1D9KD

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
188
structure length
188
Chain Sequence
GSERHFVHQFQPFCYFTNGTQRIRLVIRYIYNREEYVRFDSDVGEYRAVTELGRPDAEYWNKQYLERTRAELDTVCRHNYEKTETPTSLRRLEQPSVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 188
sequence length 188
chains with identical sequence H
ec nomenclature
pdb deposition date 1999-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d9kD01
1KIPB 2X2YA 3AAZA 5E2VL 4V2BA 1T89C 4IS6B 3S9DB 2OR7A 3GSXB 3QA3A 5C70A 5E2WL 1J1PL 1NCNA 5IB4B 4HGKC 2OZ4H 4OLWL 3D85D 2GJZB 1L6ZA 5GSRA 3L3IA 4JLRB 3KPNA 4NQDB 5CGYD 2EDTA 3QI9D 4CN6A 3NIDE 5F7NC 5DJDA 4WDIA 4X4YA 4XPGH 5A16A 4PJGF 2DKSA 1GOHA 2NY1C 3V0WH 3C09B 1NUNB 1BQHB 1X5AA 5L2KB 2X4QB 5SWZE 3D85A 4WFFE 3K4AA 1KJ3H 2V7HA 5DUMH 5HSFA 2ERJB 4ZQKA 4OKVA 4YE4H 1IC7H 5F7KC 4R2GC 3PJSA 3QI9A 1N3NA 1M7IA 2VUYA 4MSWA 4YHZL 5KVDH 3G5YA 4NBXB 4X6BA 1KTLA 4TNVF 2VAAB 3VWKB 4BUGA 4NN5B 2ATKA 5FYJH 4FXGB 5ALCL 1D6EB 2F5BL 3BPLB 4ACPA 4AG4L 5F7YC 1CFNA 3HE7A 3RPIA 2P46B 1MHHB 1VGKB 4I77H 3KDMA 1KJ2L 3L5IA 4M7ZB 2OP4H 4P46A 4YEEA 2PW2B 1FH5L 2A6JB 5L8KB 5JW4M 3GSQB 4QHKI 1C5DA 1OCWL 4M00A 15C8L 4D9LH 2R2BB 1NBYA 1WGOA 2OSLA 3BQUB 4KKLC 3SE3C 5I9QC 3QXWA 3BMVA 4FQJL 1NGZA 1DUYA 3WKNA 2X1QA 2CRZA 3MROB 2BNQB 3CU1A 4OD3H 3V4VH 3AC0A 4FG6D 2CRYA 4QHUB 4XCFH 2VLJB 4KTEL 4FQHA 1CU4L 3I9GH 5GRYA 5JQ6L 1YEHL 3SDAC 4YFLF 3L3OB 1NGPL 3BD3A 1QPXA 1YEFH 4NKMA 4X6FB 5D7KD 3KPOB 2X4TA 4JFYB 1YEEH 6FABL 1I3GH 5C1MB 1E28A 1G7IA 2BVOA 2I9LB 3RA7H 2C5DC 3QUZC 5D2NC 1XCQA 3V0AC 1WBYB 1NCUA 1HEZB 1UXWB 2GJJA 5T5FL 3BI9X 1I85A 1HHHA 2UZYB 1E4XH 5IOPB 1KC5H 3UZEA 3DTXB 3L3HA 3STZA 5JMRA 1KF9B 4XVUC 3FOMB 3BKCH 3GJFB 3UDWA 3QQ3B 3GJEA 4PS4L 2GIYA 1F8TH 5CCKH 5F1NB 3HNSH 4MXWL 2HH0L 1H3PL 2FNBA 4GSDL 5CD5D 1DBAL 1NEZA 3RY6A 4NQSB 1ZWIB 3G5ZA 1U8NA 1UJ3B 1Q9OB 2F54E 5ICXA 3TCLA 2ZUYA 1IGML 3MRLA 4KK6C 1U2HA 1H3GA 1RZGB 1XAUA 4P3WA 5F9AC 4TOYH 1IMHC 4MS8C 4I48A 4HUWA 4PRHD 4Y16D 5E70A 3CVHA 4HJ0D 4LSPL 3QQNA 3P0GB 1UJTA 3MRQB 4XRCA 5DR5H 5BS0B 3BZDA 4HS3A 1M6OA 3O4OB 1JPGA 3D39B 3VD9A 2YPLD 3EAKA 2DQUH 2Q20A 4KDVA 4U0RC 2DM2A 4EDWL 1X5HA 4DZBB 1PVHA 4J3WA 1KIQB 4JKMA 5F6IC 1H3XA 2FBOJ 3PV6B 4PRHA 1ZS8A 1LD9A 3FOLA 1T66D 4LCWE 3VMNA 3QUYC 3BKYH 1DQLH 1RUKH 5J1SC 5HHOE 2HVKA 2YPLA 3LQMA 3TBWB 1A7OL 1KYOK 4DZ8B 3BRDA 2FJHA 3QXAA 1Q72H 4WRLA 2AJYL 1ERNA 2VXVH 3PL6C 1T0MB 4NCC2 3UJJH 4RZCB 2HT4D 4AL8H 5HYSG 3T08A 1WBZB 3VH8B 4F7EB 3IU4H 2DQCH 3CXDL 4UTBH 2ENSA 4I0PB 4CVUA 3TYGH 2BNRB 3RWCA 5TDNB 2BY2A 4XPHL 5FO8A 5GGRA 3AM8A 3MRIB 1UWGH 1CFSA 4M6NL 4PYGA 2YXFA 2W9DH 4QHMA 3WKMH 2FRGP 5EO0A 4N68A 3BVNA 3IXTB 5GISH 3PWNB 1ZGLP 3T3PF 1UYWL 1CXIA 5IMLA 1MCFA 1PG7W 4MD5A 4TTDD 4G80A 3N1FC 4KZEL 4YIQB 3CDCA 4PJAE 4QRTA 5GGQL 2OL3A 4IM8A 4I0KA 3TV3L 4PJ7F 4WU7A 3MYJA 2X4PB 5B38B 3P30L 3GK8H 1MF2L 3HG1D 4GW5B 2R4SH 2CLVA 4LPWA 5J11B 1JI1A 4KK9D 1LO3H 1Z5LA 2G9HB 3KHQA 5SWQB 1EHAA 4XNUH 4LNRA 3G5XB 4O02H 4CU7A 5I1HL 4FQIL 5CJOH 1RJZB 3ZL4H 2XWJB 1T20A 3RX7A 1CWVA 2DOCA 4WUUD 2ZWLT 3QB7C 4Z7UA 1F00I 3DO7B 1B0GB 5K9KA 3H42H 2I27N 3HG1A 2VZTA 5DYOB 2BK8A 4KHTL 5TE4H 2UWEB 1G7LB 2R56H 5D7SH 5E6ID 5GSVA 4MZ3A 3HB3D 1GCFA 4PV9B 2QKIA 3WIFA 4LF3B 5F9DC 2NX5B 4JFQA 2Y6SD 3WHE1 5JTWA 1SYVA 4QT5B 4C57C 3GIVA 1RHHA 2G60L 5EIVA 4WUUA 5CBEA 4GRMB 1CF8L 5E95B 2OBGA 5EZJA 1YJDC 1DVFC 1MJ7H 1BFOB 3DUSB 2DQDH 3U9PL 1MIML 5E6IA 3RRQA 4D9QD 1NBZB 1WUNT 3T4YA 4DVBB 3BDYL 4OFYD 5MEQA 1HK6A 5FCUL 4YAQB 3V6FB 1GAFL 1OSPL 4KROB 5JOFA 4K3EL 2ZP0T 2IFGA 2W0FB 4ZOCA 3QIBD 1UM6H 5E1HB 3LHPH 4AENB 1TLKA 4PB0H 3CDYA 1P84J 1ZHNB 1J1OH 4OFYA 4JKLA 5DJXB 1R5WB 3BUYB 3HFML 3WHXA 1S3KH 3T2NL 4KMTH 4X80L 3WLWC 1UWXH 3MBEA 5DHVH 3W0WA 2R8SL 1DQJB 4HJGA 1AE6H 4YDVA 4QF1B 5DJCA 2YUZA 4P2RD 4W70A 4J3TA 4U1HA 2G5RA 4M1GH 3QIBA 5AZ2L 3HTLX 3O6KL 2YBRA 3P77A 3WEXB 3K0WA 3MV8D 4ZTPH 4Q9CA 3MLRL 2AJZA 3BPNC 3HNTL 1F90H 5K9QI 3QDJD 1UACH 3NGBB 4QKXB 1G0XA 1RQ5A 1KT2B 3TM6A 1B4JH 2FBJL 3NACH 5CD3A 4P2RA 1C5BH 1R6VA 3HE6C 4U6HA 4JN2A 4CVXA 2PTUA 4QXGH 1F4WH 3FQUB 1MEXH 3K8MA 3MV8A 2P5WD 4Y8DC 1OW0C 5B3NA 5J9PA 1S9WA 4NP4H 4L5FH 2VLRA 4CVZB 5DD3L 5E00B 1NSNH 3O8XD 4MX7A 3D6GA 3B83A 3IETA 3Q5YA 5K9JL 5EU4A 1NMAL 3MJ9H 4R90L 4RDQF 4M7KL 4PGDA 4UB0H 3ZZ1A 4YDLB 5IB5B 2EDEA 1QLRA 1ZT1A 2Y23A 4EI5A 4IMKA 2XIDA 3VXUB 4K94C 1HHGA 2P5WA 3S35L 5IJKC 2JJTC 3JTSA 3OJMB 2YKLL 5F89A 2W9LA 5E94A 4Z0XA 2EE6A 1YY9C 5ID1B 4CW1B 3O8XA 5BO1H 4Y19B 5F8QC 1HILA 4RBPH 1DQML 2EDNA 3VXOA 2F19L 2MWCA 3GKZA 1QEWA 3U2SA 5D2LE 4O2CB 4CNIA 1JGDA 3KPMB 3LKOB 1Q9KB 2QQKH 4PY7B 1HYSC 4R3SB 1ZMYA 3PGFH 4ODHH 5HBBA 5AWNL 4OQTH 4OV5B 4PLKD 3CFJB 1JGVL 1O7VA 1QACA 4LVNC 3SPVA 4EBQH 3QXDA 4HULB 1DN0B 4HIIB 3FMGL 3LKSA 3ALXA 5KSAD 4A6YA 1FNFA 1R24B 1BLNB 3GMLA 5IR1B 1IRAY 1HI6B 4LEXH 4P2OB 4LLWB 5TFSH 2D7TL 1QA9B 1R0AL 3EW3B 2XN9B 2IBGA 3ZHLA 1B4RA 4CN4A 2GK2A 2QV2A 4LVEA 1VGEH 3DVNB 4OM1L 3RQ3A 1OSZA 1J1PH 2APVA 5KSAA 1TVBA 1D3CA 4FQ1H 4OD2A 3KJ4B 3B9KD 3OJ2C 4JZNA 4LARL 4JO3L 2YD3A 4D0DB 1RAMA 5F7MC 1DFBL 2AJVL 3DGGB 4XVSL 1GC1L 2VXQH 4HMEA 4H88L 1EEZA 4MQXC 1QFWM 3BGMA 3HRPA 4IRJC 3RWIA 2XYCA 4NCDA 2OQJB 5GRZA 1W0VB 3GSNL 1HXMA 4QEGA 5C0JB 2P43B 2Z92B 3B9KA 1T3FB 3X13A 2NY4C 4ZUTA 3RNKB 3V4PL 3RVTD 3U4EB 4BA8A 2AW2A 1INDH 3VRIB 4E41B 1BX2A 4ZDHB 3NPSB 4R0LC 4XP4L 4OFKA 4RFOL 3RWDA 5EOCL 2F5BH 3MRRB 2X70B 2WM0A 1FVDA 1EGJA 3G6JB 5DJZB 3MLWL 3IXAA 4M4RA 1WT5A 1G6RA 4PJ8C 4QCIA 1KPRA 3ZT6A 2EDFA 3LV3A 3E6HB 2OJZL 1WF5A 4PV8B 4JZOA 4BKLA 2YUWA 4LK4A 2YPVL 1KTKE 4NWTL 4U1JA 2PXYC 3EOYG 4KPHL 1O0VA 4ZUVA 1LE5B 4FFYH 1G6VK 2O5XH 2ZOLB 3UTSE 5D2NE 2AABL 5I16A 5CSGA 4PRPE 1ED3B 3IRPX 1RMFL 5HPMA 1J18A 1MFCL 4QRUB 1QVOB 1JYVA 3QPXL 4URTB 2A73B 1CU4H 3EDDA 1E4KC 2FSEA 1FAKT 3CFDA 1Q8MA 2ZPKL 4WHTA 4XMKL 4PJXB 3EFDL 4GW4B 3S3PA 5D1QC 2X7LB 4LHUD 6CGTA 4GS7C 2R2HB 1Q94A 2VKWA 1EO7A 3MRHB 4FQQA 1MSPA 6FABH 3P4MA 3EDFA 3BP7A 3MCLL 1S78D 4D9RE 3FT4A 5ANME 1KIUA 2Q1EA 1JUFB 3L3DA 3PWPB 7FABL 4LP4A 2IGFL 1G1YA 3VG0H 1K8DA 4MQSB 4PJHE 2PN5A 1LO5B 1MVUB 3KR3L 3ULSA 4DUXA 2AV7A 4LHUA 1E27A 5T1KB 4PFEA 1MRFH 1FYTB 1SBSH 3I84A 4V1DA 3NCEB 3BAEL 2A6KB 4NPYA 2VDOL 1SJXA 3QFDA 2JB6A 4BZ1L 2HH0H 2R0KL 2XWBA 1RUML 4GSDH 5HGBA 1HINL 4TNWK 1DBAH 1MUJA 1QRKA 1TJGL 1TCMA 5D1XB 1P5UA 2ADJB 1JPST 1IGMH 1QLFA 4NKIL 1QBLH 3CFEA 4UT6H 2VAJA 5DK0A 1WQVT 5EORL 3BJ91 2HRPL 3FFDA 4Y4HD 4HBCL 2A6IA 3RL2A 2GFBA 3RZCC 4OLZL 4OGAC 4JRWA 3KVQA 3MACL 4GRLC 2A6DA 1X6NA 5IEHB 3M1BB 2HMID 4LKXB 4D9QE 2HTKC 4LLQB 4L8CB 3GBNH 3BE1H 3U7WL 3OKOA 4LLVB 1UH3A 1A1OB 1LK2A 3IFNH 4HCRL 3HUJF 2BSTB 4N5EC 4N0RA 1T5WB 4XPAH 3RNQB 4WIQA 4ZOAA 4Y4HA 3VFPB 1QSED 4AIZA 4NQCD 1E4XI 2GTZA 5D7LB 2YHGA 5I8CB 4FXKA 1HWGB 1PZUB 4CMMB 1A2YA 4X99B 4PGJA 4YZFF 4L29B 5DMKA 4LMQI 2Q7YB 2GTWA 4JHAL 1AQKH 3MV7E 4OD1H 1RHFA 1U95A 5DEFA 4I2XE 2MKWA 3DVIA 4NQCA 4P3DB 1HHJB 3OGCB 4P2RE 3VD7A 3QJHB 3EJYD 3FQNA 5I66A 3V6BR 3DROA 5B3JF 4NSKB 4H8WC 3QRGL 5IWLC 1IEBB 3HS0B 1CXLA 3MLUH 1T4KA 1HIML 3HN3A 3TVMC 4ALAH 3QDJE 4X98A 3VU2A 1AQDA 1RIVL 4PJ9C 2Q87A 1SMOA 3E3QC 5LWYL 3LH2H 1FN4B 1N5YL 5F7FA 4G6KH 4OFDA 4PJFE 3MLTA 3MNZA 3O4LB 4GUPB 5FYKU 4U31A 2CMRL 4E9LA 4NKOB 1NCTA 4N9GA 3LPFA 3I6GB 5FM4A 4Z7VA 4PJDA 4OF0A 1AC6A 4XNXL 5E6ZA 3EYOB 4PY8I 2A9NH 3NFSH 3ALPA 5JOPE 4KTDH 4FQIH 2VERN 1NGWB 5TDPA 5MEOA 3O3DA 3OKNA 2CO7B 3SGDH 3KLHD 3RTQD 1HXYA 3MRBB 5B8CA 5JHDB 2H2PC 4Z7WE 2G2RB 5T1MA 5C0NC 2XRAH 1IKFL 5KS9F 4R7NB 2EE9A 4NIKB 4KHTH 2J5LC 4J8RB 2AV1B 4HX1B 5CSZB 2VLKD 3U7YH 4UTAL 5C9JB 1KIRA 2B2XH 2HT3D 3HZMB 1HSBB 3L3GB 4QGTA 1ACYH 2HTLC 4F9LC 3RTQA 1XR8B 2CUMA 1J0YA 1ZGLA 4U6TA 4HBQA 1ZV5A 3NZHL 4U6YA 3U9PH 1DANT 2A83A 4JFXA 3TYFA 3KYOA 2VLKA 5D70H 2QEJA 5DLMH 4EN3D 2JELL 3U0TA 1AXSA 2VDQL 4ORZC 4WNQA 4RFNB 4QHNA 2RCSL 4P5TB 3B43A 2XZAL 2DTML 2J1KA 2YOCA 5KOMC 4ZTOH 1AD0A 3LIZH 4GQPH 4L4VD 5DMGD 1X4XA 4PLOB 1RFDH 2YZ1A 2W65B 1RK0A 4OLYL 2PW1A 4L3CB 3STLA 1ZSDA 1D5XA 4JAMB 4H25B 1U91B 1AP2A 3RVVC 4EN3A 3FONA 4EVNA 5GRJH 3EOAB 5GIRB 5HTSA 2DLFL 1YN6A 1QG3A 3QEQD 1DP0A 4NUJA 5F88A 3T0WA 4CDGC 1BBJB 2LV4A 3FN0H 5H35B 4OUUB 1MCPH 2NY3C 4N1EA 4U05A 2DI7A 3P0VH 4LRNL 4L4VA 5AZ2H 1MPAL 1TJIH 3F5WA 5LAXB 1K4DA 1DL7H 3O6KH 3SDCA 2YUVA 3MLSL 4PGEA 4M5ZL 3BISA 1F42A 2C3XA 5HI4C 1RJLB 4F15C 1HZHL 1K8IB 4YDJB 5SWZB 3BH9B 3H9SD 4U1IA 3EDKA 3NIGF 3BXNB 4WO4D 5B39A 4JFEA 3T65B 5IB2B 4AK1A 1DBJH 5E2UL 1MWAL 3UPRB 3MA7B 3SGEH 3SDDD 3V0VA 4QWWD 2NR6C 4ZFOL 1HKLL 1L6XA 3H9SA 3IGAB 4MA1C 1ACZA 4YLQT 2BDNH 4WO4A 2B4CC 1MFDH 2E27L 4XWOD 3UTTE 4M7KH 4W4OA 4CU8A 4F2MA 2JB5H 2X09A 1WV7T 3MRDB 2F9BT 4DQOL 1F11B 3SDDA 5EU3A 4AIOA 2DB8A 2A1WH 2JJWA 5E99L 3QZWG 3IU3A 3TN0D 1GVIA 3U6RA 4MJ6B 1GIGL 3T0XA 1X3DA 2M8XA 4G7VL 4LQFL 2CDEA 1M71B 3GJFH 3BZFB 2F19H 4HKZB 4OIBA 1K5NA 1KXVC 4QRRD 4MJIB 1WWWX 2IADB 4H26A 2CKBL 2PNDA 4NHUB 5C07D 2CJUH 3TN0A 4Y5VB 2Z93A 4NJAH 3GI8L 4RMTA 3LEYH 1JGVH 3DX8A 4UQ2B 3I50H 4BSVA 4N1HB 2F8VA 4Q9QH 1S7XB 5KZCB 3VXRE 3W9EB 3UO1L 5C0EA 2BSRB 5M7QA 4MNQE 4YXKL 4F57L 1Q1JL 2Z0BA 3GDBA 4QRRA 5IBUG 4LCIH 4YFLI 1JPTL 1MHCA 4LLDB 4WWKC 4X8JB 2YWYA 1QO3B 4ZPVB 5C07A 3HMWH 4G42A 4LDLB 2D7TH 2EDHA 3LSOB 5E2JA 1OM3H 2LU4A 4G6FB 3ZLQC 2Q76B 3QUKB 1IFHL 2YMXL 2IH1A 3OV6A 4RWHA 3ARRA 1FFNA 2ARJA 1YMMD 4IHOA 1IAIM 1L7IH 1UM5L 4E5XA 1KELL 1KN2H 3BPOC 5DFVD 4UILH 4JO3H 4P4KC 5E0QA 1PYWA 4EI6A 4Z7NE 1FGVL 1CXEA 2VDKL 3L3JB 1RUAH 4UDUA 3W11C 4NNXA 1B9ZA 4ENEC 4KZDL 3UTOA 1YMMA 1IM9B 1MQKL 4X4ZA 5GJSH 1OTTC 2B0SL 5ID0B 2P4AB 2EIBA 3K2UH 2IFFL 2IH3A 5EIIB 2CDGA 4AMKL 2XXCB 1NKRA 3MOAL 1M05B 3HPLB 1LDSA 2OXHA 4M7LH 1QSEE 4C56E 3SO5A 5I74C 3NH7L 2YD5A 3ZE1E 4XAWL 1IC4H 2VDNL 1EAPB 2GSGA 1SM3H 4IIQC 3MLWH 3T0DA 2HFGH 1N7MH 1G0YR 2HN7A 2Q7NA 4LCWB 5F9JB 3NCYS 4KY1L 2BMKA 2IALB 4JGJA 2OJZH 1FZOB 3W2DL 3DX9A 5HHOB 1ZGLM 4HZAA 2YPVH 3WNMA 4L3ED 3QHFH 4W81A 5I2IB 3VFRA 2R0WH 4OB5L 2Y1VA 1MCEA 4WI3A 4YWGL 2XQBL 3R0NA 2J8UE 2YEZB 1JNNH 4JHWL 3C2AH 5IMMA 4KKCC 4JFFE 5JDSB 3GHEL 1A64A 4EJ1C 1A0QH 4JR9L 4JM2B 1CE1L 3MUHL 5GXBB 1RZFL 1S9VA 3WD5L 2Z31C 3GMMB 5JXAH 4P49A 2ZPKH 4XMKH 3EFDH 5EC2A 1OGTB 4Q9RH 1Q0YL 5EO1A 3G6AA 1MLBA 3PDDA 3HAEH 4HKJB 1IBGH 5F97E 1CYGA 1NUDA 4Y2DD 3QWOB 1NLDL 3IFLL 3D48R 2R15A 5E08L 1ONQA 4MLIA 5ACLA 5I1CH 4NN6C 4JQIH 2DQEH 4NN7C 4ZFFB 2FECL 3VFTB 4JPIB 2CIKA 4RCAA 1LNUA 1J86A 3IDYB 5IJVA 2OMNA 2ZNXA 1T04B 4DJMA 2VL4A 3KR3H 4UT7H 5JUEL 1YMHA 4JG0L 5MP6H 1JWUA 3D5OF 5DJ2A 4Y2DA 1AGDA 1PW3A 3TLRA 4OZFB 2HT2C 3S4SB 1DQQA 3TO4C 2R0KH 4BZ1H 1G7QB 3EO1B 3SGKC 2BVYA 3ET9F 5CS7A 5F7WC 2DLGA 2QHRL 3U4BL 3S88H 5FDWB 3B2UD 2J6EL 2SEBB 4HK3N 2ORBH 1I7TB 4GW1A 3UAJD 5DA0B 1IEAA 2GCYB 4PB9L 1IILE 2QQLH 3RWEA 2H26A 4RDQG 5J6HB 3RBGA 3EYSH 4EIGB 1UGNA 4K23L 5CLTA 5E56A 1AJ7H 4MQTB 4GBXC 1XGPA 4WFHE 2GK0A 2ZUUA 3PG2A 1YPZE 1BECA 3QFJE 3RI5K 2JJSA 3KXFE 4ORGA 4WUKH 3LEVH 2I60H 1EERB 2NY2D 5DZNA 5EULV 5T3ZE 1HDMA 5GSRB 4P23D 1UB6A 5DJDB 3SDXF 4WDIB 1IGIL 3E3QE 4JHAH 2ZJSH 2D7OA 3LMJL 4GLRH 3GSUB 1F4XL 1NAMA 3OWEA 1RJYA 4X6DF 4LLAA 3QEQE 1YA5A 3VXME 2X1WL 3FJTA 4WW2F 3TBSB 4ZQKB 3ULVD 1D5ZB 2KQNA 4JHBA 4P23A 2C1PB 4KWUA 1AGEB 3PJSB 3QI9B 5I1LA 4XP6L 1N3NB 1M7IB 3N85L 4KRMB 4MSWB 5E4EC 3G5YB 3VMPA 1X5IA 4IRSB 1PGRB 3O2DL 3QRGH 1NMBH 3A67L 2GYSA 4P0DA 4G8FB 4XP5H 3BT2H 4RMWA 1WISA 1HIMH 5B4MD 4LOUC 1A7NH 1CXKA 1F4AA 1N0XL 4X6CE 3H9SE 4X9GA 2WZPD 1IKNC 2WMPA 3RPIB 3WFDL 3KDMB 5DJ0A 3BFOA 5LWYH 5DJ8B 4FZ8H 4PREB 4I1NB 5SX4H 3TO2B 3U1SL 5DRXA 4OIAA 4P2QD 4PJGA 1NBYB 4KKBD 3LEXA 4O00A 1P69B 4XBEL 1B88A 5AUMB 1AO7D 2X5PA 4HC1L 5GGRY 3O6FB 2CSPA 1IAKA 3GSRA 1U8OA 5EU6D 2PO6D 2Y72A 3MRJA 5AEAA 1DUYB 1NUFA 1FAIH 4PLJD 1FZKA 1QD0A 1CE6A 3PNWB 3Q5OA 4OCWL 4X7TA 2Y9RT 4HUNB 1UKQA 1T5XA 4FQHB 4DKFH 3NCMA 4M6MH 1G7PB 1AO7A 1BD2D 5C08D 1P53A 4UV4H 4WGVB 1IKFH 4TQEH 4KUCF 5EU6A 2PO6A 2YA2A 3QIWC 1IAMA 4JPVL 3VGAB 2V9TA 1A4JA 3CZJA 5FYJE 4F7CB 4N90D 4LL9A 5KVEL 5IHZA 1G7IB 2UZIH 2BVOB 1JZ4A 4UIMA 4IMLA 4HUUB 4HDIB 5IVXE 4GXUM 2N7AA 4BZYA 1BD2A 5FUZL 1IJ9A 1HHHB 5DVOA 4WJ5B 5C08A 1B6DA 1ZLUH 3DPBA 5LBSH 1NAKL 3NZHH 3L3HB 3NTCH 1P2CB 3DBXA 4F9PA 4JM4H 2KDGA 5IT2H 1VCAA 4P4RA 2DQFA 2JELH 3GGWA 1FVEA 4OCLC 1LO0H 1CICD 2NY5H 2NY1B 5E2TL 5EA0H 1E6JL 2XZAH 4MAYD 4S1SH 2DYPB 1C5CL 2CGRL 3H8NA 1CFVL 1I9JL 4EDXA 5FYLL 4KUZL 3SGDI 3JSSA 4YJZL 1OQOA 1V7ML 3OAUL 1FO0L 4HUWB 4ZO6A 3CNKA 3N1MC 5ESQA 4JKWA 5HI3D 4XRCB 2DLFH 2Q8BL 3TZVC 1CICA 2R9HD 4OLXH 2FGWL 1GHFH 4MD0A 4MAYA 1XGRA 3QQ9D 4MDJB 5HHVH 4NQXB 5HYEA 4KHXL 1JFQH 2EDQA 4MVBC 4RGOH 5IKCB 2H3NA 2C7UB 4M5ZH 4Y16B 3QUMA 1LD9B 1I1FA 3T0ED 4QHKJ 1V7NL 1HZHH 3KLDA 4LMQE 3RL1A 3I3DA 5CILL 1CGSH 5I9QB 3S96A 1R3LA 4XCNA 5CEZL 4YDIH 1NDMA 4JPWL 3A6BL 1A3LH 5E2UH 1T80A 1LP9E 2MQ3A 5ABDE 3LN5A 1UCBH 2UUDK 2FJHB 3QXAB 5IM7A 4Y4KC 3T0EA 4OGYL 2FD6L 3CSBA 4BSWB 2YSSA 3WJJC 4XP1L 5F7EH 5GRUL 3SDAB 3U36A 5I1IH 1VFBA 4LP5A 1FBIL 1FORL 4KDTC 3IS0X 4DN3H 1IL1B 3FQRB 4L3EE 3JTTB 1AXTH 5FECB 3RWCB 3QZWA 4Q0XL 3H6JA 5D1ZC 4YXHH 2RJMA 1CFSB 3HZKB 3A0OA 3UTSB 5D2NB 2YS4A 1GIGH 4ZD3L 4OZGA 2HFFA 5L6YL 5TPWH 1JF6A 1M7DB 1WEJL 3BVNB 5F44A 4L8BB 1R3JA 3JV6B 2NXZD 5IMLB 4YQXL 1OD9A 4UUJB 4OJFH 2Y5TB 3VFGL 4PBVC 4Y2OA 2R2CA 1NFDA 4WU7B 3TP4A 1C7SA 1S8DA 2AEQL 2RAMA 2CLVB 5IESL 2EYTB 1KACB 5GJTH 1Z5LB 3T0VA 4LNRB 2LTQC 2C1OA 1EMTH 3PIQA 3DNKA 1A5FL 3SGEI 3JUYA 4RGND 1AKJD 5IW6A 3SOBL 4YXKH 2EZ0C 2C3VB 2FH6A 1S7SA 5K9KB 1KJ2A 1AGFA 5JPMA 3VG9C 1JNHB 3K7UA 3HG1B 5EZOL 5JORB 2H2SC 4KK8C 2QKIB 4PJHB 5IGXH 4BFGA 3P2TA 1P6AB 1SYVB 1FIGH 1WIOA 3W9DB 3O2VL 1JK8B 2QSQA 2O61B 2QQNH 1NDGB 3ARDC 3DHJA 4PJ7A 5CBEB 2EH8H 3QIUC 5H94A 1KPUB 4PJBA 4IOFC 4JY5L 5DF0A 1JPFA 3F65A 3WIHL 3MR9B 5E6IB 5J06A 2VDKH 1IGCH 3HNVH 2LAGB 4APQD 4LPXA 3GKWH 3OB0H 1VFAB 5TF1H 2BFVL 3CFBA 1KCUL 3L5WA 4ZXBD 3LVEA 3N0PB 5CMAB 1T1YB 1QKZL 3CVIL 4ONOA 4JO4L 5GZNC 1MCIA 3HAEG 5HHNA 5JOFB 1NCDL 1S7TA 4K9EC 5JPNB 3UXFA 4WI2A 4UNVA 2R1YA 1T7WA 3VFVB 4APQA 3PL6B 4MWFA 4G43A 4NT6A 1ZHKB 3EZJB 4PRDA 4GG8A 3MLPA 1YY8B 2FEEL 3N1GC 4M61A 4JN1L 1WWCA 5EOQL 1LEIB 1CR9L 4QRSA 2WUCH 5I1EH 4KY1H 3QIBB 4X9FA 4Y5YC 4NM8L 3WL9B 3QR2A 2VISA 4TSBL 4OCRH 3IAPA 1CD8A 4GRWF 1RZ7H 2FWOA 3UTPE 5LQBL 2P5EE 2AJZB 3C60C 3GMNA 5INDB 3AS2A 2XQBH 4ERSH 1GOFA 1PEWA 2V5YA 4JHWH 4PUBH 2QSCH 4P2RB 1CT8B 5MEPA 4KI5F 3MODL 3DV6A 4JN2B 3P9LA 3MV9D 1WCBA 3QO0B 3WD5H 2KBGA 3RWJB 4X7EC 5KSVB 2YD4A 1PKQE 1OP3K 5J9PB 3T0BA 1S9WB 3CMOL 1A6VL 1MCOL 3C5ZC 1OWRM 3QDJB 4MX7B 4ZOEA 3NCCB 2UY7A 1KBGH 5TQ0L 1HHKA 4P2QE 3MGTA 4PJFB 4QTIL 5HI5D 4ZAKD 1OF2A 4N8VG 5D5MF 4GG6A 2YRZA 3C6LC 1G9ML 3MV9A 1ZT1B 4ETYA 4M5YH 4R7DB 3PWJA 1JJUA 3G6DH 4O58L 4JQVC 2P5WB 5IW3A 4U6XA 1DBML 3C09C 1MNUL 3MRPA 1YDPA 5DI8B 4X0KB 2DQTH 5F89B 1KCKA 4WCYL 4XMLL 5E94B 3IJHA 4Z0XB 3OKEB 4JG0H 1EEUA 1JWMB 1DVFB 3PWLA 4TVPL 4ZAKA 3UCRA 2AJXL 2DL2A 1NL0H 1GGYA 4PJ5E 2BRRL 4XX1G 5C08E 1ZLVK 4YUEH 4PJCE 3HI6H 4TULH 3VWKC 3HMXH 3QEUB 1J10A 2QHRH 4Z7WB 1RULH 3SKJH 3TEUA 1T22A 4WEBL 1B90A 3M8OL 2V2XA 5IBLD 1A4KB 5EWIH 2XZCH 1J9CT 3R06A 2YN5A 4M7ZC 3SPVB 1F6AB 4Q2ZA 1FL5B 4PB9H 5BZDA 4A6YB 1P1ZA 3GMLB 4DVRL 1B2WL 2P8MB 4MA7H 4YBLC 5FHAL 2IPUG 2X05A 4YBQD 5CWSA 4K23H 4WY7H 4X6EA 5DQDL 3BQUC 3EO9H 1J7VR 1QRNA 3EYUH 2Y25A 1N8ZA 3P0YL 4JKPL 5CJXA 2EDJA 4NRZA 4DGIL 4H5SB 2IAMD 4O4YL 3SKMA 5KSAB 1BJ8A 4OD2B 3H9HB 1QR1A 1JNJA 5DRWB 4JZNB 4HH9A 1K2DA 4NOBA 1PD6A 3I6KA 1D6VL 5I30H 4MXVE 3EYQC 4NKQB 4LLUA 1MFAL 3B8SA 2V7NA 3ULUL 4PP1C 1EEZB 3LMJH 4LSRH 4GXVH 4KJPD 1JF5A 3LKNA 2IAMA 3BGMB 1J0KA 5I6XB 4G8GD 3PXJA 3BIBX 4WU5A 3B9KB 3X13B 1BGXH 4ZUTB 2ZSVA 3QQ4A 4XWGL 4W6YB 3O45A 1WITA 4JFZH 4QHLB 4XP6H 5HYJD 2CXGA 4WHCA 3O2DH 1QYGL 2P8LA 4L8SA 3G08A 5DA4A 3NAAH 4WEMB 2K7PA 4G8GA 1FVDB 3F7YA 5GS0H 2LAAA 3GRWH 3WCYA 1YQ2A 2YPKA 3BKMH 2GUOA 5KJRH 5IFHL 2HJLB 5HYJA 2D7QA 3IDJA 4BKLB 1MY7A 3QUXC 2BVTA 1UM4L 1E4JA 2OL3L 4U1JB 2DL9A 4ZUSA 2R23B 4ZUVB 2K7QA 2O5ZL 4UU9A 3DX7A 4R4FL 4PRIE 2E7HA 1QSFE 2EXYD 4XGZA 2DJSA 1XZ0B 5HPMB 4GLRI 4NZTL 5HJ3A 3VFWA 3O4OC 3RU8L 1I7RA 3UTTB 3L7EA 2FSEB 4MMZC 4HT1L 1ZA6A 4LVNB 4WHTB 5EOCJ 2IPTH 2AI0L 1EUTA 1JHTB 1HNGA 4K7PY 2EKJA 3VWJC 4JPVH 1NC2D 3AXLA 3BH8B 1JRHL 4NYLA 3P4MB 4IRJA 1NQBA 3FT4B 3L3DB 2ZKHH 3IF1B 3MRMA 1TTGA 2FZ3A 1A21A 1J1XL 1BHGA 3BP6A 3SDYH 2XTJD 4S2SB 2I9TA 3QO1A 3O41B 2FYYA 5SX4I 3T3PE 2O5YH 3RKPA 1XIWD 1NC2A 2AV7B 3GBML 4WI6A 1E27B 1FCCA 1MFNA 4MB3A 5EUKB 1TCRB 4S1DD 2X4SA 4RGNE 2V5MA 3QSKB 2BOBA 4PJ7E 2D31B 2PR4H 1A6AA 1FC2D 1B0WA 4LAQL 3VXRB 4NPYB 3QFDB 2JB6B 5F1KC 1LHZA 4LKCA 2VQTA 4I0PC 4YHLH 2Q8AL 2AK4E 4PJ8A 5KG9B 1E6JH 1MUJB 2R1WA 2XQYG 1U8KB 3G04A 4PD4K 4BUHA 1QLFB 1C5CH 4LPVA 2CGRH 1T2XA 1XIWA 2DQHL 3MUZ1 1CFVH 3CFEB 4C54A 3IDNA 5FYLH 2NY4B 1UVQA 2AP2A 2GITB 4POYA 5CEYA 1PY9A 2A0LC 2A6IB 4HEME 3VRJA 4U1KB 4NKDB 4TRPL 3DUUA 5EBMB 2EEDA 3VI4F 4R0LB 2HRLA 3C08H 3P4NB 1FNHA 4HXBH 3FO2A 4MCYB 5GGVL 3BGAA 3SJVD 5FHBH 2GTZB 3QHZL 35C8H 3MRNB 3O81A 2VE6A 4GRWH 3CCHA 4ZO7A 3BDXA 5J7CC 1Q0XH 5CILH 3QEGL 2OJEA 1M4KA 3ZTJH 3ULUF 2AKRB 5CEZH 2GTWB 4AEIL 1I7UA 4JPWH 4JEGB 2VZ3A 3VXNB 3QG6A 2G5BB 4L8DA 3MGAA 3FT2A 1T7ZA 5DEFB 3SJVA 5C6TL 1QSEB 3UBXG 4C56B 5H2BA 3K8LA 3TIDA 4JFPA 5FYKL 3NN8A 3VRLF 1G9NH 4UNTA 5HYSB 2FD6H 3U46A 1WVZA 3SEPA 4LCYA 2MCPH 4U6VH 2B5IC 3LN9A 3FQNB 5D1QB 3DROB 3DX6B 5FGCE 4YR6B 2Z35A 3SBWA 4TPRL 3O6MH 5CP7A 1T4KB 3W82A 5BQ7B 4X98B 3HZYA 2DLHA 3PQYD 4XI5D 1AQDB 1DCLA 2N7BA 2VC2H 3FB7B 2ITDB 1NCCL 2ZCLL 1GZPA 2J8UB 5AYQA 2I25N 3DRQA 4JFFB 3MV9E 5C0BD 3MRKA 4KROC 1RZKL 1C7TA 4Z5RA 2VQUA 3GSNA 1F4YL 3MREA 3SE8H 1U8MA 3PQYA 2AEQH 1KLUB 4OCSL 1CXFA 5JA9A 4G7YH 5BV7H 3RHWF 4FZEL 3MZTA 1J8HD 1WC7A 1S9YB 1K4CB 2HLAA 5BXFA 3HC3H 4Z7UF 5TDPB 3VGHA 5F21B 3O3DB 1EBAA 3OKNB 3VFUB 4DK6A 1U3YA 2E6JA 1SVCP 1HXYB 4K7FB 3D9AL 4XBPA 2P48B 3HC0A 2YK1H 3ARPA 2WBJC 4L1HA 2X44D 1HQRA 3RVWD 3NGBC 4NO5A 1J8HA 4GRLB 4JY4A 2EDOA 5FKAB 2JCCA 3NABL 4YGVA 1Q9WB 3O2VH 1TVHA 2X4NA 4KVNH 3BHBA 3RTQB 3QPQD 2QSVA 2Z8VC 5FF6A 3WIIH 2FLBT 1OAQH 4QY8B 1XGQA 4U6YB 5INCB 4R97C 2A83B 1NFIB 4JFXB 5HHMD 1JYWA 5D71L 3AU1A 3KYOB 3TVMA 1DQDH 1AXSB 1J8KA 4WNQB 1X5GA 4WFEE 1GYAA 3MRFA 1T83A 5ALBL 2EH7L 1T2QH 1LMKA 4OLUH 5KS9A 3O11B 3CDFA 1AD0B 1ZHBB 4CKVX 4KQ3L 3INUL 1NCDH 3BN3B 3NFNA 2I07B 5DVMA 2CRIA 3ZTNL 3QFJB 4FQ2L 2PW1B 1UFUA 3STLB 4HXAL 1D5XB 1A47A 4JVUA 3UBXI 3KXFB 5F1OB 4EVNB 1PJ9A 4EN3B 3FONB 3UYOD 3DVGA 1DE4A 4BYHA 1YN6B 1ZANL 5F88B 5L9DL 1KFAL 4KQ4L 4ELMF 1ZLWH 1N5AB 1QBML 2WWMD 2QADC 3BKJL 3O9WD 4WWID 5EOQH 1KB9J 1JHLH 2NY0C 3DARA 1G6RL 4PGBB 3FO0L 5E9DD 5BVPL 3B6SA 5D7JC 5L88H 4L4VB 3CUPA 4WV1A 5J3HC 1WK0A 1K4DB 4TSBH 1U36A 3WBDA 3VXPA 5A3IC 4OCMC 2E7CA 2X4OA 3EDJA 3P11L 3QEQB 3VXMB 3BEWA 3KYMA 3O9WA 3VJ6A 2ITCA 3HI5L 4P2OC 1MLCA 1INQA 3CU7A 4LCCB 4AQ1B 5E9DA 2OS7A 1VFMA 3GFUA 2EIZA 4DKEL 5IB1B 5ADOH 1JMXA 1WAAA 2IQAA 2IBBA 2XPGA 4LQ1A 1MCOH 3C8KA 1VPOH 4X6CB 4NZRL 3H9SB 4S1RL 5L8LB 3KJ4C 1OP5K 5D72H 4HCRA 4DK3A 5F3HB 1X6LA 3L5XL 4WO4B 2IAND 1A9BA 3DSFL 2VWEE 3K4DA 3B3IA 5KVFH 1REIA 4R96A 3UJTH 4F2MB 3T04D 3E1F1 3GIZH 1G9MH 5D6DC 2YZ8A 5E8OA 2VDMH 2ADIA 3RDTD 1X7QB 3CH8A 4LASH 3SDDB 5EU3B 1VENA 1BFVH 4Y7MA 4HUXB 3F12A 1DBMH 3M17B 5HYFA 5ICYB 2BERA 1T0NA 3U6RB 1FYHB 1OL0A 1ES0A 2EXWC 2H41A 5C0AD 3T77B 3G5VB 5I18L 1MFEH 4YDKL 2QQQA 4JRYD 5I19L 1BZ7A 1FG2A 3EHBD 1K5NB 2XKUA 3OJDA 1JPSL 3SY0B 4XPBL 3RVUC 1BIIA 1AFVL 4H26B 4WTXA 3RDTA 1B6UA 4JPKL 4HLZH 3O6LL 2V17L 5HYQA 3DMMD 1H8OA 4J3VA 4QTHB 3VFNA 1NC4B 4HWNA 2Z93B 3OR7A 4WEBH 3D1MC 3ARGC 3M8OH 3CFCL 5C0AA 3VW3H 1OARH 1N6VA 4NGHH 4JRYA 2GAZB 4AJ0A 5I8EB 4MNHA 4ZOBA 5C0EB 1JMZA 2H8PA 3BEVA 4JRXE 1B2WH 4L1DA 5FK9B 3CVHH 4QRRB 3GMOA 4HFWB 5T1LD 5IVXB 1MHCB 1J88A 4F3FA 5C07B 3DMMA 2VN7A 3C6SA 3ZE0F 4JKPH 3P0YH 3D2UD 3TJHC 2H6PB 4XNYH 5AZEL 4DGIH 5SV3A 3ARBD 1FFNB 3LQAH 3THMH 1H5BA 2NY3B 4Z95H 2XFXB 2FECI 3ZSTA 4G8IA 1IGTA 2BCKA 2MPAL 3I2CH 5T1LA 5J6GB 1D6VH 4EI6B 5F72S 4HWBL 1ND0A 4OFVA 5IIEA 3D2UA 4NDMA 2FDBP 4FP8L 4XH2A 3S37H 5IK3B 4NNXB 5T3XL 5KSBE 5DRZB 3ARBA 4ZS7L 1YMMB 1IGFL 4QNPE 3B2VH 3ZDYE 3RY5A 1P4BL 4GOSA 2D9CA 1U8QB 5DS8A 2IH3B 2CDGB 5IG7A 3BW9B 1KNOB 3N9GL 5SWSD 2DTSA 1KCVH 4R6UA 2NTFA 4YHNB 1QYGH 1QSVA 3OG6B 4MA1B 1CL7L 2XNAB 4H0HB 3GNMH 2DQIH 5EUOF 3MO1B 3BRFA 1H3UA 5D7IE 4A2MA 5DD0L 4XC3H 1I8IB 4XXCC 3C87A 2BMKB 4WEUD 3HUJE 4JFDE 1S7WA 1UA6L 1Z3GL 3S97C 3VD4A 1FLTX 5ADPL 3LZFH 1GXEA 1UM4H 5DGRA 1PG7X 2Z4QA 2OL3H 1K9TA 4RFEA 1OGAD 5D9SA 5EZIH 4ETQA 1IC5L 1DDHB 1JHKL 1QFWH 4YZFE 2ZUWA 3WFZA 4NZTH 4OI8A 3UTZA 3CXHK 3GSVB 3V7AG 4OAWB 1MHPH 4L3EB 1I3RA 4ZNEA 3PQYE 1G7HB 4M48L 1B0RA 3CLFL 4TSCL 5F6HJ 3H7BA 5EC2B 1OGAA 5SV4A 1C08A 2ADFH 4FQXC 2QSTA 3DYPA 3D3VD 3NFPA 5B3JE 5BRZD 5C0BE 3WXVL 4EIZC 5K9OB 3QNXB 3C9NB 3X14A 3TA3D 5GS3A 2RQ8A 5DC0A 4Q6IC 5C0FA 4JB9H 3V8CA 5MI0C 3IJYA 1XGUB 5GZOD 1YEKL 3RUGF 2X4RB 1UZ8A 2VLME 1X44A 2VZOA 2MNUA 1FG9C 1RY7B 3ZTJG 3JV4A 3IFOA 1A1MA 1MIEH 2CKNA 3D3VA 1JWUB 3BPOB 4JDTH 5BRZA 1MWAA 3BIAX 4KMLB 2VQ1A 3MC0A 3B8YA 2CLZA 3MNVA 5FIEA 1UB5B 3TA3A 4LAQH 2DWEA 2A77H 2LABA 4OI7A 1YYLH 4ZFOA 3AS3A 4U3CA 3F7VA 1GGUA 5I73B 4RNRB 5I8KH 2VMFA 3EO0A 3ILPB 1Q9LA 4MGXA 4L9LC 1R3HA 2W91A 1PY4A 1YEDB 4OTXL 3KYNA 3LS5L 3LY6A 4X9IA 3JWOH 1IEAB 3CC5A 4RBPK 4J4PD 2AK1H 1FL6B 2H1PH 4ZSOE 4Y8AA 4K3DL 2XKNA 1J0ZA 5EC1A 4Y5XC 3MJ7B 4LPUA 1XGPB 2GK0B 1MOEA 1DBKL 3SKNA 5D93B 5HHME 4M9PA 5HDQH 4ZFGL 5HGDA 1BZQK 3SGJC 5F1IA 4ORGB 1OHQA 1CD1B 2CKBA 4J4PA 4R4ND 4Z9KB 2ICWA 2DM3A 4JDZB 1FNSL 5J12B 1KPVB 1HDMB 2GJ6D 3Q6GL 1I9EA 5F9OH 4Z77A 4D0CB 5F9WC 3UJIL 1UB6B 4BQBA 4KJWC 5CEXA 3D69B 5JOEA 5HDLA 1QFUL 2E9IA 1NAMB 1CDHA 2N56A 3SQOL 1NANH 2J8OA 4O9HL 3LDBC 1RK1B 1XF1A 2JKXA 5GRXG 5C6TH 2NY2B 4MB4A 3FQTA 4MAUH 2GJ6A 3ME0A 1NCBH 3R4DA 4MCZA 4Y4FD 1CDYA 5GHWL 4P23B 3BO8B 1CGTA 1BMGA 3VCLA 4U0QB 3V5HA 1XF5A 4NRXA 2DWDA 3QDMD 4LSVH 1I8KA 4NQTA 2P5EB 5DJ0B 4G9DA 1TZHB 2CRMA 2R0ZL 1NCCH 5KSUA 4NN6B 4IOIB 4Y4FA 3X3GL 2D4DA 4RFNC 3SDXA 3ZHKA 3LN4A 5JIIA 4JZJB 1FE8H 5ISZD 5DRXB 5CINL 4JO1H 1KEMH 2BSSA 3GSWA 4Z7VF 4PJDF 5HDBF 3V52H 5IQ7L 1XF2A 4NO0D 5FO9A 1TJHL 3H3BC 1WFTA 3ORJA 3QDMA 1RZ8B 1U3JA 3GSRB 1U8OB 1XCTA 4WW2A 1NBVL 1PKQB 3NIGE 1IQWH 3WO4B 4OCSH 4XCEA 1FZKB 4OCNC 2QLVB 2IANE 4NNYB 1H3VA 2FR4A 1QZ1A 4BZ2L 5ISZA 5I76A 3MZGB 4PGCB 4P2QB 4UIKH 4A6YH 5DHVB 4MB5A 4XHJC 1AO7B 3MFFB 1C1EH 4NO0A 5BVJB 3NA9L 3UEZA 5J89A 4ZFZA 1K6QH 3EGSA 1CD0A 4Z76A 3F7PC 2PO6B 3R8QA 2ICES 3C5JA 5C0AE 4ONGL 2CK0L 3VFOB 3GBLA 4HKBA 2ZZUT 4GBXB 4CUCA 1S7VA 4UIMB 4X9BA 4HPYH 1MCLA 3NABH 1FFOB 43C9A 5FOBB 5C0CE 2WLYA 4E42A 4UV7H 2RGSA 5C08B 2NYYC 4HWZA 4KTYA 4PJCB 3AY4A 2IPKB 1RSFA 1YNLL 1XGTA 1OTUC 1T21B 3P4OA 1P7QD 4NWUH 5FB8A 1RZIB 3O2WH 1MCHA 3NIDF 4I5BA 4N9OB 3TFKC 5DURD 3NA4A 1RIUH 3GGWB 1MCBA 1BJ1J 1FNEB 1JZ8A 4U1LA 5JW3H 3ES6B 4XP9L 2EH7H 3GO1H 5ALBH 1H9VA 1I1RA 2VDPH 3MJ6A 3B5TA 5GS0C 5IQ9B 4GAGH 4EDXB 1P7QA 5IB3B 1OY3B 1SYSA 4GKZA 3K74B 4PG9B 3RAJL 1CGXA 2WINB 5C2UB 4HF5L 1MJ8L 1U93B 5ESQB 4LSSL 5E4EB 1N6QL 2VXUL 3VXSD 5C6PB 1EGJH 1QBMH 3ARSA 3FB5A 4YDLC 4MD0B 4NJ9L 2AXFA 4UOJA 4K8RL 1D5MA 1G6RH 2Q86A 2PTTB 5EU5A 5BVPH 3PP4H 3C8HA 1KGCE 4Y5VC 2R69H 1WZLA 1FPTL 1FRGL 4KRLB 2A2QT 2A74A 2H3NB 4IOSD 3DYMA 2EKSB 2ZSWB 2FEDD 2X40A 3QUMB 3U0WH 1I1FB 3MLVL 3MNWA 4HLZG 3P11H 3RL1B 3VXSA 1NEZG 2J6EA 3S96B 5SWSE 2HFTA 4Z7QE 1Y18A 3G9VA 4XPFL 4F7MA 3IT8D 3CFKA 2P24A 1NDMB 3ARXA 5AYUH 4K2UH 2AJ3A 2AVGA 1IM3A 1J05A 2HLFD 1N4XL 4OM0H 5FEBA 1OB1B 2JJUA 3V4UH 5I1KH 3GHBH 1HN1A 3U0PA 2XICA 3FAXA 3BZEA 4S1RH 1PBYA 1MCCA 2DMKA 1CZ8L 5C0RH 3U36B 2W60A 4P3CL 1FNGA 1KCSL 3WFHA 5DUBA 2FIKA 3FRUA 2B20A 3OKYA 3L3KB 1J0JA 2J4WL 4YGAB 1KTDA 2Y07H 1OGAE 1TZIA 2RFXA 3QZWB 5E8DL 3QBTB 2Z8WC 4PRNB 5DRNA 4LSTL 1OD7A 4PRIB 5TDOA 5CZXD 1QSFB 4R4BB 2HFFB 3F58L 5I18H 4PGZA 1MCQA 4YDKH 3VGBA 2E7LA 4IJ3B 4KRNA 2NY7H 4PTUA 1A7RH 3QG7H 1HOCA 2EC9U 1S9KC 5CFHA 5FUOL 1S8DB 3TZVA 4R26H 2ICEB 2NXYD 3MXWL 3O6LH 4DN4L 2BC4A 4P5KA 3O2DA 3HZVB 1MAML 1SJHB 3P9WB 2X4UA 3GM8A 2YWZA 1RVFH 1BFTA 3ROOA 4YO0A 3PIQB 1ZLVH 2NXZB 4DGYL 1I4FA 1Y6MR 5CHNA 2DD8L 5IW6B 4EUPH 3O3BA 5JO5A 3KPLA 1S7SB 1TENA 4M43L 2OCFD 1D5BA 3WS6C 2IWGA 3Q1SL 4ZUWA 1KULA 3FT3A 3OKDA 2DLTA 1WFNA 3QJFA 2RR3A 3MUGA 1MHEA 4HC1A 5DZOA 5AZEH 4RGNB 1AKJB 1I7ZA 4AH2B 4JM2C 4PJ7B 2AEPL 3RWHA 2JLLA 3EFFB 2ATPA 4P48A 4UI2A 5DK2A 3REWA 5TQ2L 1K3ZA 2AK4B 1NBQA 3R1GL 3PWVA 5A2KH 3QNYA 4F37F 1G9NC 1CBVL 4ODUA 4UT9L 1DJSA 3RVXC 3S7GA 5JW4R 4I9WE 5D1ZA 1KSRA 1S5HA 4ZS7H 1I9RL 1NPUA 1INEL 1I8MA 4UINL 5FA3A 1ORSA 1A6WH 3IDIB 5CBAB 4LIQH 4MLSA 1TZGH 3N9GH 1IGYA 2X1OA 3JV0A 4Y4KB 5F3BB 3IDYC 1ZLSL 4MWFB 4BH7B 3FZUC 4NT6B 5JIKA 2CO6B 4OGXH 1YN7A 3DLQR 4PRDB 1CL7H 3OR6A 1U3HD 5ITFA 2GJ6E 5IFAL 4NOFA 1YZZA 4ZXBB 3T1FA 4M61B 5HGHB 4N5UA 5ITBL 5DD0H 1JN6A 2LFGA 4DEPB 5IF0A 4X4MA 2DRUA 1IAIH 4S11A 5FYLD 1UXSA 3ARWA 2MJWA 1RJCA 2OR9L 1EO8H 2AGJL 5FGBC 3LB6D 3U9UB 4F33B 3QCUL 4D3CL 4Z18A 4HW6A 3KJ6L 2FWOB 4PRAB 1KUMA 4P9HL 5FM5M 1TMCB 1U3HA 1S7QA 4PJAF 3X12A 1JHKH 3OQ3B 1SY6L 4N1CA 1TETL 4K7PH 4NZDA 5DUPH 3WNLA 12E8L 4D8PA 1NCWL 4LBEB 5DDHB 1FO0A 4OZHA 3HR5B 3P9LB 4X6DE 5FGCB 3QDME 3ZKSD 1HHIB 1RU9L 1T03L 2C4FU 5I1GH 1LEGA 4LHQB 4BK5A 1DLHB 3CLFH 5HXMA 4DW2L 4NHCL 5T33L 3R8BB 3WLBA 5CEZD 4OBRA 4X5XB 4ZPTB 1N59A 4HQQL 3ARFD 1QNZH 4ODXB 2ED8A 4KI5D 3IVKA 2JK5B 3VG9B 4YHPA 3KNBA 1OF2B 1EIBA 5K59F 1KJVB 2EYSA 2IBZY 3MV9B 3LRHA 1NMCC 1F3JA 3JWDH 5HGAA 4M8QA 4WW1A 2DIBA 5FA4A 3VA2C 4HJJL 5J56B 5DD1L 3MRPB 1RV6X 1YDPB 1AR2A 1WIPA 4XBGA 1Y6KR 3ARDB 3OZ9L 1ZVSA 3ARFA 3X3FH 5T1DH 3MMEA 5HDOA 1FZMB 4FFZL 4ZAKB 2VITA 4KKAD 1ZE3C 5CGYC 4LU5L 5C09A 3C60D 3QI9C 4MYWB 3E6FA 5CJ5A 5E1AA 3OPZL 2EE2A 1N64H 1S9XB 1U8IA 1QFWI 5I1AA 1RURH 4FQPA 5F7LB 5F7DA 1MJUL 5KTEH 1SEQH 2XZQL 4Q2ZB 1C12B 1UZ6F 3DO3A 3IDMB 5D5MA 3UTQB 5AG8A 3T2PA 1IZJA 5BZDB 4J6RL 5JZ7D 5TGBB 3IDXL 3TBTB 3C60A 3X11B 5KAQF 3E8UL 4XMPL 5IV2A 3FQXA 5CWSB 5F71A 1LE9A 1YEGH 4X6EB 5LGJB 3NBNA 2NW3B 2PCPA 4NQDD 1XGYL 2CLRA 1EXUB 1KIPA 4WI8A 3AUVA 4NRZB 4IS6A 2Y06L 2VDRL 4ODTL 2OK0H 3SKMB 3MA9L 3LS4L 1RUQL 1JF1B 4P2CG 5L2KD 1FNSH 4Y5YB 1YQVH 4M6AA 1QR1B 4HH9B 2GJZA 3VDAA 3I6KB 3FN9A 4M6OH 1MI5D 4JLRA 1CDUA 3CK0L 1JTTA 2EE3A 1VEMA 4NQDA 5CZVH 1FSKB 1GPOH 2V7NB 4JANA 1QFUH 3VGAC 4U33A 4JG1L 3LKNB 2HJFA 2IAMB 1AHWA 4FG6C 1JZ5A 5L2KA 4M62L 2X4QA 1ZEAL 1CQKA 2ZSVB 3SO3B 3QQ4B 5GHWH 3RWGA 1MI5A 5FO7B 1I85C 1GSMA 3C5ZB 5IHUH 4NM4H 4JVPA 2W0LA 3G08B 4G9FD 4JREC 1J5OL 4N0UE 3VWKA 2X41A 3GI9L 4GJTB 2DDQH 4FXGA 4TUJA 3UDWC 1D6EA 4M7JH 2CR6A 3ULVF 5FAAA 3WIHA 3C6LB 3EBAA 4G6MH 2YPKB 1VGKA 4X83A 5J57B 4R9HA 1CLOL 3RY6C 2GUOB 5CINH 3GSQA 5HYJB 5EDXA 2ILLA 1L0QA 2R2BA 3HE7D 3OXRB 2GSIB 2XG5A 3T8XB 4G9FA 4P46D 2VLLB 4NUGL 5D2LF 1GOGA 3RFZC 3QRFM 3SE4A 1ORQB 5DWUH 4ZYKA 5DHXB 5CD5C 3MROA 2BNQA 1I8LA 1R3IL 5H37H 1NANI 1NJ9A 4EXPX 2VH5L 2C3HA 1EHXA 2VLJA 3L7EB 5H8DA 2DBLL 1FDLL 4TSAL 5IBTH 2ZCHH 4J3SA 3LQAC 3OSKA 5J13C 1TDQA 3L3OA 4OCXH 1OAUH 4Y16C 3KPPB 4HIHA 4YBLB 4HJ0C 5KN5B 4ONGH 5DC4B 5ETUB 5HHXH 2E7BA 2CK0H 4NYLB 4OIIH 1ADQL 4KJQD 2B1HH 4JFYA 4XVTH 1WWBX 3I75A 5C9KA 1F4HA 2I9LA 5ESAB 4ODSH 3MX0A 2FZ3B 1GGCL 1WBYA 4LSQH 3OGOE 3NCFB 3BP6B 4ZO9A 2I9TB 5IOPA 4Z6AT 1EV2E 4KVCL 3DTXA 1T66C 4MJIE 1U8PB 3Q3GB 1RIHH 2BOBB 3FOMA 1RZJH 5JNYA 1A6AB 2PYEE 5CKGA 5EH1A 2EIDA 5C2BL 1BQLL 4LKCB 5CKAA 4JRXB 3HC4H 2F53E 1F58H 3GEWB 3DRTB 3QCTH 3G04B 4NQSA 3D39D 4TVPD 3AM8C 1ZWIA 4RIRB 2D0HA 3RI5F 1UJ3A 5E8PA 1XIWB 3BJLA 1A14L 3IDNB 1Z2KA 1UVQB 5TE6L 2HT4C 4HLJA 1I1YA 3RAJH 4KMQA 1P7KA 1CCZA 3FHQA 5E7FA 4IDLA 1LK3H 4GKNA 2DQJH 1DLFH 3DUUB 3J8F7 1YEIH 3KPSE 3WJLC 2G75B 2EO1A 4RISH 4MQ7B 3D39A 4LHUG 2P7TB 1VADB 4ONFH 1LO2L 1UWEH 3MRGA 1W72L 1JZ6A 3TJEL 5JA8B 4RQQB 1AR1D 3ESUF 4DZBA 4BQ6A 4G6JH 4MD4A 5KSBB 4UQ3A 3H7LA 5CJ8A 2VE6B 3BD4A 3QUXB 4TTDC 4X4ME 4G5ZL 2ZG3A 3PABA 3FB6B 4XPFH 4ZUUB 1W0WA 1I7UB 4KK9C 1YEJL 4ODWB 4B7LA 1IGJB 4L8DB 1IQDA 2HKFH 3TBWA 4EUPG 5GQBA 1YJDL 1N4XH 1ZTXH 1OAXL 2WW8A 1EA9C 1QR4A 4DZ8A 4LEOA 4I3SH 4JFPB 3S36H 1NGQH 5FYLE 1IC1A 3U46B 4YX2L 3ULUD 4XXDA 5D7IB 3KLSA 3V7AE 1T0MA 3E2HB 2IQ9L 1IZKA 4OLVL 1DSFH 3FCTB 3HUJB 4JFDB 2AXHA 3HRZB 2Z35B 3VWJB 1AGBB 5E6IC 2B1AL 4I0PA 3PHSA 3HB3C 1KYOJ 5CP7B 2BNRA 5SX5H 4Z0BL 5F7UA 4AM0B 1OP5H 32C2B 2VR5A 2FATL 3HZYB 4W4NA 4DTGH 5I1JL 3QH3B 1YYMH 2Y6SC 1BAFH 4XVJL 3MRIA 4OZGF 2BRQA 1D5IL 3CX2A 3O3EA 4YHKH 4M7LT 4YNYB 4XC1L 4GRWE 5IFJA 3MRKB 4Z5RB 2O26U 1NFDF 5FXCH 1BQSA 3F62A 3GSNB 3JWOC 4YIQA 5B22A 1JTOA 1ULVA 2HAZA 3MREB 5CEZE 3PQYB 4HH8A 5B38A 4KFZC 25C8L 3S34H 4L4TD 2R1XA 4RX4D 1AIFB 1WIUA 4YXLL 1WC7B 5SWQA 2HLAB 5BXFB 1ZAGA 2BVUA 4YHOH 5C0BB 4DGYH 1OTSD 1RJZA 2BHZA 2XWJA 3QIBC 3BN9D 3DO7A 3TCXA 5I71C 3P9MA 3RWFA 2HWZH 3CD4A 3ZKMD 3SKUD 5GRWA 4L4TA 1DTUA 4RX4A 5D5ME 3MOBL 2OTUB 4PV9A 1AY1L 2VDLH 4TVSa 1JZ3A 3KLAB 4LF3A 2NX5A 1H8SA 1TVHB 4QT5A 4YH6A 1Z0MA 4PJIE 4PJBF 5FF6B 5F1SA 4LLMA 4K07A 4GRMA 4HIXL 1ZXQA 1AD9A 3SQBA 3ZSSA 5ENWB 2PF6A 1FL3B 1BFOA 3EYFA 4ISVB 2PUQT 3DUSA 4TUKH 1CBVH 1FNLA 3AU1B 3UC0L 1NAMH 5DQ9B 4DVBA 3TT3H 4K94L 8FABB 1I9RH 1WBXA 1EFXB 5LKNA 1INEH 4YAQA 3MLZH 3V6FA 3HAEB 4QRQB 1EEYA 4ZSOB 1ZLUK 4IMKC 4XZUB 1L0YA 4FABL 3PP3K 2W0FA 3P3YA 1EHLH 5HHMB 1I9IL 3O8XC 4FTVE 1JYXA 5HHQB 3I02A 3QDGD 3MJGX 5DJXA 2B5IB 3BUYA 1DE4B 1KJMA 2HFEA 3DVGB 1MJJB 3VI3F 4IRZH 3WUWG 4K3GA 3N1PC 3D18A 2CUIA 2P8PA 1CDCA 3ULVH 4QF1A 1U8JB 2L4OA 4WV1B 5I15L 2WP3T 3CPLB 3MBED 4DAGL 4HHAB 3W0WD 3QDGA 3VE0B 2KZWA 5BMFH 5LGHH 5MHSD 1IEHA 2APTA 3O9WB 3HCVA 2ITCB 1MLCB 2QR0B 4HAFA 1E6OL 5DT1L 1OAYH 1NCWH 4M1DH 2EIZB 3CX5K 3K1DA 5BZWB 1V3KA 4PLKC 1T03H 3ZDXE 5CLWA 1JTPA 3LKRA 2IQAB 4LSUL 3FQUA 2XPGB 1F6LL 3VXUD 4ELMA 4DW2H 4GKSB 5KSAC 1KB5L 1Q38A 3FB8A 2F5AL 4OCYL 4CVZA 1YECH 4HQQH 4Z7WF 1FLRL 1EDQA 4N8VB 4GG6F 3UYRL 3GMRA 3HLAB 3B3IB 2FX8H 1CL7I 2WBJB 5E8OB 5FYKD 2ADIB 2VLRD 4J3OC 1PG7L 5IB5A 5C0GA 1Z0NA 4NBYB 2BNUB 2ZUXA 4HAGA 1KENL 4QOKD 1IAII 3VXUA 4FQLL 5I6XC 1T0NB 5DMJB 3I85A 4C83B 4NZUL 1ES0B 1S5IH 2XQYK 1PSKL 2XZZA 3MTRA 5B39G 3B9KC 3CH1B 5ID1A 4CW1A 4HFUH 4Y19A 2IANB 5IHBA 1FG2B 4EI5D 1XT5A 3A6CH 5KVGL 4R97B 1ZA3A 1BIIB 4O2CA 5IP4A 4MA8L 1L7TL 5AAWA 2COQA 5DSCB 3KPMA 3LKOA 1F3RB 5FCSH 1FNAA 1Q9KA 5HYQB 4QOKA 4JFOB 4EKXA 3JXAA 4R3SA 3OR7B 5C0AB 1QLEH 3CFJA 2XZQH 2WBKA 1WT5C 4JRYB 4JO2L 4MNHB 3RVTC 3FRPG 3IDXH 1MCKA 2IG2H 3PDOA 5IR1A 3GMOB 4DKAA 5C0CB 1HI6A 4GMTH 4LLWA 1TQCB 2Z8SA 4F3FB 1CLYL 3ZYZA 1T1ZB 4NQVB 5DO2D 1CD9B 1XGYH 3ZMRA 3JVGA 4KRPD 3C6SB 1QA9A 1DEEB 1CFTB 2QADB 2NY0B 3KS0J 3DVNA 3MA9H 3LS4H 4G8IB 5D7JB 2CIIA 3QUMH 2GY5A 2DICA 1IGTB 2BCKB 4PR5A 1NGYB 5D7KE 5BW7A 3TT1L 2DQGH 3MXVL 4HWUA 5CUSH 3MBXH 4HV8A 4D0DA 1NGXB 3WFEH 4PBXA 4PTTB 3VXTB 3DGGA 2EYRB 5H37G 1TFHA 1CVSC 4XH2B 1OAZH 3ARBB 1KN4L 3SE9L 1T2JA 1NLBL 3BSZL 4M62H 3ECBA 2DN7A 1ZEAH 5DS8B 5E2VH 2OQJA 5C0JA 5IW1B 2Z92A 5DJ6B 1T3FA 4RWYL 3CLEL 2IC2A 3C5SB 4X8XA 5E2WH 3U4EA 1DZBA 3OB0K 3VRIA 4OLWH 2OTWA 4E41A 2BJML 2YD1A 4HS8L 1S78C 3MRRA 3U4AA 2X70A 3MCKB 2F8XC 5SWSB 3V5DB 1S7WB 4PRHE 1XF4B 4BFBD 1EJOL 3TIEA 4KK5D 1CG9A 1T1WB 2GT9A 5D4QA 2QBWA 1T6WA 1X5ZA 4ETQB 4NUGH 4S1QL 1LE5A 2YPLE 1E4WL 4YHZH 1F3DH 2P45B 2LVCA 4LGRB 1MCSA 3IKCA 1ED3A 1VACB 4CJ0A 4OGZA 4HKXB 2K3TA 4KDWA 5ALCH 1QVOA 4AG4H 1U0QA 3K1KC 3ARGB 2DBLH 3MUJA 3VRLE 4TSAH 1I3RB 1TVDA 3WNPA 5EUOA 1KJ2H 1OGAB 3WE6A 4PJXA 1BBDL 1FH5H 4Y4HC 4BQ9A 1OCWH 3NFPB 15C8H 3WFBL 4F7PA 4UAOC 2XTLA 2R29L 2EO9A 5T1KD 3S98A 1ADQH 1CFBA 5E03A 2HMIC 4KV5E 3MJ8A 4FQJH 1JUFA 5E8EB 3ILQD 5CIPA 1A6UL 4Q6YA 1SBBA 3OHXB 2D03L 3JV4B 1A1MB 5D1XD 4H8WL 4KTEH 3D3VB 3O0RL 1LO5A 5T3ZL 5BRZB 2VQ1B 5T1KA 5JQ6H 3MNVB 1YEHH 1FYTA 1CIUA 3TA3B 5TH2A 4KJYA 1NGPH 1UEYA 1JE6A 2A6KA 4XXCA 3EO0B 5I0ZA 3FFCD 3QWRD 2FHFA 1JP5A 1R3HB 5HD8D 4L3AA 1FJ1A 4YHYB 4V1DD 4XCYB 4Z7UE 5D1XA 2ADJA 4MXQC 1NKOA 4OZIF 3WO3B 1DUZB 5KW9L 3HG1E 5T5FH 3BPCB 3EJYC 5DMIL 3WS3B 5F96L 3LKQA 3RUGA 5D7LD 2F58L 2XKNB 3FFCA 3QWRA 3MLXL 3ZE1F 3KG5A 5JR1L 2AJSL 2DI9A 4L8CA 4LLQA 4WUUE 2WWKT 5HGDB 4HG4K 1MAKA 4PS4H 4LLVA 1A1OA 3IJSA 4MXWH 1H3PH 3KPRD 1CVRA 4OT1L 1T5WA 2ICWB 3RNQA 1L9NA 3SHSA 1J0HA 4C55A 1YUHB 5KVMC 3GMPB 3VFPA 2OZ4L 5D7LA 4Z77B 3FQWB 5I8CA 2WIMA 1WFOA 3CMGA 4CMMA 5CEXB 3DURB 1OLZA 4L29A 4LRIC 4YBHA 2Q7YA 4EUPA 3WNOA 3QDGE 4LSPH 2DIJA 3UBXB 4JVWA 3KPRA 4FMKA 2UYLB 3JWDC 3FQTB 2BVQB 2GJ6B 3KLHC 1QBBA 4P3DA 1KJ3L 3U82B 5DUML 3RTQC 5GS1A 1VKXB 1HHJA 3OGCA 4YE4L 1IC7L 4EDWH 5T3XD 3QJHA 4PP2B 4PJEF 5KVDL 3O4LD 3VCLB 2R4RL 4FQXB 3V5HB 3IFPA 3W0WE 4NSKA 3CZFA 3EYVB 4LHJB 4Z0BH 5FYJL 1IEBA 3HS0A 4M4PA 4NCC1 1E0OB 4HWBA 4E0RB 2HT3C 4V2CB 2VNCA 3LCYA 1F2XK 1ETZB 4Q6IB 5KSUB 5MI0B 2OP4L 1FN4A 3LN4B 3P4LA 1UCTA 1A7OH 5DEGA 3O4LA 3ARYA 4D9LL 2V2WB 2AJYH 4YC2B 1MCWM 4X6DB 1XF2B 4NKOA 3QDMB 3LQZB 5JW5A 3I6GA 1XCTB 4WW2B 2D2OA 4IDJL 4EN3C 2ZG1A 3CXDH 3SGJA 2NZ9D 4YXLH 2FR4B 4OD3L 3V4VL 1R5VB 3MV8E 3DHMA 5I76B 1I1AD 4L9LB 3L7FB 4XCFL 4XPHH 2VLRE 1NGWA 2D7PA 5A1AA 5D96C 5DMGC 5C0DA 4X7SL 3I9GL 4M6NH 4NO0B 3MRBA 1WLHA 3I6LD 5JLZA 3EGSB 4Z76B 2G2RA 3IDGA 1UYWH 1G9EA 1YEFL 4GQ9L 2JCCF 4J8RA 1X4YA 5BJTA 4KZEH 1M1SA 5GGQH 4HKBB 1F5WA 3QAZC 4Y5XB 2P5WE 5HHPB 3TV3H 3U83A 1YEEL 1I3GL 1YPZF 1I1AA 2FJFB 1JZ7A 3IYLW 3P30H 43C9B 5C9JA 4LCCC 1MF2H 3RA7L 1H15B 3N50A 1HSBA 3L3GA 1SJVA 4P5TD 4PIRF 4HWZB 2B4CL 5I1HH 1KC5L 1XGTB 3VFMB 2NNAA 4I18A 2D4FA 3TPUA 3PDGA 5F9WB 3V5KB 4FRWA 4WO4C 3L6FB 2VABA 5CCKL 4N0CD 4W4OC 5JIHA 2VKXA 2W1NA 4P5TA 3SDDC 2NPLX 3LDBB 4QWWC 2WSKA 3TGXA 2G60H 3QT2A 1CF8H 3GSOA 4G6AD 4L3CA 3IAQA 4TOYL 3WUWA 5ILTL 2BOCA 1LQSR 1VEOA 1U58B 1U91A 1VHPA 4XWOC 4FMFA 5GIRA 1W8NA 5DR5L 1UEMA 1MIMH 2FB4L 3CSYB 3ZE0E 3ZKND 3EJZD 1BBJA 4WFFD 2AXFB 1D5MB 2Q86B 2V2TB 3BDYH 1OOAA 1FZJA 2WIIB 5FCUH 5I15H 3TN0C 2DQUL 3S5LB 5C71A 2ED7A 1GAFH 1T1XA 5LAXA 2A74B 3PUCA 1D9KD 4X9HA 2VB5A 2HJKB 1OSPH 1RJLA 4K3EH 1K8IA 2APWA 3BH9A 5FKPB 4F7MB 2O93L 4I8DA 1C8PA 2Z91A 4UNUA 3SDCD 3BKYL 1DQLL 1RUKL 5DT1H 2P24B 4L9DA 3HFMH 3T65A 5IB2A 1WAAF 3T2NH 4X80H 1D9KA 2ZUTA 3UPRA 2R8SH 1Z6JT 5HGGS 4N0UB 1Q72L 2VXVL 4JFED 1KB5H 4EEEA 4XB8A 1O5DT 3UJJL 3IGAA 4KXZH 4AL8L 5DUBB 3UYRH 3IU4L 2DQCL 4UTBL 1FGNL 3MLRH 1KTDB 3HNTH 4NRYB 3WN5B 2RFXB 3P73B 5GS2D 5E8NB 1F11A 3RGVD 2FBJH 2QHLA 2UV3A 3FHAA 5A2LH 4FQLH 3TWCL 1UWGL 2FO1A 1UH2A 5TDOB 2W9DL 4KH2A 3WKML 4MJ6A 4B50A 5J0BA 2CQVA 5DFVC 3HR6A 5KZCD 1M71A 1U8HA 1BM3L 1TITA 3RKDD 3BZFA 3MQIA 4HKZA 3T1WA 5DD3H 2BZDA 2Y7QA 4F58L 3GK8L 1VDGA 3RGVA 4NHUA 1IT9L 2R4SL 3ZKXB 4FFVD 5K9JH 2BC4B 1NMAH 1LO3L 4R90H 4Y5VA 3RJQB 1U8LA 4XNUL 4G6FD 3FRPA 4NFBA 4UQ2A 3A6OA 4YO0B 5JXED 1XH3A 4OV6F 5CJOL 1S7XA 4HIEA 5CHNB 3DIFB 5JO5B 3S35H 2BSRA 4JY6B 3RIAK 2YKLH 4HK0A 5EPMA 4UDTB 3B5HA 3H42L 4LLDA 3Q6FA 4X8JA 4ZPVA 1QO3A 4ZUWB 1PX4A 3OKDB 5TE4L 5D7SL 1DQMH 2R56L 4WHDA 2F54D 3QJFB 4O2EA 1G7MB 4XNMA 3QUKA 1TTFA 3W39B 5JXEA 4HK3J 1N6UA 5FM8A 2PYEB 3CDGB 5AWNH 3RWHB 5KANG 2ATPB 4EZMA 3IKKA 3TNNB 2F53B 4C58B 1MJ7L 4LNVA 4V1DE 2DQDL 2Y36L 3FMGH 4ODUB 3L3JA 2F54A 1QFPA 2GY7B 3FO9B 1S5HB 3WYRA 4DUWA 1GGIL 1I8MB 5DD6A 1IM9A 1R0AH 1LP9F 2DLIA 5ID0A 1UQSA 1OWWA 4CADA 4NQED 5EIIA 1BVLB 3AROA 3KPSB 4OM1H 1UM6L 4LDOB 3LHPL 3HPLA 2X6MA 4PB0L 1J1OL 1YN7B 2ADGA 3QEHB 4LARH 3CJJA 4Y2DC 5I1DB 1S3KL 2EDYA 3DETD 1DFBH 3FTGB 2AJVH 1JN6B 4XVSH 4WGWB 1AE6L 1EAPA 1GC1H 4H88H 5I73C 4OF5A 4NQEA 4LCWA 2Q6WB 5A43C 1JNLL 3PGDA 2IALA 3NOIA 5M95B 4M1GL 2FO4A 3U48A 3GSNH 5LVEA 3WS6A 1U3HB 5I2IA 3V4PH 4K8RD 2OI9B 4S1QH 4ZTPL 4CAGA 5IVNA 1LO4L 1F90L 2GW5A 4O2FA 1ZLWK 1UACL 4U1GB 1E4WH 3PXHA 3LPGA 2YEZA 4X4XB 5ICZB 2VL5B 4D8PB 4M1CD 5JDSA 4XP4H 1FO0B 4NQCE 4X5LA 2X9YA 1C5BL 4RFOH 5EOCH 5D93C 3TESA 3B2UC 3GMMA 4QXGL 1F4WL 5ACZA 4FHBD 4LIQE 4PRBB 3UAJC 1MEXL 2JJSC 5IMKA 2XOTA 3BWAB 3DXAD 2D7MA 5EU7C 1OGTA 1A3RL 1QOKA 4NP4L 4L5FL 1N59B 2MQCA 5J12C 2UVFA 2NY6D 3WFBH 1QBAA 5GRVL 4YHPB 4NWTH 3MJ9L 4KPHH 3QWOA 1AGCA 1F3JB 1XFPA 4GRWB 2ZUQC 2AABH 4WW1B 5MERA 5FA4B 1H0DB 4PJAA 4ZFFA 1RMFH 3DXAA 4H1LH 1KG0B 4JPIA 2WK2A 1SQ2N 5IEKA 1MFCH 1U9KA 2NY2C 3FO1B 4POZD 1G0DA 3QPXH 1T04A 4Z7VE 4PJDE 5BO1L 3MMEB 5FOJA 4P23C 2QJDA 3C2SA 5E1AB 3I6LE 4P5MA 3EIFA 4M8VA 2QQKL 3EO1A 3ARZA 4Z8FL 3DVFA 4ODHL 4OQTL 3H3PL 5IROA 3MCLH 5FDWA 1NFKA 2SEBA 2XWTA 1G1CA 5LJYH 3MRCB 5HY9A 5D5MB 1CQYA 3CSPA 3ULVC 7FABH 2IGFH 2GCYA 4MHHG 5KW9H 4JZJC 3PF2A 2MTPA 1CFQB 5IV2B 5F96H 5A2JH 5J6HA 1LE9B 3KPQA 2Y4SA 5L2JB 4C4KT 1MELA 4LEXL 4PJIB 5EZLB 5TFSL 2PCPB 2CLRB 5B4MC 4O51A 2AJSH 3BIKA 3WO4C 4J1UA 3BAEH 3MGOB 2VDOH 1T7VA 1VGEL 1ZOXA 1RUMH 3ARED 4OT1H 1JV5A 3SCMD 1HINH 4FQ1L 1QQDA 3TBVB 1TJGH 4KKBC 5BV7B 5HVHC 1DANU 1EK3A 4NKIH 2VLKE 3PV7A 3O3UN 2C3GA 1F13A 5EORH 3D0VB 5L0QC 4JANB 2HRPH 2PO6C 2DKUA 2VXQL 4IRSD 4HBCH 4PLJC 4WFGD 1PAMA 2HJFB 4OLZH 5GGUA 3RP1A 1AHWB 3GSUA 3MACH 4FTVB 3AREA 5DFTA 3SCMA 1ZVHA 1A3QA 2MOVA 4UBDD 4U2ZA 4EOWL 3AAZB 3U7WH 1VESA 3TBSA 3QA3B 4KAQL 5TF0A 3RWGB 1MI5B 1HSAA 1SVZA 4HCRH 1D5ZA 3C8DA 1ZKAA 2C1PA 1AGEA 4CJ1A 3ALWA 2R4RH 1INDL 4IRSA 4P9ML 2VSCA 1ROWA 4MA3A 4F9PC 2UZXB 1G7JA 3L3IB 3KPNB 3O6FD 4TUJB 5IUSA 4G8FA 1X5KA 4L4VE 1NMCB 4X4YB 1BPVA 5A16B 3RBSA 4XTRD 5E6YA 5DJ8A 3MFGB 4PREA 3TO2A 1OT1A 4P59L 3D85B 4G9FB 2V7HB 5AUMA 3OAZK 4OKVB 3O6FA 2EDDA 4JFEE 4FFYL 1SEBA 2O5XL 4FXLA 4MNGA 4AEHL 4IDJH 4X7FC 1UH4A 3HHRB 2L7UA 4ZYKB 4X6BB 1KTLB 4PJCF 4FFWD 1BFSA 1CICC 3PNWA 2ATKB 4MAYC 1NJ9B 3RY4A 5IMOA 1CFNB 2V5RA 3HE7B 4F8QA 1RIVH 4X7SH 3VFSA 4P46B 1G7PA 2YD2A 1N5YH 1S7RA 4HSQA 3V6OA 2X1XR 3G9AB 4HIHB 2XV6B 1C5DB 1WFUA 5HI3C 1FFPA 4GQ9H 3B9AA 2CMRH 2A38A 2BX5A 2OSLB 4MHHI 2R9HC 4F7CA 5CSBA 3REVA 3RHWK 3QQ9C 1MH5A 3I75B 1EBPA 4LAJH 4HUUA 4HDIA 2F8OA 1H3TA 4XNXH 1NGZB 1SY6A 1T89A 1WTLA 3BGFB 5D2LA 2NY1D 3VG0L 2FHBA 2VR4A 3CIQA 4WJ5A 2WNGA 4B53A 2B4CH 2DYPD 3T0EC 2WQ8A 1P2CA 4AY0A 4MXVF 1MRFL 1SBSL 5JNYB 2KUTA 4QO1A 5JW4Q 4R2GD 3K3QA 4NKMB 3KYAA 1U42A 2X4TB 5HVFB 3T2QA 1E28B 4UTAH 2DYPA 5E8PB 5FUCC 3V2AR 2GHWB 1ZHLA 3KWWA 4QRRE 3RPKA 1QBLL 2GI7A 1XCQB 4UT6L 1JGEA 5C07E 1I1YB 1HQ4A 3ZHDA 1P7KB 5ILTH 4IJ3C 4GKNB 2FB4H 3PP3H 3STZB 2H9GA 4K71B 4KKLD 4JREB 2NCMA 4Q9BA 3O3AA 4HUMB 3GJEB 4MDJA 3GBNL 3BE1L 3MRGB 2BVEA 3IFNL 4NQXA 2VDQH 1LDPL 1OT2A 3BYYA 1JVKA 1HKFA 2P49B 2RCSH 4XPAL 4MD4B 5IKCA 4UQ3B 1NEZB 2C7UA 2DTMH 2NXZC 4Y16A 3G5ZB 1U8NB 5ICXB 3TCLB 3MRLB 5EN2A 4NQEE 3PABB 5EBLA 3SE3A 4OLYH 1YMME 1W0WB 3SDAD 3ABZA 2CDFA 4I48B 1F45A 4Y1AD 1IQDB 1AQKL 3CVHB 3KHOA 4OD1L 4HS3B 1M6OB 4LEOB 2VIRA 1JPGB 4BQ8A 4RGNC 3OKKA 2NLJA 1A1NA 2YC1A 4XXDB 3QUZD 3UTSD 4LRNH 1MPAH 4BSWA 4HUKB 4PRPD 4I0CC 3ELAT 3WUZA 3SDAA 3LD8B 5J13B 3MLSH 5BOPA 4PRHB 1ZS8B 3FOLB 1FGNH 4Y1AA 1IL1A 1XR9A 3FQRA 4LLYA 3JTTA 5FECA 1PQZA 3MLUL 1SHMA 4XVUD 3HPJA 4ALAL 1DBBL 1PKOA 3HKFA 3TWCH 4K9EL 2HVKB 2YPLB 3OG4B 3O3EB 3HZKA 3LH2L 3UTSA 3QUZA 5D2NA 5GGVY 5K9QG 4G6KL 4PRPA 2DIAA 1MWAH 1M7DA 5IFJB 4L8BA 2J88L 1BM3H 3JV6A 5C0IA 4UUJA 4PG2C 2NTSP 4D9RD 3DSNA 2Y5TA 5HVWA 2XA8L 1HKLH 4APQC 3DXAE 4KK6D 3WJLA 1OVZA 4F58H 2BY1A 4HMDA 3T2OA 2IJ0C 1IT9H 4RMQA 4MS8D 2EYTA 2R1XB 2A9NL 3NFSL 4ZXBC 2E27H 1U92A 4KU1A 4DEPC 4RAVA 4KTDL 4DQOH 4EXKA 5FO8B 5GGRB 4FNLL 5E99H 5DVKA 1Z9OA 4D0BA 4FS0A 2C3VA 5ANMA 4QHMB 5MEND 4F7TA 5D6CA 2XRAL 1QSZA 5EO0B 3P9MB 4N8PA 2YA0A 1JNHA 4G7VH 4KXZI 3RWFB 4LQFH 5JORA 4L4TB 2ED9A 4MD5B 4G80B 5K59E 5I17A 4PJHA 4QRTB 2OL3B 4N0FA 4ZS6C 3U7YL 3QUYD 4W6WB 3MYJB 4ONHA 2CKBH 3AB0B 2B2XL 5L7XL 3W9DA 1JK8A 3K81A 4LLMB 1ACYL 1NDGA 2O61A 1AD9B 3GI8H 3MYZA 4OFPA 5MENA 1KPUA 1W8OA 3WNKA 3WV0A 4UMGA 2MCG1 3EYFB 2BP3A 2HVJA 2X9XA 3UMTA 5EB9A 2Y36H 1T20B 3MR9A 3UO1H 1T7XA 4Z7UB 4F57H 1Q1JH 3PL6D 3DI2B 3L95A 1VFAA 3QUYA 5D70L 1JPTH 4GAYA 1WBXB 4LPTA 5DLML 1GGIH 2YUXA 2YD7A 4XT1C 5GSVB 4HUVA 2W59A 1A6ZA 1EEYB 4HGWA 4WVRA 3TH4T 2X42A 5CMAA 1T1YA 3WIFB 1IFHH 4ZTOL 2YMXH 1ADQA 1UZ6E 3LIZL 4JFQB 2HKHL 5JPNA 3GIVB 1RHHB 1WJ3A 4WUUB 1RFDL 1UM5H 3VFVA 3KYKL 3PL6A 3I02B 1KELH 3OXSA 5EZJB 3MV7D 2D7NA 1KJMB 1ZHKA 2HFEB 4M93B 5HI5C 2ESVD 4ZAKC 5GRJL 1YY8A 1FGVH 4H1LG 3D18B 3H2WA 2FH8A 2D9QB 2P8PB 3FN0L 1LEIA 5EU7E 3T4YB 1MCPL 1EHNA 1P84K 1JNLH 5MEQB 4KZDH 3P0VL 4TUOA 4WFGE 1TJIL 1MQKH 3WL9A 1DL7L 2B0SH 2DF3A 3QDGB 5A2FA 2IFFH 3MV7A 3PE9A 4AMKH 2ESVA 1LO4H 3DV4A 3MOAH 1HCFX 4X5WA 5ESVA 5INDA 1UKTA 5J1AA 3HCVB 3PHQA 4I2XA 1MFBL 4CU6A 4OZHF 1FP5A 1CT8A 3WHXB 3NH7H 4XAWH 1DBJL 5IBLC 1CGUA 2VDNH 3MBEB 3QO0A 4QYOA 5CJXC 4DKDC 3W0WB 4HJGB 3LKRB 4MNGE 4YDVB 3RWJA 5KSVA 5LGKA 4ELMB 5DJCB 1BOYA 1A3RH 4U1HB 3FB8B 1BOGA 3QDJA 2F74A 4YBQC 1PZ5A 1W72A 3W2DH 2YBRB 3P77B 4P2YA 5DD5L 4DFHA 3GMRB 2BDNL 1DVFD 5I71B 4Z7OF 4PJFA 5F7HA 4LCUA 1I3UA 1MFDL 5JOPD 4OB5H 1A7PL 1FSKC 1TIUA 2JB5L 4YWGH 3ULVE 5C0GB 3V6OE 3FN3A 4R7DA 2IAMC 5CD3B 2A1WL 4PJGE 3GHEH 4M9OA 5DI8A 2AJUL 4JR9H 4U6HB 4X0KA 1CE1H 1X9QA 3ZE2F 1RZFH 4CVXB 3ARQA 1T7YA 1PDKA 3OKEA