ZCKH 3LIZH 4NCC1 5IMLA 2O26U 2LE9A 4X6BA 1Q9WA 4H0HB 1NC4B 1ETZA 4Q9QL 4LCCC 2ZUQC 5KAQF 1BFOA 1DZBA 4HAFA 1KG0A 2IFFH 4Y19E 2EYSA 1JBJA 3V2AR 3LH2H 1HWGB 5DJ6B 4HIEB 5HGBA 1NFDA 1YDPA 5DHXB 1CFVH 4JPIA 5I8EA 4U0QB 2Z4QA 1OGTA 4KJWD 4LPYA 4RMUA 1I8IB 5JPMA 1AO7D 2NY4D 2CIIA 2VZUA 3FMGH 5EO9A 2FECL 5HHMB 2DD8H 4QRPE 1JWSB 4Y4KD 4W6XB 3QPXL 1FO0L 1TPXB 4NO5A 3VGDA 4MNHA 1CE6B 3BRFA 3QPQD 5M7QA 3BVNB 3MROB 4Z8FH 5ANMA 1F6AB 4WU5B 4B5EA 4JLRB 4PRHE 1G0YR 1EUUA 3TVMA 4NZTL 1RZFH 1T1YA 4DVBB 2DQHH 3MCG1 4IRJC 1FYTA 1VPOH 1TJHH 2Y23A 4K3HA 1CYGA 1FVCB 1VA9A 5LXGH 1WZMA 2DWEB 2QSCH 5DFWH 2WIMA 3K1KC 5KS9F 5HGDB 2OJEA 2P8LB 4FMKA 4ZUUB 4OZIF 2V9RA 3TPUA 4K3DL 1KTRL 3PGFH 2ICEB 4GOSA 5J57B 5DMJB 2W0FA 1LE9A 2HRPH 3PV6A 3H9YA 2W0PA 1HN1A 1RU9H 2I5YL 2XKNB 3G6AA 4LSVH 1WQVT 4WTXA 4F9PA 1VADA 3GKZA 4CDHA 1YQ2A 4Q7DA 4NJ9H 4BUHA 1IT9L 4WI8A 5DA4A 3A6BH 2X09A 4F8TA 2DIBA 1HILA 1ZLUH 3U7WH 3ILQD 3S35H 3RVTD 1EHNA 1PQZB 4K8RL 4XNXH 2V2XB 3IDIB 4YHML 1WBYB 5F96H 3IDGB 1N5YH 4CMHB 4AMKH 3S9DB 5D7SH 3PNWB 1EUTA 2PO6C 1Y18B 3RZCD 4ZD3L 1FVEB 1F3JA 5GXBB 1T1XA 2IAMC 3D0LB 4OGAD 1JYWA 4Z9KB 3DMMB 3PIQA 1MLBA 3BGFB 3HFML 1YMMD 3C08H 5GGSA 4Z7NE 3HCVB 4R96B 4KJQD 1T1WB 3B9KD 2QR0B 4Y89A 1WZLA 5FECB 4MX7A 4L4TD 5E8DL 5F3BA 2GHWB 2HLFD 2NW2A 3KYNA 4KGLA 4KTDL 1Z6JT 1QZ1A 5J06A 4QCIA 1N4XL 3RY4A 4JFFA 4LKXA 2NXYC 1CFQB 2MQ3A 4WO4C 4ISVA 2I07B 1NC2B 1K3IA 2NXZD 2XTJE 4WWID 4M48L 5DD0L 4E0RB 1A1OA 3ARGC 3MXWH 4ZUTB 5HHVL 4YPGB 2JJUA 3VXQA 1A7OH 3KS0J 3P9LB 4F7PA 1SY6H 2ZCLH 3TN0D 3FCTB 1B0RA 1MCHA 1A2YA 2VIRA 3S37X 4BH7A 3QULA 2ZSWB 5SV3A 4Q9CA 2Q76A 5IGXL 1KN4L 1QHPA 3HPLB 2YPKB 1PYWB 1V7ML 1ZXQA 3HRPA 1FRGL 3MLWL 4Z0XB 4XWOD 5TF1H 3IKCA 2WBJC 4G80B 2BJML 2BSTA 5IHUL 1P1ZA 4YDIL 4HQQH 4JGJA 4OZHB 5C09E 3V0WL 1F90L 2CXKA 5L9DL 2D3VA 3KYKL 2Q86A 3KJ6H 4Y5YC 5CP3A 1QFWL 3CDCA 5JOFA 5CD3B 1DE4A 2JF1A 4PRID 1OAUL 4FP8L 3NZHH 5HVFB 2ATKB 3O41B 1I7RB 1RUMH 4IIQB 5ICXA 6FABL 4ZTOL 1F4XL 5CEZE 1KLUB 3QRGL 2B2XL 2DIAA 1GZQB 2OP4H 4UU9B 4XVTL 5F9DC 4TVPL 4WFEE 2OK0H 3GMRB 3MREA 4JFQB 2GCYA 2VXSH 3GB7B 5FUCC 5C0ND 4G6JL 5CMAB 4ZFGL 3T77A 4H20H 3BGMB 3EO9L 2QKIB 4HUWA 3PDDA 4JFED 4X0KB 3CFBA 2MCPL 2W60B 4JFPB 4Y16A 5E08H 4FG6C 3DRQB 4NQVA 2PR4L 1H5BC 4U1SA 5JO5B 2DTML 4PJ8C 4RNRA 5TH2A 1A3RH 1F58L 4NHUB 3W2DL 1R3LA 1MOEA 4PJBA 3GSXB 5EIIB 2VB5A 3CC5A 5DVOA 1R3JA 3WYRA 3MNWA 4OTXL 4YR6B 3I3EA 4G8FA 4P3CH 3MCKA 3C9NA 2PYEA 4OFDA 5DI8A 3VXRE 2Y5TA 1FZOA 4WW1B 5CZVL 1ZSDB 2FJGB 3PE9A 3DYPA 4F33A 1P7QD 3QDGB 4MJ5A 3VXNA 3PABB 5F88B 3QIBB 4NQCE 1IGCL 5DJ8A 4PIRF 1CDHA 2XNAB 3VD7A 5BS0D 3QA3A 3BOVA 2YN3A 3IFLL 5IB4B 4JG0L 2X9YA 3CD4A 3T1FA 4DGVH 4ENEC 4N0UB 5GISL 1BD2E 4HGWA 3EDJA 3VFRB 1DR9A 4KQ3L 3NCEB 3EOTL 2HJLA 3GJFA 4E41B 2YKLH 4U6XA 2HT4D 3HNVH 4YBQD 3H42H 43C9A 2CGRL 3ES6B 3O3EB 3FJTA 1DBMH 4Y1AB 5MI0C 1ROWA 3D3VB 5KVEL 2PW2B 3AS3A 1F11A 3GUTA 4OCRH 3DGGB 3JBG7 5CJXC 4PJIF 1OAXH 5AEAA 4C4KO 1A9BB 4LSPL 5BVPL 4PBWD 1NAMH 1FNEA 3VXSA 2A83A 4HC1L 4DCQA 2DJSA 4WEUD 3QDJA 4XPTH 4JZJB 3T0EA 3RGVC 2YD2A 3QFJD 4ODHH 1H3UA 4LPXA 4ONOA 4C56B 3BUTA 4F7MA 5KSUB 2VLLA 1AGFA 1EO5A 2I5YH 1KPUA 2R4SL 3LHPL 5C0BA 1J8HE 2V5TA 1A1NA 5IV2B 4POYA 2A74A 4Y2DD 4PJAF 5FHAL 2ORBH 2WW8A 1EEQA 1EVTC 3TO2B 5KZCB 1N7MH 4OF8A 5E8EB 4PJCB 5DJYA 2NX5E 1JN6B 1KGCE 5HDQH 2CJUL 2COQA 3AY4A 2VWEC 3CLEH 1RK1A 5DRNB 3BDXA 3G6JB 1FFPB 4PJFA 5DRWA 1BMGA 2J5LB 5C0RH 2B0SL 5B8CB 1UJ3A 4OAWB 3HFMH 4Z95L 2DMCA 5BJTB 4I5BA 4GG8B 2KDGA 4EXKA 3KXFB 2BSED 3VFMA 2VDQL 2K7PA 4CKVX 1K8DA 3EYVB 1N4XH 1MREL 3VGFA 5C8JA 3DI2B 3QO0A 4ORZC 3RIFK 3FRPG 4KRMB 4P2OA 1T83A 2UYLB 1FP5A 3GHEL 4PJXB 1XCTA 3GSUA 5HHVH 3PHOB 4NO3A 4ODWA 1MWAH 4P3DB 3VA2C 4JPKL 1SJHA 5E1AA 5GRVL 3WJJA 4WWKC 3CX5K 3VJ6A 4JQVA 4M4RA 1IEBB 1QFUH 1GPOL 2QV2A 3CUPB 1BVLB 4MGXA 1KN4H 1EEYB 2AXFA 1QSFB 3MODL 3I9GL 5FB8B 3ETBF 2P5WB 4A6YB 1LGVA 1NGYB 5IHUH 3V0WH 1X5KA 1JF6A 3R8BB 3LEXB 3JWDC 1G7PB 4ETYA 5I71B 3RWCB 1AGEB 4CMMB 1S8DB 1RJLB 2YD6A 1OAUH 3JV4A 2EDRA 3QIUD 3SDDC 6FABH 4Y19B 3QRGH 2B2XH 4NT6B 3WFHA 2AK1H 1S9VA 1CE1H 4GMTL 5C0DA 3TWCH 4F15C 2DL2A 2C4FU 4GW4B 4PR5A 4GAGL 1HZHL 4QWWD 2VRAA 2R2BB 4PRBB 3PWNA 1KELH 2UWEB 2D31A 3ARPA 1HDMA 3VG0L 3TBWB 3TZVC 1IGIL 5CILH 4Z0BH 3HZMA 5IQ7H 5MHSD 1OCWH 3TM6A 1FN4B 1X5ZA 5H94B 1OD9A 4UMGA 4LLUB 1A6VL 3VGBA 1F58H 2WBKA 4NQDA 4U2ZA 2NY6D 3NAAH 1BBJB 1TNMA 2OZ4L 4U49A 2Z35A 2AP2A 4ZO7A 1HCVA 3TT1H 2EEAA 4QGTA 3X12A 1I1FA 4U6YA 3QXVA 4KKAD 1G7IB 4L4TE 4EI6A 4K7PY 3V7AE 4JPVH 4RRPA 2B4CC 1D9KC 1PG7W 3LKRB 4L8BB 1NMBH 5C71A 1IGCH 2BCKA 2YPVH 1HHGB 3U46A 2NY0D 1V3MA 1FLRL 2NTFA 3N1FC 3QNXB 1BGXL 3EYOB 5GS0H 5IVXA 3QUMA 1T2JA 2IBGA 3NBNA 2BNUB 1UENA 3E6FB 2CRMA 4GSDH 5AWNH 3UPAA 2R39A 1NCNA 1A4KA 2BSSA 4D3CH 4IMLA 1M7DB 4WW2F 2IH1A 2FYYA 1Q94A 3SQOH 4U6VH 3VDCA 3BSZL 3GM8A 4FXKB 1NANH 4OLEA 3QAZB 4PLOB 4KKNA 3LB6D 5LVEA 2EE3A 3OJ2C 1NGPH 3T0EC 3FOLB 3U7AA 2BY2A 4G8EA 3W11D 4GRMA 3OPZL 4YHLL 1FFNA 4HC1H 4P9ML 5EOCJ 1ES0A 3QG6B 1I9IH 4RX4A 2BDNL 5D1QB 3L3DB 4PRIE 3WDHA 1U3YA 3I6GB 5A2JH 4F58L 3OKLB 1GGTA 1GZPB 2P8MB 4F7EA 3W9DB 1FFQA 2J8UF 5MEQA 2ADFL 5BO1H 5CLWA 1WAAF 4MAYB 4UT9L 5DQJA 3IFPA 2CKNA 4PJDE 2HT2C 3PG2A 1KB5L 1IE5A 1U92A 3X14B 3KPRA 5ESVB 2YOCA 1VKXA 3STLB 2BNQD 2G9HA 1U95A 4ALAL 1DFBL 4JFEE 3ZMRA 1RZGA 5EORH 35C8L 2ATPA 3ARBA 4XXCC 1H3PL 4OCSL 4GBXD 1HXMB 5HYJD 4TSBL 3BJLA 1M71B 3ZTNH 4B50A 1D5ZA 4R0LC 5EPMB 3IDUA 4M6NH 4KJYA 2YK1L 4R4BB 2APVA 2FWOA 4MJIE 3IS0X 1TTUA 3MRBB 4F80A 2FEEI 4PLKC 5ENWA 5JHDA 2B0SH 3DRTA 1MCPL 1K4DA 3I6KB 3DX9B 2IWGA 4HFWA 3GIZL 5I6XB 4Q9BA 5D7LD 2ARJB 4LIQL 4LFHG 5E2UH 3RUGB 4LEXH 2VDQH 3S6CA 3EOBB 4P2OC 1T83C 1C5DA 3GSOB 2V5RA 4X98B 1QR1B 3BEVB 4MXVE 5HVHB 2VXQL 1MREH 4PUBH 5JMOC 2J12B 4I2XB 5BS0E 1KJVA 5I1HL 3TO4C 1YEGH 3DO3A 3IXTB 4HJ0D 5TDOB 3QP3A 4JPKH 3KLAA 2EXWD 3HS0B 5L0QB 4U4BA 5AYQA 3FT3B 3LN5A 3VCLA 4LARL 3ARFA 4YPJA 3I9GH 5KVMC 2GFBA 4TSAL 4OF7A 1NFIA 4RAUB 5M94B 5GS3A 3ZKQD 2VLRA 4XVSH 4NO0B 5TDNB 2YD5A 5CEYA 1HSAB 1TVHB 4DUXA 3MGOA 1YPZE 4ZFFA 3H7LA 1J0YA 2QEJA 5FKAA 3UTTB 3ZE1E 4PGBB 2A38A 1BF8A 3O45B 3QFJE 1NLDL 2VQ1B 4J23A 1IL1A 5IBLC 1KIPA 1DEDA 1T04A 1JZ3A 1UACL 4OFVA 3W0WA 5D4QA 4NN7B 5HHOA 3G04B 4XB7A 4ZPTA 5DFVC 4K8RD 3RTQB 3M17B 5I17A 5DJAA 3HR5A 3JWDL 3V5HB 3EYSH 3RQ3A 1ZMYA 4KK5D 3TH4T 3CFEA 4M02A 5ETUA 4PGCA 2DLHA 5E2WL 4P5TD 1BVKB 3VG0H 3Q0HA 3BYYA 1NBZA 1IGIH 3VI3F 1KIRA 1J1XL 4FZ8L 5LAXA 2RJMA 3H9HA 4G8IA 4K3JH 1QO3A 2G2RA 2EDEA 1AXTL 1A6VH 3MCLL 4AZ8A 3WS6A 1ZANL 3BT2L 1ZGLA 3MV7D 2W0LA 1JJUA 3UJTL 5I1DA 1W0VB 5CGTA 3IU3A 4LOUD 4HZAA 1QBML 4R3SA 5J1AB 5ABDE 1DUYA 2XG5A 2JCCF 4WI4A 1C5BH 2J3SA 3EGSA 3LKNB 3SN6N 5HYQB 3VA6A 5EULV 3UJIL 2W1NA 4IHOB 1MCCA 1GGYA 4JPWH 1O7VA 5D96C 1OVZA 4YHNB 1CN4A 1ZT7B 2J88L 5SX4I 3Q3GB 4LSTH 2FO1A 4G5ZH 4LVOB 2GJJA 4FFYL 3VWKB 3MV8D 1IFHH 3TA3A 1FC1A 1MVFA 1AP2A 1XGYL 3OKYA 3ARDC 5H37G 1QOKA 3AXLA 1J8HB 2B4CL 2X4OB 1NCAH 1CVSC 2HJKA 1IZKA 2PXYD 4JHAL 5IFJA 3C60A 1PGRB 4PB0H 2BMKA 3BSZH 1QQDA 5IW6A 3H9SD 1S7XA 2YA2A 1K2DB 4JY6A 4BZ1L 1FNHA 4MQSB 5IKCB 1JPTL 4Z77A 4HGKC 4JJ5A 5E6ZA 1CICD 5D2LA 3LEVL 1LO5B 2R23A 3FQWA 5TE4L 3KYOB 4YHLH 4P9MH 1T20B 1RFDH 3NIDE 3JVGA 1S7WB 1UKSA 3MRLB 5DC9B 4TVPD 1ADQL 4F58H 2F74A 3HMWH 3PWJB 3QUXB 2H32A 2D7QA 3L5IA 2ADFH 2R0WL 4OUUA 2IALB 1J18A 1MFEH 5DMKA 4RMRA 1OW0C 2N7AA 4NM8H 1BFVH 1T2QH 1NLBL 5T1KA 4NZJA 3TBYA 5BRZD 1NGWA 4ALAH 1DFBH 1MCIA 4O58L 2PUQT 35C8H 3PDOA 5MHSE 1WCQA 3BWAB 2EIBA 1S9YB 4XMKH 4OCSH 4EUPA 2OLDA 3LEYL 4QTIL 4M1DH 5I66B 4OF6A 1U8PA 2YK1H 4D0BA 2CLVB 2DF3A 4GRWF 4I9WD 5LQBL 3QDMA 3QQ3B 4OD1L 3MA7B 1I7ZA 5FCUL 3CSYA 1IC4L 1KENH 2MHAA 1H0DA 1YEKH 1DQML 5C08A 3GIZH 1EXUA 3A67L 5F97E 1NBYA 4JN2B 3G5XA 2V7NB 1LILA 4CNIB 3QUYC 4GKZB 4NFCA 2FEDC 1YMHA 2DIJA 2OXHA 4EBQL 3O4OB 4JRYA 4AY0A 2Q6WB 5HY9B 4ZS6C 1NMAL 3W5NA 1IEAA 3ELAT 3BPCA 1KCRL 5EZLB 2NNAA 3WIIL 2K9UA 3BP6B 3ARFC 4I0PB 3CH1A 4KDTA 1AGBA 4JREC 4PRAB 2PETA 1U3JA 3QXWA 4HXBL 3FB6A 3MA9H 3AREA 1RHFA 1Z0NA 5FA3B 1B2WL 3L3OB 4WHTB 3BQUD 3ARSA 1I7UA 1KJMA 3NGBB 5JDSA 5I1LA 4Y4FB 4HDIA 4IRJD 1VFUA 4MD5B 3UTPD 2FATH 3U4EB 4P23A 1CDBA 4XPFL 5DJ0A 3FAXA 2ADIA 3SKUD 1U8OA 5C0AA 4ZQKA 3WEXA 1FZJB 1J1PL 2VDNL 1AIFB 3EJYC 3OMZA 4GO6B 5ALBH 2X7LB 3IFNL 4WFHD 2NMSA 5FM4A 5CP3H 4YDKL 1AKJA 1QFWM 1MELA 4CN6A 5JQ6H 2ZZUT 3RIAK 1OD7A 4XRCA 3RRQA 3TBVB 1DBAL 3JWDH 5E0QA 5C7XL 1PSKL 3C8DA 1LE5A 2BNQE 4HWBL 3B6SA 4P46B 5E2WH 4ELMB 5D7IA 1T22B 2FZ3B 1J0ZA 3CPLB 1J1XH 1OT2A 5HYJE 1DDHA 2RCSH 3RKDC 1AXTH 1ZANH 3BT2H 4TSCH 3IDJA 2H6PB 1H3GA 2JIXD 12E8L 2FBJH 5DD1H 3VRJA 1MCBA 2OS7A 1M1SA 1I8IA 4ZAKA 2CDEB 4AG4L 4JQXC 4MA1C 2PO6D 1EHAA 4GW5A 5D7LE 2IAMD 1RUAL 4JGUA 4XPGH 4LLMA 1YEHL 4OD2B 3VG9B 3VXMB 4HWEL 5IW3A 1F6AA 3QWOB 3FB7A 4R7NB 2J88H 4UBDC 5L7XH 3C2AH 3FOMB 2ED7A 2R1YB 4G42B 4HJJL 2EECA 2NXYD 1NCWL 1TENA 2DQGL 4P2RA 1PLGL 3A6OA 4R4NC 4WO4D 4HS8L 2BNRB 5C0CA 1XGYH 3FT2A 4XAKD 5F7YC 1ND0A 4HKJB 4X6FB 3L5WA 4XC1L 2FL5B 3P73B 3ULUC 5C07B 3MC0A 3ARGD 2DWEA 1B4JH 2B4CH 3C5JB 5HGDA 2P8LA 4ZUUA 4RAVA 1FPTH 1YY9C 5CJBA 1K6QL 1EFXB 4JE4B 5EBLB 5JNYB 4HKXB 3DSNA 3MLYL 4KWUA 4RQQB 5BOPA 3GJFH 4HG4K 1A3LH 1R5VB 1KXQE 1R0AH 5BVJA 5C0EB 2GKIA 1MJ7H 4LCWD 3D85B 3KPMB 4HS3B 2WBJD 3RIFF 5TE4H 3C6LB 1MI5A 4TNVK 1FJ1B 4HMDA 1P4BL 3WSQH 1PQZA 1TMCB 4O2FB 4ZUSA 4LPUA 4P59L 3G6DL 1UEMA 5I16B 4XCYB 2YBRA 4KKBC 3IDGA 4CUCA 1NGZB 5A43C 2CK0L 3L7FB 4AEIL 4JJHA 1TLKA 1LEGB 4Y88A 4MDIB 32C2B 5EIQA 3X3FH 5I76A 2DJ4A 3DMMA 2XQYG 1A9EB 3IJHA 1T7ZA 3VFWA 3K0WA 4R96A 3MFFB 3I2CL 5KBNC 3FKUS 4X6CE 1N0LA 1IGTB 3MRMB 4U1GB 3WKNA 3MLXH 4KI5C 1AGDB 4XVJL 1WWCA 4POZC 3LEYH 3MV7E 1LEIB 3LVEA 3GSRB 4FG6D 4RGNC 4MD0B 1HH9B 4WNQA 2EDOA 4PJ8D 1NC2A 4YHIB 4JZNA 3MRFB 5FCUH 5I30L 1IC4H 2BOBB 5EO1B 4PJ5A 1LO3H 1XF5B 3PDGA 4R8WH 1XCQB 4WV1A 1KV3A 3A67H 3QYCA 1RZ8A 4FXGA 3P9LA 3BKYL 2P46B 3FT4A 1L0XA 2AJZA 5KSAC 4LL9A 1E4XL 5KOMC 2QHRH 4DK3A 1YPZB 4GLRI 2X1WL 2YPKA 3NOIA 4Z0XA 3S98A 2UWEF 3MV8E 4KDTC 4FQ1L 1T5WA 4N9GA 3JUYA 1P7HL 1T80A 3WNOA 5I8KL 5J3HC 3T0WA 3D39B 4OT1L 4ENED 4ZFOA 2XIDA 4KAQL 2GJZB 3K2MC 4LLYB 5GRJL 4PJ9A 3WLWC 4WUUA 4G6FD 2QJDA 4JHBA 2EYRB 2IGFH 1V5JA 3H9SE 2VABA 1I7RA 5SX5K 2WP3O 1FYTD 2J6EL 4GAJH 4M93B 4P23C 1RZ7H 4YUEH 5CKGA 4M9PA 3GMRA 4PGDB 3GB7A 1A6PA 3S37L 1LP9B 1CBVL 5DZOA 3SE8L 1JHTB 2VLJB 5CMAA 1A5FH 5BV7H 4Y5XB 5D7JB 1FAIL 3WN5A 4TVPE 5MEOA 2QKIA 2EE9A 2F5AH 2PYFB 2KH2B 5ACZB 2AK4B 5HI3C 1CDGA 1I7TB 4I8DA 1J1PH 5F6HJ 4WTZA 3KPTA 2CUMA 2APBA 5DK2B 5CIPB 3RGVD 3MRNB 3N0PB 2ENYA 2BSRB 4YDKH 3MRHA 3VWJB 2CPCA 5K33A 1Y0LA 4GQ9L 2C3HA 2X4UA 2OYPA 4YXHH 1XH3A 3DXAB 3BEWA 5HXMA 5INCB 5BRZE 3ZTJG 3VGAB 4NKIL 2AEPH 4OSUH 4K94C 3IDMA 2H9GA 1BBDL 3O6ML 2E6JA 2M2DA 4L29B 3ZYJA 2AABL 5MP6H 3DUSB 4WW1A 2C9AA 2FJGA 4RA3A 3HMXL 1G1CA 1TIUA 1BIIB 3P0YL 5F9OL 3QDGA 1OGAA 3PABA 3QIBA 5F88A 1MFAL 1X5FA 3ZHDA 3JTSA 4I9WE 4EI5B 1URLA 5EOQL 12E8H 5K9OA 1TPXC 3L3IA 1YEFL 4ZO6A 3MZTA 4AG4H 3FO0H 5IB4A 3CZFB 4CN4A 2BVQA 1DVFB 1G7QA 4U6TA 4C83A 4G9FB 3F6LA