1D9KD

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
188
structure length
188
Chain Sequence
GSERHFVHQFQPFCYFTNGTQRIRLVIRYIYNREEYVRFDSDVGEYRAVTELGRPDAEYWNKQYLERTRAELDTVCRHNYEKTETPTSLRRLEQPSVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 33
structure length 188
sequence length 188
chains with identical sequence H
ec nomenclature
pdb deposition date 1999-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d9kD01
1G7PB 4HQQL 4JO4L 4R2GC 2P4AB 1WSST 4TUOA 5LAXA 3MV7B 3CMOL 5HHVL 2JJVA 4R4BA 3PUCA 5CIPB 1UKQA 4ORZC 1KEML 4R26H 4F3FB 1UEMA 4KZEH 2D31B 1KJMB 2EO1A 2AGJL 1JHKH 5IOPB 4F8TA 3OKMB 1NAML 4GG8A 4J1UA 4Y2DB 4X5LA 4XNMB 4KK5C 2IPUG 5DRZB 3IFNL 4JM2D 1W72A 3V6ZB 2WUCH 2Y5TA 3BKML 1T21B 1HHGA 5F7WC 1IC4H 3TT1H 4MJIE 3W0WB 5D7JB 2KL6A 5HXMA 3RNKB 3GHEL 2EEDA 2WK2A 1UCTA 3SDDA 1FFQA 5FHAH 5MEPA 4GG6B 1CBVH 4UQ2B 1FO0B 4GMTL 4CVZB 4M6MH 1TPXC 4ORGB 4I0KA 1OP9A 3DVIA 3S4SA 2NY6C 1AKJD 1F00I 1DQDH 2VL5A 2Q8AH 4KQ3H 5IW1B 2XWJB 5E03A 2GTZB 2O5ZH 1C7SA 1JGUL 3OKKB 4NP4H 1JPTH 2W9LA 3T1WA 5JDSA 1NKOA 4NT6A 4X4XA 5D7SH 4DKDC 3EYFA 3S97C 5DRWA 4LRNL 4PP2A 4Y1AD 4PS4H 1A7QH 3P0VH 2H2PC 5DFTA 2FIKB 4XH2A 5IHBA 4NYLA 2DTSA 4WEBH 2ITCB 1LMKA 3SJVD 1EFQA 4UIKH 5T33L 2BHZA 4TRPH 1N5YH 4JO3L 3N85H 2G9HA 1H0DB 2Z35A 2Y7QA 4HK3N 4JM4H 3B9DA 4NQCA 3TT3L 1N4XL 1H3PH 4NZTL 5C1MB 5ACMA 4P2YA 5K59F 5C0AA 1Q9OB 2NY4B 4AIOA 4NO2B 5EUOF 2ZSVB 5HYEA 2AK4A 1NMCC 3PGFL 1HILA 5HHQB 5FUOL 1YPZB 4LLDA 4TVPL 2R2HA 3R06B 4HLJA 4XGZB 1P7KA 3UZQA 1KJ3L 4Z7NF 5JOFA 2WUBH 3UTQB 4JRXB 1EAJA 1FDLH 2ZSWA 1Y18B 3AU1B 3BUYB 3SQOL 4K7PY 5E94A 2EDEA 3T65A 4M1GL 5DHYB 3MRFB 3QDME 1KBGH 4BZYA 2AEPL 3LQAL 4IJ3C 1JGVH 4YBLC 3ZZ1A 1S7WA 2OTUA 5TE7H 4F2MA 2PYEA 3LIZH 3GBMH 4U1SA 5GGRY 5GGUA 3VGEA 3UTPD 1BX2A 2AXGA 3MMEA 1B4RA 2MCPH 5DJXB 5JUEH 4HAFA 2FJGB 5L8LB 3FOLB 2JCCB 2CMRH 1YY8A 4OIAA 1TTGA 5FDWA 4LU5H 2HVJA 3JTTB 1U8NB 5C7XL 5DHVH 3T0VA 1CD0A 3KS0H 1VGKA 4OD1L 2NY5L 3V6OC 1SY6L 2D4FA 3EDJA 4XVJL 2DWEA 1FZKB 2PR4L 3CPLB 3GBNL 1NGWA 1XFPA 2BHYA 2AK4E 4BK5A 2HJFA 2ILLA 2XA8H 4KTEL 3MRNB 4I9WD 3T2QA 2A6DA 1JWUA 1EX0A 4UUJB 1UADC 2VZ1A 4FFZL 1EO5A 3GMPA 4I3RH 3DVGA 4U1GB 4H20L 3FQWB 2GKIA 4AH2A 4S1DC 3RGVB 5IROA 2F5AH 2ORBL 3BZDA 4X7SL 1LK2B 3MRKB 4PJAE 5HGGS 3QCUH 5F7UA 4LSRH 1F8TH 2YXMA 4LSPH 2D03L 5AZ2L 4ZSOB 1L7IL 4ZTOL 1G9ML 3JUZA 1AFVH 3ILPA 1F6AA 2MCG1 2PYEE 4MQSB 3LS5L 3AREC 4AK1A 4M9PA 3GUTA 4Y4HB 4HIJA 4WCYH 3LN5B 1A02N 4MA7L 5EO9A 2XZCL 1SYVA 1INDL 3TN0D 5ISZA 4NM8H 4PGCA 2CKBL 1BEYL 3DVFA 5CSZB 4J3SA 3HZYB 3JWOH 3S4SG 2CSPA 1DLFL 3WFZA 5J6GA 1BM3L 2B1AH 1HI6B 4LCYA 2XKNA 5JLZA 3MV9A 5DEGB 2BXZA 4TTGA 3P73B 4ZFFB 1HZHL 4KDWA 5HDBF 5ICZB 4GS7B 2RIKA 3B43A 3BE1H 1QACA 3KPLA 2VDOL 1FAKT 5B39A 4TYUA 3TV3L 2NY4D 2VDNL 3VD3A 1NCCH 5KSAC 5B38A 3MFGB 2FYYA 2VQTA 5A2LH 3OAUL 4C59B 1JZ6A 4LVOB 5T1LB 2O5YH 4ZO8A 4WUKH 2QADB 5DJAA 3TO4B 1QEWB 2UWEB 5EBLA 3LQZA 4L3AA 5EU4A 4JRXD 1SJEB 2NQCA 4RA0C 5I8EA 3O3EA 1T2XA 32C2A 4YEFA 4X6CF 1J0IA 2AJSL 4QHMB 3MUHL 2ERJC 4OCLC 1LWRA 5JOPE 2W9DH 4RGNC 3VWJB 5IFJA 2PUQT 5D72L 5B4MC 3O3DA 4UBDD 4U7SA 2Z8VC 5ADOH 3AC0A 2CK0H 2GJJA 5IR1B 4G5ZL 4X8JB 2VDML 5HVWA 4U3CA 1FIGL 4BZ2H 3O8XD 2Q6WA 4FQXC 4N5ED 3MV9E 4WI9A 1ROWA 1A6WH 3C5SA 4YDLC 5KVGH 3RWDB 3MA7B 3VWKB 1IFHL 4JQVA 5E8EB 5ESQA 3SO5A 5IGXH 4DFHA 3MV01 1CFTA 3IXAB 2DQDH 1MSPA 2GSGB 3Q0HA 4X4ZA 2I9TB 4F58L 2VITA 2MPAH 5TF0A 1JPSL 4ZAKA 2B2XL 4WTWA 4FQHA 1DEDA 2BVPA 1RVFL 1VSCA 5DC0A 3OJVC 3BO8B 5E8DL 3BHBA 3S5LB 4NWUL 1NPUA 4GRWF 2IPUK 4JY4A 1VDGA 4YXKH 5HHME 4EUPB 3GK8L 5EOTA 5E2VL 5EUKB 4XP4H 1NEUA 4X6EA 4FS0A 4Y7MA 3VH8A 3NH7L 1UWXK 2BCKA 2Z92B 3FONA 3H2WA 4HXAL 1P84K 3QUMB 4KJWC 4UT6L 1FZMB 3NGBB 1I9IL 5D1QA 1M7DB 1N6QL 5BRZA 5MHSD 1DVFC 1MFBH 4WUUA 5FO9B 4ODVL 3W39A 4Z95H 5C3TA 4JO1L 3G6JF 3MRDA 3OZ9L 4W6YB 5EZJB 4YHOL 4GRLC 3ZLQC 2PTUA 3EUUA 4JG1H 1X5YA 1RUKH 2AERT 1RJLB 2X4UB 1QHPA 3D0VA 4Y4HD 4NGHL 1KG0A 2BVQB 4K7FB 2E7BA 5E8NB 5BZWB 1RHFA 1BIIB 1I8LA 3KPNB 4PJFF 4K94C 3RHWK 2EH8L 3MV8B 4P49A 4IEFB 3NFSH 4K3JL 4N9GA 3MBEA 2ADIA 1LEIA 3V9FA 3VFWA 2OL3B 2DKSA 4JFYA 3LEYL 1E27A 3MGOB 4L1DA 2Z91B 3B3IB 4GRMA 4MQTB 4OLWH 4RAUA 5HHPA 2JJWA 2V2XA 2GK2A 3NA9H 2VE6B 4WW2F 1OAKH 2CDEA 2NXYD 1YEGL 1RU9L 1GHFL 1HQ4A 5HI4C 5EU6B 4RMVA 1T1XA 4BQ6A 2XNAB 2RQ8A 4LL9A 4MDIB 1OGAB 3B9AA 3K80A 3UJTH 3FT2B 4KHTL 3CSYB 1GAFH 1LDPH 2QADD 4WUUE 4PLKC 1J88A 1LEKA 5AD0A 3V6FA 2VR9A 5D5ME 3U7WL 4BSJA 1RMFH 4NJAL 5J3HC 1QFHA 1S7SA 4OLYH 1EPFA 2DMBA 2PW1B 1OAZL 4XTRC 4CGTA 4PJHF 4OZGE 1A6AA 4DKAA 5B38G 5EBMB 3A67L 4BFIB 4QTHA 1OWRM 4FTVD 3WSQL 3BZ4A 1T5XB 4P59H 3V0WL 3LEXB 4ZS7H 1EZVY 4YWGH 1Z5LB 2DLFL 5JO5A 5FO7A 1CD9B 1EDQA 4DTGH 3HS0A 4C4KT 4NQED 4QRTB 5DSCA 4BQCA 5C6WH 3NFNB 3RVVC 2KZ1B 1J1XL 4WWKA 1A6ZA 1X4ZA 1CDBA 3IDGA 1R3HA 3VGHA 1F6LL 3EYOB 4XHJD 3FQXA 3F12A 3L1OL 3ULVH 3T8XB 3ZKXB 3V8OA 3OX8A 4DVRH 1ADQH 2DS4A 3TPUA 4AEEA 1ETZB 2QBWA 4JHAH 3VRLF 1OQXA 4B7IA 1D6VL 4XPTH 4G8EA 1CR9H 2P5WB 5HGBB 5TE4L 3GSNH 5C0FB 1CLCA 2K7PA 3OHXB 3OSKA 4JPKH 2H1PL 4JM2A 1CIUA 1AC6A 1SHMA 2HA1A 1OL0A 4XMKH 3O6KL 4H88H 4NC2B 2AJUH 3TYGL 4RMQA 1T4KB 4ELKA 4PJ7F 1TETH 5INCA 4MJ4A 3KPSB 4RCAA 2CLVA 2QHRL 3U46A 4N0YH 4ODTH 1ZHNB 2VC2H 3BEWA 2AJYL 4IDJL 3BEVB 4ODBD 1F5WA 2AJ3B 4XNYH 3RDTC 2R1XA 4D9RD 1FZOB 3KYOB 4G3YL 3ZTNL 1AKJA 1DCLA 2DN7A 3D2UD 1RURH 1IGFH 3VH8G 3BZFA 3KPPA 4QXUH 4NKIH 5IKCB 3IAGC 1PQZA 4QO1A 4ZUVA 3X17A 1GYAA 4ZFZB 2GJZB 1QBMH 2FHFA 4O00A 1C16B 4Y1AA 1VFMA 3ARDC 3G6DH 3MRCB 3NCJH 3MV8D 3SGEH 3SGJC 1NMBL 5GRYA 1I85C 2HAZA 3QEGL 5EC1A 3IXTB 1YQVL 4YIQA 3SJVA 2BC4A 2OTWA 4AIXA 5C86A 5F96L 3B2VH 1GRWA 4X9FA 5GS0D 1EGJH 1S7VB 2P46B 1ZA6B 4DCQA 2Y6SD 2JJTC 4YXLH 2IFFH 4LCUA 3M17B 1NGZB 5DMGC 5KOMC 5A2FA 4H5SA 3U6RB 1CFQA 1QKZH 2XI9A 2NY3B 1JNHB 1OGAD 4X4MA 1JMZA 4IOFD 4YHPB 2BSRA 15C8L 5IG7B 4GBXA 2EDLA 1KC5L 1NAKL 2Y9RT 2B5IB 4KTYA 3NIDE 1MFAH 5SWQB 3IAPA 3SY0B 5DUMH 4ONGH 3T04D 1R3LA 3QXDA 1A9EA 1WAAF 3RVUD 1VFAA 4WGWB 1QLEH 5JIKA 1ND0B 1LE9A 1H3VA 5HGHA 5FXCH 4O2CB 2VDRL 5HBBA 3DVNA 2FHBA 5HI3D 4Y1AE 4PY7A 4PY8I 1DUZB 43CAB 2Q76A 5J6HA 2O5XH 1G7PA 3M45A 4OB5H 4LKCB 5F7YC 3AS2A 4Q9QH 4Z8FL 2BJMH 3DIFB 4Y8AA 1ZKAA 2YPVL 4HDIA 5CIPA 5IW6B 1RK0B 5FYLD 4PJ9C 2D31A 3CFEB 3HLAB 5AWNL 5DMIL 1KJMA 1MHEB 4HEPG 4ONOA 3MBXL 5C3LD 4P2OB 1KB9K 3MRJB 4NKOA 3OKMA 5F1IB 1UWXH 4Y2DA 5FO8B 3LSOB 5FEBA 4P23D 4X6CB 1PKQB 4XNMA 4HV8B 3VU2A 3SKJL 4YC2B 5DRZA 4X4ME 5D2LF 1FJ1B 3PWNB 4LPVA 3WLWD 3V6ZA 4TPRH 3MGTB 1TJHL 3JWOC 1T21A 5FYLL 5IHZB 5K9KA 3FFDB 3KPSD 3RP1A 4R4FH 2DLGA 4NQXB 1DBMH 4JHWH 3RNKA 4LOUC 3REWB 3ARYA 4GG6A 1YY9C 4UQ2A 4BZ1H 1FO0A 2H26B 4KQ4L 4PP1D 4JFZL 1K6QH 5E0QA 4ORGA 1A5FH 5C0IB 5MEND 5M7QA 1V7NL 2XQBH 3MXVL 3WNNA 4UDTB 4OD3L 2XWJA 3FB5B 2GTZA 4LSSH 4ODXB 4RX4D 5IW1A 1EUUA 4OIBA 2IANE 2IQAB 4CL7A 5LGHH 1M71B 1FAIH 2L0DA 4JFHE 3MV7E 5EZOH 5F1KC 3UTPE 5C8JB 1UKSA 2ATKB 1H3GA 3RKDD 4S1QL 2FIKA 1IKFL 3P4MB 5B3JF 3MLWH 3H9ZA 2ZG2A 2H41A 5DJZB 4FOMA 5I66B 1K4DA 3MA9L 4LCWB 1NEZG 3HB3D 1VENA 1J0HA 3UJIH 5IT2H 5D2NB 5DMJB 1OPGL 4PB9L 2QSTA 1LILA 4JDZB 3G6JB 2W1NA 3W0WE 5BW7A 1Q9OA 1MIML 4AL8H 2EDQA 1S9KC 4NO2A 1JGLL 1OSPH 1IEAB 3DURA 4GG6E 5IHUH 2ZSVA 1MPAL 4QKXB 2EYTB 4XWOC 4B7LA 4HFUH 3RA7L 1NCBL 1YPZA 3R06A 4Z6AT 3OXRB 4XGZA 2GJ6D 4PJFB 4JRXA 5C6PB 5B8CB 2ADJB 3ARWA 3CCHB 2QTEA 4OLUH 1Y18A 3ETBF 4JKPH 3BUYA 1KFAL 5JW4M 3PWUB 4M7KL 1P7QB 2F58H 4AIZB 4NNYB 5DHYA 1O7SA 4GMSL 5MERB 3MRFA 3OGCB 4LLUB 1IQDB 2HTKD 4MLSA 1HHHA 4WW2B 1Q1JH 1T0PB 3DECA 4LQFH 5FECB 5GISH 2EC9T 2ZUUA 3S96B 2GT9B 4JDTH 4QHUB 4R0LB 3NCFB 4GXVH 5I30H 1WWCA 4KI5E 1INQB 2X40A 3LY6A 2C7UB 5DJXA 4FMKA 2FJGA 5ALBL 5IMMB 5K9OB 2JCCA 2FATH 4TULL 5DI8B 4YJZL 4KKAC 4AMKH 3CDYA 3HC4H 3JTTA 1U8NA 4P2OD 2CXGA 3KPQB 4M6AA 3KR3L 4LHJB 2VWEC 4LF3B 3TBTB 3PDDA 3H3PH 3CPLA 4LARH 4LVNC 5I73C 4OFVA 1UJ3B 3ZKND 4PJHB 4PB0L 3WKMH 1YPZE 4UUJA 2FECL 1C7TA 3G5VA 3BQUB 4P3CH 3DROA 2R39A 3FQWA 3DYOA 3RGVA 1FNFA 1INEH 2K7QA 2Z31D 1AIFB 1QG3A 5D6CB 1LK2A 1L9NA 3MRKA 3LH2H 4G7YL 4CNIA 3Q1SH 4HKZB 1D7FA 4HT1H 5D1XD 4M8QB 1B0WA 2X4TB 4ZSOA 5H37G 4D0CB 2NY0B 3EDDA 3H7BA 5E24E 3I2CH 2IH3B 3ULUF 4X8XA 3VMNA 5SWZD 2VERN 5I76B 1ZT4B 3H0TB 3C60D 3BVNB 2VLLB 5EBGA 4Y4HA 4GAJL 3LN5A 2JCCE 1KEGH 5CSZA 3DX8B 1PG7L 3HZYA 1LP9B 2P43B 1X5XA 3P9MB 3CH8A 1XZ0B 1YEJH 1SEQH 1I3GL 2P42B 3QQNA 5ECJE 5JR1H 1HI6A 4PJ7B 5KVMC 4LCWD 2DQFB 5E08L 3GSRB 1RUPL 5DEGA 4Z7WE 5DVNA 1FGNL 4JKMA 4S0TD 3P73A 4O58H 4ZFFA 3PGDB 5ICZA 1S5IH 4EJ1C 2ICWJ 1J8HB 2HRPL 1FPTL 1ZXQA 3G5ZB 1IC7H 3IRZA 4NSKB 5AAMA 4UB0L 2IBGA 4BFBD 5DZLA 5IM7B 5CLTA 3RPIB 4P57B 3B9KB 5JW3L 1CLZL 3TVMB 4I2XB 1QFWL 1A7NH 4XPHH 1MFEH 4G6KH 1A14L 4OCYH 1AI1H 5ESAB 3WIHA 1P9MC 4Y4FD 1YMHA 1XGUB 1N0XH 2D4DA 1CXFA 4JFFB 3E8UH 5MHSE 4DW2H 4A6YB 3FO2B 3ULVC 4Q6IC 5L8JB 4ZSOE 4XMPL 4M3KB 4QOKD 3VXNB 1QEWA 1UH3A 2UWEA 3GIZH 1SJEA 1WIUA 4WHDA 5TDOB 1G0DA 3QUKB 4F9PC 1IGJA 4ODSH 5GIRB 4HBCH 12E8H 1J5OH 5CHNB 3VWJA 4OCWH 3SDAC 2YC1B 3JWDH 1VFBB 2C3GA 3K7UA 5IR1A 4X8JA 5C0BB 5ICYB 1P53A 4EVNA 1ONQB 5DQDL 4V1DB 4U0QB 4P3DB 4DZBB 2YRPA 3HN3A 1LK3L 3ZKSD 3RWDA 3VWKA 4WI8A 2HH0L 5E8EA 2X1WL 3FT4B 1X9QA 3IXAA 2GSGA 3U82B 5FYJL 2WIMA 3TEUA 2I9TA 3TZVC 2B1HH 3N06B 3HC0B 4KRMB 2X1QA 5BV7L 5CD3A 4DKEL 1GGIH 4OAWB 1YEEL 1KCKA 4NZJA 4LSQL 2X6MA 5EOQL 3BO8A 3Q3GB 3HG1B 3S5LA 1NGYB 4EUPA 5HYJB 5JPNB 4KKCD 3KJ4C 3BQUD 5EUKA 2BY0A 4F80A 3CUPB 2HT4C 5E5RB 2UWEE 5EFIB 2M8XA 2QSCH 2Z92A 5LCVH 2EH7L 3QUMA 1FZMA 1M7DA 2BMKB 5ID0B 4JVWA 3QEQB 1CE1L 5GRVL 5FO9A 4G6JL 2UZIL 4TTDD 2NY0D 1FG2A 5EZJA 4Z77A 4YEEA 2C3VB 1EV2E 3V5HB 3D2UA 3V95A 3UTOA 1RIVH 3RAJH 3WUZA 3DUSB 2PTVA 4M1DL 1LHZA 1CGXA 3QJHB 4U6XB 2VH5L 4PR5A 4UV7L 3MQIA 2BVQA 4MXWH 3SGDH 2WBJB 4K7FA 4ZXBB 4Z18A 4IOIB 5D2LB 3G6AA 1BBDL 1BIIA 2ESVB 5BZWA 3KPNA 1XR8B 3TCXA 5IW3A 3MV8A 2Q7NA 4PRBB 1KB5H 4G7VL 4TSBL 4WV1C 2IWGA 1P4IH 2E8ZA 2OL3A 4RFNB 5BZDB 3MGOA 4JHBA 4O02L 2Z91A 3B3IA 3EW3B 4OQTH 2JELL 4BELD 1RZJH 2VE6A 3Q5YA 3F58L 4OLZH 4HFWB 1MRDH 3TVMD 2FR4B 4Y5XB 4J6RH 3RX7A 4U3HA 5BXFB 5JXEC 3S8WA 5EU6A 4YHML 2XNAA 1NC4B 3VD4A 4MDIA 1OGAA 3FT2A 1GIGH 2D7MA 1HE7A 2I60L 3S34H 5EU5B 1NC2D 1N5AB 4D9RE 2DM2A 5B22A 4OFYA 4W4OA 4LLQB 5SWSD 4WU7B 4X6BB 1Z3GL 5ELIA 3UX9B 1NGQL 3O4OC 4KJPD 1X5JA 5FKPB 3SDCC 1ZSDB 4RGOH 2Z0BA 3CH1A 2PW1A 5EBMA 4BFIA 1T5XA 4JY6A 5FCUL 1Z5LA 4HJJH 5C0BD 4LGRB 4WJ5B 1JF5A 1F3JB 2HMID 2CDGB 2ED9A 3LEVH 4QRTA 4NC0B 4UT7H 3MV8E 4V1DD 1ZLWH 2CR6A 3NFNA 4KRPC 2IMNA 4LP4A 1A1NB 4EIZC 4OTXL 5DT1H 4GXUN 1DBJH 3EYOA 2DQUH 3GSUA 1BHGA 1KCVH 3RVWD 5A40E 3T8XA 5GZNC 2W60B 3GMLB 4GAYB 5C0DB 1ETZA 1N64L 1RZFL 3CVHA 2P5WA 5EU6E 5HGBA 3F7VB 2FX7H 4OV6F 4JLRB 2HKHL 1CF8H 3OHXA 1PD6A 1OGAE 1Q8MA 3HG1D 1FCGA 4E5XB 5KVEL 2FRGP 1CICC 3UBXI 5IJKA 1OTUD 3K2MC 3PP3H 3E2HB 5I1AB 4HZAA 5BVPL 2OR9H 1T4KA 4C57C 1BPVA 1G9NL 3KPSA 3WNMA 1AQKL 1RIUH 5LKNA 5IBUB 4QRRB 1F13A 2G60H 2V5SA 3ARVA 4OCRL 1DBKH 1ZHNA 4J4PD 1IM9D 2AXFA 1F45A 1RULH 4K2UH 3WEXB 3S5LG 5E9DD 2AJ3A 4M8VA 2NYYC 1FZOA 5MENA 4XVUC 2VDQL 1FL3B 2N4IA 4RX4A 2XXCB 3RWCB 5IKCA 3LMJL 4EBQL 1BJ1H 4ZFZA 2GJZA 1C16A 2ESVD 4HPYH 2BFVL 4Y4KC 1X5GA 2DLTA 4YGVA 5C0RL 1FP5A 3KPMB 1KF9B 2CGRL 5J89A 3G04B 4PJGB 2F19L 5C07B 1L7TL 2FLBT 5E7FA 4OLVH 5MI0B 3IXTA 3KYKL 4Z7NE 3EZJB 2QQNL 2P5WE 1MAMH 3C6LB 1GGYA 5EA0H 5F7HA 5I1KL 3VG0L 2WM0A 1S7VA 2DM4A 1ZA6A 1KJ2L 1I7UB 3ARFB 4QNPF 4Q9CA 1RJZB 1TNMA 3M17A 1HHJB 5HD8C 5HGAB 2ZPKH 1MHPH 3U6RA 3KPSE 4Y5VC 4XP1H 4BSWB 3EO9H 1G84A 2AVGA 1EEZA 2VABB 4WFFD 2FBJL 4PRPD 3Q6GL 5FUCE 4XRCB 3WIFA 4YHPA 3BYYA 4AEHL 3O2DA 4M93B 4Z76B 5IG7A 4WEMB 2A1WL 5C6TH 5SWQA 3ZE2F 3SY0A 5FV1L 1OARL 3OF6D 1W0VB 4I0PC 4JO4H 4HQQH 5LG1A 1SMOA 5DK3A 2NY2C 1FIEA 1U42A 2DIBA 4KDTA 5CCKL 4O2CA 3BAEL 3MZTA 5LXGH 5HHVH 3HFML 43CAA 1DUZA 2EDJA 5CZXC 1YEFH 1FZJA 1WCQA 3T3ME 2E8YA 1ORSB 1YN7B 4XZUA 3SO3C 4LKCA 3IFLL 1DLHB 4LVHB 3S37L 2CQVA 3V79C 1K8DB 3TPKA 4HIEB 3DIFA 1TQCC 1NAMH 1I8MB 1JI2A 2C3HA 4N0CC 3SDDC 1FHGA 3OAZH 5IW6A 1RK0A 2NCMA 3T3PE 4ESKA 1N7ML 3IFNH 2G2RB 4NC1E 3CFEA 1AO7E 3HLAA 3WKNA 5F3BB 1MHEA 3EYSL 4P2OA 3MRJA 2AQ3A 3BKMH 3IU4L 1ZAGA 5F1IA 3SGKA 2E27L 5KTEH 5FO8A 3QT2A 3LSOA 3BSZL 5FF6B 1CDCA 4X6CA 3VGAC 1PKQA 2CUHA 2OZ4L 3DMMB 1WBZB 3QXWA 5E5UB 1FJ1A 3PWNA 5EOCH 4EEEA 4YR6A 4F15C 4N1EA 5IHZA 3FFDA 4MJ6B 4KUZL 3FAWA 3UAJD 4NQXA 5IB1B 1IAII 3REWA 2Z31A 3GKWL 3NACH 5KW9H 1A3QA 2CIIB 2H26A 4LSTL 3MJ9A 5D1XA 5C0IA 4HULB 5HDBE 3NBNA 1KGCE 1JVKA 2A9NL 4QRPE 3K2UL 4LRNH 4PJCF 4MHHG 4UDTA 5INDB 4ODXA 3FB5A 4PIRF 1S8DB 2FNBA 2J7LA 4HKXB 5C92A 4JZNB 2IQAA 4CRPA 2ZOLB 5CEXB 2QL1A 2CRYA 4UU9B 5F7FA 5T33H 5C8JA 2ATKA 1ED3B 4JO3H 2D0FA 1BZ9B 4HWZB 3ARBC 5C07D 1KXQE 1CL7I 1N4XH 3P4MA 4MNQB 1HXMA 3RUGB 4YDJB 1VPOH 2Y36L 2YD4A 5DJZA 1JZ3A 3EOAA 5I66A 4KK9D 3MACL 2ADFH 4LCWA 3VXRB 1FLRL 4X6CE 1PKQE 2QHLA 4WTZA 1KN4L 3NPSB 3JWDC 4X7EC 3QDJB 4YHNB 2LV4A 3BFOA 3ARFD 4FQ1L 5I1HL 5DJ0B 4HIHB 3PGFH 2HFFB 4JDZA 5FUOH 3G6JA 5L6YH 3QDAA 2GCYB 4UAOC 3ULUD 3BN9C 3CFJB 5F8RC 4DGYH 3GSXB 1IM3B 4XCNA 1JJUA 5B21A 1IEAA 2H9GB 2EYTA 3QNXB 3SQOH 4XAWL 3OXRA 1SMAA 1EHXA 4QOKA 2DQIL 2VKXA 3MODL 4PJFA 2Y1VA 2BY3A 5B8CA 2ADJA 5EIQA 4EDWL 3CCHA 2EEAA 3TJEL 1FN4A 4YHLH 2ICWI 1CGWA 1CGTA 4AIZA 4NNYA 1QQDB 3BPLC 4Z5RB 4HW6A 1J1OL 5MERA 3OGCA 2C1PB 5TGBB 4LLUA 4R97C 2WWMD 1WIPA 1EVTC 4WW2A 5EO1B 5HJ3B 5FECA 2DQTH 3KS0J 3S96A 1T3FB 5C7XH 2GT9A 4QHUA 4R0LA 4N0UB 1UC6A 3IDNB 4OD1H 3TFKD 4PLJD 2YD7A 1SY6H 2C7UA 5D2NE 5IMMA 2M1KA 5K9OA 2PR4H 3GBNH 1PEWA 2IEPA 4RWYH 4PRID 4JO2H 5DI8A 3RKPA 1D5ZA 3RWJB 1R3JB 4KTEH 1R0AH 2X4RB 5BMFL 3WO4B 3ZMRA 3G6JE 3KPQA 4RSVA 4WHCA 3C09C 5C9KA 4JRWA 3ARGB 5I1IH 1YYML 4LF3A 4H20H 3TBTA 1K85A 4D9QD 2BDNL 2ORBH 3LB6D 3QAZB 3I3EA 5HTSA 1UJ3A 5JMRA 4GAGL 4PJHA 1RZGB 1QZ1A 4X7SH 3QG7H 1UZ6F 3RWFB 3BQUA 1BFVH 2D03H 4L4TB 5E70A 1TDQA 5AZ2H 4NN7B 4ODWB 1CZ8L 1AIFA 2VISB 4LQ1A 5D6CA 5D71L 1MJ8H 4HKZA 5L0QB 4RFOL 2YBRB 4M8QA 4PJ5B 1C5BH 2X4TA 1RZJC 3RFZC 4P9MH 4MA7H 1FO0H 4D0CA 2XZCH 1INDH 5E8PA 4KAQL 3L5XL 2CD0A 2IH3A 2XWTB 1IBGL 3VA6A 1AD0B 2QQKH 3NA4A 3OWEA 5I76A 3DO3A 1ZT4A 3H0TA 1ZV5A 4U1LB 1BM3H 2I24N 4MA8L 5GS3A 2R9HC 1P4LB 3RQ3A 2QJDA 2DL9A 3NCCB 1F3DJ 4R7NB 5JIPA 1QSEE 4CVWA 4HKJB 1HZHH 1YEHL 3DX8A 4MNQD 4KKNA 5CEZL 1LP9A 3P9MA 3K74B 4HLZH 2VDOH 4PJ7A 3RWEB 2DQFA 3GSRA 4Z7OE 2VDNH 5CILL 1FNEB 5E00B 3PGDA 5IWLA 4CN4A 3QDJD 1J8HA 4P0DA 3OAUH 5DDHB 3U7YL 1J87A 3G5ZA 4ZFGH 3DSFL 3ZYZA 3MOQA 5DMKA 1LO5B 5IM7A 4P57A 1HINH 3B9KA 3HCVB 2R0LL 4W70A 3TVMA 4I2XA 1U6AL 3FCTA 1UB5B 3MRRB 1MCIA 1FNGB 1LEGB 5ESAA 4F7EB 1FVEB 3LD8C 4KROB 1XGUA 1ACYL 4JFFA 2EECA 3VRIB 4WTZG 2XN9D 4U4BA 3FO2A 4A6YA 5D72H 5TDNA 1TJIL 3VXNA 4L5FL 5DD5L 3SE3A 1IEBB 5TDOA 1QUNA 3QUKA 4G5ZH 3J7HA 2VDMH 2ZWLT 5SWSA 3WXVH 3DHMA 3MLUL 1I1AD 1FIGH 1JUFB 4OZHE 3VRLE 7CGTA 1U8MB 1EJ6A 3UPRB 3WO3B 2D7TH 3T0EB 5D93B 2YC1A 1OCWL 1VFBA 4IIQB 4U6VH 3D69B 1JFQL 1IFHH 2DBLL 5E4EC 5C0BA 5ICYA 2OI9C 1LP9E 2UV3A 1G6RB 1RUML 1ONQA 4YFEA 3RTQD 4V1DA 1HXYB 3SDXB 4F58H 4J7RA 4P3DA 4PJ7E 4PJEF 4UNUA 5DEFB 3X12B 4DZBA 3WD5L 3VXSB 3V2AR 1XGPB 3MNVA 5I74C 1CFVH 3U79A 3FT4A 4ETQB 4K7PL 1MCWM 4XPAL 1J8HE 5D1QC 2XRAL 2D9CA 1RVFH 5E8DH 4DGVH 2BVEA 1N59B 3HC0A 5E2VH 2L7UA 4I2XE 1J18A 5FA3B 4ZOAA 2EDOA 4OAWA 3NH7H 2PO6B 1I8IA 1WAAA 4JFFE 3Q3GA 2W91A 4UT6H 3HG1A 1ULVA 3FTGA 4MDJB 3KLHC 4A2MA 5JPNA 5HYJA 4KZEL 3CUPA 3GI9H 2A77L 4ODVH 1JHKL 3MXWL 4JO1H 3OZ9H 2HYMA 2MTPA 2BMKA 2ZNXA 5ID0A 3QEQA 3NCEB 3MBEC 4PJ5D 2WUCL 1MY5A 3D25A 4J4PA 4AT6B 3SHSA 2IPKB 2YPLB 1IC4L 1KLGB 3RX5A 1TQBB 3IU3B 2ZUQC 2C3VA 3V7MA 1VHPA 4IMKA 5KOVC 4PJ8B 1A3LH 3V5HA 3DUSA 2ENSA 2EH8H 2X7LB 4Z0XB 2VQ1B 1TFHA 2XZZA 1OGTB 1CBVL 4K3JH 4QRQB 2MQCA 3QJHA 1U3HD 1EXUB 4YK4B 4WI7A 4M6ML 4U33A 2WBJA 5JHLL 1G7IB 2IBZX 4ZXBA 1OAXH 4IOIA 5D2LA 3STBA 2ESVA 4Z7UF 1DQDL 4U1HB 2JIXB 2Q8AL 4POYA 2FL5B 3VGDA 1H9VA 2OR7A 4PRBA 1RIHH 3CU1A 4DGIH 4GW1B 5I15L 2JTDA 3W5NA 3VFPB 4MZ3A 5D7SL 3ECBA 4KKBD 1WAAE 4OFKA 3B8YA 4P2RB 3HG1E 3P0VL 4HWBL 3BESR 3JV6B 3CFCL 5HYJE 4KHTH 4IRSB 1ZT1B 1G7LB 2BZDA 3QUXD 4U05A 3RIAK 3H42H 4WEBL 1S7TA 2FR4A 1UG9A 4M03A 4PJCB 4UIKL 4TRPL 4Y5XA 5DJ2B 5AZEL 5BXFA 3U7WH 3LDBB 4IMLB 5CD5C 3N85L 1GZPB 4E41D 1F42A 4KROD 4FFVC 4RNRB 5E6ZA 1NC4A 5HHNB 4P4KC 1WFUA 1H3PL 3QEQE 4C56B 4JRYB 7FABH 4MGXA 5DC4B 5EU5A 2W65A 1N5AA 3HKFA 2EIEA 3WJJC 3V0WH 4YPGA 4XI5C 4MB3A 3D85B 4LLQA 4WU7A 4X6BA 3PABB 4XNQB 3PJSB 3G9AB 4H1LA 5FKPA 3J8F7 1ZSDA 5C70A 3T08A 3GEWB 1RFDL 3OF6A 3PHQB 4I48B 3T0ED 4YXHL 2N7BA 1J1XH 2JLLA 1PGRB 4ZS6C 3VI4E 1JRHH 5D2LE 5E7BA 2ESVE 2E9IA 4KVNL 4WJ5A 4KTDH 2YZ1A 1F3JA 5HDQH 4JM2C 2FGZA 2R2CA 1A4JB 2OR8A 2QR0B 1FDLL 1S9YB 3VMOA 3EOTH 3VXSD 3WL9B 1A1NA 1D6VH 2W60A 3GMLA 4GAYA 5C0DA 5C71A 3F7YA 5TE7L 1P6FA 3IDIB 3NIFF 3TYGH 4AEIH 5ERWA 1YEKH 3F7VA 4XBEL 2MCPL 4WFFE 4JLRA 1IKNA 2X4QB 2QHRH 4E5XA 5IVXB 3LPFA 4OCNC 3CZFB 2J8UF 5I6XC 4ZYKA 1B6UA 3UZVB 5I1AA 2AJYH 1ZS8B 4IDJH 4EDXA 2CLZB 4EUPH 4M62L 5B3JE 5DGRA 4ZMAT 4XP9L 1F11B 3MC0A 1MHHB 4F9LA 1CN4A 5FV2A 4RIRB 1I9EA 4LGSB 1OF2B 4WENB 3WEXA 1E4JA 3UMTA 4I3RL 2FWOB 2YD3A 4MD4B 4PJ8D 4ISVA 1FL3A 2BRRH 4WY7L 4EZMA 4Q7DA 4NO0B 1IAIM 3RWCA 3GMNA 3QEGH 1RHHB 3BP5B 3QIWB 4DAGL 3RY4A 3HI6H 2CO7B 1DN0B 1QR1B 1MCPL 4HKBB 4PRNB 5F96H 2JIXD 3KPMA 3G04A 4P46B 4R7DB 5C07A 3UZEA 1MJUH 3QIUD 2AV7B 4JZJC 1T1WB 4POUB 3ARRA 3TO2B 3P11H 2VQUA 1U3JA 4JAMA 4NN6C 3C6LA 3EGSA 4WCYL 1NUNB 4WDIB 2R2BB 5EORH 4EN3B 1IGYB 3GMOA 4NM8L 4JFDB 3CLFH 4BYHA 5CBAB 1I7UA 2EKSB 2RCSH 4IRSD 3LRHA 3MLYL 2A2QT 3ARFA 15C8H 1RJZA 1HHJA 4OGAD 4LASL 5HGAA 4OV5A 2B1AL 1NAKH 2VXUH 5C08E 5AYUH 3NABL 2VABA 4QRRE 5IV2B 3CFDB 4XRCA 5KANI 2DI7A 1U93B 1C5CL 3BX7C 4NRZB 4Z76A 3F7QA 5M95B 2GITB 3HNSH 3BIKB 3D85D 4Y16B 3QG6A 2E9JA 5JIIA 3CD4A 1NCCL 3QJFB 1W0VA 4P3WA 1SJXA 4RWHA 5MEOB 4PD4J 5F9WB 3B2UC 4FRWA 4N90E 2H45A 2BY1A 4WUKL 1D9KB 4NHCH 1I1CA 5A16B 4NNPH 4I18A 5IB2B 2YPVH 2BY2A 2EKJA 2FX9L 4L8DB 4QT5A 4WU5B 4PJGE 1ORSA 1YN7A 4OF6A 1RZ8B 1DLHA 3RZCD 3L7FB 1G9MC 2RB8A 3L3HB 5DMIH 3MBXH 2W9DL 3NMEA 1K8DA 1CLOL 1KLUB 3PQYD 1GOGA 1CIDA 1QFUH 1WTGT 4KK6D 1XIWB 5J11C 3VFGH 4NQTA 1I8MA 2CK0L 3SKJH 4BQ9A 5FGRA 2G2RA 5ANMB 1JF1B 1OHQA 3FAXA 3GZKA 5F3BA 2ZG3A 2I5YL 3EJJX 3R8QA 5L9DL 4HJ0D 4TUJB 1TJHH 5FYLH 2GY7B 1A6WL 5GPRA 5KVGL 3L5JA 3ULUE 1QR4A 5FF6A 1AY1L 4MXQC 3DTXB 4NDMB 3DMMA 5F72S 3CVHH 2X4PB 1MVFA 1WBZA 3NZ8B 3ZT6A 2DQDL 3EHBD 4FNLL 1A7OH 4KQ4H 4JFZH 4XC1L 2P48B 3EBAA 4X6DF 4KDVA 1S7UB 4MJ6A 1CYGA 2X1OA 3TN0C 1D3CA 4KPHH 1V7NH 3H9SB 5IB1A 3N0PB 1M05B 4OD3H 1G7MB 3UTZA 4PJEB 1T1YA 5GS1B 2CIIA 1MRFH 4K23H 1M4KA 3C08L 1AP2A 4MB4A 1PAMA 1BIHA 4YXKL 5DD6B 4XP4L 1HKLL 4GW4B 4MAYB 1A21A 1BGXL 5INDA 3KNBB 1EIBA 1S8DA 4S1QH 1KLFA 1IKFH 4NO0D 4HKXA 4JZNA 3B5GA 4HUKB 3B5HA 2ZOLA 5CEXA 4UU9A 5BS0E 4HSQA 5IBUG 3FQUB 5BW7C 3L6FA 1MFBL 2NY4C 2HJLB 2VLME 3MA9H 3IDMB 1ED3A 2NX5B 3AAZB 4Z95L 1BZ9A 4HWZA 4OFDA 2J2ZA 4P46D 4PB9H 5HVHB 3LHPL 4MNQA 1A2YB 4U1IB 4DUXA 1RUKL 3RUGA 4YDJA 3RU8L 2AEQL 3VXRA 2R1YB 1CXEA 1A1OB 4PJAF 1MIMH 5T1KB 1UJTA 4YZFE 1DQJB 1NUFA 4D9QE 4JFDD 3QDJA 4YHNA 1I7RB 4MSWB 2CPCA 5DJ0A 4HIHA 1NCBH 2HFFA 4UBDC 5TQ2L 2FO1A 2YA1A 2BHUA 2NXZB 2W92A 2GCYA 2HJKB 3CFJA 2FBOJ 5FYKE 3GSXA 4U7KA 5D7LB 1IM3A 4C83B 2H9GA 3O8XC 3ZKQD 5JPMB 3UYRL 1NDMA 3QNXA 4N5EC 1D5MB 1KFAH 1QSVA 2IFGA 1L0XA 2X4SB 4Z7UB 5I17B 4Y16D 2I25N 4GMSH 1MUJB 3O2DH 2PNDA 1H5BC 3OJ2C 2YMXL 2APVA 2EYRB 1LDPL 4GW5B 1D9KD 1QQDA 3I02A 4Z5RA 1QSZA 3QFJD 2C1PA 5ALBH 5TGBA 4LLAA 4TULH 3MLPA 4MNQE 5EO1A 1RZKH 3MCKB 5HJ3A 3RUGE 1T3FA 3QSKB 3PE9A 4N0UA 1RZIB 3VXRE 1XIWD 5DFVD 3KR3H 3DX6A 4P59L 3INUL 3CMGA 4BFGA 5DK2B 5CJ5A 2OLDA 3QDJE 3DV4B 4IRJD 4DTGL 1C5DB 1R3JA 2X4RA 1I4FB 4ZUSB 2YUXA 1H15B 3ARGA 1UXSB 3O45B 4JANB 3T2OA 4XP5H 4DVBA 1V3MA 1T0MB 1RZGA 3C2AL 2X10A 3VXUB 5DLMH 4G7YH 1OP5H 4NQVA 3UJJL 4LAQL 1Z9OA 1V3LA 4QHKJ 4JHAL 2Z8SA 1XT5A 1CR9L 2N1KA 3H9SD 4ODWA 3RVTD 2YZ8A 5CBEB 3WHE0 2VISA 3P9LB 4WHTB 1UT9A 5CSBA 4ETYA 4ZOCA 1WUNT 2YBRA 3IF1B 4PJ5A 1RK1B 4GUPA 1EJOH 1QA9B 2AQ2A 4BK4A 4CN1A 4TSCL 2XIDA 4GAJH 2AJUL 4MAYD 4DOHB 5EU7E 3CDFA 1TETL 1N3NB 2XWTA 4BKLB 4HIXL 3D0LB 1AD0A 3EJYD 1MCOL 2NXYC 4N0YL 1I3GH 4N0UE 4ODTL 4U1LA 1KCSL 1P4LA 2X9XA 3I6KB 3JUYA 2K9UA 4UILH 4PBXA 2N7AA 4R7NA 4HKJA 5SX5K 1U8HB 2HRPH 5DJ6A 1IGFL 2QADC 3BUTA 4UB0H 4QXUL 4GRWH 4NRXB 3RWEA 2X4NB 1ZVYA 1CLZH 1G1CA 3C5ZD 1QBML 4FQIL 1A14H 5E00A 5CP3A 3VG9B 1E4XI 2EC8A 4XAKD 2XTJE 5DDHA 2LFGA 3U30C 1LO5A 3CXHJ 3HCVA 3PHOB 4L4TE 1TPXB 3MRRA 3MX0A 5D7LD 1FNGA 1LEGA 4HH9B 4F7EA 1FVEA 4X7FC 2NY6B 4E41A 1AGCA 3VDCA 2YN3A 1ZWIA 3VRIA 5JW4Q 3EFDL 2GSIB 1A3RH 2EEBA 2IFFL 1JF6A 2P8PA 5A1AA 4U6YB 2VL4A 3TWCH 1FBIH 5EBWB 1IEBA 4L3EB 1QRKA 5I8CA 5GSVB 1MFCL 2DLIA 3I3BA 1JUFA 1U8MA 4H0HB 1AGFB 4M7ZC 5DQDH 2VO5A 3UPRA 3T0EA 3TBYB 1L6XA 4IIQA 3D69A 5FIEA 1NJ9B 4WNQA 4PGJA 1WT5C 1MFAL 2CLRB 5DA0B 1G6RA 3B4NA 5FYJH 2YR3A 4L4JA 1P2CB 4ONGL 1HXYA 3SDXA 3X12A 2X89D 4MS8D 5DEFA 2VN7A 3VXSA 1OY3B 1JZ4A 1XGPA 5BV7H 1T0NA 3O6FB 2HFGH 4ETQA 4EI5B 1YEEH 3PP4H 1UQSB 4LSQH 2R15A 5E5MA 1YC8A 2CJUL 2O5XL 5D5MF 1N59A 1ZHKB 1NMCB 2HG5B 4NKMB 3NIGF 5FA3A 4JR9L 2BJML 4OZGF 2PO6A 5JW4R 4G8IB 3HI1B 3VXUD 1JZ5A 1TITA 4ONFH 3MR9B 5MP6L 1CE1H 4G6JH 4OBRA 2VZSA 2UZIH 3BN3B 3EO0B 5HY9A 1G7HA 3MRGB 3OB0K 5GJTH 1OAYL 4M5YH 4G9FB 3T0EE 3HPLB 4YBLB 2Z4QB 5JQ6L 4TPRL 3BKJL 4AT6A 2VH5H 4JQXC 4K07A 1WICA 1OM3L 2IPKA 3DARA 2YPLA 1KLGA 3IU3A 3ARQA 3MOAL 4PJ8A 2BSED 4QNPE 1IAIL 4JHWL 2ZG1A 1JWSB 2AK1L 2FO4B 3SDXE 2Y6SC 2VQ1A 1FCCA 1KPVB 1OGTA 1E6OL 4QRQA 1U91B 3VXSE 3ALXA 4G7VH 4TSBH 1EXUA 1K6QL 1JTPA 1A5FL 5T3ZD 4YBQD 4U1HA 5I19H 2JIXA 4O02H 2JELH 4IOFC 1TVBB 1KIPB 3QDMB 4LSSL 1T04B 2FL5A 3R0NA 1FNHA 1LNUB 1JN6B 3QIUA 4X6DB 4DZ8B 1Q0XL 1IEHA 3P30H 1FAIL 1CI5A 5DQ9B 3ZE2E 4W4OC 2KKQA 3VFPA 2JKXA 2XQYG 4YHMH 5DS8B 2OS7A 3S36X 1QBLL 2VXQL 3JV6A 5DA4A 2EE9A 3FMGL 5KSUB 3RVUC 3PWPB 4IRSA 1X3DA 3MLWL 1G7LA 3LKRA 2I60H 4J3WA 3SN6N 1V5JA 3OAYK 4PJCA 5DJ2A 3ZTJG 2C4FT 5H94B 4IMLA 1PEZA 2NY6D 3RX8A 1GZPA 3UJIL 1Z3GH 3KYNB 4NHUB 5HHNA 4U7MA 4G42B 1DUYA 1MWAB 3MJ8B 4C56A 1UA6L 4JRYA 3GJFB 3MRMB 1XMWA 3IB4A 2YPLE 1SVZA 3AREB 4KC3B 3HE6B 4A6YH 4ZQKB 3D85A 1WEJL 4XNQA 3PABA 2WP3O 3ZKXC 4K3DH 4AL8L 5A2JH 4TSAL 4NQSB 1NBVL 3WNOA 2XYCA 3PHQA 4I48A 3TBWA 3QYCA 4HFUL 3U83A 2YD8A 4PJAB 4ZDHA 2V2TB 3LV3B 4OTXH 3K4ZA 4P23C 4YFLI 2O93L 2UYLB 5CP7B 3WLWC 1A4JA 2QR0A 4PJXB 4XCCH 1S9YA 3RZCA 1VESA 3WL9A 3MREB 4ODHL 1T6WA 1WLHA 4JREB 3PQYA 3O6FD 2XZQL 4EI5D 4CADB 4PFEA 3T77B 4P2RE 2HT2D 5KSAB 4PYGA 1Q1JL 1T20B 2C9AA 4PP1C 1HEZB 1ES0B 3IDIA 4PJCE 4JDTL 4BH8B 4ZO6A 4GXVL 1G9NH 1S7QB 3L3IB 2Q7YB 3EOBB 4KRLB 2EE2A 5KSBF 5IVXA 1C12B 5SV3A 5L8KB 4C56E 3CZFA 3OTTA 4JRYE 4AMKL 2ERJB 4OCRH 1U58A 1G0YR 3HC4L 1Z9MA 3IJYB 5J4MA 2FZ3B 4LPXA 1ZS8A 1Q9LB 1BQLH 1WWBX 2CLZA 5DURB 3BGFC 2EZ0D 3RKDC 2EICA 1BD2B 5I16B 1MHHA 2VDQH 4LARL 4O5LL 4NJ9L 3V4VH 5HDOA 2NPLX 4RIRA 2X9YA 3LMJH 4EBQH 4M6NL 1UFUA 1ZK9A 3NPZB 3HB3C 4FQXB 3ZHDA 2OCFD 4LNVA 25C8H 1W72L 4P3CL 5SX5H 4GKZB 4MD4A 2BFVH 4HK0B 5C0RH 2CGRH 4XVTH 1INEL 2EXWC 2F19H 4NC1C 1L7TH 4NO0A 5DMYA 3DWTA 3LH2L 1RHHA 3KYKH 4J3VA 1A7PH 2F54B 3VD7A 2P49B 2QQNH 4GJTB 3CJJA 4ZFOB 1KIQB 2VXSL 1JZ2A 1QR1A 1A7RH 4HKBA 5DRNB 3VG0H 3QDMD 3I2CL 4P46A 4R7DA 4JGJA 3T0DA 4QCIB 2AV7A 1T1WA 3TO2A 4K3GA 3HZMB 1UM5L 3U1SL 2B5IC 5H2BB 3HTLX 1FFOB 4S11A 2P7TB 2R2BA 4EN3A 5IVXE 4I8DA 1IGYA 2FBJH 3Q6GH 1SJHB 4JFDA 5CUSL 5A3ID 3PWPD 5CBAA 2EKSA 2EIZA 5I0DA 2JB6B 4L29B 4AEHH 1CU4L 4KDTC 1YEJL 4OD2B 2J3SA 3HUJB 4W68A 1DVFB 3U48A 4PG9B 2A1WH 1BFOB 1VEOA 2J88H 4EQ2A 2HTKC 3CFDA 4LIQE 5I9QC 4CW1A 5JXAL 4LLVB 3RNQB 4NQDB 1U93A 2AK4D 4NRZA 3R8BB 4WI2A 1DE4B 3ARED 2GITA 3E6FB 3HE6D 5CCKH 3BIKA 3BAEH 4Y16A 4G6KL 1AR2A 1AI1L 3QJFA 3HA0A 3SE8H 2LAAA 5MEOA 1TZIB 1FNLA 3H3BC 1N0XL 3IFLH 3KLAB 4GLRI 5D8JL 3E8UL 4DW2L 4H1LH 1MQKL 1D9KA 4X9IA 5IB2A 4YFDB 1CD1B 3F6IA 4L8DA 4WU5A 2RHEA 3GIZL 3ZKNC 3U4AA 3D9AL 1N7MH 1UZ6E 4ODSL 1RZ8A 5JW4N 3L3HA 3SCMB 3EYSH 1J5OL 2PYED 3OXSB 1KLUA 4OCWL 2C1OB 3IU4H 1XIWA 2EDFA 4M7LT 2E27H 1T7VA 3BSZH 5SX4I 2Z31C 1YYLL 2R56H 4O51B 4IRJA 4OZFB 2Z8RA 1LE5B 2MWCA 5FM4A 5CJOH 5D1XC 3AS3A 3LRGA 2LE9A 3QUZB 5E99L 2W0FB 5F1OB 4NCC2 3OB0H 5HYQA 3HMWH 5I8OL 3UBXA 3WJLA 4NDMA 4X9BA 3NZ8A 3GKWH 3P9WB 3C2SA 3C60C 1ZGLM 3PHSA 3LN9A 5B4MD 2B1HL 1S7UA 1OLLA 3JV4B 5DURD 2A9NH 3V4PL 3K2UH 1GGIL 1BD2D 3H9SA 2DLEA 2JB5L 4MHHI 2IMMA 1G7MA 4KI5F 4PJEA 1UACL 5GS1A 3KG5A 1S5HB 3KPTA 4URTB 4YHKL 4GW4A 4MAYA 4XPFH 2X09A 4HCRA 5D5MB 1MNUH 3KNBA 3TH4T 2H8PB 4I13B 3FQUA 1LVEA 3NN8B 4QHKI 3MACH 2HJLA 4OZGB 2GY5A 3IDMA 3QWQB 3AAZA 2NX5A 3OMZA 5IFAL 4P99A 2DJ4A 1KN4H 4Y4FC 5ANME 3FQRB 1A2YA 1XGQB 1RIVL 5CINH 4U1IA 2ATPA 5I1HH 1FVCB 1RJCA 2HKFH 5CAYB 2EDNA 4R96B 1V7MH 3FRPG 3MV9D 4D8PA 1G0XA 1DQJA 2D3VA 5EZIL 1OB1B 5SV4A 1I7RA 2XQYK 1IILE 4MSWA 1DL7L 1JK8B 5C0CE 2OQJB 1NCDL 4MCYB 1AHWB 1T7WA 5TFSL 2HJKA 3F5WB 5H8DA 2DQIH 4ZNEE 3H9SE 4N0RA 1P4IL 5D7LA 3C5JB 3RDTB 4WW2C 5DZOA 4C83A 1QBBA 4DWHA 4EDWH 4MAUL 5BV7C 4PJEE 3TJEH 4NQDD 5JPMA 1AXIB 3D1MC 4KXZI 1RZJL 3QDGB 1D5MA 4OLZL 5HHMD 4G80B 1AR1C 3LPWA 1DQMH 4Z7UA 2PYFB 5I17A 1J1OH 2GHWB 1MUJA 4PTUB 1BZ7B 3O9WB 3JVGA 4P2QB 4MNGB 3TC9A 2WZPD 4Z7WF 43C9B 4X83A 2AQ1A 4ZNCD 4GW5A 3CX2A 3S34L 2NX5E 1F4HA 2AXJA 2I27N 3Q5TA 1G9EA 3MJ6A 1CTOA 5IHLB 3MCKA 3WFDL 3SCMD 1BMGA 4KKCC 4RGOL 4NIKB 2BVTA 1RZIA 4KY1H 5CJXA 5I1DA 4NNXB 1YYMH 3REVB 2A0LD 3GRWA 5HI4D 4HJJL 4NZUL 2LVEA 4WFED 5DK2A 3DV4A 6CGTA 1C5DA 4GAGH 2C3WA 4UT7L 4WI4A 1I4FA 2CRZA 2ZNWA 4JHZA 1QPXA 3S98A 1KTKE 4ZUSA 1H15A 3QUZD 3K8KA 5M94B 2NY0C 4HH8A 5IVZA 1UXSA 1CE6B 3O45A 3BDYL 4O2FA 4HUXB 4J3UA 1NFKA 4JANA 1BF2A 2CR3A 5DHVB 2DQUL 5ACLA 1NKRA 1T0MA 3VXUA 5D71H 5IMKA 4XHQA 3FO0H 4XTRD 2VDKL 4GT7A 4RFOH 3U36B 3CFBB 3HNTL 4Z7UE 3FHQA 1URLA 3EO1B 1BOGB 3SKOB 5CBEA 4KAQH 5I1EL 5JA9A 2VXVH 2FX7L 3L5XH 4NWTH 4PRHB 1CF8L 3P9LA 4WHTA 4YDVB 3DETD 3EIFA 1U8IB 3IF1A 4WVRA 1RK1A 4OKVB 2XOTA 1QA9A 3JTSB 2Y5EA 4Y0GA 3H9YA 5IWLC 3EZ8A 1N3NA 4BKLA 3D0LA 1JGEB 2G60L 2HP4A 1CFNB 4PJ9B 4LDLB 3I6KA 3UTTE 4NCC1 5KSBB 2APWA 3QNZB 5CILH 4RQQB 4DK3A 1Q9KB 1LO3L 1U8HA 1YECL 2UWEF 1NMAL 3CK0L 3HI5H 5FOBB 3DSFH 4IHOB 4NRXA 1KIUA 3SE3C 2X4NA 1BZQK 2R0LH 4G6AD 1U6AH 3DSNA 1IC5H 4YFLF 1BECA 3F7PC 4ZUWB 4KJPC 4HPYL 4W6XB 2EYSB 4LPTA 4X98B 4Z7VF 3L5WB 4OLVL 3PHOA 1PY4A 5GSRB 3MGAA 1TJIH 5L7XL 5CFHA 2DTMH 4PG2A 5DD5H 4RMTA 1UYWH 4H0GA 4HH9A 3ORJA 1JBJA 3OPZL 4ZODA 2HMIC 2XACC 3MLUH 3ES6B 3QDGD 3ZT7A 2LTQB 2GSIA 2UY7A 2VLRB 4JN2B 1OCWH 3GNML 4UTAH 4DOHE 4U6YA 3PDGA 1GGUA 2ZPKL 3O9WD 1WQVT 1JFQH 3X3FL 1MHPL 2DBLH 4L9LC 5HPMA 3RVWC 4UINH 2ICWA 2YXFA 4HXBL 1UB6B 2MOVA 5GSVA 3BIAX 1G9NC 2ZUTA 1RUMH 4Z0BL 3RY5A 3TBYA 3UDWA 4ACPA 4H26B 4OUOA 4BFEA 3W9EB 1ZA3B 1NJ9A 2XA3A 2P5EB 2WIIB 4S1SL 2XRAH 2D7QA 3PXJA 5EH1A 1P2CA 1DQQA 1OTUC 3CZJA 4LNRB 2VAJA 2XKUA 2DQCH 2IANB 3GSOB 4WWKD 1ZGLB 2C5DC 4U2ZA 2DLHA 3O6FA 1MREL 4EI5A 1NCWL 3ARUA 5ID1B 4GKSB 3OR7B 1E4KC 5LXGL 3AM8A 1EH9A 3DRQB 1YEFL 4Q0XL 4B41A 1HNFA 3U0WH 4Q58C 4OZ4B 1ZHKA 4J4PC 2HG5A 1DANT 2LQRA 3E3QC 4RGMC 2A77H 1J10A 4IMKC 3MXWH 4U1NB 3U9UA 2EDTA 1HWHB 1EHLH 3ARTA 4M3JA 4G8IA 3HI1A 4LPYA 1ZGLP 1S9VB 4ODUA 5DQJB 4OZIF 1I75A 4KU1A 3MR9A 4U49A 4JQIL 4UT9H 4F7MB 2GK0B 5GRUL 5I1JL 3EO0A 3BH9B 4L3EE 3O0RH 4M02A 5KTEL 4DQOL 3MRGA 4I3SH 1PSKH 3I9GH 4G9FA 4K9EH 4NFDA 3T4AB 2WNGA 2HT3D 3HPLA 1J7VR 5EOCL 2Z4QA 4P5TD 3P4NB 5JHLH 4JEGB 1JWSA 2NLJA 3NACL 1KPVA 2DJSA 1U91A 5I15H 5KW9L 1SBSL 2FJFB 4Y5XC 2V2WB 3O2WL 2O61B 1DFBH 2DF3A 4QY8B 4HX1B 3DX9B 3JWNC 4LRIC 2UZXB 5DJDB 1TVBA 1KIPA 3QDMA 4HWBH 4LVNB 5I73B 1T04A 3CFCH 1LNUA 1JN6A 4X6DA 4DZ8A 5L2JB 3L3OA 5DQ9A 1FYTB 3BH8B 5AZEH 3ZTJH 2J1KA 5ENWB 2XFXB 1B3JA 5DS8A 5A43C 5DO2D 1NQBA 3PWPA 5KZCB 2M26A 3PL6D 3BI9X 2KQNA 5CP3H 3ARXA 1VPOL 5IEKA 4RDQG 2ADFL 5H94A 1T03L 3KYNA 4NHUA 4G9FE 3FQTB 1V3KA 1MWAA 3MJ8A 1BQHB 1RFDH 3RL2A 3GJFA 3S35L 4YXHH 3MRMA 2HLFD 2C26A 4GBXD 2ITDB 3GMMB 3HZVB 3AREA 5CZKA 5BCAA 5L6YL 3HE6A 3MRQB 3V4UL 2E9WA 4KVNH 4DGYL 1GGTA 4NQSA 2V6HA 4OLEA 4NN5B 4MVBD 1KELL 5GHWL 2VYRE 4PJAA 3W9DB 2V2TA 2YD6A 3LV3A 2MKWA 2W0LA 2IBBA 4FFYL 2P5ED 4Z78B 4NRYB 5CKAA 2Q3AA 5CP7A 4P5KB 3MLTA 4X6DE 3E2HC 4BQ8A 4CDGC 4YHLL 5F6IC 2IAND 3MREA 2DQEL 5T3XD 4L8CA 4JFHD 1CWVA 1G6RH 2FX8L 5ALCL 3MV7D 1CDGA 4YQXL 3UAJC 4CADA 3T77A 2VNCA 4XBEH 4F9LC 3KHOA 5KSAA 3PWPE 1YNTB 3IETB 2R2EB 1T20A 1X5HA 2DQTL 3PDOB 1HEZA 2Z93B 1JPFB 3RRQA 4BH8A 4Q6IB 1S7QA 3L3IA 2Q7YA 4M62H 2YHGA 4Y2DD 3EOBA 4XP9H 1NGPL 4Z7WB 1C12A 4LLMB 2FGWH 3RIAF 4RWYL 3WFEH 5LBSL 4JO2L 1T7YA 4HGMA 5C2BL 5I75C 1QLFB 2ZUWA 4I5BB 2IF7A 3IJYA 2VZUA 3GSNB 4UQ3B 1R0AL 2FZ3A 4KH2A 3WS6A 1R5IB 3T3MF 1JWMB 1MCFA 3SDAB 1RY7B 1Q9LA 4P4RB 4CUCA 3W0WD 5I1IL 5D7JD 2V5RA 1BD2A 5I16A 2ARJB 4WY7H 2WLYA 1R5WB 2NY7L 1QO3B 3QG7L 4KK9C 4MJ5B 4DAGH 2WSKA 3T3PF 3DX7A 2DMCA 1BFVL 2XV6B 4GKZA 1MCPH 3DGCR 3I6GB 5CLWA 4HK0A 5IP4A 5F7EL 2A74A 3ARFC 1TZHB 4PJXE 3LCYA 1N6VA 1UWEH 5C0GB 3IVKB 1MJ8L 4ZPVB 3UPAA 3TNMB 5DUBB 1C5BL 1KIQA 5C0JA 3OKEB 5DRNA 2A73A 1ZVSB 2JJSA 4P9ML 1FO0L 3EDFA 3BRGC 3BGAA 3UPCA 4MMZC 2QQKL 1AE6L 3MLYH 4QCIA 2E7LA 3HZMA 3A0OA 1FYTD 1MAJA 2V5MA 4LASH 5FYJU 5H2BA 4KI5D 2P7TA 2BNRB 1I3RA 3NABH 1SJHA 1BJMA 5KZCD 1TTUA 5JMOC 1NGXB 3EFFB 2JB6A 1C5CH 4RGNE 3UYPA 4PBVC 5IVNA 3HUJA 1W8NA 1DVFA 4I18C 4PG9A 4M6OL 3SKNB 1BD2E 5KAQG 1G7JB 3MLRH 4LLVA 3OR6B 3BPCB 3RNQA 3VXOB 4NQDA 3VA2C 4OFIA 3NAAL 4ZFGL 1Z2KA 1O5DT 1DE4A 5DWUL 3E6FA 4PLJC 3SOBL 1HINL 1PKOA 3I6LE 3RWGB 5IFHL 2FX9H 5J13C 1L0QA 3IFOB 3D3VB 5I1LB 1TZIA 3KLAA 1NBYB 2F54E 2MHAB 1CLOH 1I9RL 3SE9H 4FQPA 4Z7VB 1CD1A 2VR5A 3LB6C 4KRNA 1NFIB 3THML 5IMOA 1X5IA 3WXVL 1OT1A 3SCMA 2ENYA 2I5YH 3OXSA 2D7TL 4N68A 5L9DH 2F9BT 4OSUL 2HVKB 1MLBB 5GRXG 4NKDB 4U6VL 4K55A 4HZLB 1AY1H 2GAZB 3ZSTA 2N56A 1W2KT 2OXGA 4O51A 2G75B 4OZFA 1LE5A 1Y6NR 4QXTB 4FNLH 1NCTA 3HUJE 2IADB 4XC1H 1B0RB 2FD6H 3QUZA 3AMKA 3R1GL 2NR6D 1CFVL 3CSGA 1HH9B 1J11A 1CDUA 3AROA 4NQDE 1QFPA 5TDPB 3O4OB 1X5FA 3SDCB 4DGVL 4KKLD 3C08H 3SDAD 4ALAL 3JV4A 1HKLH 3RGVD 1BGXH 1ZHLA 5TH2B 4M1CD 4XBPB 3W11C 1R24A 5T5FL 1S5HA 3GI9L 3NPSC 3I84A 4YDKL 2RBLA 4JN1L 3MJ7B 4IOSD 5D5MA 1I3VA 1KPRB 2G5RA 4JFPB 3PNWB 3LHPH 4MA1B 1XF5B 3BP4B 4GKNB 3GGWB 4XXCC 1MY7A 3NN8A 3RU8H 2AEQH 4OZGA 2IQ9H 4HUUB 1JNJA 2NZIA 2ZOKB 4WFEE 4OZIB 2KDGA 3OKYA 1A3LL 3FQRA 4L3CB 1XGQA 2PTTB 1NBZB 3PG2A 4YUEH 1FVCA 3K4DA 5TQ2H 1CICB 3LN4B 4I3GA 3MLVH 1PBYA 4R96A 2X70B 1II4E 2D2OA 2GEEA 1OAXL 1I1AC 1OB1A 4H0IA 5IMLB 3UYRH 1JK8A 2OQJA 1RIHL 4DGIL 4MCYA 1AHWA 3F5WA 1WC7B 4FXKB 3C5JA 3RDTA 5JDJA 4POZD 3RTQC 5E1AA 2YMXH 3QDGA 1CGUA 5T1LD 5E2TL 3BW9B 3O3BB 2FEDD 3H42L 3V6BR 2PYFA 3STLB 5FUZH 3TO4D 4PTUA 1BBJB 4MXVF 1BZ7A 3O9WA 4RZCB 4P2QA 5E95B 4MNGA 1RJYB 3ZSSA 1SYSB 4Y4KB 4Z7OF 1MCRA 2F74B 3NIGE 2X1PA 3SGJA 43C9A 3VWJD 7FABL 6FABL 3WIHL 5TQ0L 5IBLC 1MFDL 1UZ8B 3INUH 5AG9A 4MWFB 3QI9C 1NFDB 3EAKA 4QWWD 4K9EC 2JJTA 4NNXA 3REVA 5FGSA 3ROOA 3VWKD 1JRHL 3VRJB 3N1GC 4Y5VB 3BKCH 2YPKB 4KTDL 4LKXA 5F9OH 5HDQL 3C2AH 1YA5A 4X80L 2VKWA 1GGBL 3UJJH 4LAQH 1ITCA 1EFXB 2G5BB 2IJ0C 3AB0C 3EOTL 4YE4H 4OZHF 3ELAT 1CE6A 2OMNA 4HUXA 4LSVL 3QO0B 5DHVA 3OJMB 3HMXA 1X7QB 5GZOD 5HHOB 5I0ZA 3QPQD 3GM0A 3QDGE 4K3HA 4I0PB 1U3HC 5IB5B 3CFBA 1LP9F 2NY2B 4XPGH 4OZFG 4TSCH 4AEIL 1BOGA 4P2QE 3SKOA 4MNGE 5DD0L 1YEKL 4P9HL 3QNYB 2KQMA 4HIXH 3CX5J 4LFHD 3GI8L 1BWWA 1MCOH 3SO3B 1KCSH 4OKVA 1JNNH 3JTSA 1HHGB 3ZE1E 5KJRH 3O6ML 4P5TA 4KKBC 1TQCB 3KPRB 5EN2B 3W81A 1CFNA 3QUXC 3OQ3B 2A38A 4HCRH 1NEZA 4PRAA 3QCVH 2Q86A 1JYWA 1F6FB 3QUML 5KSBA 3QNZA 5EIIB 4FQIH 4RQQA 1Q9KA 2GIYA 3L7EB 4JPVL 1ZANL 2BRRL 3MNWB 1X5ZA 1D6EA 5FOBA 4IHOA 4P48A 3WS3B 4A2LA 4F15B 3HI6L 5JORB 4MA3B 4PJIE 4ZUWA 1YN6B 3RY6A 2EYSA 5DD3L 5KVFH 1MJUL 2PCPB 5IB4B 3EFDH 3PL6A 1KCLA 4IIQC 4D0BA 1AO7B 5GSRA 2R4RH 3P11L 1KTRL 2DKMA 5ITFB 2NYYD 5EU6D 1XGYH 4PRHE 2BNUB 5EORL 1MFCH 2DM7A 1BWMA 3ES6A 3CLFL 3C87A 3FJTA 1VA9A 2OL3L 2RCSL 1CGSL 3BPOB 1T89A 4I4WB 3EJZD 1AGDA 2VLRA 4JN2A 2EDYA 4PV9B 3T2PA 4QYOB 5EG6C 3MRIB 5GS0L 1VKXB 4M4RA 1I1FA 2H2SD 3KHQA 2VXUL 4OFYD 5AYUL 4GSDH 1XF1A 3ARBB 3U0PA 5KANG 2XZAL 2YD2A 3G5YB 1U0QA 3QRGH 4H26A 1MEXH 3W9EA 5KSBE 4Q74A 2F5BL 3HNSL 3KXFB 5EU3B 5JOFB 2P5EA 4QRPB 2WIIA 3GJFK 1MIEL 1PJ9A 2AP2A 4ELMF 5L2KB 3MYJB 2CJUH 4G8FB 4LNRA 3AY4A 2PKDA 3RGHA 2IANA 5IEHB 3GSOA 4YAQB 1ZGLA 4JR9H 3MV7A 4NHCL 5ID1A 2I26N 3OR7A 4GKSA 4NNPL 4APQC 2DM3A 3DRQA 3U0TB 3K1DA 5ILTH 5GGSY 4F3FA 4HJGB 1EFXD 3GRWH 4OZ4A 5MP6H 4U1SB 1LD9B 4UIMB 1LDSA 1NBQA 2E7HA 3DV6B 3EYQD 5IOPA 4U1NA 4RAVB 1QFUL 2AXGB 3I50L 2P5WD 4PJ8C 1EA9C 3VFGL 4TVSa 1CQYA 2D7NA 5LGJB 4X5XB 4Y5YC 3VI4F 1OAYH 5DQJA 4U2YA 1GOFA 3GDBA 5KN5B 1E6JH 1N8ZB 4YK4C 2VLRE 2NY2D 2X05A 5BJTB 5JQ6H 3BKJH 4F7MA 2GK0A 4RMUA 3BH9A 1OM3H 3BPLB 1JTTA 3W0WA 3MOAH 5D7JA 5CZXD 1IAIH 4R97B 3T4AA 2HJFB 3QIUC 2AK1H 3CVHL 3HPJB 1JWUB 3RWHB 2BVOB 1E6OH 3LS4L 4J3OC 3TIEB 4N8VB 1QFOA 3T0AA 5F88B 3QIBC 1A7OL 1EMTL 1RUQL 2BERA 4CVZA 3P4NA 2UUDK 2J8OA 2P5EE 4KPHL 4AJ0A 4N0CD 1LGVA 4X6FB 1JPST 3NCYP 1M1SA 2MSPA 3S6CA 3OKKA 1KENH 3F8UB 1Q0XH 3AXLB 1MRFL 4K23L 4OGAC 5T3XE 2V2WA 5E2UL 3C09B 2O61A 4QY8A 1HQRB 4FP8L 1TTFA 1KTDB 4JPWH 5DJDA 3Q48A 2X5PA 1CVSC 1QBLH 2VXQH 3ILPB 1CL7H 3FMGH 3X13B 4PJDB 1K3ZA 3TM6A 5BVJB 4R3SB 5T3ZH 2W07A 4U1JB 5L2JA 4HGKC 2ITCA 3EDEA 1FYTA 3BH8A 1T66D 3MLXL 2QSVA 5EO9B 1SYVB 5ISZB 2XFXA 1H0DA 1VADB 5I1CL 1KB5B 4KI1A 1DQLH 1UA6H 4FFWC 2H32H 1AO7D 1M7XA 3SQBA 4CVUA 5I2IB 3VGBA 1I3UA 5F93C 2NY3D 1WEJH 4TSAH 2EE3A 3FQTA 1VGEH 1NBVH 3NCMA 3RZCC 1BQHA 3GM8A 1U8KB 2LU4A 3STZB 3GMQB 1F58L 5HHQA 1YUHB 2ITDA 2P45B 3MOBL 3BPNB 3MRQA 3VXQB 3VCLB 1HYSD 3UTQA 2LAGB 1HHKB 4HJ0C 2VXTL 3AU1A 3KJ6H 4ODHH 3W9DA 2XZQH 2VWEE 4WW1B 3KXFD 1YC7A 5EU4B 3LQZB 1KGCD 2OP4H 4Z78A 4QRPD 4NRYA 3O2DL 4JZOB 2KZWA 5L2KD 2FSEB 5DYOB 3EHBC 4P5KA 3HE7B 1NUDA 5LQBL 1FYTE 5E1HB 4LLWB 1P7HL 1MCLA 3TJHD 3FOLA 3MRLB 2WP3T 3IS1X 1QSEB 1YNTA 2BSTB 2V9TA 2R2EA 3IETA 3P3YA 3LD8B 1RZKL 4M9OA 3PDOA 2Z93A 5IESH 2PXYC 3WN5C 4K8RD 3VFVB 2YUWA 2WAHA 3NZHL 1ADQA 2V7HB 1BVLB 3O2VH 2NZ9D 4JB9L 1FZKA 4LLMA 4Z7WA 4F57H 2AXHA 2DMKA 4F9PA 5DD1H 5CZVH 4O5LH 4NJ9H 1QLFA 1U92B 3FL7A 4I5BA 5DFWH 3MRNA 3GSNA 3O4LB 3TNNB 4PJGF 1R5IA 4M6NH 3U9PH 1JWMA 3SDAA 4P4RA 3SBWA 4DJMA 1W72H 3FQNB 2JJUA 5BQ7B 2V17L 3SPVB 5EULV 4K8RL 4LCIL 4XP5L 5E4EB 2EC9U 2ARJA 2OI9B 4OCXL 1R5WA 4OKDA 5DLML 1QO3A 1OW0C 3S7GA 1GXEA 1QNZL 4MJ5A 2VXSH 5ITBH 3HR6A 3ILQD 3LKNB 3FONB 3CDGB 2CUIA 4OCSH 1TZHA 1WITA 1MJ7H 5C0GA 5BRZB 2IBZY 3IVKA 4OZHB 4ZPVA 1UM5H 3U1SH 3W39B 1EHAA 3TNMA 3VD5A 5DUBA 3QR2A 4OI7A 1EJOL 5E2WH 3OKEA 1CDYA 1ZVSA 4L4VE 4NZRL 3MJ9L 5CUSH 1S3KH 1I7TB 4IBLT 4CBPA 1AGEB 1CU4H 5F89B 1OAQH 3ULVE 2E6QA 1KG0B 1U8PB 4Y16C 3LOWA 1XGTB 4UILL 1CXHA 1KOAA 4WHYG 5F9WC 5JXAH 2VLKB 1NGXA 1KYOJ 3EFFA 3P0GB 3WXWL 3F62A 1D9KC 5A2IH 5K9QG 1ZVHA 3MBEB 2F8VA 5AUMB 1EGJA 1RUAL 2NMSA 3SKNA 3TIDB 5J0BA 1G7JA 3VE0B 5TJWK 4MZ2A 3OR6A 3BPCA 1L4IA 3VXOA 3SKMB 4HC1A 3DUUB 1XCQB 5D8JH 3DJ9A 1FVDB 1XIWC 5DFVC 5F44A 5T1LA 1MQKH 1MWAH 3LZFH 2DOCA 3IAQA 3GJFH 3TO4A 3RWGA 1YNKL 4F7TB 1MCDA 4IRJC 3IFOA 4NUGL 3D3VA 4F7CB 5I1LA 3D9AH 3QUYC 4QHMA 1NBYA 4YZFF 2BSSB 1BOYA 4FZ8H 4CMMB 2MHAA 4Y19B 1A3RL 1P7QD 2DKUA 1BQHG 4LHUB 1TENA 2B20A 5GGVY 3TWCL 1FBIL 1QTYT 2DWDB 4Z7VA 1YYLH 1NFIA 3ZO0A 5IBTL 4O4YH 4LEXH 4F37F 3HE7D 5IUSA 2A9MH 3DPBA 4EQ3A 5KG9B 5D96B 1OP3K 4OGYH 3BISA 1MLBA 2BNRE 5E99H 4NKDA 3RVTC 5B3NA 3MA7A 4HZLA 4S0SD 2GAZA 5LGKA 5FGCE 5I8OH 1QSED 5GS1C 5JTWA 2G75A 4XNZB 3L5HA 4R9HA 1NAMB 2SEBB 2XY1A 2APFA 4P4KB 4QXTA 3A6CH 1ZHBB 2IADA 1B0RA 1AD9B 3LKSB 2ZUVA 4MAYC 3WFCL 3V4PH 3MLSL 4DN4L 1HH9A 2HFGL 2JB5H 3PP4L 5TDPA 3EJYC 1UACH 1Q72L 2UUDH 5GRWA 4J3TA 4S10A 1KJVB 4BM7A 3RUGF 4YHKH 4ELMB 3K3QA 4M00A 1MCWW 5TH2A 3D3VE 4YX2L 3Q2CA 4FABH 4XBPA 3KVQA 4ONFL 2DI9A 3C5ZC 3L3JB 4Z7VE 1F97A 5IFAH 3V0AC 3MJ7A 4N0FB 1KPRA 3U46B 3QHZL 4JFPA 1CQKA 3PNWA 3V5DB 5GJTL 4M5YL 2WBKA 1S78D 5DUPL 1XF5A 3BP4A 1RJLA 4GKNA 2X4UA 3GGWA 4LHQB 2EDBA 2W0KA 3I75B 2UVEA 4GOSA 1JHLH 4HUUA 2ED7A 2ZOKA 4OZIA 3VFTB 5E8NA 4M48H 5EZIH 1MI5B 2PTTA 3BZFB 1NBZA 1DL7H 3ZDXE 3H8NA 4ZUVB 3G08B 3LN4A 1NCDH 2X70A 4ZG1A 5TFSH 3JVGC 2AV1B 1U3ZA 1BVZA 2LU7A 2VLKD 4MAUH 5I19L 1J8HD 5IMLA 2J8HA 1B4JL 5JZ7D 2R1WB 3P30L 5C0ND 3SJVB 1QFWI 2BC4B 3B9KD 4HHAB 1WC7A 4OM1L 4FXKA 2Y06L 1WWWX 2O26U 1K3IA 3EKCA 4JFFD 3S88L 4MS8C 3CSYA 3BW9A 3O3BA 4JCMA 3STLA 4WI6A 1BBJA 1QOKA 4RZCA 4KUCF 5LJYH 1BJ8A 1RJYA 4LCCC 3A6OA 4HS3B 1WK0A 1SYSA 5ICXB 4Y4KA 2F74A 4DFIA 3WFDH 3BZEB 3VXMB 5CS7A 4Y19D 3BD5A 4JZJB 3D5OF 4LHUD 3K1KC 2IAMB 4QGTA 4QF1B 1UZ8A 4OZIE 3LEXA 4NN6B 4A6YL 5IB3B 4NZUH 1JYNA 4MWFA 4K3DL 5IQ9B 5GGQL 1NFDA 1A9EB 5KSVB 1J05B 2RFXB 3X14B 4NCDA 4CMHB 3BDYH 3DVNB 3VRJA 4Y5VA 2Q76B 4KZDL 2YPKA 1NDGB 4S1RH 3RVXD 4P4KD 1EFXA 2G5BA 4HS6B 4XCCL 2VDKH 2X4OB 3HNTH 4OZFH 2CDFB 4XI5D 4JJ5B 3QO0A 4HDIB 3PV6B 5I1EH 5IF0B 1X7QA 4LP5A 5C0FA 5HHOA 4WI3A 1HIMH 2W9EH 4I0PA 4CDHA 1SM3L 4XWGL 5HYJD 4QHLB 5IB5A 3FB7B 4NKOB 4ZS6D 3DI3B 4YBQC 4OI8A 4CU6A 2YK1L 5HYFA 3QNYA 5C08B 4WO4B 1IGML 3VI3F 4FA8A 3WCYA 1T1ZB 3QEQD 5C09B 5K9KB 3MCLH 2AI0H 1YJDL 1BQLL 3BEVA 3VG9C 3KPRA 5J11B 5EN2A 2WWKT 1LO3H 3KYOA 5GGTL 1YECH 3LKOB 3AFLA 4B0MM 1NFDE 1NMAH 3V4VL 3CK0H 4XC3L 4Q6YA 5T1DL 2CKBB 4PG2C 2D0HA 1KNOB 1X44A 4LFHG 1A6PA 2P44B 2WBJD 5TF1H 5EIIA 25C8L 4ZXBD 3L7EA 1R6VA 2NW3B 4H8WH 1MI5D 3QQ3B 1EK3A 4XVTL 3MNWA 3MRCA 3P2TA 3RJDA 1A6UL 3WS3A 3P4LA 5L7XH 4UV4L 1A7PL 4XNUL 5JORA 4MA3A 1GPOH 3OPZH 1A7RL 5D9SB 3TN0B 1KT2B 2FDBP 1YN6A 4GKOA 5HHOE 4XCEB 2HFEB 2WBWB 3UDWC 5IB4A 2PCPA 3FN9A 3BRDA 4JJHA 2PN5A 1AO7A 4LAJH 1K4DB 2B4CL 3M07A 3GNMH 1NGZA 1T83A 4NBXB 3SDXF 5ITFA 3X3FH 1YEIH 2BNUA 1IQWL 4HXBH 4TVPD 1JNHA 1NC4D 3OKNB 4Z0BH 1A0QL 3M8OL 1WZKA 1MVUB 4I4WA 3OKLB 2A6IB 2RGSA 2VZVA 2VTFA 3O6FC 4PV9A 5BO1H 4QYOA 4EI5C 3WHE1 3MRIA 4PY8J 1VKXA 3KPRE 3AM8C 2HT2C 2J88L 1IZKA 1MCEA 1DJSA 2ARWA 3ARBA 3DURB 1MCKA 4S1SH 2Q1EA 1FFPB 3VXMD 3G5YA 4TQEH 1OP3H 1BQUA 2R8SH 1EO8H 2IAMD 4DN3H 1N26A 1ND0A 3MRPB 2PF6A 1MREH 3KXFA 5EU3A 1NCWH 1KPUB 3LKPB 2IGFL 4QRPA 3IS0X 1DBBL 1WZ1L 4Q0XH 5C2UB 3MYJA 3SE8L 5L2KA 4G8FA 4QXGH 3IDXL 1U8OB 5IEHA 4KJYB 1WBYB 4YAQA 1R5VB 5DZNA 3VFRB 1RZ7H 5BS0B 2EZ0C 4X0KB 1IRAY 4XP6H 3LVEA 3HHRB 3U0TA 1YDPB 3L9RB 1HHHB 4HJGA 4LPUA 3O8XB 4V2BA 4JQIH 2R29L 1LD9A 4JFOB 1JL8A 4UIMA 3DV6A 3H3KA 3OG4B 5GRUH 5I1JH 3DYMA 4RAVA 1ZOXA 2I07B 3MLZL 4DQOH 4NQCE 4XXDB 5LGJA 2AJXH 4KWUA 4X5XA 4HV8A 2R56L 3B8SA 1H5BB 5E6IB 5KN5A 1TNNA 3B2UD 1N8ZA 1D5IL 3HMXH 4D0DB 1U8QB 5BJTA 5CJOL 3MGTA 3P4OB 5C0AE 3K46A 3HNVL 4HK3J 5C08D 3HMWL 4CVXB 4WO4D 4QRRD 1Q94B 2F53B 5D7KE 3HPJA 3ZDZE 3RWHA 5C09D 2BVOA 2OMBA 3TIEA 5LWYH 4N8VA 1SBSH 1JI1A 3G5VB 5F88A 3O2WH 3DROB 2ARJQ 1RD6A 4K71B 3KXFE 2MKLC 5A3IC 3MO1B 4X6FA 5L2KE 4BUGA 3QXAB 4CNIB 3AXLA 5HSFA 1M71A 3S3SA 4JFEB 4N90D 5HYIA 4X99B 1CCZA 3H7BB 1HQRA 1K8IB 1KTDA 2IH1B 4MXQD 4XPFL 4PGZA 2OM5A 3QPXL 3VFOB 4HUVB 1MNUL 3ROLB 3X13A 4PJDA 5BVJA 4D9LH 4R3SA 1PG7X 4HIIB 4U1JA 4NBZB 1CK0H 3UROR 1KUMA 3HE6C 1XF2B 5IIEB 3C6LD 4AQ1B 3S36H 1T03H 1VADA 4FQQB 1KB5A 5FB8B 1FGVH 2ADGB 5D2NA 1KSRA 5EZLB 1BQSA 3KYMB 5CINL 5JIHA 3S35H 5HYSB 2XG4A 4D2NA 4OQTA 4AYFA 3GSWB 2HKFL 5I2IA 1EAPB 1V7ML 3K81A 4G43B 3V4UH 3ABZA 1LO4L 3GMRB 3BRFA 1F3DH 4U0RC 1U8KA 2MJWA 4HF5L 1KELH 4RAHA 3STZA 4JREC 3GMQA 5GHWH 4M5ZL 2NXYB 1YUHA 2VOTA 1F4YL 1FQ9C 3RI5K 1CS6A 3AMLA 4FFYH 4PV8B 3VXQA 3VCLA 1DP0A 4F33B 2R4SH 1YMHB 3JZ7A 1HHKA 1HSAB 3NCBB 3OBAA 1GC1H 3RPKA 3ULUL 5IVXF 2DQEH 3LQMA 4NFCA 4NO3B 2FX8H 3PWUA 1P7QA 5ALCH 4WW1A 4YQXH 1DQML 5F6HJ 4JZOA 1IGJB 4HG4J 4UOW1 4P2CG 4PJDE 1IQDA 2FSEA 3VXTB 2WMPA 5DYOA 5HHXH 3HE7A 3WS6C 4ZD3H 2GTWB 5BS0D 3U30B 4FTVB 1NLBL 1FV1B 1IAKB 3LRSB 1GJIA 2Y07L 1FE8L 4LLWA 5ISZE 1INQA 2VLMD 5IROC 3ZKMD 1NGPH 5T3XH 3MRLA 4U31A 3N50A 1QSEA 4BA8A 2BSTA 4EVNB 4NQEB 5LBSH 4BUHA 4FQLH 5C2BH 4J8RB 4HPOL 5CIPH 1T5WB 1OTSD 3VFVA 3TA3B 1W0WB 4OF8A 5K9JL 1F90H 2XXMB 4KY1L 3MJGX 2V7HA 1BVLA 5TE6L 3DMMD 5E6ID 4GAFB 1HDMB 1U92A 2NY7H 2XTJB 4M7ZB 3O4LA 3TNNA 4JY5L 3QULB 2JJSC 5CD3B 1J0YA 4MQXD 4PD4K 1G7QB 4YHYB 4NOBA 5H37H 3FQNA 5BQ7A 5FYKD 1J1PH 2F53D 3I85A 3P40A 3SPVA 5F7EH 3C6SB 5CJQH 2E7LC 2UZYB 1FSKB 1H3TA 3FO0L 1CTNA 3HRPA 1BREA 3LKNA 4KMLB 4AG4L 3CDGA 5F71A 3S3PA 4XNXL 1OQOA 1UCBL 2VXVL 2ZCHL 4NWTL 1AE6H 4OZHA 4JFED 2NTSP 5FYKL 1N2RB 4OLXL 3BVNA 2VLLA 3UXFA 1FG2B 4Z77B 1FNSL 1L6ZA 3K8MA 4N8VG 5D1ZB 4WHYH 3D2UB 5ADPL 1I7TA 3X3GL 4WFHE 5J57B 1AGEA 2ED8A 3SDYL 5F89A 1XZ0A 4MXVE 1U8PA 4PR5B 1XGTA 4FG6C 3VXRD 4M6OH 1S7XB 1JYVA 1ZE3C 3FRUB 3G6AB 3CXDL 1R3IH 4EOWL 2D7PA 3DYPA 2VLKA 1E4XH 2VLJB 3GHBH 3O4LE 3HI5L 3NAAH 2MQ0A 4NSKA 4HAGA