1D9KC

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
183
structure length
183
Chain Sequence
b'IEADHVGSYGITVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFAQLRRFEPQGGLQNIATGKHNLEILTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 183
sequence length 183
chains with identical sequence G
ec nomenclature
pdb deposition date 1999-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kC02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d9kC01
4KK5D 4Y4KB 4WY7L 4C56D 2HFEA 2P8LB 1RSFA 4GG6A 1DQDL 4I0PA 3GMQA 3SE4C 2AAVA 3PGCB 3TV3L 5T1MA 3QXAB 3SDXF 5ECJE 2D7TL 5F9WB 5CFHA 5I1EH 1ETZB 1PYWA 5GGRA 2VYRE 1HWHB 4NUJA 2IQAB 5L2KD 1J12A 5CP7A 1S78D 4TRPL 4U49A 1KN2H 3SGDI 3T1WA 4LFHD 4ZOAA 3NFNA 2DS4A 1QBLL 1K5NB 3NCYS 2SEBB 4P4KB 1U2HA 5DURB 2D0GA 1ZMYA 3IFPA 3O0RH 4OBSA 4YK4C 1T6WA 4CU8A 3BP6A 3FB6A 3DPBA 1LO5A 4APQC 1DVFB 3DVGB 3V95A 2OZ4A 4ORGA 3DBXA 5IMLA 3MV9E 2GKIA 3WFHB 5L9DL 4XCFL 1CVSC 3PHQA 3QWQB 4YDLC 2R1XA 1Z9MA 1N6VA 3ARYA 3MRRA 5E8DH 3DHJA 4P5TC 2H6PA 5IVZB 3R8BB 3LDBB 1R3LB 2HKFH 3QXTA 1NAKH 4IBLT 5ESAB 4Q7DA 2NY0B 3VCLB 4XPFL 3Q6FA 3CVIL 4JREB 2W60B 2NX5B 3KYKH 1OGTA 1WWBX 1WQVT 1FCCA 3MRNB 3MNVA 1G7MA 3RL1A 1N2RB 1BJ1J 4ODVL 1HH9A 4AEIL 5FYLH 2R9HD 5IBTL 3KLHC 2EE3A 2O5YH 3HUJF 4MVBD 2NTSP 4LHUB 1ZT4A 5SX4I 1BZ7B 1KIRA 2BERA 3QNZA 4WDIA 5C0BD 3STLA 2WSKA 2V5TA 4P2RA 1WTLA 5FOBB 3TN0D 1U3HA 3TA3D 2DM4A 3L7EA 1QHPA 4YPGA 1T1YB 5DJ0A 4X7TA 1DN0A 3NTCH 1FG2A 5D2NE 1I7TB 5KSVB 1F3DJ 5TF1H 2R56L 3DGGA 3BGAA 4QHNB 4R9HA 4U1SA 3MUZ1 3FFCD 4HFWB 5FYKU 1P69B 1VGEL 4H5SB 1EHLL 1P1ZB 5MENB 4AIXA 4KI5F 1FZOB 4PGEA 3D2UA 3T2NL 5M95B 3SKOA 1J1PH 3EYFA 2H32B 4AMKL 4BSJA 4YR6B 4WUUB 4XCEB 1AQDA 1UJTA 5FDYA 5MI0B 3RA7H 5TE4L 1OM3L 5FO8A 1P4LB 3IRPX 3MACL 5HGGS 2VDPH 4OI7A 4C83A 4Q0XH 4F57L 3VFPA 4JKMA 1AJ7L 4XAWL 4HLZH 1ZHLA 4N8CH 3OAYH 5DQ9B 4UOJA 4BZ1L 1TPXB 1NCDL 5DS8B 1GAFH 3HE6D 4CW1A 1EO8H 5EIVA 1K6QL 1IAKB 2WAHA 4X5XA 5CLTA 1GHFL 3EDJA 4X6BB 4BK4A 4FQXC 4H88L 5DO2C 2V17H 4U31A 2VLJE 3IF1B 1TLKA 4LEOA 1IGCH 2JK5A 3U0TA 2BC4B 2AXGA 4RX4D 3G5VB 1U8OB 4OGAD 1A6VH 4JHZA 1BZ9A 5EIIB 3VA6A 3M1BB 5E9DB 1H3UA 1YMMB 3D69A 1GGCH 2VLLB 3DO7A 1T20A 2IALA 5EA0H 1V7NL 4LSTL 1F8TL 1H8NA 5HYJD 5C0EA 3BPLC 5IFHL 3BGMA 5F1KC 2R1WA 4PJ5D 2PW2A 4U3XA 2VR5A 3BRDA 4N1EA 3W82A 4WCYL 5CJXA 4NZRH 1UM4L 2B5IB 3BWAA 2OJZH 3O8XD 4HS3A 3L5WB 1KJ3L 3QDGE 3PQYE 3OJDB 3IETA 1MHCB 4D8PB 3AREB 5AAWA 5DLML 1JPTL 3PNWA 2H2PC 4ZFOL 3QPXH 1T1ZB 3VJ6B 3AXLA 5JMOC 2IPKB 4PGDB 2Y06L 3A6CH 3WEXA 4AEEA 2AJSH 5HYQA 3VG0H 3ARVA 1TCRA 2QQLL 3CFCH 4NQDB 4WW2F 3VWJD 3LV3A 4JHWL 3X17A 2E27H 3IAPA 4NUGH 3N1QC 4NNXA 5FHBL 2NW3A 4WHTB 4FXGB 4PD4J 2ADIA 4WJ5A 2YD4A 5GPRA 4KXZH 5D7LA 5HD8C 4UDUB 1I1CA 4OFVA 2IH3B 3LN9A 1I1AD 4NKIL 4PRPD 3SDDD 1AO7D 5EBLA 3TNNB 4KVNH 3O9WD 2J4WH 43C9B 1Z9SA 2PNDA 5CBAA 2V2XB 3SKJH 2YD8A 3HS0B 3W11C 1R6VA 2JIXA 1S7WB 4ODSH 2XWTA 1DFBL 4Q9QL 1DCLA 1T83C 3BIKB 3C5ZD 4NZDA 1WUNT 2BK8A 3QDJD 4TTDC 3NN8B 4XCYB 5LKNA 2VAAA 4L8DB 5I1GH 2DDQH 4MD4A 4HJJL 4B41A 4KK8D 3L3JB 3W39B 3IDNA 2OL3A 2XQYK 4XP1L 2AEQH 4HX1B 5BZWA 4JGJA 5C0GB 1A6TB 4WW2A 1S9VB 1JP5A 4HUUB 2YUZA 3PWPB 1HXMA 5EU6D 1ULVA 1FSKC 2BJML 4U33A 4X5WA 4HULB 1IEHA 1HYSC 5HYSA 5HPOA 5HHME 1I9JH 1MQ8A 4ZPTB 4Z78B 4I5BA 5H35B 4MJID 4PFEA 3BDYH 1CICC 2RIKA 4UNUA 4N0UA 1I7RB 1ES0A 5EC2B 3GSNH 2IAMC 1DDHA 2NTFB 5I1EL 5J06A 3L7FB 1ZLWH 1UENA 4RNRB 1P84J 2RFXB 4D9RD 5MHSD 5D5ME 1M71A 2P8PA 5CUSH 1KN2L 4M7LT 4U6HA 3DROB 4S0TD 4QOKB 4FQQA 3SOBH 1I4FB 2YOCA 3GMLB 4OLWH 3O0RL 4JPKL 1QLFB 4U6VH 5FGBC 4Z9KB 1SVCP 5IB4B 2MCPH 1UKTA 1N5AA 1NH6A 2IADA 1LP9E 4U3CA 4IMKA 4PJBE 1UZ8A 1C12A 5T1KB 3CXHJ 3WLBA 2I26N 1UM6L 3RVXC 5EU5A 1INQA 2AEIT 1K4CB 2NZ9C 2ED7A 4JFYA 3F12A 5E8DL 3ZKQD 5IIEA 3MROB 1Q8MA 2HKFL 5SV4A 3MREA 1NAKL 2H26B 1G7QB 3RUGB 2RB8A 3VWKC 1X5FA 4LNVA 2J5LB 1C8PA 3EAKA 1XGYH 3MZTA 2AV7A 3OF6A 5D2NA 3KYKL 1KTLB 2Z9TA 1GCFA 1MCRA 5DC4B 3J7HA 2R4RH 5FYLL 4ODWA 2C3XA 2O5YL 3KPRE 2IMMA 4BK5A 1BFSA 4O5LH 3QHZH 2YPKA 5CD3B 4ZOEA 3AM8C 5C9JA 2YUVA 3U1SH 5DHYA 4PJGE 1HN1A 4UU9B 1JNLH 2BOCA 3NTCL 2CLZA 5TF1L 3TEUA 1CXIA 3CFEA 4JZNA 3BGFB 3IU4H 1IGTB 5B38B 4L29B 3ARDC 4HKJB 4E42A 1KELL 5EORH 5DFVD 2I60H 2ZCHH 4IOIA 3QUYD 1C08A 2E7LA 2EIZA 2VLJA 2X7LB 4N5EC 3FQTB 1Z5LA 2EYSA 5DI8A 1J1PL 3BVNA 1MI5D 1KJ2B 3IKCA 4O2FB 4RAHA 2QEJA 3W9DA 4BELD 2NLJB 1INDH 2VDPL 1CVRA 4Q0XL 5D7JD 5GS1A 1CF8L 1AD9A 4LAJH 2CKBA 2RQ8A 4IOFC 3DX6B 1GAFL 4MCYB 3HLAA 1CXLA 1EO8L 1AGCA 4X6FB 4RBPK 3QQ3A 4K71C 4FFYH 3PWUA 3MNWA 2V17L 5BW7C 3U79A 3ULVE 1IGCL 4RSVA 3ZLQC 4XTRD 2GFBB 2PETA 2NYYC 4S1RH 5DHVB 3WIHH 5E7BA 2MHAB 4QKXB 1WFNA 3HI1A 3HR5A 3UROR 2YUXA 4Z0XB 2PO6B 2ZG3A 1GGCL 4Q74A 3FT3A 4ERSH 1QSFD 5EA0L 3RNQB 3BH9A 2Y9RT 3WE6A 5F6HI 4YHNB 6FABH 1QLRB 1ZXQA 4L4JA 1GGUA 2VDOH 4NZRL 4X80H 3GB7B 1NAMA 3TVMC 2CDFA 4G5ZL 4OI9A 5D7KD 4Z7WA 2OJZL 2D9QB 3ZKXC 4DCQB 2J6EA 1B2WH 5IQ9A 1NGZB 1F58H 3X11A 1MY7A 1EEYB 1WLHA 4P4RB 2X4NA 4QGTA 3R06B 3QPXL 1RJLB 1TIUA 4TTGA 5EPMB 4UV4H 1R5IB 3A6CL 5D5MF 2VISA 1QLEH 2AJSL 2VABA 1FRGH 4GRLC 3VG0L 5DD6A 2YEZB 3CFCL 4K7PY 4OFDA 3WLWC 1LK2A 2CIKB 2I07B 3CDCA 4UQ2B 1QRND 2E27L 1EBAA 4N0CD 1XF4A 4NUGL 1R3JA 5D93B 2ZSVB 2CDEA 4ISVB 4G80B 3BRGC 1IM9A 3FCTA 5ACZA 1WSST 2DWEA 3DX8B 5BOPA 1LE5A 1A1MA 3SCMD 4U2YA 2FRGP 3BJLA 5I71C 1OWWA 4YEFA 1LP9F 5C07A 1ZLUK 4ZFFB 3DX9A 4KVNL 4PJBF 3TT3H 5C0CB 3RWFA 1EPFA 3KYNA 5C0JA 4ODSL 2V9TA 1MHHA 3I6GB 3GSWA 1MNUH 2E6QA 4PRHA 3QXVA 3RIFK 1AR1D 4Y5VB 5IBLC 1Q1JH 5I1GL 1XGRA 2DDQL 1MCWM 4KRPB 3GIVB 1OVZA 4P59H 1OLZA 1EHXA 2F8OA 1YNTA 2Z8SA 5J11B 1KCSH 3HCVB 4HC1L 4WI8A 3UTTA 4EIZC 2AEQL 2BNUA 1FAKT 1L7TH 4DQOH 3QJFA 4PY7B 4JRYD 1ITBB 2ZUVA 3QFJB 4IRSB 2XN9D 3EDDA 5DMGD 4Y4HB 3OKDB 3ULUE 3W9EB 1I9JL 1FE8H 2D7QA 1YEDA 4R0LB 5CEZH 3U36B 5DK2B 3GSNL 4ODXB 3UC0H 4PRNA 1LP9A 4N68A 5E94A 3NPZB 4GRWE 4PJBA 4PJGF 5CUSL 1PBYA 5K9OA 3CUPA 2O5XH 4HJGA 3LOWA 3QULA 2LU3A 3SE3A 2OI9B 2FX9H 2Z93B 3L3OA 5CGMA 1XIWB 2GJ6B 3JBG7 3MO1B 2AP2A 3VRJB 4OLWL 4NT6B 4LBEB 1ZLVH 3FQXB 4U6VL 5E24E 2MCPL 3ZYIA 4XC1L 2FD6H 3PDOA 4X4YB 4WWKD 3CDGB 1FDLH 4NNYA 1VKXA 2GQHA 5ELIA 5GRJH 4RGND 1UB5B 5I1HH 3MRBB 1Z9OA 5I1DB 2C3HA 4XBGB 1DN2A 2BVYA 2OQJA 4PJ9B 5CEYB 3ARPA 4J8RB 3LKSB 4ONHA 4JM2B 5BVJA 1NBZA 3GJFH 1BBJB 4LCUB 3KPRA 5DT1H 1EXUA 3BW9A 1V7MH 2DYPB 4XGZB 4HGWA 1WVZA 4KXZI 1A8JH 4NO5A 3STZA 4D9LH 3S88L 5ID1A 1SJVA 2RAMA 4JJ5A 4XPGL 4TN9A 5JZ7C 5IB5B 2MPAH 3MR9B 4AIZA 2HVJA 3ULVF 4PJGA 1A4KB 1KC5H 4HWUA 1MCCA 5B4MC 4WHCA 1ND0A 3HC3H 2HG5B 2HKHH 5IEHB 1XGYL 3PXHA 5JMRA 4P2QB 2GSIB 3KPSA 3NCBB 1CLYL 1E4KA 2Q3AA 1JF5A 3D85A 3EO1B 5ADOL 4ZO9A 3PGDB 1KNOA 5T3ZH 3TBTA 4OSUH 3QHZL 3WUZA 2YRZA 4WTWA 3MJ8A 3CCHB 1CN4A 3OKNA 5EO1A 3U6RA 1Z3GH 1BVKA 5DEZA 2XRAL 3QH3B 2ITDA 1CFBA 2HRPH 4P2RD 4RFOH 5F9AC 1U3HD 2BNRA 1M7IA 5BRZA 5HJ3A 2BSTB 5EZLA 3MJ7A 1A4JA 3PIQA 2DJUA 2P24A 3B9KA 3IU4L 1MWAB 2M2DA 4FNLH 1IEBA 3KPTA 1CL7H 5EORL 1ZSDA 2I60L 3HZMB 1JYNA 1H15B 4UAOC 3AU1B 4P9HC 4YNYB 1WCBB 3KR3H 2BVPB 4KK9D 3N85H 4U6YA 2W59A 1M7DB 4L4VB 1PZUB 3D2UD 4X8XA 5A16A 4JPVH 3O41B 4DK6A 3BQUB 5IOPA 1INDL 3MRPA 3FL7A 4NO0B 5DJ8B 1JWUB 1YY8A 1KIUA 2HA1A 5DXWA 4WGVB 2AGJH 2EO1A 1T2XA 3O45B 3K1DA 4JGMA 3LKRB 5IWLA 4XCNA 2E6JA 3QISA 3IJHB 5AWNH 2J3SA 4LU5H 1F42A 3DMMC 1FGNH 1QVOB 2B4CH 2E9BA 3G08B 3GKWH 4JRXA 2OBGA 3WIHL 1CLOH 1Q0YH 5A2KH 1UJ3B 3ZT5A 2FJFB 1S7QA 3SDAB 2FEDC 4K9EH 1JL8A 1YY9D 3SBWC 4ERSL 4LLYB 5ETUA 3WDHA 3FO9B 4Y2DA 4HWNA 6FABL 4S1SH 3DTXB 1U58A 5H8DA 3MRLA 5IB1B 2VDOL 2NQCA 4X80L 5I1AA 3FT2A 5I6XC 5E4EC 3GHBH 3ULUF 4BQBA 3VFGH 3DV6B 1GL4B 3QRFM 1KACB 1VEPA 1BJ8A 1EMTH 1BWWA 1B2WL 1F58L 3QIWB 1ZA3A 5I1KL 3V4PL 1J5OH 1OGAB 1SY6A 1KEMH 1NCCH 3KXFA 4IMLB 3F62A 1MCPH 4GRWF 4E9LA 1QLEL 5FA3B 3HB3C 2Q7NA 1KXTB 3UCRA 3B2UC 3BIAX 3K1KC 1F11B 5TH2A 2PW1B 3MLRH 3ORJA 4K8RH 5KSBB 1NCTA 4NC1C 4LHJB 1G7PA 5IR1A 1HE7A 4AEHH 1FYHB 2NNAA 4MAYA 4M8QB 4Y8AA 5HGAA 5ADPH 1FAIH 3L9RA 1A6UH 4CNIB 4YC2B 2KQNA 4JY4A 5IHZB 2CK2A 5D7LD 4JANA 4L3AA 1YPZE 4LSVH 5DUBB 2GAZA 3TT3L 3VFUB 2DOCA 3N1PC 4D0DB 4TUOA 4OIBA 3G6JE 3G9VA 3RVUD 4MJ4A 2V9QA 1MNUL 3ARTA 1TZIB 2WQRA 5B8CC 4PRIB 4DK3A 5ALBH 2JIXD 1S7TB 2DIBA 3EKCA 2NXZC 2FB4H 4QF1B 3RGVB 4K55A 5SWQB 4P59L 1W0VA 5HVGB 1KCSL 4G9DB 4HBCL 4H8WH 5DVKA 2BNQE 4KTDL 4TYUA 5D70H 2J8UB 1L7TL 4DQOL 3ELAT 3KPQA 5FF6A 3GSRB 2BSSB 3GMRB 1HZHH 5CSZB 2W65B 4J6RH 3DV4A 3L6FA 4I3GA 5H94B 1FE8L 4MXVE 3CLFH 1W8OA 1DLHA 4R90H 5CEZL 4ZAKC 2QADD 4QCIB 1MIEH 3K81A 2XY2A 2GSGB 3MV7B 3ZKMD 4OF3A 4LCWB 3UC0L 3V79C 3FQNA 1XR9B 1Q9OA 3EGSB 1C7SA 2C4FU 3TPUB 1F4YH 4FQHB 4HIXH 3MA9H 3UBXA 4F15C 4E41B 2O5XL 2DI9A 4KPHH 1JGVH 1AGEA 2FX9L 2YHGA 1XT5A 3SO5A 4F2MA 2LQRA 5C71A 3C6SB 2BVOA 5IF0A 2Y1VA 3QXWA 4MAUL 1CE6A 4YK4B 3V4UH 2FD6L 4PJDB 3L95A 1FDLL 1HINH 4AENA 5KW9H 1KJMB 1MAMH 2KBGA 4YHPB 5CS7A 1T04A 3R1GH 4LPWA 1SYVA 5JO5B 2DQUH 5I1HL 3BO8B 5J6GB 3D0LB 3UPRA 4P2OA 1IBGH 3RWGA 4NWUH 4D0CB 1VFBA 4GW5A 3LQAH 1CE1H 3BAEH 1CDGA 4ZYKA 3WXWH 3BIBX 4PLNC 2LAGB 3U82B 4POZD 3REWA 4YDLB 4LGSB 5DT1L 4CU6A 1V7ML 3FQWB 1J8HA 4I2XB 3KAAA 4D9LL 1QZ1A 1YYMH 5FM5O 3MV8B 4OZIE 5DDHA 3UTSE 4P5TB 4OD2B 1HHKA 1JUFB 2F53E 2MPAL 3AMKA 5INDA 3CPLA 2YBRB 3TIDB 1VGKA 2Q86A 4OI8A 2W07A 1P6FA 1KC5L 3SKNA 4K9EC 3HC3L 2YUWA 4R2GC 2HKHL 1M4KA 2BXZA 5F9JB 4JZJA 3SJVA 3MRFB 4PJAE 4YGAB 1OQOA 1OP9A 4KK5C 3RVVC 3VE0B 3OF6D 4PTTA 3KPPA 2R2BA 5DMIH 3BKCH 5J56B 4B7IA 5T3ZL 5F7DB 3A6BH 3RVTD 4OSUL 5IMKA 3RX8A 5B21A 4NQCB 2DQTH 4WHYG 3BPOB 4IHOA 4OLXH 3IDMA 3H9SB 1Z3GL 4WFHE 3QHFH 1I85C 1NJ9B 2YPLA 3MNZB 2HRPL 4RFOL 5GHWH 3RWJA 4FQ2H 4F7EB 4ZFOB 4FXLA 5I18H 1HEZA 4AT6A 1RZGB 4LCCA 4F7MB 2ZUSA 3U30C 2F5AH 3WS6A 2WBKA 2ZOKB 4FNLL 1CL7L 2F74B 4K8RC 3FT4B 3SGJC 3N85L 4XNMA 3O6FA 3QO1A 4H1LA 3DUSB 2KUTA 1R3IH 2VLJD 4WENB 1TFHA 1I7UB 5I76A 4JPVL 2VXSH 3OKMA 2HLFD 2UWEE 2DI7A 3L3IB 1RK0B 2XQBL 1I3VA 4NKQB 3T8XA 1CGVA 2APBA 3GMOB 4GUPA 2AGJL 3KPNA 5JOFB 1SMAA 1T89C 1I75A 5J1TC 4O2CB 3FONB 4Y19B 5ITBH 4WFFE 2ICES 4XPTH 3CD4A 2B1AH 1WIPA 4FQXB 5AWNL 3ARFA 3QWOB 1YPZF 4YHIA 4X6CB 3TH3T 1FGNL 1I8KB 1G7IA 2B4CL 3MRKB 3GKWL 2UVFA 5I8EB 4G8FB 3NVQA 3G6JF 1CLOL 1KBGH 1Q0YL 4EN3A 4HIIB 5DZOA 5ABDE 2CXKA 4TULH 3WJLA 4K9EL 1BFVH 5F97E 4LVOC 4LAQH 4YE4H 5KSAA 4LPCA 3P4NA 4AM0B 1MAKA 4MVBC 4NKMA 2O5ZH 1DBBH 2W92A 4JG1H 3VXSB 5F7FA 4TNVK 3U7YH 1KT2A 3RWDB 2GUOB 3P2TA 1TQCC 4CVXA 3WFBH 4S1SL 2GITA 3BPLB 1D5MB 2XWBB 5FOJA 1JYWA 3TN0C 3TA3C 5BV7C 4U7MA 4P3DB 3F7RA 5TDNA 4MXVF 4LP4A 4X6DA 4DVRL 1EMTL 2OSLA 1J5OL 1KEML 1NCCL 1D5XA 5FK9A 1JNNH 4BH8A 1BOYA 5CD5C 1MCPL 4F3FB 1I8IA 4KDTC 1MH5A 3IDIA 5JQHC 3G6JA 3GMMA 3PHOB 2AK4E 3Q5YA 3MLRL 3MRMB 4K23H 4K8RL 1EO7A 3ARBB 3TYFA 3JTTA 3OPZH 3TJHC 2EXWC 5FV2A 5ADPL 3PWLA 3I84A 3LQAC 1FAIL 1CL7I 3MYZA 2OP4H 1A6UL 3RI5F 1RJCA 5C7XH 2MTPA 3U4BH 3QRGH 3UPCA 4U2ZA 4LSVL 4OZHA 3VFSA 3DSFH 1N3NA 2WM0A 5C07D 5EULV 2Z0BA 5FGSA 2QR0B 3VXPA 3RDTA 2WIIA 2IANB 1DBMH 4NCC2 3FB5A 4J23A 2FGWL 4YFDB 1WWAX 2BY2A 1OTSC 1MJ7H 1CFSA 4MDIA 5HHMD 5ALBL 1OL0A 2DAVA 5EBMA 5DRXA 1OD9A 4OZIF 4MD0B 3G04A 4PRHD 4XMKH 4XZUA 1HHHB 1BJ1H 2BMKB 4Y16B 3SKMA 3T4YB 1X6LA 3C9NB 5F3BB 4WI3A 1OB1B 4JJHA 2QKIA 4PG9A 1ORSA 4X99B 4YBHA 1CQYA 3F7VB 1ZVSA 1AH1A 3UTTD 3VFMB 1HZHL 1U8LB 4PJAF 5DVMA 4WFED 3O4LB 4J6RL 2C4FT 3OAZH 5D2LE 3ROOA 1Y6NR 3CLFL 4R90L 1U8MA 2A6IA 4ZFZB 5FM4A 5E0QA 1MIEL 1FVDB 3KPLB 4FTVE 2HN7B 2VQ1A 1CICB 2HJLB 3FFDA 2X4UA 5BV7L 3AVEA 2IAMB 2HMID 3FN0H 3ZZ1A 4JDTH 3FTGA 1WICA 1F4YL 2P43B 5F9DC 2YK1H 3QI9D 4KPHL 5JW5B 1JGVL 3U4EB 1H8OA 2HP4A 1CXFA 4ENED 4F33A 4R3SA 3A6OA 4JFEA 3QEQA 4Z8FH 1S7UA 1T7WA 3TCLB 4MNHB 5BMFH 3S98A 5EUOB 3KLAA 4OZIA 4QRUA 4YDJB 1W72L 4K7PH 3V4UL 2F53A 1HINL 5KW9L 4ELMB 1VACB 1MAML 1HSAA 4DGYH 3R1GL 5FECA 1X4XA 3UZQA 1GZPB 3OSKA 4Y5XC 5DR5H 2DQUL 1MPAH 1IBGL 4IM8A 3LQAL 1CE1L 3O9WC 3BAEL 1BEYH 2C7UB 5BZDA 2NW2B 3WXWL 5KG9B 4MQ7B 2UWEF 5EFIB 1U42A 1NL0H 2ID5A 1HK6A 1HHIB 5EOTA 1D5IH 5D1XA 3RPKA 3EYOB 1OAZH 1PZ5A 1YYML 2YPVH 4Y1AB 4X98B 3VFVA 3NA4A 3V4VH 1OCWH 1F4HA 3KPRD 1EVTC 2DLHA 1JF1A 1MFEL 2Q6WB 2EDDA 4TUKH 4YUEH 1CCZA 4Q6IC 1KTDB 3TBVB 1QPPA 1FNLA 4M03A 4ZOCA 3X12A 1B0RB 4V2BA 1T4KA 4I3SH 3EUUA 4PJ7A 2VRAA 1LQSR 4BH7B 3WN5C 4UV7L 1MCOH 3TC9A 3KPSD 5DMIL 2E9JA 3BKCL 5MENE 3D85D 1NEZA 3A6BL 4FFVC 1UWXK 5J13C 2D31B 4M62H 4ZODA 3NCEB 1N5YL 5KVFH 2DQTL 3FOMA 5AZ2H 1VEOA 2GJZB 5GRWA 5HGHA 4OLXL 5LWYH 4WUUE 1AGFB 1HNFA 3VMNA 1S5HB 2XI9A 3NACH 3V5HB 5GHWL 1KXVC 4FQ2L 2UWEA 3D9AL 3K4DA 2F5AL 3DARA 3NPSC 4HS6B 4S1DC 4ZUSA 2BNRD 4G9FB 5BRZD 2VDMH 4NJAH 4PG2A 2HT2D 2BY1A 4YIQA 4GQPH 3B9KD 5JIPA 4LIQH 2DI8A 1CWVA 1MJUL 3DRTA 2XWJA 4HUXB 4IRJB 2YWYA 3VGDA 5KBNC 1M6OB 1I3RA 3V6FB 2VXSL 3VD9A 4M5YH 5FYJH 3KVQA 5E9DE 3GGWA 4ALAH 4OCYH 4AQOA 1YMME 3K2UH 4O2EA 5JDJA 1NGWB 3ZDYE 4U1IB 5FUCC 4RMWA 5ITBL 4P49A 4PV8B 4K71B 4RMSA 4KJQD 1VFAB 2NXYD 4HLZG 3VA2C 1XH3A 4JFXA 1YDPB 3RWHA 5LGJA 1YEEH 2DQFA 2UYLB 3E3QE 1KBGL 1FGVH 1JMXA 4FXKA 3P4MB 2EE2A 1ZHNA 4JRXD 5E8EB 3EDKA 5CWSB 3D87B 4CU7A 1BFVL 3T65A 4LAQL 4YE4L 1NCUA 4CVWA 2HFEB 5DRNB 2O5ZL 2R0WH 4JG1L 5HDOA 3EIFA 4I0PB 5DQJB 1HQ4B 5GSVA 3WFBL 4QRRB 4OZGE 4NQDE 4IIQC 4R4ND 5T1DH 1PDKA 4Y2DD 2VLRB 2X4OA 4PYHA 4NC2B 2IQ9H 5ICXA 4UNTA 2ZJSH 4OT1H 2BSRB 5D2LF 3HPLB 3V5KB 4Z77A 3OGCA 1WBYB 3FN3A 2BCKB 4P46A 5E8NA 5KJRL 2ENSA 4XBEH 5D1ZA 4G8IA 3EO0A 2OMBA 1JNNL 1X6NA 4KC3B 2IPUG 3KXFD 4Y4KA 1N0LA 1WCQA 3QA3B 4ODUA 1S7XB 2X9XA 3MOBH 4ZUUB 4P23D 4GRLB 2P8LA 2WP3T 4K23L 1F4AA 3PGCA 3KLSA 3ILPB 5D7JC 5C2UB 2VB5A 3RZCC 4QRPE 1QBBA 2OP4L 2Q20A 3HMWL 3I85A 5C7XL 3C8HA 5KVDH 3GMPB 3U4BL 2FH8A 4YDKH 2R1XB 3QRGL 2RGSA 4GFTB 2W1NA 4LKXB 5IK3B 2JCCE 2SEBA 4P4KA 3DSFL 3GRWA 4FOMA 2FATH 3MBED 4XTRC 4G7VL 4L8SC 2A9MH 1DBML 1PQZA 3ESUF 2AXJA 2XFXA 1DVFA 3MQIA 1OT1A 3MRCB 3EYVB 1WT5C 4XMKL 3MNVB 3BPCB 3LKNB 3MUHL 2P5WA 3DXAB 5IMOB 4KZEH 1HH9B 4L8CB 2B8OT 2YA2A 3ARZA 1BHGA 1OWRM 1JPSH 3DO3A 5FA4B 5C0ND 3DVIA 3BEWB 3LEVL 1RZ8B 3MCLH 3OQ3B 5KANI 4KY1H 4WO4B 1AXIB 5IVZA 4PYGA 4OZFH 5ESAA 3MMEB 4NSKA 4NO3B 3I9GL 5F1NB 3VCLA 5F1SA 1IE5A 3M17A 5HVHC 1ACYH 2IPTH 3FN0L 3LH2L 2W60A 2NX5A 4JDTL 5TPWH 4O51A 1QRKA 3MRNA 2CDGB 3VH8B 1OP5H 3WBDA 2HTKD 2P48B 1CIUA 2YK1L 4PGEB 3RFZC 4I4WB 2HFFB 1OAYH 4IDLA 4Z8FL 4EUPH 3C8DA 4N0RA 3WYRA 4LHUA 5BMFL 1DEEB 1BZ7A 3HG1E 4GLRH 4XPAL 4YXHH 1UH3A 5IW1B 3JV4A 4UT9H 4M43H 2AJYH 2E8YA 5FOBA 3U9UB 3P4OA 4R4BB 1EHAA 3D0VB 3VFPB 4DGYL 1JWMA 5CBEB 5FFLA 1T1YA 2FJGB 3Q3GB 5DR5L 5JW4R 3DUUB 5EIQA 1I7TA 2V7HA 1BEYL 3P77B 4TSAH 4QHNA 2ATPB 3AC0A 4HFWA 2A77H 4NM4H 1NL0L 4H5SA 1CGTA 1P1ZA 4PS4H 3FO1B 1O7VA 3O6LH 1D5IL 1QBMH 1FZOA 3U0TB 3ZDYF 1A9BB 4JFQB 1OAZL 3X3FH 1YEIH 4UMGA 2YPVL 3V4VL 2R2HB 1AR1C 1OCWL 2B2XH 4UDTA 2H32A 1BZ9B 4YR6A 4WUUA 4XCEA 1J8HD 2M1KA 1UWEH 3FZUD 5E6IB 4G43B 4RA3A 1MFDH 3Q6GL 4TUKL 4YUEL 3E6FB 1P4LA 5C0RH 1T20B 2XTJD 1SJHB 2F5BH 4PY8I 4I3SL 5DQ9A 4KVCL 2CUHA 1AHWC 5DMGC 1IAKA 1MCOL 4M1CD 4PP1D 3SJVD 4X6BA 5CJ5A 4OQTA 3VMPA 4N8VA 1HH6B 3IF1A 2AVGA 4M62L 5KVFL 1JGUL 2X9WA 5SWZE 2BC4A 3WHE0 5T3XE 4LLQB 2OTWB 4OZGF 4R26H 3V52H 3O11B 3G5VA 1U8OA 3LCYA 1DUYB 4K3EH 5DEFB 5EIIA 4EEEA 3NACL 1EUUA 1QSVA 2VNCA 3M1BA 3AXLB 5E9DA 1YMMA 2VLLA 1NMAH 2H2SC 2VDML 4NJAL 3UZVB 2OM5A 3VFOB 5ACLA 3SE8H 3R4DA 2Z8WC 3PJSB 4EDWH 1GVIA 1WFTA 2RR3A 4TVSa 4WWKC 4UAOB 4UOW0 4J3VA 1D6VL 4IJ3C 1F3JB 4RGNC 3VH8G 5KVEH 3O6FD 3B3IA 3OJDA 4DW2H 4M5YL 1MHCA 4WI2A 5FYJL 4D8PA 4ALAL 3AREA 1CIDA 4UIMB 2Z4QB 1G6VK 1X5ZA 4QXUH 3K2UL 5J1AB 4JFOB 1T1ZA 3VJ6A 2MSPA 2NY3D 2IPKA 2UUDH 4PGDA 3OX8B 4UNVA 5IGXL 1PKOA 5J12B 3DIFB 4KGLA 5IFAH 1FNSH 3CFBB 4NQDA 2AEWA 5DQDH 2JCCF 1U8QA 1B9ZA 1TZHB 3DMMB 3ARFD 3X3GH 4LRIC 4WHTA 1YEEL 4FXGA 1FGVL 2X70B 5L8KB 4HCRL 4UDUA 2IH3A 1PKQE 1IAIM 2Q76B 3I6LE 4EN3D 2EYTB 2GCYA 4N1CA 4EQ3A 3TNNA 2R0WL 4D3CH 2YZ8A 43C9A 5HYSB 5JW3H 1CDJA 1FC2D 5KSAD 3UAJD 3HS0A 1XF2B 1UG9A 4YFEA 5DJ2B 1B3JA 5T1DL 1S7WA 1ES0B 4TVPE 2IQ9L 2ZJSL 4L3EB 4OT1L 4JFZH 5I6XB 5E4EB 2Y07H 3B9AA 1UT9A 3NN8A 5DMJB 4YEEA 4L8DA 1U3HC 1M71B 1QPXA 4XBEL 3BKJH 3L3JA 4PJFB 2IBGA 3W39A 4N90E 5I8OH 2JJUA 4HX1A 5C0GA 5CZVL 2P46B 1S9VA 1BD2B 3GSVB 4HUUA 3PWPA 4J3SA 3VI3E 3QEHB 1OP3H 4KK9C 3MOBL 1WFUA 4ZPTA 1VERA 4Z78A 5H35A 3AUVA 3QNXB 3AY4A 4BFIA 1I7RA 1NFIB 5ID0B 2NTFA 3RAJH 3L7FA 4WI9A 4RNRA 2RFXA 3QIUC 1JMZA 2GEEA 4LASH 3IDGB 5KVDL 1U93B 5EU5B 4YDKL 3DROA 1IQWH 4GMSH 3F12B 3GJFB 4QOKA 1I4FA 2OJEB 3GMLA 3WIFB 5HGDB 1MCQA 2FATL 4S1QL 5BS0E 1LK3H 1P4BH 1QLFA 1V3JA 1QFWH 2A9ML 3VRIA 3S97C 5CZXD 4TSCH 2DICA 5DFWH 5B8CB 2NXZB 1CZ8H 1RUPH 4KZEL 1YY9C 3EFFB 1IM3B 4HPOH 5DA4A 5T1KA 1U3ZA 4ZDHB 1HSBB 3WFDH 2VXTH 4KI5C 1OHQA 5E2JA 5JHDB 1A7BA 3MC0A 2KPNA 5C9JB 3MCLL 1P7KB 4QY8B 3S96B 1AGBB 4KY1L 4DOHE 3MJ9A 4L8BA 5E00B 3MROA 4XAKD 4QHUB 1KF9B 1KENH 5CJXC 3K4ZA 2H26A 3RUGA 2A2QT 5F6HJ 2CRIA 5A1AA 2CLZB 4KK6D 2Y5TB 4BJLA 1ACYL 5HYSG 2IPTL 5ITFB 1KTLA 3AS2A 4P3CH 1HNGA 4V1DB 3UTZB 4NRYA 5SWSA 4I9WD 4HQQH 4W4NA 1HKLL 1OTTD 1CU4H 1LD9B 3O3DB 4F15B 5MEPA 2N7BA 1OAYL 3ZO0A 3KWWB 1N6UA 1Z5LB 3VD5A 1JGLH 5D1QA 4QXGH 5DGQA 1AD0B 4YXHL 5CD3A 5EH1A 2XZQH 4F58H 4JFED 3LAFA 2VJXA 1OAQH 3QEQD 4CKVX 2PCPB 4UT9L 3EOAB 4M43L 1KIPB 2AJYL 1DE4B 5ISZE 1J0ZA 1CS6A 3NCCB 3UTSD 3U48A 4UU9A 4XBPB 2F53D 2P5EE 3F7PC 2VLKB 1TTFA 4EI5D 1PSKH 4P2QE 1KEGH 3T3PE 3QQ3B 3RGHA 3FRUB 4TSAL 4FA8A 1MCJA 2A77L 4NM4L 1IGTA 5B38A 1FH5H 4L29A 4HKJA 4M00A 4PGZA 4PS4L 5GRUH 3O6LL 1QBML 3BYTA 3RTQB 5GGTA 3RVUC 1IEAB 3EJYD 3X3FL 4WVRA 1YEIL 2X7LA 4HFUH 3LKOB 5F1OB 2HFTA 4NQTA 3FQTA 2VZ1A 4L5FL 2B2XL 1KJ2A 3V6OE 5D1XD 4O2FA 4U1MA 1IKFL 1CK0H 1UWEL 3HI1B 1MFDL 4UBDC 5ANMB 1PJ9A 5JHLH 2NLJA 3UZEA 5C0RL 4WFHD 2I24N 5KZCB 2YXMA 2F5BL 5IVNA 4G6FB 4MCYA 4PJCE 4X6FA 2ITCB 4WW2C 2N7AA 1NAMB 2CDFB 2DMBA 2AEPL 2LV4A 2QADC 1CD1B 3TCXA 3LS4H 2NY1D 3ZKMC 1UXSB 3JWDC 5I73C 3O2DH 2DQCL 4L4VE 4R26L 4PPTA 4MZ3A 2AJUH 2JE8A 4P3WA 4K3EL 5DHVA 1G9MC 2MHAA 4DEPC 5T33H 4CVZB 2RCSH 4Z0XA 4YAQB 1D6EB 1F90H 3PP4H 4LLMB 1NMAL 1CG9B 3RY6C 3RNQA 2R0LL 3U30B 3RBGA 4YHNA 3VDBA 2ZUQC 1A1OB 1I3GL 1QLRA 3SE8L 5HXMA 2CR6A 1UXWB 5E03A 3CVHH 4EDWL 1T1XB 3VI3F 3GB7A 4I0CC 4WFFD 5EWIH 1IM9B 3FCTB 2QJDA 3IT8D 4J4PD 5E56A 4F7TB 2I5YH 5KVEL 4DCQA 4POUB 4DW2L 1NGZA 3BN9C 4OJFH 1EEYA 4P4RA 3H3PH 3HZVB 3R06A 4CUCA 4FQLH 4QXUL 3TFKD 4POZC 4GLRI 1RJLA 2XZAH 5EPMA 5F7YC 1R5IA 3PP3H 1NBQA 2F19L 5IFAL 1FNSL 3GSWB 3UDWA 2YEZA 5INCB 3P9MB 5DYOA 5DQDL 4OF0A 2EXYC 2CLVB 2BP3A 2CIKA 2I07A 2IGFH 5I0ZA 4UQ2A 3M8OH 3OR6B 3CK0H 2K7QA 4Z7VE 2CRMA 2ZSVA 3X3GL 1K8DB 4ISVA 4G80A 2X89D 3DX8A 5FKAB 5F96H 2ZG1A 3QJFB 1OGAE 1WZ1H 1ZVYA 5CGYD 5D2NC 4LVOB 1LO3H 3TBWB 2J8HA 3BDXA 4RMQA 3RVTC 5I16A 1JGDB 1YEDB 5C0CA 3EZJB 2L7UA 2B1HH 1TQCB 2HJKB 5SX5K 2VZUA 5KSBE 4UT7H 4AH2B 3S7GA 4JFZL 3E1F1 5GRYA 2DKMA 2PXYC 4M7JH 2Y07L 4LSDA 3JWDL 5D6DA 4KKLD 4LARH 2F58H 3U7WH 3L5IA 1PG7X 1GGIH 3BKJL 1G9ML 1WC7B 3HCVA 2EICA 2EYRB 5I8OL 4N5UA 2IJ0C 4LDLB 3FFCB 4NM8H 5D1ZD 4G6KH 1LILA 5AUMB 4ODHH 2VZTA 2P8MB 3QFJA 4IRSA 1XGTB 3ARXA 4GJTB 5E2WH 1R3HB 2HT4C 4JM2F 1AXTH 4JKPL 4Y4KD 4R0LA 2ZUWA 3WUWB 1QSEB 2YMXH 3U36A 1HCVA 3ZYOA 3FOLA 3EHBD 3KGRA 5DK2A 5JXAL 2X40A 4ODXA 3RAJL 4KKAC 4ONHB 4LASL 1EUTA 4AY0A 1FL3B 1IQWL 5C0BE 4GMSL 4UUJB 2H3NB 2Z93A 3T3PF 2BDNL 1MUJB 4Q9CA 3STZB 1XIWA 2GJ6A 5FGRA 3NH7H 1NGXB 3HMXA 3MO1A 5GGVH 5ID1B 3VRJA 5DVLA 1AC0A 5ESQA 4NT6A 4LBEA 1LK3L 1P4BL 4X9FA 3V0VA 1GGTA 4P4KD 1QFWL 4TSCL 3D6GA 5DURD 4X4YA 3L5XL 4J7RA 3CDGA 3MV7E 1XF1A 5I1CH 4LCWE 4KU1A 4NBYB 5IW6A 1CYGA 1CZ8L 1RUPL 2GY7B 3MRBA 5I1DA 1L0QA 3VGBA 1DVFD 1YQ2A 2DM7A 4W68A 4XBGA 1X3DA 4HPOL 4KRNA 4PJ9A 5CEYA 4J8RA 3LKSA 2JB6A 3WFDL 5L2JB 2GI7A 4MGXA 1JGEB 2FEEL 3LKPB 1BBJA 4Y4FC 4PJCF 1B4JH 3BZEB 4XGZA 2DYPA 5C2BH 5AG9A 3RPIB 1KENL 5GZOC 5IB5A 1NBVH 4PJEE 4PJDE 4E5XB 1A4KA 1A1NB 5GS3A 1BBDH 3DX7B 2HG5A 5IEHA 4YHOH 1P2CB 2VDKH 2NY0D 4P2QA 1QG3A 1I9IL 4XH2A 2GSIA 3RIAK 3ZKSD 2A0LC 3U46B 3ARGA 3EO1A 4HQQL 3G5XB 2NX5D 1EEQA 2X1OA 3L3DB 4YO0B 4C59B 1CU4L 4XC3L 1LO2H 3PGDA 3GK8H 1JGLL 3BDBA 4QXGL 3CIQA 4OZ4B 2XZQL 4F58L 1J88A 3CCHA 1OAQL 3IJSB 1EZVY 4LHUD 3HI6H 3QH3A 1JZ4A 3ULVH 5HYJE 1NLBH 1X5JA 1A64A 4RFNC 1NSNH 1ERNA 1PSKL 4PJ5E 4XHJD 4YBLB 3G6AB 5E99H 4ZXBC 2BSTA 2VWEE 3O9WB 3MRGB 1FH5L 1MWAA 4XCNB 1JTOA 3PV6B 3HZMA 5F7HA 5GRUL 1Q9LB 3UTOA 1H15A 3AU1A 5EBGA 1WCBA 4HFUL 2BVPA 4LQ1A 5FYKE 5MEND 3UEZA 2Q7YB 4HH8A 2GK2A 1M7DA 1CK0L 3H9SE 4L4VA 4XVUD 1BM3H 2JJSA 4MNQA 3O41A 3MLVH 3BQUA 5JHLL 1BOGB 2CKNA 3CSPA 4WUUD 2D7PA 4NO0A 4PV9B 4RGOH 4Q6IB 5DJ8A 3BEVB 4Z7VF 5EU7E 3FN9A 1QFWI 1T66D 1G6RH 5DWUH 1D9KB 4FABH 3O45A 3WN5B 4HAGA 2YN3A 3C09C 3P73A 1A14L 3LKRA 3IFOB 1FFOB 3IJHA 1XEDA 3LS4L 5CIPA 1A6ZB 5J13B 2EEAA 1QVOA 4PRPE 3O2DL 3QSKB 4U05A 3QPQD 1AO7E 1MREL 4OKVB 3G08A 4YXKH 2AJUL 3FRPG 3ZHDA 3E8UH 4BUHA 1ZA3B 2HMIC 5KSBF 3BP5B 5T33L 5IVXA 2FEEI 2BXYA 1UJ3A 1MCIA 2FJFA 3IS1X 5GQBA 2RCSL 3S6CA 3QI9C 1F90L 1KYOJ 1ZGLP 4LLYA 1KSRA 5E9DD 1YMMD 3FO9A 3NPSB 1RUMH 2XKNB 4Y19E 3BWUC 3SE3C 3KHQA 3DTXA 5IB1A 1I1RA 3ZYJA 5IR1B 4X6CE 7FABH 1X5KA 3CFJB 4MAYB 4N8PA 5HGAB 1IMHC 4XI5D 4X4ME 2JJTA 4F7PB 5TDOA 2ICCA 2I5YL 3DV6A 4QXWA 3VD3A 1GZQB 5EU6E 3QIWA 3H3PL 4F37K 1OGAA 1BVLB 3L5HA 4FQLL 4IMLA 4POYA 2XZAL 3K46A 3GSQB 3ARED 2YD7A 4JZOB 5GRXG 3PWNB 5FA3A 1HDMB 5EDXA 5ERWB 3V0WH 4EKXA 3HRZB 1F11A 5D7IB 3NA9H 2IGFL 4D9RE 5MHSE 2PW1A 3DYMA 3M8OL 1MAJA 4NQDD 3AFLA 1AC6A 3ULUH 3QJHB 3JWOC 4M8QA 4JEGB 2AQ1A 1MEXL 5D4QA 4CDGC 5E2VH 2XA3A 5F96L 4HEPG 1NC2B 4YJZL 2DBJA 1WZ1L 4CNIA 2MQ0A 5IHZA 1WK0A 1E4KC 4JY5H 1LO3L 4L4TB 3DV4B 3L6FB 1MF2H 5DUBA 2X5PA 4GRWH 4MNGA 3VFUA 2NY2B 4D0DA 1QBAA 3H2WA 2B1HL 1L4IA 3O6KH 4IIQB 3W0WB 2DLGA 4UT7L 5K59E 4A2LA 1TZIA 4OLVL 2R29H 4PRIA 1S7TA 4M7JL 4CJ1A 2Z8VC 1Q9OB 5E2UL 4PTUB 4GXUN 4QF1A 3QR2A 2IBZY 4LARL 2F58L 3RGVA 2D3VA 4PJEF 5SWQA 4PJIE 4PJDF 3U7WL 1GGIL 3Q2CA 4G9DA 1CDCA 2NY7H 2J8UA 2X10A 4BKLB 4NM8L 4G6KL 2HT2C 4MWFB 4ODHL 2BVOB 5IW3A 3GSRA 5I19H 2BSSA 3GMRA 1KOAA 3OAYK 4NRZB 2W65A 4YHZH 3TH2T 1AXTL 5H94A 3DJ9A 3PWPD 3RKDD 2DLTA 2GTWB 3OJVC 4LOUD 2YMXL 4QCIA 1WF5A 2RJMA 3ULVC 4MJ6A 3G5ZB 2GSGA 3MV7A 4QRQB 4LCWA 4P2OB 3RWGB 3HZYB 3ZE1E 4GW5B 5D7JB 2VTFA 1NCNA 4U7KA 3EGSA 3TPUA 3RZCB 4HWBH 4Z7UB 3I50H 2ICWJ 4FQHA 2CR3A 2WUCH 1Y0LB 4E41A 3S35X 1CFVH 2R0KH 1FORH 5F7KC 5GGVL 1WFOA 3NH7L 3MV01 1CFTB 3O4LE 2GY5A 2KZWA 2NXYC 4QOKD 3C6SA 3OB0H 5JIIA 1DL7H 5KOMC 3ULSB 3CPLB 3WMSA 3SE9H 3WS3B 2EDYA 3DI2B 3VU2A 1V3LA 2H45A 4H0IA 3SKNB 4L8SB 4ONOA 4PJDA 4U6XB 3F7QA 1KJMA 5I1CL 4LPXA 1RU9H 4APQA 2H1PH 3QDMA 1FNFA 3BO8A 4LVEA 5F70A 3D0LA 5JO5A 3JWOL 2IPUK 5HI5C 2OS7A 4D0CA 4ZNEE 3O6MH 2FSEB 4FRWA 1MI5E 4ZO8A 3HRPA 5T1KD 1QP1A 3MXWH 4Y2DC 1B4JL 3FQWA 4I2XA 5EUOE 1FL5B 5C2BL 2F8VA 2FR4B 3MV8A 5AZEL 4HGMA 4P5TA 4OD2A 3R0MA 5D9SB 1NBVL 2YPLB 4MXWL 1JUFA 4KH2A 3L1OH 5GS2D 2A6DB 2YBRA 3HG1D 4ELME 3L3KB 3ABZA 4AT6B 5K9KB 3RIAF 1BBDL 1MRDH 5A3ID 3T2PA 4YHOL 2VDKL 5F9JA 4OLUL 4PB0H 3AMLA 1N64H 5HVHB 3MRFA 4UIKH 1IZKA 3VE0A 3W2DH 1A7QH 3RHWK 4Z5RB 1LO2L 1N4XH 3GK8L 4P23C 4XNMB 4NPYB 3CX2A 4K3DL 5F7DA 3S36X 4NQCA 4W6YB 5I76B 3UBXG 3I3EA 4MYWB 3H9SA 3HI6L 2P42B 2DIAA 4LSUH 1QSFE 3ULVL 4X6CF 1NJ9A 3MNZA 1NLBL 4C54A 1G0XA 4F7EA 3FB7B 4ZFOA 4J12A 1BJMA 1RZGA 1RK1B 4F7MA 3HC4H 5E99L 3NIGE 3W5NA 1KPRB 3MBEC 2ZOKA 1I8LC 2E3VA 2F74A 4S11A 2ZUYA 3ARQA 3IVKA 3FT4A 3ULUC 5MERB 1CDYA 4EI6B 3DUSA 1P9MC 2FBOJ 4KZDH 1BM3L 1S9WB 1I7UA 3MLVL 4N0YH 1JHTB 2R4SH 5T3XD 5DMYA 1M1SA 4RGOL 3L3IA 1RK0A 3EYQD 3Q48A 4YXLH 3V5DB 4GKNB 4NCC1 3GMOA 3SDCB 2MJWA 5JOFA 1G6RL 2APFA 5DWUL 1ZLWK 4FABL 4GO6B 2L0DA 2D7MA 2XN9B 1AHWB 3FONA 3OKYA 4KROB 4O2CA 4ZNCD 4FQXA 2JKXA 3QWOA 3S4SB 5E5MB 4PRBB 3VXUB 4WIQA 4X4MA 5SX4H 3MRKA 2ZKHL 4GS7C 5I8EA 4YXKL 4G8FA 3E8UL 3F65A 4M4RA 4MQXC 5K59F 1L7IH 4HIIA 1UM5L 1IFHL 2HTKC 1TVBB 5GS0D 2CXGA 4L9LC 2PYFB 3WDJA 4PJIF 1LWRA 4AM0A 4MJ5B 3VXSA 5EOCL 2PO6D 1RUML 3RWDA 2GUOA 3NCJH 1D5MA 2XWBA 5K93A 1MCSA 4NNPH 7FABL 4XP9H 1IARB 2OXHA 2UVEA 2EDJA 3PWLB 4P3DA 4JRYE 2OLDA 3DSNA 4IJ3B 1F45A 2W0LA 4F37F 4TRPH 1NANH 1R24B 4UOW1 4UINH 2ICEB 1OPGL 4U1JB 4DN3H 3CSYB 3EDFA 3ZT6A 3ZE1F 1NDGB 3N1MC 4OLYH 3IGAB 3EJJX 1N3NB 4CJ0A 1CGSH 4F3FA 1E6OH 1XGUB 4GG6E 3LB6D 3I6LD 3RDTB 5L88H 2WIIB 4QRRE 2IG2H 2VIRB 3FB5B 3V0WL 5HHPB 1KN4L 1CFQB 1BIHA 3NA9L 4MDIB 3T2OA 4XX1G 3PHOA 1I9EA 3MRMA 3VXRB 2Y6SD 3I3DA 3SDXB 3ARBA 3ULUL 2VERN 3DOSA 5F21B 3CH8A 3SEPA 4TVPD 5K9QI 1U6AH 3S37X 5E2VL 1U8NB 3T4AB 4PG9B 5HHXL 3CU7A 5DA0B 4PP1C 1MCHA 4JY5L 3BH8B 1MF2L 4N90D 2DRUA 4HW6A 4A2MA 2JJWA 5DJ6B 3MXVH 4AYFA 3O6KL 2QR0A 4PR5B 5I8KH 4OZFB 5DZNA 2PR4H 1H3WM 2IANA 5C0CD 4I13B 4GAFB 1VFOA 2R29L 4OF6A 4D0BB 1T83A 5EUOF 3MUGB 3EFDH 3K4AA 4MD0A 4Q97A 4U6TA 1FLRH 3B9VA 1I1FB 1HHHA 4JAMB 1CGUA 2BMKA 4AEIH 4ELMF 5EOQH 2HTLD 4U7SA 3T4YA 1CGYA 3VGEA 2NY7L 1CDIA 1C16B 3C9NA 5F3BA 1OB1A 4G6AD 4X99A 4U0RC 3F7VA 4EUPB 5I19L 4MCZB 3VFMA 4QXTB 4MA3B 3W81A 2KH2B 2J7LA 3QFJD 4IRSD 4JGUA 1TZGH 4ZFZA 4Y4HD 1FVDA 3KPLA 2HN7A 1CICA 2HJLA 3RL2B 2QHLA 4AJ0A 2IAMA 5BZDB 4HWBL 4ZNEA 3I50L 1EHLH 3QIUB 2NY3C 2O61A 4U0QB 2WUCL 4KDVA 1G7JB 4NZJA 1CFVL 3U4EA 5JW5A 1FORL 2HWZH 3HUJB 4EIGB 1JZ5A 1GRWA 1A6WH 1RJYB 5DFTA 4MNHA 3NIGF 5EUOA 1DL7L 4MLSA 1XIWD 2GJ6D 3SE9L 4OF7A 5FGBA 3QG7L 5D96B 4WWID 4ELMA 1VACA 3X12B 1RU9L 2FHFA 1INEH 3Q1SH 5J0BA 1T4KB 1FYTA 1GZPA 3OG4B 5IQ7H 3SGEH 5D8JL 1DQLH 4JN2B 3QXUA 1YZZA 3O3EB 2C7UA 4GW4B 2NW2A 3WJLC 5DD3H 5KG9A 4MQ7A 5EFIA 1UQSB 2OK0H 4XVTL 5DUPL 1HHIA 1CD0A 3MXWL 3VXQB 5F7WC 2YD5A 4JM2D 3EYOA 4OFYD 5CHNB 2WMPA 4Y1AA 4X98A 4EDXB 4Z7QE 5IROC 2BFVH 2DYPD 3L1OL 1HKFA 1RUAH 2Q6WA 1NGYB 2UZYB 3VXNB 4I18B 3ALXA 5F1IB 1KTDA 1MRDL 4RAUA 3TBVA 5EBWA 3BOVA 1B0RA 5I8CB 2HLAB 4PB0L 1N64L 4WU7B 5C0IA 3KYMB 4BH7A 4UIKL 3JTSA 5IFHH 1CXHA 1A7QL 3GUTB 3K74B 1QFUH 4OZFG 4P2QD 1JFQH 1N4XL 1DQTA 1TJGH 1UM4H 4LRNH 4YX2H 4BQCA 2P44B 2GJZA 5C0AB 4FZEH 3AM8A 5E8PA 1KJ3H 4KTEH 4LSUL 4ZD3H 3SHSA 1AGFA 5I1JL 3QUKA 5AD0B 1S5HA 3V5HA 1JPTH 4CAGA 2JLLA 3MLZH 1Q9KA 4P2YA 4EUPG 2ZG2A 1NUNB 4I8DA 3HC4L 5DTFB 1IGIH 2PYEA 3CDFA 1A3QA 2QQLH 3FB8B 4HS6A 4G9FA 3H9YA 3ARDA 4UZGA 5CZXC 4GG6F 3SGKC 2MNUA 4HUXA 4KZDL 4M7ZC 1KB5H 3QZWB 1M6OA 3HNTH 4N0YL 3V6FA 2ZCLH 4RMVA 2EIEA 4U1GC 3T65B 4L4VD 2EC8A 4HK3N 3BQUD 1DSFH 4ZSOB 4G7YL 1NGWA 4NO0D 1XR8B 4U1IA 4NGHH 4CMMB 4ORZC 3ES6B 3JV0A 2HJFB 4OBRA 1QTYT 1LEGB 5FGCE 2I25N 3ZTNH 2YR3A 5BW7A 3QQ9D 3OBAA 3CZJA 3OGCB 1YDPA 1RUKH 4KK6C 4M3JA 5I73B 4P46B 1ZLVK 2UYLA 1DP0A 3P4MA 4EBQH 2R1YB 4IOSD 3VFWB 2EEDA 1IAOB 2DWDB 5E8EA 5CWSA 3TT1H 2XT1B 4JO3H 4ODUB 2BJMH 3GBNH 4G8GB 4L1HA 3MV9B 4QHLB 5DRNA 3TO2B 3SDAD 2VH5H 4BQ9A 5DQJA 1HQ4A 1FHGA 3NCJL 4QRRA 1G9EA 2ZUQB 2VLRA 4NNPL 5A2LH 4HIEB 4XVSH 3GJFK 4XP9L 2BY3A 4JRWA 3WFEH 3GSNA 2VZVA 5GISL 2BSRA 5T1LB 1CBVH 3HPLA 3V5KA 3E0GA 4EI5C 1WBYA 2FZ3B 4RMUA 4HD9A 2BCKA 3CX5K 4UINL 5TQ2H 4P5KA 2CMRL 5I9QC 4DN3L 4HKZB 1WV7T 4QT5B 4KJPD 4OLYL 3VG9C 1R5WB 1UH4A 3QIWD 4JFDB 1CGSL 1OGAD 1E6OL 3QA3A 3EJYC 3P11L 4JPKH 1S7XA 3KJ4C 5J6HB 1XGPA 5L88L 2IG2L 2HYMA 4ZUUA 2YD3A 1FQ9C 1PQZB 3WFZA 4GRLA 4N0UE 5D1XC 2XFXB 1WBZB 1JI1A 4IS6A 1BAFH 3BE1H 5H2BB 3ILPA 2P5WB 1YQVH 4PREB 1U6AL 1YC7A 3KPOA 2E7MA 5HY9A 5D7SH 3WKNA 3MJGX 1UM6H 3GMPA 1ODAA 4OFKA 1BQUA 4LKXA 5IK3A 1BD2E 1WWWX 1ZEAH 5EO9B 1E0OB 3QZWG 4PY8J 3MXVL 3DI3B 5IMMB 2KDGA 4NSKB 5I8KL 3VFTB 2PR4L 3QBTB 1FZMA 3M17B 4GBXC 2V7NB 3EFDL 3NZHH 5HHQB 4LCIH 1MJ8H 4RAVB 4Z7QF 3MRCA 2PXYB 3EYVA 4O51B 1FLRL 4KI1A 3MGOB 3BPCA 4FG6C 4PRID 3LKNA 5IMOA 3DXAA 3I2CH 1YN7B 5F89B 5C70A 4L8CA 4I1NB 3TO4C 3QDHA 5E70A 1IC1A 5EOQL 3H7BA 3VFNB 3S8WA 3RGVD 3ETBF 5TQ0H 4NYLB 5FA4A 1X5LA 3BEWA 4XXDA 1ZOXA 4NJ9L 1RZ8A 4JO1L 1BX2B 3JV4B 2WWMC 5FUOL 1JIBA 4WO4A 1HQRB 1T0NB 4H26A 2FNBA 3P4OB 2VDNL 4J4PC 1TZGL 1JWMB 2ED9A 3MMEA 1RURH 4NO3A 3PL6C 3I02B 3RKPA 5F1NA 3NCYP 2V7HB 2G5BB 4Z76B 3MV7D 2DLIA 3D39A 4LCWD 5CJOH 2AI0H 2CDGA 2V5RA 1PG7W 4KMTH 3VH8A 1JZ2A 1QEWB 4C57C 1N59B 1KELH 3WIIH 3CMOH 3MGAA 1K85A 1VDGA 2HWZL 4I4WA 5I74C 2HFFA 4DVBB 1A6WL 3ARWA 3LN5B 1Z9LA 2QSVA 4E41D 3O2WL 4UDTB 4LEXH 3ARRA 1DEEA 1NANI 4P5MB 5IW1A 1FNEB 2Z92B 3U9UA 2V6HA 3D0VA 4R4BA 2V2TB 1CF8H 4LCYB 1INEL 3Q1SL 5CBEA 1IAIL 5IQ7L 2FJGA 3Q3GA 1DQLL 3DUUA 2IWGA 2LVEA 3QDGB 3PQYB 3P77A 5DD3L 2NPLX 2ATPA 4N8VB 1HOCB 1FFNB 2V9RA 2OK0L 1J87A 5FM8A 1MFBH 3FO1A 1A9BA 4JFQA 1FNGB 1S7VB 3TGXA 4Y4FB 1MVUB 2R2HA 2XY1A 1KB9J 3TWCH 2BFVL 2BVQB 1JK8B 3I75B 5E6IA 1RUAL 4G43A 3MV8D 3WIHA 3E6FA 5EC1B 3EW3B 3L5JA 4YGVA 2DKSA 1SJHA 3FHAA 4LNRB 3C60C 2DTSA 4LLDB 1TMCB 1U91B 4OFIA 1QFUL 2IEPA 3UTQB 2E6PA 1JVKA 1JFQL 2WW8A 1TJGL 4PLJC 3CVHB 4G5ZH 1S5IH 4LGPB 3P0YH 4LRNL 1HH6A 4YX2L 4YDIH 3EHBC 3KLHD 2OXGA 3GJEB 3B3IB 4FZEL 1IC4L 2OTWA 4LLQA 4KTEL 2ARWA 3O11A 4ZD3L 5FYKD 4G42B 4M9PA 4NQCD 1DUYA 2X1WL 2K3TA 5DEFA 1AFVH 3H9SD 3MCG1 4LHUG 3MLZL 2ZOLB 5IV2B 1IC7H 1MRCH 4RFNB 4WEBH 3OR7B 1IGIL 5HI3C 1J0IA 4ZXBB 1H5BC 2WNGA 35C8H 3VFOA 1U8QB 3PJSA 2ZPKH 3ZTJG 1XF5B 4Z7WE 4HG4J 4KFZC 1ADQH 5HHMB 1F3JA 1KB5L 3IAGC 3HNTL 4DGIL 3MLWH 2ZCLL 3MFFB 2RBLA 4MDJB 4O4YH 2GCYB 2F15A 4KHTL 4UIMA 2Z4QA 1DSFL 5J1AA 4WEMB 4JFOA 2FX8L 4ESKA 1NDMB 5D5MB 3OX8A 4NGHL 3DIFA 3CFBA 3NFPB 1SYSB 1IAII 3SGEI 1ACZA 2P4AB 4OF8A 3ZTNL 1A47A 4Y19D 1TZHA 3DMMA 1RUKL 4FQXD 5DO2D 4M8VA 1H9VA 2GW5A 2WBJD 2Y7QA 4A6YH 2VXQH 2NY0C 2X70A 4EBQL 4N8VG 4HC1H 1LDPH 1RHHB 5C07E 2Q76A 3JVGC 3TT1L 5B22A 1S3KH 4HIJB 2EYTA 4JO3L 3GBNL 1T0MA 3SBWA 2VH5L 4PBWD 2F9BT 2ILLA 3ZT7A 2UV3A 3MSPA 1XF2A 4PRHE 5DJ2A 1NCAH 3VXSD 1GGBH 4BFIB 5DVOA 2Z31B 4XVSL 1RPQA 3WFEL 4HMEA 4L3EA 4XWOC 1CBVL 3A0OA 5DK3A 3HE7B 5I30H 4XHJC 1HHJB 3UTTE 5TQ2L 4WFEE 4PJFA 1UVQB 5HHNA 3VRLE 3OZ9H 2NZIA 1EJOH 5HHVL 1BD2A 3GSVA 4F8TA 3K8LA 1NCWH 3QEHA 4M02A 3VRIB 2H2PD 4NDMB 2W9DH 5J3HD 4XC1H 3LRHA 1LE9A 3QNXA 4RGMC 4RDQF 4XVUC 3QUZB 3TZVC 1BAFL 3BE1L 5CLWA 1NFIA 3PGFH 1YQVL 5ID0A 2G60L 3LQZA 5TGBA 4X4XB 5D7SL 3ARBD 4KAQH 1Y18B 5EU4A 3JZ7A 3IDGA 3UO1H 1T66C 2APXA 2PTTB 1U93A 5FDWB 3NAAH 1TPXC 1UKQA 3GJFA 4HPYH 1ZEAL 4L8BB 5HD8D 2OJEA 3S88H 3WIFA 5HGDA 3V7AG 2Q1EA 2HVKB 3JV5A 1XFPA 5F6IB 4XPGH 1F2QA 3K3QA 2UZXB 5CEXB 1A6PA 4P57B 2ENYA 3ARUA 3NZHL 3BJ91 4LCIL 4HHAB 2IAND 1MJ8L 3ILQC 4WTZG 3W11D 3C6LD 5B8CA 3ZKNC 1CLYH 2E9IA 4NRYB 2VUYA 1A7NH 3I2CL 3EFFA 5SWSB 2JJVA 1IM3A 1EK3A 1T22B 4TTDD 5ADOH 1E27B 5MEPB 1CD9B 1V8HA 4ZDHA 1B6DA 3BSZH 5TQ0L 1HSBA 3TYGL 4Y16D 5JHDA 3WNLA 5D1QB 1RIHH 1HHGB 1KUMA 1P7KA 4QY8A 5FYLD 3S96A 5L8LB 1AGBA 4CL7A 1WTGT 5E00A 3EO9H 4XI5C 4QHUA 3KG5A 2H8PB 5DRWB 2XRAH 5CP3H 1A7RL 3O4LD 3VDCA 1RURL 2EDOA 5C3LD 1IC5H 4PIRF 5GSRB 2Y5TA 3KPSE 4M6NH 2VMFA 3E3QC 5DJCA 3C08H 1CICD 1KCRH 5CJOL 2AI0L 5ITFA 5IJKC 4FFZH 4KMTL 3AREC 4V1DA 5JIHA 3UTZA 5IHLB 2IAMD 4OCSH 2NY6B 3CMOL 3FQRA 3WIIL 3O3DA 1LD9A 3KWWA 1QD0A 3MLTA 4LEXL 4U1MB 4F9PA 5C08A 2ZUTA 1AD0A 4KKCD 1JNHB 1C1EH 2PCPA 3EOAA 5KS9B 1KIPA 1DE4A 1FN4B 3MOQA 5LGKA 4S2SB 4Z7WF 2ZSWB 3JXAA 3I3BA 2BNRE 2VITB 4XBPA 5BRZE 1FCGA 2X05A 2VLKA 3ZSSA 1YN6A 2IMNA 1TETH 3FRUA 3FHQA 3GSUB 1G6RB 3K8KA 2PTUA 4BFGA 4X9IA 1MFBL 3U7AA 1WISA 3RTQA 1IEAA 1RZKH 4MS8D 3QUXC 4CN1A 3LKOA 1P5UA 3RVXD 3TWCL 1PEWA 4OQTL 4Y1AD 2DQJH 4NOBA 5ANMA 5GGQH 1H3PH 1WGOA 5LJYH 3WSQH 5FO7B 5KAQG 3ROLB 2ITCA 4ZPVB 4LF3A 3MLSH 4HUWB 5JPMA 2I9TB 4JG0H 4C56A 3EJZC 1S5IL 3P0YL 1CD1A 4JRXE 4YDIL 4XNUH 2FLBT 1UXSA 5JTWA 2VDLH 1EIBA 4M5ZH 1P4IH 2QHRH 5I1KH 4L9DA 3V4PH 1T2QH 1AFVL 1FLTX 1I85A 4CVZA 5L2KA 1IC7L 1MRCL 4YAQA 1D6EA 4JQXA 4WEBL 4LLMA 1CG9A 5AYUH 1IGYB 35C8L 5DYOB 3VRLF 1RHFA 1A1OA 1C5DB 3OJMB 1UXWA 2ZPKL 1KLFA 4P9HH 1MLCB 1T1XA 4G9FD 3SGJA 5FCSH 1ADQL 4ONGH 2WWKO 4LP5A 4F7TA 5B38G 5GRVL 3OAZK 3MLWL 4PLOB 3KXFE 4N5ED 2X4PA 4O4YL 4OF5A 4IRJD 3B9EA 1FNAA 3HZVA 3MRHB 5I16B 1U95B 1I7ZB 3X13B 4XB7A 4GRWB 3HKFA 4HKBA 3BFOA 1T89A 3UPAA 4XXCC 4NZTH 5INCA 4IOFD 3P9MA 2CLVA 3CH1B 1AKJB 2E7CA 3IDUA 2G2RB 3OR6A 1P53A 3S3SA 1GJIA 4HXAL 5CZKA 1K8DA 4A6YL 4GS7B 2VXQL 4HBCH 4NCDA 4GAJH 4KTDH 1LDPL 4JO4H 5FKAA 1TVHB 4JFFB 2J5LC 2NYYD 1S3KL 4B50A 4WGWB 1FVCB 1YEHH 1FJ1B 4L9LB 2DQGH 4MHHG 3TBWA 2EZ0C 4Q58C 1JGDA 5DJDB 2G75B 4NN6B 1NCAL 2HJKA 1GGBL 3FOLB 3MPCA 1ZT7B 4I0PD 1FC1A 4AH2A 4QRRD 5IFJB 4HJ0D 5CMAB 2VLRD 5I30L 4EXPX 1XZ0B 2EH8H 4Z18A 4OKDA 4QYOB 2JELH 2W91A 1WC7A 2EYRA 3OZ9L 2BVEA 4PGJA 1EJOL 1U8JB 3FFCA 4L4TE 1S9XA 1B0WA 2Y72A 5ESQB 5HDQH 5AUMA 3V0VB 1NCWL 2P8MA 1CLZL 1XGTA 3NZ8B 4MAUH 1R3HA 3OXRB 2W9DL 4KDTA 2L7JA 1DEDA 5FAAA 5JNYA 4IRZH 3WO4C 3WUWA 1ITCA 1QSEA 4RA0C 5IW6B 2D9CA 2ZUUA 4GRLD 1AQKH 4XHQA 3PGFL 3WLWD 5JA8B 4MD5B 4KAQL 4X7EC 3RVWD 2JB6B 4LPTA 3LEYH 3UO1L 1TJHH 1FL3A 2BVTA 3GBMH 4G8EB 2EDBA 3NAAL 5B39B 4UUJA 4HPYL 4B0MM 2H3NA 4LMQE 3WFCH 1RZKC 2ADGB 1MUJA 4L1DA 3T0WA 1NGXA 1RZFH 3TBYB 1CXEA 1F5WA 4Q6YA 4S0SD 2XACC 3OKEB 3MLUH 4XH2B 1UADC 4QHMB 4PD4K 1A7NL 3ARGB 1Z2KA 3FRPA 2EE6A 2PO6C 4J3TA 3BSZL 4CVUA 3DXAD 5L2JA 3IFNH 5DF0A 1JGEA 2ZNWA 1J8HE 4GKSA 3ZYZA 1RIHL 3LKPA 2AJVH 4HUNB 3BZEA 2VKXA 3EO9L 2ZCKL 4QNPE 3TIEB 2XTJE 5DC9B 4G6JH 3RPIA 1KLUB 1UZ6E 1CT8B 4QEGA 4WO4D 4E5XA 4MSWB 2QL1A 2V2WB 4U1KB 1IQDB 5AYQA 4CADB 1IC5L 1A1NA 5ESVB 2DN7A 3SJVE 4M6NL 1HXYB 3DX7A 3ZE2E 3C08L 2A83B 1P2CA 1KCRL 5HYIA 1FIGH 5LXGH 4FFZL 3C8KB 3UXFA 3U46A 3MYJB 4OCSL 5TE6H 5GJTH 3G5XA 4MQTB 1XGQB 3L3DA 4YO0A 5IHUH 4XNQB 1JN6B 1QO3B 1BQHB 2I9LB 5TDPB 3TNMB 3ZSTA 4NKDB 4OZ4A 4MNQB 3IJSA 1C1EL 2YPLE 3KYAA 5H37G 1TQBC 4ZOBA 1Y6MR 2XQBH 3MRDB 1JI2A 1JWSB 4Y5XA 3U0PB 1TETL 1P84K 3G6AA 4JR9H 3P73B 3BD5A 3WNMA 3O9WA 3MRGA 4QWWC 2HT3C 3AAZB 5CIPB 3PV6A 1Q9LA 4LIQE 1RZKL 2G9HB 5F71A 3JV6B 3V6ZB 2Q7YA 5IVXB 1L6ZA 4NN5B 4RQQB 2DQJL 2E7BA 5GGQL 4ZS6C 4XX1E 4Y5VC 1BOGA 3G9AB 1A6AB 2EO9A 2O26U 1H3PL 4PV9A 2HTLC 5E6ID 4Q6IA 3BEVA 4G6AC 3PDDA 1WZKA 3GO1H 3WSQL 3CXHK 1BLNA 3P9LA 1D9KA 3MLSL 1X5IA 3WN5A 1KJVB 5D6CB 4JG0L 4KUCF 3IXTB 3IFOA 1FFOA 4DJMA 2M8XA 4Y4HC 1TNNA 5TDOB 3V9FA 1A6ZA 4XNUL 5C09B 2VDLL 1J7VR 2FWOA 4M5ZL 4DVRH 5F7UA 4OKVA 5I75C 1P4IL 2QHRL 4JVUA 4JFHD 1BQLH 1T2QL 3BP5A 3BI9X 4LSRH 5C6TH 1K8IB 3OHXB 3MV11 2BRQA 4R8WH 1JRHH 1R5VB 4Y0GA 5AYUL 2NY4C 2BNQB 4BSWB 2DL9A 1JPGA 2XKNA 4XRCB 3BHBB 3ZDXE 3WNNA 1S7SB 2FYYB 1U36A 4P9HL 2NR6C 3CFJA 4NQEB 5ALCH 4X6DE 4F7PA 1GC1H 1NMCC 4ONGL 1U92B 4PUBH 4QHKJ 4TVPL 4M7ZB 1GZQA 1FFQA 1TCMA 3T0EC 3NGBC 1NKOA 1NC4B 1JBJA 5ICZB 1WZLA 4U1GB 1IGJA 4YHYC 1BVLA 3I6KB 1BZQK 1QA9B 1BQHG 2W0KA 4MNGB 1QFOA 3AS0A 2ZNXA 3GSQA 3GFUA 2QLVB 2YD1A 4JZOA 3PWNA 4JM2C 4KV5E 3QIBC 1HDMA 3RIFF 4NZTL 5ERWA 1OP5K 2A6JB 3HRZA 2FGWH 5D7IA 4R6UA 4KGJA 3ZE0E 1DZBA 2W9EH 1A0QH 3QJHA 2HRLA 4GAJL 4JO4L 4XP4H 4CGTA 1NC2A 4Z6AT 4O58H 4OZHE 5FB8B 4PJ8B 4W4OC 4L4TA 1YEHL 2DQGL 3F7YB 4H20L 2XG5A 3FQUB 3O2VL 3HTLX 3VI4E 1EHNA 5JLZB 2VL5B 4MJ6B 4IIQA 3W0WA 3VXRE 2B0SH 1QFPA 5BV7H 3JSSA 3H8NA 4RZCB 3V6OC 4QNPF 3UTSB 4PTUA 3SO3C 4WW1B 2EH8L 5JORA 1UZ6F 4L3ED 4PJHB 3STBA 2JELL 4OGXH 4EOWH 5E2TH 4YHML 4TUJB 4XAKE 1T5WA 4M7LH 3ZE2F 4BKLA 43CAA 3D5OF 4MWFA 3VG9B 4BUGA 5HDQL 5J6GA 4H25B 4NRZA 3ZHLA 2R23B 5JXEC 4R4FH 1W72H 4P48A 1PGRB 3KJ4B 1BD2D 4IRZL 2GTWA 1BF2A 2FX7L 3VXMB 4LKCB 2R8SH 1K2DB 4APQB 4WV1C 3G5ZA 3HB3D 3QDMB 1AQKL 4I9WE 4QRQA 4K7FB 3PWJB 3HZYA 3BPNC 5IHBA 5D7JA 5I15H 3RX5A 1N8ZB 2HH0L 3RZCA 4Z7UA 3LEYL 1TJHL 3GBML 1X4ZA 4JFEE 1W0YT 5CJBA 1Y0LA 3QEQE 3WFCL 1RZFL 2EKJA 2WV3A 4RMRA 3NFSL 3ZDZE 3QQ9C 1CFTA 1V05A 3ULSA 1MFEH 2EKSA 3WS3A 4L8SA 1EEZB 4MXQC 4U6XA 2QSTA 4KTYA 1N6QH 3MLUL 4WU5B 4GBXB 1MCFA 3NOIA 2MOVA 2NMSA 2A73B 4LLWB 1VSCA 4RISH 4U4BA 5JUEH 1WT5A 4EVNB 2ED8A 3MOAL 4UV7H 4WUKH 1RZIB 2A1WH 2NXZD 3SDAC 2FSEA 5JDSB 3TO4B 2J8OA 3IFNL 4FS0A 1N5YH 2AJVL 1T7YA 1FL5A 5JHDD 5GGSB 1F6FB 1JZ3A 2FR4A 2UUDK 5T3ZD 4PP2B 4G6JL 1UEMA 1U0QA 5D9SA 1YEJL 2BHZA 2A6DA 1S78C 3D9AH 5FYKH 1EVUA 3L3KA 4DZ8B 1ONQB 3PL6B 5K9KA 3WKMH 3GDBA 1N7MH 4PJ7E 4Y5YC 1AP2A 2YD6A 4MA7H 1FIGL 1F3RB 4M3KB 5LXGL 1JZ7A 4J3WA 5TE6L 1CDBA 5GJTL 3RWEB 3BUTA 5IHUL 4Z5RA 5HSFA 3IVKB 2OTUA 4V1DD 4NPYA 3WCYA 4XNXH 1MJUH 2FJHB 2ICWI 1DQQB 1GC1C 5A2FA 4NO2B 1JV5B 2H9GB 1QRNA 3T08A 1ZHBB 3DVFA 3QNYB 4ELKB 1KB5B 3ZDXF 4M61B 4HK3J 3J8F7 3B4NA 4OM0H 7CGTA 3HPJB 4X6DF 3FB7A 1YYLH 2C1PA 4HV8B 4I0KA 1RK1A 4HH9B 3B6SB 1NBYB 4JR9L 2VZ3A 2VLKD 1KPRA 4YBQD 4Z95H 2LU4A 3EOTH 4UB0H 5MERA 4KV5F 5BXFB 4EI6A 5C0AE 3RTQD 1HILB 4NHUA 2F54B 1OP3K 2AK4B 1S9WA 15C8L 2V5MA 1Q0XH 2J88L 1JHTA 3ZE0F 1FO0H 2R9HC 4HK0A 4FQCH 4XMPH 3V5DA 4GKNA 1ZS8B 3GO1L 2X4QB 3C60B 3HAEH 4AL8H 3SDCA 5KZCD 2YWZA 2XN9A 1AHWA 4OZHF 4YDVB 4BFBD 1VFMA 3MUJA 1HYRC 3H0TB 3RVVD 4JLRB 3S4SA 5E5MA 4PRBA 1MQKH 3VXUA 3VI4F 1KTKE 1D5BA 5KJRH 3DUHA 1B4RA 1BQLL 4FQJH 1MFNA 5LCVH 4LSRL 5C6TL 2DQIH 2DJSA 4GMTL 4NRXB 1TVBA 4ZSOE 3BESR 1F6AB 5HHOB 4R8WL 1JRHL 2PYFA 2VQUA 3HN3A 5IM7B 1PW3A 4ZFGH 4MJ5A 1E4XI 3MRIB 1IKNC 3U9PH 5EOCJ 2APTA 1H5BB 5IUSA 3U0WH 1C5CL 1T1WB 2XXMB 2PUQT 1JPFB 5ALCL 1GC1L 4PUBL 4WWKA 4BQ6A 5D2LB 1T7XA 1RJZB 2BRRH 4K8RD 4M6OH 4JCMA 3HE6C 1MJJB 3HMWH 3QUMH 4FTVB 1IM9D 2MWCA 2P45B 2D0FA 1R24A 1VCAA 2ICEA 4U1JA 4TSBH 1FZKB 3CSYA 3HNSL 4XCCL 3QEUB 4XWGL 1GIGH 1NDGA 3IGAA 1Q9WB 4G8GE 3FO0H 3UJTL 1XGUA 3WD5H 5M7QA 1QR1B 4G7VH 3S9DB 2Y25A 2VIRA 1YMHB 4OGAC 5HHPA 1CFQA 1I1YB 3HI5H 3BXNB 5JPNB 1MVFA 3VXRA 2W9EL 1A0QL 2MMXA 1GOGA 3SDXA 5DJZB 3ZDZF 1H3TA 1EZVX 1J10A 3KS0J 4LRIA 4FFWD 4XP4L 1ZWIB 1J0JA 1L9MA 2BVUA 1U8NA 3T4AA 2DIJA 4M93C 4O58L 4MX7B 4XPBH 3LEXB 3LEVH 2ADFH 4HXBH 2CUMA 5HPMB 3T0VA 4JFDE 1FSKB 3BH8A 4JQIH 2VWEC 3TH4T 1KGCE 4HZLB 4D2NA 5DJ6A 4F80A 3O8XC 4QRTB 2ZZUT 4PR5A 3I9GH 4OZFA 1A22B 3UJJH 1FIEA 2B0SL 3CLEH 4PGBB 3BPOC 5DD0H 4D0BA 5EN2B 3MUGA 2P5WE 3LH2H 4I3RH 4LL9A 1I1FA 2O61B 4JAMA 4OGXL 4EOWL 4PGCB 5E2TL 5E4IA 5EU7C 3SY0B 1IGMH 4P9MH 1C16A 2LVCA 4PJ7F 4LVHC 4M7LL 4RIRB 3VWJC 3HFML 2AJXH 4EUPA 4MCZA 4M1DH 4XPAH 3CC5B 5FKPB 5KVGH 4KKNA 4QXTA 4MA3A 4JDVB 4UTAH 4R4FL 4UT6H 1EDQA 5CD5D 5JW4N 2R8SL 1SHMA 1FYTB 4RGMB 1I1AC 1T21B 5EZJA 3SDDC 3TZVB 1JRHI 3RL2A 1FP5A 2NX5E 2Y5EA 1QSED 5I15L 4NP4H 3O4OC 3IDXH 5E7FA 3UYOD 3QIUA 5DJXB 2NY5H 4ZTPL 3OMZA 3MRJB 3TJHD 2EXWD 3CMGA 4LK4A 1G7JA 4GSDH 1JE6A 1P7QB 1MCLA 3HUJA 2VXVH 3C5ZC 1RJYA 3CZFB 5F7MC 2DQDL 1G7LB 2W0FA 2XG4A 4Y7MA 1G1CA 4LSSH 2PKDA 1EGJH 3Q6GH 2MKLC 2EDXA 1QYGH 4KK8C 4X8JB 2WBJC 3JUYA 4RAUB 3VWKB 5EBWB 1N6QL 2EDTA 4OD3H 1LDSA 5C0IB 4RISL 4JN2A 3JTSB 4KVCH 5JUEL 3U4AA 1OTSD 3O3EA 1GOHA 4WUKL 2OR7A 2A1WL 4M9OA 1OOAA 2XICA 1FFPB 4GW4A 4F7CB 3OTTA 5CKAA 1YA5A 1UQSA 2CD0A 2XNAB 4XPHH 1KXQE 5IJVA 1JGUH 3VXQA 1XCQB 5E8PB 5CHNA 4E0RB 4EDXA 1SBBA 3QUKB 3PP3K 1PD6A 1QOKA 3SDYH 2VOTA 3QEGH 4KDWA 2YA1A 2EH7H 2AS5M 3WJJC 5FYKL 1NGYA 4OQ1A 1Q9KB 3VXNA 4I18A 2EIBA 5F1IA 3WKML 2MQ3A 1N7ML 4W6XB 3R0NA 4HDIB 2PYEB 5I8CA 4MA7L 2HLAA 4WU7A 1QSZA 2VDRH 3KYMA 12E8H 5IB2B 4HIHB 3PE9A 3GUTA 3ARDB 1S7RB 5J3HC 2XV6B 4XNXL 4F8QA 1D6VH 1UACH 3V7MA 3VGAC 4OZGB 2GTZA 5C0AA 1OQXA 4OAWB 1GPOH 1Z0MA 4RRPG 3ARBC 3OXSB 4G6MH 5AD0A 4OM0L 1X5XA 5GGVY 1YYLL 4JPIB 1X5YA 2IBZX 5IGXH 3BZ4B 2X2YA 3CFIC 1J86A 2BX5A 5DTFA 1WIUA 1F2XK 4KQ3L 3FB8A 4ZTOL 5C0DB 25C8H 4Z95L 1J05B 2Y4SA 4JQVC 3EOTL 4UB0L 3VW3L 2Q87A 3QUXB 1LNUB 3IFLH 3T0BA 3C6LC 5JOEA 4HCRH 3QZWA 4A6YB 3K2MC 1Q0XL 5IG7B 4DN4H 3TESA 2XA8L 1FO0L 1X5AA 1YJDH 3O3AB 4ODTH 4FQCL 2A9NH 5DSCB 4TNVF 1URLA 5ILTL 1XCTB 4XMPL 4ZSOA 5I1IH 5DJAB 4QRPB 4Y16C 4AL8L 1XR8A 4U1NB 4CMMA 3ES6A 3V8OA 2HJFA 1LEGA 2JCCB 1D9KD 3GSNB 3TVMB 1MQKL 5DZLA 4B53A 3V7AE 5I17B 2QQQA 3ZKXB 4FFVD 4P5KB 1PLGH 4GH7B 4FQJL 5C86A 5LCVL 2R1YA 2DQIL 3VFWA 1IAOA 2DWDA 1E4JA 5CZVH 5DFVC 2DM2A 3GI9H 3QUYC 1ZV5A 3T09A 3ZMRA 1WIOA 4NHCH 4G8GA 2AXHA 1XGPB 4ZFGL 4QRSB 3MV9A 4QHLA 3TO2A 2ATKB 3U9PL 3RY6A 3BN3B 2APWA 4KKCC 2EECA 3U0WL 2KZ1B 4IS6B 5B3NA 2WLZA 1NMBH 4HIEA 4S1DD 3GSXB 5I2IB 3KPOB 1V5JA 2BRRL 4M6OL 5HY9B 5T1LA 4XT1C 3GBLA 4MAYD 2FECL 2FZ3A 3QUML 3OB8A 2NY5C 2VR9A 2P1YA 3T77B 4KJYB 4WNQA 4HKZA 4TSBL 5I71B 2OZ4H 3F58H 4QT5A 3PWPE 1GIGL 5HGBB 1R5WA 1FZJB 3FO0L 2LTQC 4JFDA 4S1QH 4X6EB 5AEAA 3WD5L 4MS8C 1BFOA 4KUCD 5EO0B 2LAAA 5J6HA 3RNKB 3P40A 1FZMB 3HI5L 4YFLF 5C6PB 1WBZA 3CFKB 3GKZA 5H2BA 1NUFA 3HG1B 5F44A 4PREA 4G3YH 5CGTA 4GW1B 4HUKB 2C3VB 1RY7B 3H7BB 4QOKE 1QHOA 1MFAH 4XXDB 1NFKA 4XPBL 3OKOB 2ADFL 4HXBL 1NC2D 4YPJA 4JQIL 1J18A 4H26B 1S9YA 5EO9A 4L4TD 5IMMA 4F9LC 3VFTA 5MEOB 3EOBB 3UJJL 4X83A 3V6BR 2NY2D 3CLEL 5SV3A 3EBAA 5DD0L 2Q3ZA 2V7NA 5HHQA 3D39B 4I3RL 4RAVA 3W0WD 2PXYA 1KG0A 3MGOA 1Q94B 2OYPA 4AG4H 1MHEB 1YN7A 5F89A 1HKLH 4C4KO 3MA7B 1OAUH 3VFNA 1IGML 4P9ML 1KPVA 3ALWA 4NYLA 2EDRA 2AJXL 4M1DL 4N0CC 3PV7A 3BP7A 5KVGL 2DF3A 3NIFE 1BX2A 1ZHKA 4UTAL 1HQRA 4U1HA 4UT6L 3RUGE 1L9NA 1T0NA 1S8DB 3CFDB 3WO3B 4D9QD 4WI7A 3WO4B 3SCMC 4BZ2H 3F6LA 3I02A 5SWZB 3DLQR 4IRJC 2DD8H 2XTLA 2G5BA 4C58B 4XVJH 5IEKB 4NP4L 4Z76A 1IT9H 3WNOA 5SWSE 3RA7L 3IDXL 4P2OD 4CN4A 2NY5L 5F7EH 4QTHB