1D9KD

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
188
structure length
188
Chain Sequence
b'GSERHFVHQFQPFCYFTNGTQRIRLVIRYIYNREEYVRFDSDVGEYRAVTELGRPDAEYWNKQYLERTRAELDTVCRHNYEKTETPTSLRRLEQPSVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
molecule tags Immune system
source organism Mus musculus
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
total genus 33
structure length 188
sequence length 188
chains with identical sequence H
ec nomenclature
pdb deposition date 1999-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d9kD01
1KTDB 4YQXL 1T7YA 3V4UL 2XRAL 3MJ9A 1BQSA 2EZ0C 5EO0B 1JZ4A 4GG8B 3NCYP 2WAHA 4PLOB 1IAOB 3S37X 4MA7H 5IKCB 3VW3H 3R8BB 4JFOA 3G08A 4R0LA 1HYSD 2DMKA 4JFEA 2LU7A 2HJFA 2BVTA 1YQVH 3U46A 2A38A 2BHYA 1PG7X 4NKIL 4H88L 1FORH 4ETYA 1ZEAL 4XNMB 5FHAL 5JR1L 1NLDL 1DLHB 1N6QL 4PJIA 1L7TH 4KK9D 4YC2C 3MRNB 4TSAH 3MNZB 5IP4A 2NY2B 1G7IA 3QO1A 3VFMB 2YPLD 3UZVB 1KXTB 4JDZA 5F7FA 1F4HA 4QXGL 3FL7A 1FRGH 4ZAKD 1DL7H 4WFGD 1L6XA 1XZ0A 4X4ME 3CZJA 4FQLH 1NJ9B 2D0GA 4I77L 3T4AB 2A74B 3H9SE 1ZXQA 2OSLB 1KTLB 1YNKH 1OCWL 4HKBA 4WNQA 1E28B 5KVEL 2IAMB 5GS1A 3O3AB 4WENB 1TVBA 1M7IB 4G6FD 5TFSL 1IM3B 3OX8A 1Q9WA 3LEYH 5J6HB 2CLVB 3IFLL 5IJKC 5MI0C 4PJ5A 5TFSH 5MHSE 4JPVH 3WNMA 1QBML 2V9QA 2EEDA 1FYHB 1QSFD 4KMLB 4PLKD 4G43A 1JRHL 5T1DL 1T03L 3GSUB 2CH8A 1YEIH 1CL7I 3ARFA 3KXFA 4G6AC 4JFYA 3BKML 1JWUA 1YNKL 3QWRD 5AEAA 1MCKA 3QG6A 5F3HA 4MNQE 4R4ND 4S0SD 1QFPA 1YC7A 4PJGA 2NNAA 3HE6B 4GW5A 2P5WB 1L9NA 4F8TA 1V3JA 2AERT 3BUTA 3R0NA 2YKLL 5C9KA 1KIUA 5JHDA 4E42B 1WBZA 2G9HA 1JF1B 5IR1A 4KRPD 4LU5L 5KVFL 2X1XR 3S5LB 3P30H 2OLDA 1MH5B 1XIWB 1IMHC 3MRJA 4YHOL 1CG9A 1Q94B 2A6DB 1AE6H 1MREH 1MCPL 1T1ZB 1S9KC 4PJ8A 5EZJA 3L3HB 2YC1B 1QBMH 3VXQA 3FO2A 4WHTA 3BZFA 4FRWA 4NZUL 3H9HB 3QNYB 3L3GB 2FWOA 5EIVA 3SHSA 4P2QA 3UPAA 3U7AA 1LMKA 4XT1C 1I3VA 3C5JB 2X4TA 3PV6A 3ULUD 1N26A 1PY9A 2VITB 5H94B 5F7KC 3MRHB 4I77H 4PGCA 3FO0L 5BMFH 4DVRL 3DO3A 4ZPVB 1FN4B 3FTGB 1MRDH 3GSXA 5GGQH 1MLCB 4XVJL 5KAQG 1NEUA 4JQIL 4NT6B 1IKNA 1P4LB 2V6HA 2VR5A 2YRZA 3L5JA 3WN5A 3T0EA 2CKBL 1IGIL 1EEZA 1ZT1B 3QDGB 2XWJA 4D9QD 1OTUC 4KI5F 2BXYA 2BJML 3TV3L 4FQCL 3HMWL 4NC1E 4OCSH 3S5LG 3SDAD 3OKNA 4TUKL 1NKOA 3VXNA 3FOMA 3MBEB 4RRPA 4KMQA 1OLLA 1IE5A 5I1KL 3GMRB 3TYFA 4NC1C 2E8ZA 2XKUA 4AT6B 4D0BA 1F58H 1XGYL 4K8RL 1S7RB 3DSNA 1MVUA 2Q8AH 2OK0L 3MV01 3VFRA 4HIJB 2P49B 5F7EL 1P5VA 2CQVA 4ZUVA 1Q8MA 2WM0A 2X1PA 2MFNA 5J3HC 2LABA 3FB7A 3UO1H 4Z9KB 4L4VA 1AO7E 1VA9A 1FQ9C 4XZUB 3IXAB 3QFJB 3IDGB 5IW6A 2VSDA 1FPTH 3QUXB 3QISA 3E6FA 4I5BB 3EYUL 2O5ZH 3PWVA 1NBYB 1TNNA 5I73B 2UV3A 5IK3A 2ZG2A 2DL2A 5JPMA 2QQLH 4QRRA 4QNPE 1ZT7B 2VAAA 3IDYC 1IC7L 5ERWB 3MBEC 3N50A 2R39A 1XGRA 3KPOA 3H9SB 3NIDF 1YEHL 1D7FA 4PRBB 3PDDA 1MREL 5A16B 1UH2A 2Z4QA 4NOBA 4Y5XB 5EOTA 5CINH 5ID0B 4PB0L 2NNAB 1T2QL 1U8QB 1Q72L 2HT3C 3HRPA 2MQ3A 2N4IA 5FKPB 1FBIL 3QEQB 4Z8FH 3LAFA 4WTXA 5J1AA 3KLAA 4XMLH 3ZKSD 2F5AH 2NX5D 2QHRL 1BBDL 5I1DA 4CL7A 4LSTH 3BKJL 5ACZA 4PJ5B 3CDGA 2MSPA 2HA1A 1Q1JH 1JRHH 1E4XH 4POUB 5DD1L 3MYZA 4F7EB 2H26B 4LLVA 5KVGL 3EOBA 1CLOH 2J88H 4NQDB 2AKRA 3UDWA 2I5YL 2HVJA 1QKZH 2Q76A 4WU7B 2IBZX 4WY7L 5T33H 4OD1H 1OSPH 1KPRA 4KUZH 3X13A 5I1GL 4X83A 2VXQH 2AXJA 5I1AB 5JIIA 2Y6SD 1J1XL 4E42A 4ZFGL 5C3LD 4GRLB 1QO3B 2VLKD 5DGRA 4XPGL 4P23D 3P0VL 5ANME 4R4FH 3AU1B 3CFEA 4M6AA 3TZVA 1YN7A 1ZGLM 4J3SA 2ZOLB 3O3BB 3ETBF 3SE8H 3MNZA 4JDVB 4L3EA 5GJTL 3GJEA 3JWDH 4K07A 4LCYA 4S11A 5C0FB 1B2WH 3QUXC 4AEIL 2CSPA 2Z0BA 4ODUB 2MMXA 5IMMB 5JXAL 5FGRA 3MRQA 4XP4L 3T1FB 2PXYB 4XXCA 5ITBL 7FABH 5D7IE 2ZCKH 1A7RL 4LLQB 3RVUC 3ZTJH 1TCMA 3GNMH 1UKQA 3TESA 3BPCA 3O3AA 2VNCA 4KXZI 4Y1AA 3DX7B 2ZOKA 5DJZA 4CN6A 2HJLA 3MUJA 1FZJA 3ARGB 4HULB 5JXAH 1OAXL 1SYSB 2CK0L 2QKIB 1TCRA 1V7MH 3EDKA 1F4XL 1KNOB 2IH1B 2RQ8A 4XPBH 2Q87A 4HJGA 1LO0L 1UM6L 1PEZA 1AKJB 1EEQA 2V17L 1GHFH 1N8ZB 4NHCL 5T1LA 4PREA 1G7JB 4H1LH 3GK8L 1HIML 2P4AB 5IHLB 4IJ3B 4JREB 4QWWC 2CKNA 3D85A 4FZEH 3FO0H 3P73A 3EO9H 1N0LA 3CNKA 3FQRB 2R29L 3MRIA 2GY7B 2NY5H 4CUCA 1T4KA 5C09E 1CDCA 4Z0BH 5ETUA 3OF6D 5IFAL 4DCQB 3EDFA 3QJHB 3ORJA 5MI0B 5DQJA 4HIHB 2W07A 3IFOA 3M8OH 4P5KB 4U1GC 4LCIL 3SO3C 2DTML 2LQRA 2NY6D 5EZLA 4HPOL 5IVXA 4B53A 4LHUA 4D94A 3WN5B 2GEEA 3DROA 1FG2B 3D25B 5GRWA 2XZCH 3MRJB 1GGYA 3K1DA 1A6WH 5C07E 2ZJSH 5EUOA 1S9YA 1FL3B 4LSUL 3ZMRA 5J0BA 2FD6H 4HZAA 3TT1H 4HUVB 2DWDB 2EDRA 4PJAB 5IB5A 1MWAL 1P4BH 2GTWB 3U2SA 2G9HB 5DFWH 3BE1H 3NH7L 5CGMA 2DB8A 1J87A 5ALBH 3NFSL 1CD9B 4F7TA 2WINA 5DFVD 3FQUA 3VFOB 1J9CT 5C8JB 1H3UA 1F3DJ 4KQ4L 1YDPA 4E0RA 2LTQB 1BZ7A 2XPGA 1R5IB 4UAOB 4J3OC 4UNVA 7CGTA 1MY7A 1NCBH 3W9DB 3FB7B 3HE6D 4HC1H 5FGSA 1ZGLA 2GFBB 3VDBA 5EC1A 4O2EB 4X99B 1HHJB 3HZVB 1N6UA 3ZL4L 4GG6B 4XVTH 5HHMB 3VXTB 4BJLA 1MWAA 5ITFA 5BV7B 2EO9A 3DUHA 1C8PA 4PJ5E 1AD0A 4PJDB 1IGCL 5JPMB 1EHLH 5D7IA 1O0VA 1WAAF 4Z0XB 1CZ8L 1OT1A 1T0MA 5FGCB 1XR8A 4PJEA 3ZSSA 4NZTH 1AP2A 1WITA 3QBTB 1MRCL 2P5EB 3QUZA 3VXUA 4N0FA 4M00A 3U9UA 2WBJB 3N9GL 3VJ6B 1DZBA 2AV7B 4U0RC 3IDNB 1S7TB 3GSQA 4WI6A 2Q7YB 3RWCB 5GXBB 1H9VA 4LF3B 2RR3A 2PXYC 4RAVA 4ZUUA 1XIWD 5DJYA 1LEIA 3L3KB 4KROB 1NC2B 1OSZA 4RA3A 3G6JF 4LVEA 5C71A 3DO7B 1N59A 4HUMB 2L4OA 4HLZG 3PHQB 4NZRH 3VXOA 1CLCA 5AWNH 4YX2L 1C5CH 1U3ZA 5TDOB 2C3VA 5DJ2B 2COQA 1DEDA 1FDLL 4OKVB 2G2RB 4NRYB 3C5SB 3AROA 4PJDF 1CIDA 2K7QA 2GK0B 4ZSOA 5KSAC 4YWGL 4R4BA 2GUOA 4AENB 5FYKL 3BZFB 1PLGH 5AUMB 2CUIA 5J13B 4D8PA 5CLTA 1MF2H 3TBWB 1ORSA 1OSPL 5T5FL 3TH3T 1I1AB 2BCKB 3RGVB 3DGGB 5T33L 1M7XA 4X98A 1UYWH 5LGHH 1KCSH 2ADIA 1B88A 1C5DA 1WLHA 2MNUA 5IB1A 1RZKH 5AYQA 1HXYB 1EK3A 5CFHA 4RBPH 2YD5A 4U2ZA 2PCPA 3DTXB 5ACMA 5C2BL 3F58H 4LPWA 3TZVB 4HJ0D 4PJIF 4EN3C 5C9JA 3LMJH 5F8QC 2X4SB 4FQ2H 3HFML 4ZAKB 4O2FA 3T0EC 2I9TB 4YPGB 4OCNC 3L3DA 3NFSH 2O5YH 2VLLA 3TA3D 3EZJB 3BE1L 3BPOC 3VG9B 1OVZA 4Z77B 2UVEA 3FFCE 5EBWA 3OAZK 1NGZB 4L8DB 5LQBH 4DGIL 4OD3L 4Z7QE 2I27N 4HK0B 2HWZH 5INDA 3DSFL 4BSJA 5C6WH 2Q76B 3JV5A 2AXFA 2VOTA 4M6NH 5A3IC 3WMSA 5J9PB 2XXMB 3ULSB 4YGAB 3HAEG 3VD4A 3VGAC 2BOBB 4DCQA 5DD3H 3IVKA 2YPKB 1FVEA 1F3RB 5EG6C 5E4IA 2Z92A 4A2MA 1UQSB 3C08H 1U8NB 2VDPH 5D2NA 5T1DH 3PP3H 1H0DA 2FJHA 2A9NH 5EIIA 1BFVL 4IMLA 2YN5A 5KZCB 3OJVC 4LMQI 3MV7A 3W39A 4F7CA 3MLTB 3C2AL 1RZGB 2RGSA 2W0FA 4FZEL 4LQFL 3SGJA 1R3JB 1O5DT 4FFYL 2IPTH 4E5XB 4JM2B 4QHUB 1PAMA 1EH9A 2P1YA 4P2RB 3G5ZA 4HQQH 1PQZA 4X4XB 4XWGH 3BXNB 2FIKB 1CDUA 1AY1L 5CP7A 1S7QB 1W0VA 3RUGF 3VI3E 4YHKH 1JWMA 4L8BA 1YNTA 3RDTB 1PDKA 2H2SC 1NCWH 3C6LB 4IDJL 4PRBA 1F6AB 2QKIA 4LIQH 4JHAL 4NKMB 3DI3B 5D93C 1CBVL 2JJVA 3WKNA 4KPHH 4NJ9L 4RFEA 2Z31D 4M4PA 5AYUL 4YBLC 1K2DA 1TZGH 4G5ZH 1BQLL 3GNML 4U05A 3BKCH 3HMWH 4WU5B 3MV7E 3OR6A 4M1GH 4HIEA 1UM4L 4JM4H 4M62L 5GRVL 4PJ9D 1GGBL 3VXSE 5E5MB 2LAGB 3ALXA 2MJWA 1G9MC 1TMCB 2ITDB 1DUYA 1RK1A 2ZCHH 4PJIB 4LGPB 3D85B 4OZHA 4MXQC 1I9RL 5KW9H 2YUXA 3KXFE 4B50A 4H20H 1SBBA 5T3ZL 4OZIB 1CTOA 2I24N 2FR4A 2P8LA 3ALPA 2YEZB 4F57L 3BFOA 2ZUQC 1LEIB 3QHZL 4DZBA 1FZMB 4KRMB 3QULB 4NN7C 4QRSB 4PRDA 5B4MC 5AG8A 1INDH 1H3PH 4X7EC 3X13B 2FO4A 3CCHA 3ME0A 4R97C 3WYRA 1G9NL 4DKAA 1IGYA 3RTQB 2FX8H 1HHKB 4ZS6D 2DMBA 3ULVH 1T20B 4LDOB 5CD5D 2NR6D 4KMTH 4XVTL 1K4DB 1QYGL 3EYSL 4DN4L 1FIEA 3SOBL 1IEBB 4M7ZB 3BH8A 3C5SA 1EFXB 5MHSD 1P9MC 2HFFB 2W65A 4BUHA 2ZOLA 4GXUM 3SO5A 3JWDC 1TZIB 4JY5L 4YHIA 4PLNC 1Y6NR 4P3CL 2FRGP 3S36X 5HI5D 1U8HB 4J8RB 2RIKA 4F7TB 2QHRH 1JGLL 1YMHB 3BHBA 3G6JB 2PTTA 3QFJD 4YO0B 1BZ7B 4BQCA 2MCG1 3LDBC 3V6OE 3D2UA 1DN0B 1QLEH 2DWDA 4EIGB 1L7IH 1HCFX 3AUVA 5IQ7H 5B39B 5C0BA 1OY3B 1S5IH 3TBVB 1CD0A 5EOCJ 1KFAL 3CZFB 2X4QA 4L8CA 3EJYD 2I25N 1XR8B 3WFDL 1DQQA 3E6HB 3RJDA 4EDWH 3U79A 4F9LC 4NZJA 4YE4H 3IDJA 1XF2B 2AXGB 3RU8L 5I76B 4YDLC 5I6XB 3HAEA 4GT7A 3VGBA 1KYOJ 4YPGA 3B2VH 4JO3H 4LHUB 4M5YL 5GRJL 1OB1B 4Z5RA 4BH7B 1MAMH 4MQXD 1T21B 4JKPL 4JANA 4NKOA 3FT2B 2GJ6B 3EO0A 1KB5H 1NDMA 5J57B 2Z8WC 2EEAA 3WS6C 1E4WL 4CNIB 2DIAA 4L4JA 4G7YL 3TIDA 5L6YL 3WL9B 3WJJC 1A7NL 3DIFB 1XMWA 5DZNA 3B43A 3KYKL 3SBWC 4IRJB 2QTEA 4L9DA 2YA1A 3QZWB 4PLKC 2IWGA 4XPAH 5DHVB 3PV7A 2JJUA 3TA3A 4YHPB 4LCWD 4PBXA 1NMBH 4EI5D 3T0EB 5FOBB 4FQXB 3W81A 2EDJA 3NCFB 4EI5C 4FQCH 4N8PA 2FEEL 2YMXL 4OCSL 5D7JA 4OKVA 5IGXH 4D3CH 3RJQB 1SBSH 5HDQH 4NN5B 5KTEL 3BGAA 5CD5C 4JZJC 2GTZA 5DJ0B 1IGML 43CAB 3NCBB 3J8F7 2P5WE 2DF3A 3QFDB 4RNRB 5C0GA 2Y72A 3PWPD 4XP5L 5SWSD 3PV6B 1MVUB 3RKDD 4WO4C 3ROLB 3VWKC 4IRSC 3U4AA 2DQIL 4FMFA 5BZDA 3K2UL 1ND0B 1AIFA 1YJDH 4JZNA 4KHXL 5HTSA 1ES0B 2O5XH 2JB6A 4P2OD 3I2CH 3K2MC 3P40A 4JLRA 3DECA 1YYLL 1FLRH 3NIFE 3A6BH 5CS7A 4TN9A 1MJJB 4P5TA 4AG4L 3UPCA 5HYIA 1V8HA 1RZ7L 4OZIE 4P4KA 4NZUH 1KYOK 4WI9A 5K33A 1MHCA 4QRTA 5I16B 5C08D 4XGZB 1I9RH 3KPSB 5KW9L 5JW3H 1F8TH 3P4NB 2QSCL 3OKNB 4WFFD 1YNTB 3RDTA 3WNLA 1YEFL 5KVGH 4OI7A 4PLJC 4TUOA 1ZT4B 1A0QL 3C6LC 5ADPL 1LK3H 1E4XL 4QRUB 4WTWA 3RWGB 1TZHA 4YHOH 5DUBB 2LTQC 5HI5C 1QSED 2Z31C 3CXHJ 4MQ7B 2D0HA 2IAMD 4GG8A 3OB8A 1OM3L 1OGAE 1C08A 4HJJL 3LD8C 3UBXB 3JV4A 5IG7A 5FYLH 3QDHA 4IMLB 4B0MM 3BPNC 5BVJB 2K1MA 4ENED 3GFUA 5MEND 3UJJL 3RL2B 1I75A 1YYML 1N6VA 3QG6B 4K55A 3D3VE 1KB5B 3NIGE 1WWAX 3UMTA 3CFCH 5IBLD 3HE7C 1MIMH 2FWOB 5M94B 3NCYS 4TRPL 1JPSH 2AEPL 1TZIA 5DEZA 1Q9LA 1DVFD 1FYTA 4K3JL 1I1CA 5IB2A 5JQ6H 4JPVL 5I76A 2J8UB 1XF3A 3C6LA 1FZOA 3NIDE 1DSFH 3GEWB 3RVXD 5IJVA 1IAKB 3UTSE 3WDJA 3MRKA 4PFEA 4KWUA 4I2XE 5CP7B 5C0JA 1KUMA 5CJQL 2YUVA 1FNHA 2PYEB 2ZUUA 4O4YH 1Q94A 3WXWH 4KJWD 35C8H 3C6SA 4P99A 4MVBC 1NJ9A 4JFHE 1NDGB 5D96C 2BVQA 3EOBB 4Z7WF 1INQB 5IEKA 3F6LA 3DX9B 3GSNL 1JMXA 3GKZA 1OD9A 3LHPL 2ATPA 3QFJE 4C59B 4OF8A 5DD3L 1OOAA 3GSRA 3T09A 1ZK9A 5L2KE 5KANI 1X5ZA 4I5BA 4DEPB 1QUNA 2C1PA 2E3VA 2YPKA 1UXWB 1JNLH 4H8WL 3VDAA 2BVYA 1XH3A 1DUYB 1RK1B 3MV8D 2DM7A 3O6LH 3TN0A 5IBTH 3WO4B 1IJ9A 4WW2B 5E8EB 4A6YL 3REWB 1F02I 5D7JC 3KPOB 3SE9L 3R06B 2WP3T 1S78D 1HH6A 1FH5L 1L9MA 4U7MA 1DQJA 5SX5H 1HOCB 3D2UD 4Y16D 4QRSA 5FM5M 4GO6B 1G0DA 4YUEH 5JW4R 2CLZB 2D7MA 5J89A 2OI9C 3CCHB 2PXYA 3ZT5A 5FO8B 3FOMB 3IJHA 5H8DA 3ZDXF 3CSYB 2Z91A 5BW7A 5F1SA 3N0PB 2BNUB 2FBOJ 2FNBA 5F1KC 4PJEF 1OAUH 4X7DC 4OGYL 2DYPB 4HKXA 4KDTA 4LVOC 5TDNB 2P24A 3IXTB 5AAMA 5DVKA 5JDSB 2DWEB 3RY5A 2IBZY 1GGUA 5DDHA 3VXME 2FJGB 4JDVA 3NPSB 5EULV 2BVUA 4OGXL 3VRJB 4U1JB 3X3FH 1KJ3H 4PJ7F 1A1NB 4J6RH 2QJDA 3MV7D 3BJLA 1W0WA 1WF5A 3CC5B 1B90A 5D6CB 1MFDL 1NGWB 4JPKL 4HWEL 4AEEA 5FCUH 3MUZ1 2PO6C 1H3GA 2QSTA 3D39A 4M6OH 5EFIB 5E1AA 2J3SA 3WIHH 1GGIL 4IMKC 1X5HA 3V4PL 3OQ3B 1UJ3C 5DFVC 4E41D 1I7TB 4HWNA 4NP4L 4TULH 3L6FB 3F7VB 5E7FA 4G42B 5CSBA 5D4QA 4X6CB 1IEHA 5E5UB 2VN7A 4M7LT 5CJOH 3FMGH 3KDMB 1QNZH 4M4RA 2VZSA 1NANH 3SQOH 3NOIA 5C1MB 4G80B 4ZO6A 3MRBB 2HMID 4HPYL 3KLAB 1JMZA 3DHMA 5F70A 4LNRA 3BSZL 2G5RA 1FCGA 3HCVA 4HAGA 2M8XA 2DLFL 3PL6B 3S37H 3UZEA 1RIUL 4M1DH 2VRAA 1J0JA 4N68A 4FFVC 2WANA 3B9DA 4LLUB 5EU6D 5I66B 1HE7A 4AM0A 2N7BA 3MUGA 5GGVH 3I50H 1A3LL 2ED9A 3QUYA 2MOVA 3ARDD 1VADA 1ZHBB 4WUKH 1HKLL 1UZ8A 3HI1A 4WWKD 4NM8H 1LDPH 4PB9L 5EU3B 4ZTOH 5BW7C 1I8MB 1DEEA 4M9OA 4ZFOB 1BAFH 2OR9L 1FO0B 4WW2C 5C09B 2VXSH 3F12B 1X5LA 3C9NA 1FNSH 2VLMD 5EBMB 4JFQB 4KKBC 2VIRB 5DGQA 4HXBH 4OQTL 4LAQL 4X6DA 3VCLB 5FM8A 4JFFB 3EOAA 1FLTX 3ELAT 3GO1H 2VC2L 1BOGA 1BD2B 3U83A 1NLDH 2BSTA 5BV7L 4F8QA 5D5MB 3GMLA 1OSZB 1ZA6B 5JUEL 2AABL 4U1HA 4QXTB 4ZXBB 1E4JA 1MQ8A 5DJYB 3D9AH 1SYVA 3SGKC 4G7VL 5GGUB 5I8KH 4PY8I 3S3SA 4YBQC 3T8XA 4Z76A 4G9FA 3BOVA 3FRPG 5IBUB 5DEGA 1FZJB 4DKEH 4Z7OF 1N3NB 5K9JL 4NQED 5EOQH 2ZUWA 1R5WB 3WHE0 1SYSA 5IQ7L 3DV4B 3G04A 4PG2C 4RGNE 2JB6B 5DA0B 1QNZL 2EIBA 2HG5B 4HIXH 5I8CA 1IT9L 4RGNC 4HLJA 5HDBE 3TN0B 3I6GB 4Q6IA 5GZND 1AC6A 1H3XA 4KVNH 5SWQA 4XPBL 4R26L 5HGAB 3CJJA 1NGXA 4LSSL 3L3KA 1RUMH 3C60B 1P7QA 3FRPA 4BFGA 3CH8A 5E2WH 3ISWA 4KVNL 1AFVH 2IGFH 5DMYA 1ETZB 5BOPA 2YPLA 3QQ9D 4KKBD 4URTB 3AU1A 1I1AC 3RGVC 5KJRL 4UOW1 3VFGL 3ARGA 5CGYD 5DD0L 1W72A 4LSRH 3WD5H 2W0PA 5D9SB 3O3DB 5DK3A 4UILL 5EC2A 4OGXH 4UUJB 3TJHD 5EN2A 3GBMH 3HC3L 4POZD 2ZSWB 1HHIA 3QEUA 4LBEB 3QQ4B 1BECA 5EBWB 2K3TA 2QADD 5I1HL 3DURB 6FABH 5J56B 3HC4L 2E9WA 3WE6B 2R2BA 5TDPA 4XBEL 4P5TD 3VG0H 1H15B 2J8UA 3RGHA 1FP5A 5HVFB 1RUAH 4XPTH 2WINB 3OKDB 3LS5L 1M4KA 2XV6B 4XMPH 5GS0C 2X40A 5HGBB 1U2CA 2ARWA 3FCTA 1RJLA 4HKJA 4Y2DA 4LSDA 1SJVA 2WUBH 5FYJD 3OXSA 3VGFA 1U93B 3Q5YA 3CLEL 1WJ3A 5CJBA 1CQKA 2VABA 3L6FA 3PXJA 1G7JA 4O02H 5EUOB 4ZTPH 4QYOA 2M2DA 1RUKH 1R3IH 1RSFA 3VRIB 3FRUB 3V0WH 2B2XL 4RRPG 1RIVL 3BT2L 1Q0XH 1PVHA 3QG7L 5T1LD 3VXUD 2JF1A 5E1AB 1TZHB 4UU9A 4DUVA 5EUKA 3T3PF 1J18A 1UGNA 2G60H 1R3LB 3CK0L 1F2QA 1N0XH 3ARBD 4XC1L 4KK8C 3LS5H 5I17B 1U3HC 5I73C 2G5BB 4R2GC 1UVQB 1GZQB 3QPXH 3UP1A 4XNQB 4O2FB 1GJIA 3NIGF 4K71C 2A73A 1YEHH 1BFOA 2HTLD 3VXMD 5H2BB 3RHWF 4OJFH 4Z95H 1NUGA 5JDSA 5H35B 1EFQA 4Q0XH 2VL5A 3BAEL 3MLRL 2V2XB 5DRZB 1J5OL 3WLBB 4OCRH 1A9EA 2AK4A 2DQTL 4HG4J 1MNUH 1V3MA 4F7PA 2E5EA 4PBWD 2X9XA 4ZFOA 2VXVL 3HN3A 1BIIB 4KJYB 3SGDI 4LRNL 1HHGA 2FBJH 4KY1L 5GGRB 3O2VL 1SMAA 1CXFA 2FH8A 3RWFB 3P9LB 3VFNB 3VD7A 3R1GL 2P5EE 3GSVA 4EN3D 4CADA 5FUCC 3GMLB 1ZVSA 3QWQB 1JL8A 5GRUL 3WLWC 2VZ3A 2H9GB 4GSDL 3B3IA 2H41A 1H8OA 4IRJC 4G6ML 5C86A 2WUCH 4FG6D 3ZYIA 5SX5K 2Z35B 3VXOB 1FV1B 2C1PB 3ZO0A 2C4FU 3KPLA 1JZ6A 3HB3C 4M5ZH 5ANMA 1X5AA 3SKNA 3DUSB 3NCMA 3KWWB 1ZLVK 4WW1A 4EIZC 3TCLA 4OZGE 3V0VA 5JOPD 5JNYA 3N1GC 5IIEB 2HG5A 3KHQA 3C5JA 4XAKD 3SDCA 1EERB 2WBJA 1ZV5A 1AQKH 1B0GA 1I7RB 1NFIB 3IDNA 3CXDL 5FYKH 4GKZA 5FXCH 3H9HA 3QNYA 1MRDL 2WBWB 4RWYH 1P1ZA 2BY2A 1ADQA 4DAGH 4HSQA 4HK0A 4X9FA 4Y0GA 5A16A 3ARFC 5C0RH 1NGZA 5BO1H 2LAAA 3SE9H 5HD8D 4WCYH 5FGBA 4IHOB 4Z7UA 4NNYB 1FN4A 3OR7B 2XY2A 4ZSOE 4H0HB 4XXDA 3W82A 4XC1H 1PY4A 1RI8A 1RK0B 4QCIB 2QQKL 1FFPA 1DBBL 1R3HA 3ZE0F 3LDBB 1LDPL 4YHIB 5I30L 4LP4A 2A1WH 3G5YA 3GSUA 5TDPB 1KJ2B 3EFFA 4WEMB 1UZ8B 5J11C 2AJSL 3AREB 3QNXA 5HYSA 3VXQB 1KC5L 1I9JL 3KYMB 35C8L 5D7LE 2F54A 5IFHH 5DWUH 1C5BL 1N2RA 2MTPA 3CFBA 1U8KA 4IOFC 3OAUL 1QLFA 4PV9B 4RMQA 2OJZH 4HS3B 4DKFL 4GQPH 3TNNB 4HF5L 4CKVX 2OSLA 5E8DH 5J7CC 3KJ4C 3JV6A 3QUXA 3RIFF 1TQBB 4OZ4A 5GS2H 2R15A 1GXEA 4JKLA 5KSBA 2IALB 1HYSC 1OTSD 1MCBA 5E5MA 5L2KA 1OAZH 2OP4L 2ESVB 4P2RE 4PUBH 4PJBE 2CLVA 3H0TB 4FQJL 4JO1H 2DBJA 1NC4B 3I3EA 2J4WH 2NY6C 3QFDA 1T7WA 1TVHB 5C07A 1CICC 2X4UA 1IAII 5E9DD 4NWUL 4P5MA 3V6BR 1CYGA 4LKXA 4PP1C 5D2NE 3SGJC 2C4XA 2Y25A 4OFIA 1CDJA 1MHPL 1CLZH 2W9DL 5ELIA 1X3DA 4IOIB 3P11H 4MB5A 4U6TA 2EDOA 4WFEE 4KZDL 1QFUH 2W38A 1FFOA 3G9AB 3KXFD 1T04A 3LCYA 3CFJB 1OF2A 1AGBB 2RFXB 3S7GA 3VXSB 1FNLA 3WDHA 1K8IA 4KHXH 2FSEB 2GHWB 2DS4A 1EAJA 4UTBL 3SN6N 2FDBP 4K8RC 1MJUH 1FFNB 4X7TB 4R7DB 3AY4C 4OM0L 3BDXA 4U1NA 3L7EB 4G9FD 1CE6B 1S3KH 2Q86A 3Q6FA 1JHTB 5LGJB 1Y0LA 4DFHA 4KGLA 1YN7B 1YEJH 4MLSA 1U8JA 1S3KL 3JV4B 5I71B 1JPGB 4NQSB 5BJTB 2RB8A 5DEFB 1EO5A 2P7TA 4BA8A 3F7QA 2XWTA 1NMCB 4WWID 2X44D 3OTTA 3JTTA 4PTTA 1F00I 3H3PH 3HPLA 4DW2H 1EEUA 5BRZA 4OLVH 3TBVA 3JTSA 3MZGB 1WC7A 8FABA 1J10A 3B4NA 5DZLA 5C0CE 5L8JB 4P4KC 1JZ2A 5E95B 4LAQH 4NQEA 1FYTB 3QI9B 1CGWA 5J11B 4M62H 3SDCB 1Y18B 2JELH 4GRWE 5EO9A 2VXSL 3LY6A 1NFIA 1W2KT 1I3GL 4I3SL 4ETQB 1FZKA 4YXLL 4ZXBC 5D7SL 5D93B 2PTTB 5GJSL 4MNGB 4JFDB 4LDLB 4JHAH 5BVJA 2PTVA 3RAJH 2NY4D 2EYRB 3NAAL 4F7MA 2NY7H 1QPXA 3CX5K 4PRAA 4YHKL 3EDEA 4D9QE 1I1YA 4PJGE 3PDOA 2VDNH 1G7PB 2BY3A 1LP9A 5JOFB 3IU4L 4YFLF 1DSFL 3K0WA 3AB0B 3BH8B 3WXVL 1HXMB 3AFLA 3MV9A 3E2HC 4U1IA 3HR5B 4FP8L 4MQ7A 4QRUA 4EI5A 2BVPA 2HKFH 2PW1B 1HHIB 4EQ3A 1PKOA 1ZVSB 4ERSL 5DFTA 3NCJL 1A6VL 3OGOE 1QRND 4LPUA 5DVLA 3O2DA 2RCSH 5FK9A 3EYOA 1HH9A 4GAYA 1HOCA 2VJXA 3CK0H 4F7PB 4OFDA 2BRRH 3PHSA 4R97B 3HC0A 4X7SL 4KJYA 4XI5D 3IU4H 2IJ0C 3IFPA 2VDNL 2IH3B 1KB9J 4P57B 3QXTA 4U4BA 5C07B 3QXUA 4P2QE 4CDHA 1HWHB 2HKHH 4ZPTB 5DJ2A 1I9JH 1RU9L 4XMKH 4PJAE 1AGDB 4LAJH 1MI5E 5ILTH 3P0YH 4MD5B 1ZAGA 1R0AL 2YZ8A 3HZMB 4I3SH 3NN8A 4Z5RB 1CDGA 2NQCA 3N85H 4QRRE 4HV8B 5E2UH 4QEGA 4R7NB 5I30H 1D6EB 1JV5A 3RUGB 5FDWB 2EH8L 4U3CA 5GSRA 1TJIH 3GIZH 4OZ4B 5CEYA 4QRTB 5EUKB 1S78C 3HMXH 3UTTB 1P84J 3DYMA 5KVMC 3GMQB 3QUKB 5HGDB 4LLAA 5DK2A 4E41A 2UVFA 5DK0A 4PGZA 3MOAH 3O4LA 1H8NA 25C8H 1WZ1L 3WUWG 2H26A 2CDFB 3GBNL 2HRPL 4PJ9A 4CU8A 4HJ0C 2AKRB 4ZYKA 4UQ2B 4XNUL 4PJDE 1DBJL 2AJUH 3ROLA 1VEOA 2P8PB 4FTVA 1IQDB 4NO3A 3D48R 5IHZA 1XH3B 1JGVH 5FGCE 2R4SH 3CFEB 4EVNB 4LP5A 1G7QB 2AV1A 5IGXL 2X42A 1CD8A 5LXGH 4W81A 1MFEL 2XN9B 1JHLH 4ODTH 4HK3N 3OL2A 4BQ9A 1XF5A 4K8RH 1IC5L 3B5GA 4DVBB 1HQ4B 5D7JB 3OG4B 2IGFL 2Y5EA 3LN4B 3VXRA 4HHAB 5K9KB 3KPSE 2R0KH 4PRIB 3WDIA 4HKZA 5DTFB 4Z78B 3MUHL 2ITCB 2V9RA 5DI8A 4AY0A 4OBSA 1TNMA 4G8IB 4X8JB 1GC1C 4PLJD 4PRNB 5C0CA 3JWOH 2FATH 2XZQL 1NGQL 5D70L 3DROB 5DUBA 3GMPB 1XF3B 5F7HA 1KIQA 1VENA 4J3UA 3F5WB 2AK4E 4LK4A 1UG9A 1IAKA 4CMMA 4LLUA 1A5FL 3U4BL 4XWGL 3UPRB 1NFDA 1DANU 3DMMB 3V5KA 1A14L 5E4EC 5E2JA 5T3XE 4N9GA 4KTDL 3D25A 3BW9A 4R9HA 1I1FB 1U8JB 4XVSH 2OZ4H 1QRKA 4BQBA 4WJ5A 2LVCA 2IQ9L 2W9LA 4S2SB 4WW1B 4FQQB 1DN2A 4Z7VF 5F7YC 3OKEA 1RJYB 1MNUL 3VWKB 1GSMA 4Y5YC 1BX2A 3GIVA 3QXAB 2F9BT 5CJQH 2E7LC 5F1NA 3QP3A 3EYVA 4L29A 4LFHG 1MQKL 2IANB 3OKMB 3QRGL 3MO1B 4Y4FD 1OWRM 4JPWL 2IFFH 3TBWA 3ZT7A 1TQBC 2NY7L 4KJQD 2XACC 3RAJL 3MA7A 1D6VH 4GAFB 1NCBL 4FQHA 4C83B 1VEMA 4MCYB 1JHKL 2OR9H 5K9QI 4PY7B 4NRXA 4KU1A 4JFXA 4M8QB 1U8IA 5I1EH 1TITA 4WO4B 4UBDD 5ALBL 2JELL 2UY6A 4UT9L 4BFIA 3FFCB 4ZUWB 3MV9B 4OSUL 1BWMA 1D9KB 4P5MB 3OJMB 4JGJA 1AGCB 1NBZA 3P9WB 4GAGH 2VXUH 4M61B 5IESH 4ODHH 4C56D 4LLDB 1RULL 1A6WL 1ZHLA 1NCAL 3EBAA 3BJ91 1I8LC 3VCLA 1I4FA 4LDEB 4QOKB 4PRPB 1CFTB 4JFDA 3TPUB 4GRWF 5I75C 1YPZE 2Q8BL 1DQDH 4EKXA 4LCIH 5JO5A 4GW1B 5DC9B 1LQSR 2APFA 5D71H 5HHOA 2V5YA 4LEXL 3HI1B 4X5WB 4XHJC 1MI5B 1DEEB 4XNMA 1RIHL 3GM0A 3SQOL 3BQUD 4ODSH 5EZOL 4H1LB 1A6AA 4YFDB 1G9ML 3E2HB 3WUZA 4NKQB 2EDQA 2KKQA 4XBEH 2D4FA 3U4EA 5DT1H 3S5LA 4P23C 2X1WL 4RWYL 4NNPL 4F7CB 2BSTB 1NBVH 2C3WA 1KGCD 2XWBB 4OV5B 3EOAB 3MZTA 4N0YH 4PG9B 1G1YA 3WS3B 3C5ZD 4X4XA 1TLKA 3V0AC 1RFDH 2PW2A 4J4PA 5J6GB 1FJ1B 4HFUH 1F42A 1G9NC 4H26B 4G5ZL 4YO0A 3L3GA 3OBAA 4X9IA 1CBVH 1D3CA 3PL6C 4XNYL 3QA3B 5EU3A 2BFVL 3MRBA 2E7MA 4LIQL 1BM3L 1H15A 1QR1A 1M71B 1MFAH 3K81A 2H32B 4NYLA 5GHWL 3QDJE 5DYOA 2XN9E 3OKDA 3QIWA 4FQJH 3IETA 4XBGA 4FXGA 5CP3A 3RZCA 4HCRL 1XF2A 3T77A 2EO1A 4S10A 3ARYA 4IRZL 4AEFA 4ELKB 2WWMC 5AUMA 5BZWB 3OHXB 4KDVA 4AIZA 3IFNL 2R0ZL 3W0WE 3QUKA 5HGDA 3VFVB 4LHJB 5IVXF 1INEL 4R4NC 2BNRB 1P53A 2FGWL 3IDMA 3MLTA 4BSWA 4GMSH 1MEXH 3IDXH 1JYNA 4DWHA 4KGJA 5EZIH 3U7YH 1W8OA 2FB4L 5I1JL 1JBJA 3VWJD 2W65B 2AV1B 4K9EH 5C9JB 1ACYL 3S96B 1Q9KB 3U30C 1F3JB 5D7KD 2F8VA 4PGDB 1RJZA 4MQSB 5HXMA 4OD3H 2AJSH 4PV8A 2HFTA 3RX8A 3JZ7A 2P8MA 4RAUB 5FUCE 5CUSL 2H6PB 3WIHA 1F13A 3BP7B 4J3WA 3GRWA 3T3MF 5F9WC 4RCAA 1IM9B 3SKJL 1VADB 1ZHBA 5DEGB 5E2VL 4AT6A 2VZ1A 1MCWM 4CBPA 4ZTOL 1GYAA 3MJ6A 4M03A 4P3CH 4V1DA 1YEKH 5IT2L 3PWLA 4XCYA 4P0DA 1F6AA 4P46A 1IKFH 4S0TD 3WEXA 1GZPB 1CR9L 1W72L 4ODVH 3B9KD 3ESUF 2R29H 5HHOD 3FT4A 1BD2A 1A6TA 1SJEB 5F72S 4MNQB 3M07A 1MCLA 2A73B 3CDCA 3GMOA 1I1YB 5EUOE 3DMMC 4NZDA 3W39B 1J7VR 4B7LA 5T1KA 3WUWB 4JRXA 2GSIB 1PG7W 1CICA 4ZUWA 3GMRA 5JA9A 5EBGA 2ZUSA 1A7QL 3SJVD 3NGBC 4P9MH 1DFBL 1C12B 3KYAA 5GGSA 3V6FB 5TQ2L 3GMPA 1YNLH 3AVEA 2YK1L 4WFGE 4ZO8A 4HJJH 4I48A 5ESAB 1FNGA 1UWXK 3HI5L 2HVJB 1G7HB 3BXNA 4GKZB 1JPST 4NDMB 2QBWA 1VFOA 1BPVA 1EPFA 1IVLA 5B8CA 4KKCD 5HHXL 3RVVD 4YDKH 2MKWA 1VACA 3VXPA 1FSKC 3QQ9C 3NABL 1E6OH 3ZSTA 3B8SA 2V7HB 2DLTA 5TH2B 3SDXF 5HDLA 5MEPB 3VH8A 1T3FB 3DUSA 1KPVA 4D9LL 3A6BL 1WCBA 4ONFH 5ALCL 2VXVH 4NM4H 2JJSC 1OGAA 2EYSA 5IW1B 2XA3A 3FZUC 2Z4QB 4Q2ZB 1K6QL 2WWMD 4Y5XA 4JQIH 5HVGB 1KGCE 3P4MA 1WISA 3GGWA 4F2MB 3MRKB 5I19L 5I1GH 4LBEA 1DLFH 4FHBD 5DQDL 1IAIM 1SEQL 5DJDB 2DRUA 5DK0B 3MRPA 4IRSB 1OAUL 4NQXB 4O9HL 4QHKI 4WV1B 1KCUH 4I3RL 2R69H 3WNNA 2ZOKB 4NYLB 3ILQD 5JTWA 4YHZL 4FFWC 2R8SL 3RIAF 2X7LA 3LN5A 5IFJA 4HUKB 5HVWA 4G7VH 4JCLA 1NMCC 3O4LD 3VGDA 2F19L 4WFHE 3SDYH 4JVUA 3QIUD 5FEBA 5C6PB 3W0WB 5F9OL 3Q3GB 3SQBA 3WKML 4X4MA 5C0FA 1V7NH 2WBKA 2AS5M 1ZHLB 1BZ9A 2E7HA 2HT3D 4ZDHA 1NAKH 4Q9CA 5F9JB 3B9VA 1Z9SA 4EOWH 1K3IA 4NCC1 4BH8A 4DGIH 3CDYA 1E4KC 1ZT4A 3MLYL 4G7YH 4LASH 2FEEI 5IHUL 4N9OB 5KSBB 3KYNB 3HG1A 5BS0A 4OI9A 4U0RB 2K9UA 4M1CD 2NYYD 2R1WB 2PYFB 3OG6B 2EXWD 3BRFA 4JN1H 1QBLH 5CCKL 4NQCB 5DHVA 2A77H 4QRQA 2D9QB 1UM5L 1U8KB 2X4UB 4M8VA 5T3XD 2AEQH 1QG3A 3MA7B 4QWWD 1AIFB 1P4LA 3RU8H 4RISL 5I8EB 4CJ0A 1RURL 1WZMA 1ZHKA 2N56A 3CLFH 5T5FH 3VD3A 1LNUB 5HHQB 4KKAC 3RVVC 4EBQH 1VDGA 2GTZB 3MLPA 4YHYC 2OTUA 1ADQH 4Y5VA 5IEHA 2R2HB 2C3XA 3LQAC 3QXVA 1A2YB 1OAQH 2DI9A 4HS8H 3TO2A 1QLFB 1TCRB 4FQIH 4FQLL 2HVKB 1ZANH 4N0UB 4Q74A 3RPIB 5EOCL 4PV9A 2VN4A 4TUJB 3QUMA 4DOHE 1C16A 15C8L 4KUCD 3L7FB 4QXGH 5FUOL 4LSSH 1D5MA 5FF6A 2D7TL 2BNQD 2I60H 3IDIB 3RZCB 3WCYA 3QWOA 3INUH 4PD4K 4BZ1L 5SWZB 4NQSA 5BJTA 3FHQA 5HYSB 1QR1B 2OQJB 2X10A 3RX5A 5ADPH 1JN6A 2FYYB 3TN0C 5IK3B 4EUPH 3MRCB 4NNPH 4CU6A 3CPLB 1ZTXH 1KBGH 4I4WA 3RWEA 1FNFA 5FOJA 1EDQA 5HGHA 3D0LA 5EOQL 1KJ3L 5L8KB 4LLYA 1P2CB 4K71B 1MRCH 4HGMA 5EU7C 1FLRL 4M7JL 5GIRA 5EA0L 4NWTL 3QDMA 1VSCA 4XRCB 3D9AL 5D1ZC 2LFGA 3C09C 3P73B 3MLWH 3K2UH 5C0CD 3VMPA 5I8OL 1MCOL 2CXGA 3KR3L 5TGBB 4ALAL 4CGTA 1OF2B 1KBGL 1S7XB 1RMFL 4Y8DC 4P4KB 3U4EB 3FOLB 4YZFE 3QIUA 5HD8C 1D5BA 1TVBB 4I0CC 1KNOA 3IFOB 3KJ6H 4WEBH 4QF1B 1IBGL 4MJ4A 5E7BA 3SJVA 1CGSH 5SX4H 4ZSOB 4GKSA 3T0WA 1P6AB 4Y4HD 4FXKA 1TPXB 1A6UL 4RMTA 4TOYL 1MCRA 2ZUXA 2Q20A 5D1ZB 2QV2A 1X5KA 5CZVL 1KELL 1JZ3A 1KTRL 3GMOB 3EGSA 3MRIB 4LEOA 1A47A 3AY4A 3BMWA 5I74B 5IMLA 4HWBH 4M02A 2IALA 4LCCB 4PJ7B 3ARGC 3H3KA 1DBBH 4LQFH 3G6AB 5I0ZA 2X7LB 3LN5B 2IH3A 3G5VB 1GOFA 1ITCA 1E6JL 3VMNA 2QQLL 1G6VK 1UB5B 4PRID 5D1QC 2CDGA 5ECJE 5D6DC 5IHBA 4C57C 2UYLB 3DV4A 3G04B 1NH6A 3LKRB 3Q6GH 3BP5B 3MGAA 3MR9B 4BFBD 2JK5A 2CR6A 1G6RA 3L3HA 4R7NA 5DJDA 1RD6A 1O7SA 1KG0B 2J6EH 2IQ9H 1U8LA 1XIWC 4I0PC 2AJYL 3L5WA 1ERNA 2H6PA 1ITBB 3BISA 4OF5A 1IC4L 3ILQC 3KLDA 4NP4H 1PQZB 3K1KC 4KXZH 4OZGA 3QNZA 4K3JH 3BWAA 2A2QT 1FGNL 1A14H 3KYMA 5GS0D 2UY7A 2V2WB 4ESKA 3HKFA 2FX7H 3ZKNC 1YEDB 2AI0L 3EHBC 2Q8AL 2P5WA 5MEPA 1JZ7A 4ODXB 1TDQA 1B0RB 1SHMA 3OF6A 3A0OA 2OX5A 5TH2A 1L0XA 3FZUD 1AHWB 2KUTA 3JV6B 3ZKXC 5D2NB 3ZHLA 4MVBD 4OZFG 1A7RH 3GSRB 4GG6E 1F4YH 3F7YA 4V1DE 1JGLH 5ISZD 4XHQA 4OIBA 3MODL 1JYWA 3HNSH 4NO0A 5E6ZA 2WUCL 2YA0A 3MLXL 3S8WA 2R8SH 4PJHA 1I85A 4AEIH 1BIHA 4PS4H 5J9PA 3LH2L 1RMFH 12E8L 5D5ME 3BIBX 1T83A 1G9EA 3GB7B 4KKLC 4X0KB 1G7PA 4V2CB 1R3KA 4AH2B 4YEFA 5C7XH 1JF1A 4TTDD 5IR1B 4M6ML 5FHBL 5MERA 3GBNH 2VO5A 1XGPB 3GSWB 4K7PL 4TUJA 5H94A 4ZAKA 3D3VD 5E94A 4MAYA 3TVMB 4DZ8A 1Y0LB 1EZVX 4XH2A 5HGBA 1K6QH 2Q86B 3EAKA 3HZMA 4OCRL 3QCTL 3UXFA 4JG0L 2HH0L 2YBRA 1TJIL 4NKDA 3RWIB 2DM2A 3TC9A 4OFPA 3EFDL 1KIPB 4H5SB 2Q6WB 2GSGB 3DV6A 1QBAA 3MRCA 2NY0C 2ENYA 1PKQA 1HI6A 1HZHL 3PIQA 4UIMB 4N1EA 5F88B 3P0YL 3IFPB 2I07B 1OAYL 1X5JA 5BRZB 2I60L 4H8WH 1JNLL 5E24E 2B39A 2V5SA 2H1PL 2WZPD 5FUOH 2BVOA 3I6GA 4Q6IB 4EI6B 4OCYL 3IB4A 4WFFE 3X11B 4EDXA 3GM8A 4LSTL 1CFVH 1F4YL 3S4SG 1JPTH 3NN8B 2YK1H 5D9SA 1FBIH 1BBJA 4MD0A 3BO8A 4RWHA 1CU4L 2IEPA 3P9MB 3BKMH 1Z6JT 1MCQA 3SDCC 4AMKH 2RCSL 5I1IL 2FIKA 3GJFK 1MFCL 4EBQL 3PWNB 3QFJA 3C8HA 5C0BE 2B0SH 3QI9D 4TVSa 3PDOB 4AK1A 2QEJA 4P4RA 1PBYA 2HLFD 1X5XA 5JQ6L 5J8OA 4XC3H 1LILA 2FJHB 1OP5H 4WRLA 4L5FL 2YD9A 1OP3H 2B0SL 4D8PB 1KCVL 4XVUC 8CGTA 1D5ZA 4CAGA 5J3HD 5I8CB 3CMOL 1UEMA 3E3QC 3EYOB 5T5NG 1JGEA 2FLRT 5GGTH 1T0NA 3MLZL 4OM1L 4CADB 3IKCB 3ZDZE 4FQHB 4HAFA 5I1HH 3NH7H 3WFEL 3DXAD 3LKSB 5HSFA 1D5BB 3T3ME 3GHBL 1IILE 3WO4C 1OM3H 4XI5C 5E8NB 2F54D 3OSKA 4Q97A 2WIIA 4HK3J 3DGCR 5AZEL 4M48H 3D87B 4Y4HC 1JGUL 4LIQE 4R3SB 3KYOB 1BX2B 1CVSC 2XZCL 1WBZB 3F8UB 3GIVB 5CBAA 1N6QH 2B5IB 1T83C 3G6DL 3UC0L 4U6VH 1UQSA 4HUNB 4PGCB 5FHAH 4KZEL 1T1WA 1D5XA 4H88H 2DQJH 5DMGC 1AD9B 3VXRD 2ZG3A 3M8OL 2F19H 2VAJA 1GZQA 1I8MA 2JJTC 1LEGB 4Z0BL 1FO0A 2NY3B 2OCFD 3VA2C 2QQQA 4KKCC 4OAWB 2CIKB 1UJTA 3TBTB 1DTUA 4L1HA 4O9HH 4OIAA 3U7WL 4AH2A 3UJTH 3EO9L 4Y16A 5B38A 5IBLC 5E9DB 3O0RH 4HIXL 1R24B 1QYGH 5SV4A 2EICA 2V5RA 1UYWL 4S1DC 3GK8H 3M1BA 4X8JA 4J7RA 1CG9B 1LE5B 4J4PD 3FAXA 3MGTB 3VFPA 2Y5TA 1INDL 2MCPL 1SBSL 5HDQL 1BF2A 1TJGH 1DN0A 4UDTA 5C08E 2W0FB 1PLGL 2YD8A 5ISZE 2IMMA 3OKLA 3ARTA 2YRPA 4KZDH 3WSQH 3W0WD 1KPUB 4OF0A 3PGCB 4JO2L 4U33A 1MFAL 5KG9B 5GRYA 1QBBA 4Y5VB 3UAJC 4H25B 1FE8L 5IEHB 3X14B 2BFVH 3IRPX 4F58L 5IVZB 1S7VB 4OBRA 1M7DB 5FKPA 3WO3B 2ERJB 1CXHA 4GKNA 2FHCA 3RWGA 2Z35A 1MCPH 4UOJA 2N1KA 3OB0H 1ZHNA 1RFDL 3KPLB 3QCVL 5D96B 1IQDA 4FNLL 4P3DA 4ZUSB 2D7TH 4U6HB 3DYPA 3NA4A 3GHBH 2F53B 5IVXB 1TTUA 3I02B 3EJJX 2N7AA 3GUTB 3P9MA 1MJJA 4X8XA 5CGTA 4LPYA 3SO3B 3QDMD 4Y5YB 4GS7B 5DURD 2F5BH 3BGMB 4UV7H 5TF1L 3RVWC 3ARBA 3MMEB 1OQXA 2CDEA 2QSQA 1G6RB 4WHCA 1CT8A 3JSSA 5F6IC 3BIKA 3KG5A 2DQFA 3MLUH 4X5WA 4U6XB 3ZE1E 5F96H 4LKCA 3IYLW 3O11B 3U0WH 3UEZA 4OLWL 1IGCH 1SVZA 4MJ5A 5BQ7B 2BHZA 5E8PA 3IFLH 4Z7VB 1LO4H 1IZJA 4JZNB 3S35L 3QDJB 3C2AH 1AGCA 1NBZB 5T1MA 3CU1A 4RQQA 1ZS8A 4ODVL 3PP4H 5DHXB 3RNKA 2ORBL 3S34L 4AMKL 3C08L 4JANB 1BFOB 2VQTA 2ADGA 2NLJB 3EGSB 1CU4H 1YEKL 3CD4A 5IT2H 1BBDH 3MRGA 4BZ2L 4WJ5B 5MENE 2JIXB 3C5ZC 3MRLA 1AJ7H 4AIZB 1A6ZA 3T1FA 1NANI 4KVCL 3ZKQD 4APQC 5L2JB 3RVUD 5IOPB 4WI4A 4I9WE 4MZ2A 4APQD 1U0QA 3O6KH 5DSCB 1ZOXA 3MTRA 4GAJH 1FAKT 1OARL 5EZLB 3D39E 1X5GA 4E0RB 4FXGB 5DXWA 3GI9H 3O3BA 2AJXL 4NCDA 4NN6C 1ZEAH 2ZKHL 3EIFA 2W0KA 4RMUA 3D3VB 3QWRA 4JG0H 1T22B 3BEVB 4H26A 4O2EA 4X99A 4PGBB 3GRWH 1MCNA 1VACB 1IEAA 3D1MC 3QA3A 1QA9A 1X6NA 5J06A 2VLJB 1EHNA 1BGXL 1K8DA 4KAQL 3T0DA 1U42A 3GKWH 4CJ1A 3Q1SL 1IM9D 3IJSA 4ELMA 4IHOA 4HG4K 2IC2A 2IG2L 3VFPB 4U0QB 1AC0A 4KAQH 3FQXB 4NQDA 1R5VB 4PJFF 5CKGA 2AXHA 5I9QB 4XBGB 4ELKA 4F7EA 3L95B 5DRXA 1GGBH 5ESVA 3KPRD 3MLXH 2VDML 3GRWL 2DI7A 4MA3A 4YUEL 3MODH 2HJKA 3K8KA 5D70H 3FN0H 4GG6A 1YY9D 5HDOA 4Q9QH 5ALCH 5FB8B 4KKAD 5T1KB 3NZHH 2AEWA 2CIKA 2ZNXA 3H9ZA 2XTJE 5IVNA 4R96A 4ISVB 5FAAA 1FC1A 3MROA 4GAJL 4Y4HB 1MCSA 3MA9H 2EIZA 3NMEA 4HKXB 5D1XD 2IMNA 4MX7A 2AI0H 5ETUB 1AY1H 1MY5A 1Y6MR 2XWBA 1QFOA 2OTWB 2DIJA 4JFPB 2NCMA 1U8OB 5DT1L 4WHYG 5BMFL 1UACL 5CILL 2KZ1B 1ACZA 1VCAA 5EWIH 4RBPK 5GZOC 1RZIA 4EQ2A 1X4XA 2RBLA 3DVFA 4IMKA 3ZTJG 1MHCB 4M93C 5I16A 1U92A 3U1SL 1JJUA 5CEZD 4ZFOL 3BPCB 2BNRE 3H9YA 3B9AA 3T65B 2HMIC 3U30B 2F53E 2HFGH 4OB5H 1QLRA 3DVGB 4KK9C 1UA6L 4L9LB 1P9MA 4U6HA 2R1WA 1YECH 2OZ4A 1TENA 5DJAB 4IRJA 3RY4A 4OD1L 4C4KT 1Q38A 5F96L 1J8HD 4WVRA 4YXKL 4HC1L 1Q9KA 2DQHH 4ELME 3NPSC 3BPLB 4JRXD 43C9A 3KS0J 5HHNA 3ZZ1A 4RAVB 4ZUUB 3CFDA 5SWZD 1G0YR 4NGHL 2E9JA 4U1LB 5TF1H 1BZ9B 4BSVA 3ZDYE 2X9YA 4AIXA 5DJ0A 1DQLH 2AQ2A 3W9EA 3VFWA 3U9PH 4X6BA 4X7SH 3RVTC 4MDJB 3HR6A 2B1AH 3BZDA 1MI5D 3IKKA 5CZXC 3KJ6L 4WEBL 1T0MB 1A1MA 4LSUH 3K3QA 4P9HC 4Z7QF 4O58L 1RV6X 3QIWD 1WVZA 3OZ9H 3BGFC 3SKMB 4BKLA 3BX7C 4MGXA 3TCXA 1K9TA 5CINL 5E5RB 2VSCA 4FQXC 4R2GD 5D5MA 2BVPB 4JM2C 3BPLC 4GW4A 2EYRA 4F7MB 4Z77A 3Q2CA 5DQDH 3WXVH 1KCKA 1PZ5A 2FB4H 5I19H 4YDIH 4DUXA 4HWBA 1PFCA 5EA0H 4WUUD 3QXDA 3MLUL 3QCTH 4LNRB 2VMFA 1OTTC 3F7PC 3ZTNH 2O5XL 4NCC2 4MJIA 2VR4A 3P4OA 1DVFA 3KYOA 4YHML 1TJHH 3B2UC 4PR5B 1CGYA 3JXAA 1ZSDA 4XPFH 1KN4H 2UUDH 3FQWB 2BVQB 3KPPB 1C5CL 4YDVA 4GBXD 5BOZG 3LKPA 4U1SA 1FAIL 5HHVL 1T1XA 3WV0A 4WDIA 2XT1B 2CUMA 1AQDB 2FH6A 3AS3A 1LD9A 4RFOL 5D2NC 1TQCC 1N3NA 3HCVB 1EZVY 1M6OA 5F9WB 3MGOB 4XP4H 4M43H 3V6FA 1KPVB 5A3ID 4MD5A 2CGRL 1T1WB 4NZTL 3TV3H 1CIUA 4GQ9L 1IGJB 1I7ZA 2F74A 4YPJA 3U36B 3VA6A 9CGTA 3BWUC 2FX7L 5JIKA 2BVEA 3CLFL 4W4OA 5AD0B 4XVJH 1RURH 3HUJE 4XNUH 5I8KL 2PF6A 1YQ2A 1KB5L 3HUJA 5HVHC 2HRPH 1AGFB 1DJSA 4NNXB 1I7UA 4XNXL 4YBQD 4N5EC 3MLZH 3QQNA 3TO4D 1I1AA 3RGVA 3CMOH 3HG1D 4DUWA 5BS0D 2O93L 4MJ5B 3CFKA 1WWCA 5BQ7A 3U46B 3LEVH 4L9LA 3HC0B 1MFBH 3HMXL 4UIKL 1NGYB 2VXQL 5A2IH 3QIUC 2MHAB 4RMRA 2EKJA 5E2UL 5D8JH 3STLB 1HNGA 3I75B 2GY5A 1U8OA 1MHPH 1BVKA 2NLJA 3REWA 3RZWA 4ZFZA 3RWHB 2D4DA 3G6DH 2NMSA 4QXTA 4PJCA 3H6JA 3IRZA 5F9JA 2CIIA 2F58H 1RUPL 3UTSD 5CEXB 5CUSH 4XRCA 5CD3B 3U0PA 4K3DH 2V2TA 5KVDH 4YHYB 2Y7QA 2DD8H 4JN2A 1JUFA 3BPNB 4LEOB 4N1CA 1TXKA 4QY8A 4APQB 3O11A 4JRYD 4W68A 4YK4C 3QIWC 4YJZL 2YR3A 3NVQA 4JZJA 4TVPL 5E0QA 1VGEH 5EZJB 3TP4A 3SJVB 3FO2B 1EMTL 3F7VA 4U1KB 1LDSA 3S9DB 4NBYB 4DKFH 2JIXD 4YXKH 1MSPA 4AM0B 1Q9WB 1F6FB 1S7SA 4WUUA 5FF6B 3EOYG 2L7UA 3C8KB 3V5HB 4JPWH 4JKKA 3WHXB 3QHTC 3V52H 2P44B 2WV3A 4I0PD 1RPQA 4KJPD 2VLJD 1R3JA 2W92A 4QO1A 3I3DA 5IFHL 1S7XA 2VYRE 4DVBA 3G5ZB 2UWEA 2DKSA 3QDJD 5DF0A 2YN3A 3C87A 4LMQE 5CIPB 1ZLVH 3QEGL 3H3BC 5D1QD 5D7LA 4UI2A 5EWIL 2XKSA 4OCLC 2JCCB 5BVPH 5GZNC 3EO1A 1EEYB 4DK3A 3RHWK 2OZ4L 3ARFB 3ZE0E 4FTVB 3DRQA 4EUPA 5CLWA 4Z7UE 3E1F1 1NCCL 1FFQA 3S35X 5CSZB 5DHYA 1A02N 1JP5A 1DBML 4G9DB 4DOHB 3DURA 2EKSA 5SWZA 4J1UA 2XA8L 3MA9L 2X1OA 4JO4L 1UWXH 1H3WM 4GRWH 3O4OB 3BVNA 3GMMB 1MH5A 2EDFA 1DBKL 5GGRA 4TUOB 5IM7A 2PR4H 1WZLA 5HYJA 1U92B 1HHGB 3P9LA 2HH0H 4JHWH 3VFNA 2HVKA 1A22B 4PR5A 4HFWA 2D3VA 3AREC 1J1XH 5IB3A 3LKNA 4Y4KD 4MNHB 1KV3A 3IXAA 4UB0H 1PX3A 5HHOB 1P7QB 4KI5C 4JAMB 1A4JA 5IB4B 2GCYB 4NO5A 5C7XL 3PQYD 3SDCD 4TNWK 5E03A 4XBPB 1J0YA 4GRMA 4JVPA 1QKZL 4JY6B 3VFTA 2Y07H 3FB8A 5DMKB 1I3RB 3PWNA 2AEIT 5BXFB 1QLRB 3UYPA 5HHNB 3EJYC 4Y88A 3SPVA 3K46A 3SDDB 1FVCA 1QSFA 2PO6A 2NW3A 5IV2B 4ZOEA 1BVZA 4Z7WE 1MCDA 5DHVH 1MCHA 4OUUB 3P11L 3BN9C 2R1YB 1D9KA 5AG9A 3QDGE 4K23L 3RNQB 4EDXB 2XWJB 2FO4B 3D5OF 4NRXB 1YUHB 3LHPH 5DRZA 4XNZC 4MAYC 1BHGA 1LO3H 4G3YH 3V8CA 1KELH 3CUPB 3FONB 4NO2A 4Y5XC 3LRSA 1U3HB 4FABL 5TGBA 2JJSA 2X2YA 1KIPA 4H5SA 1SJHA 3RWDA 2F54E 2NXZD 4UINL 4YBHA 2VDRL 3FCTB 4Y2DB 2CK2A 1B0WA 4GOSA 3BAEH 3ULVD 4RDQF 4KQ3L 2B4CC 3V52L 2BNRD 2X5PA 4QHMA 3SDYL 2FX9H 1RJLB 4HKJB 3M17A 2NY2C 4GKSB 3TBSB 2E8YA 4XNQA 1JPSL 3GSWA 3K80A 3VD9A 4PPTA 3NTCL 4UT6L 3EKCA 4WDIB 5SWSA 2PNDA 4U6YB 5ESAA 1WT5A 3ARDC 3LKPB 4U1SB 3T2QA 2BHUA 3V6OC 4X4YA 4PJHB 4OZIF 3TZVC 2DJ4A 2H3NB 4O2CA 3MO1A 2J12B 5C0BB 2O61A 4PRPD 4XB7A 4QOKD 1ZSDB 4H1LA 2X4QB 1JGDA 5FYKD 1K4CA 3MXVH 3JWOL 3C5ZA 3N1QC 3BZEB 4JHWL 1M71A 2AGJH 5D72L 1AHWA 5HYEA 1J1PL 5L9DH 3OAZH 3X12B 3ULUL 3NABH 5DD6B 3ARQA 4XCFH 1IGIH 5AWNL 1AXSA 2H2PD 1PZ5B 3FT4B 4R2GB 1CFSA 2HT4D 1I3UA 3O8XA 5KBNC 4N8VG 2QQNL 3LPGA 4LVOB 4Z7UB 3H3PL 2VLRA 2NXZB 1RZKC 5DO2D 1C7TA 3HHRB 5EBLA 1BFTA 1YMMB 3RY6A 2IAND 4KI5E 4Y4FB 3CSGA 1U95B 1JRHI 25C8L 1DFBH 4P9ML 4RGND 3VWKD 1ZKAA 4GW1A 3DXAB 1GCFA 3UROR 3HG1E 5BS0E 2VDLL 4P5KA 4DN3L 4DGVL 4HH9A 1PSKL 2VQ1A 3WLBA 4JRXB 2D0FA 3HNTH 1XF1A 3WJLA 2Z31A 4GFTB 4RMWA 4YEEA 3ZL4H 4YQXH 1ZMYA 3SE3C 3TVMD 2C3GA 3NA9L 1C1EL 5ADOH 3TCLB 3MX0A 5J1SC 4OF7A 1D9KD 1AFVL 3ILPA 4GLRH 2CMRH 4HMCA 1CR9H 2VXUL 3LOWA 2YA2A 3BUYB 4Y4FC 4TSBH 3PABA 4PYGA 4Z7VA 4UV4L 3VGEA 3VRLF 4G9FE 5L7XL 1BQUA 5JXEC 4MD0B 4XPFL 2A6KA 3B5TA 4Y4KB 3L3JB 4KTEL 4GMTH 3QT2A 5ISZB 1EJ6A 3RZCC 4M48L 1CF8H 2C1OB 3GSOB 1TTFA 2J2ZA 4Y16C 3TJEL 3MJ9L 3WKMH 4X5XA 2EDDA 2DTSA 4ZUSA 1HSBB 5HYFA 1GC1H 1TETL 1OCWH 5T1KD 2W59A 1DBAL 4NQVA 4L4TB 5E8DL 2XYCA 3RTQC 1I8KA 2R69L 4JGMA 3HPJB 2ZUQB 3WN5C 1EEYA 3OZ9L 4KDWA 4HXBL 5EU6A 4D0DB 3HNVH 4JVWA 4O58H 4HUWB 1DLFL 5FYLD 1YEGH 5IB5B 2AQ3A 5D1QB 4NNYA 5TQ0L 3MNWA 3N1FC 5E9DA 1QSVA 1Q0XL 4I18A 1MPAH 1MHEA 5JPNA 2BY0A 5EFIA 3ROOA 3T4YA 1L7TL 2W60A 1V7NL 3AS0A 3DUUB 3IS1X 1FL5B 5GS0L 4JDTH 1AD9A 4JFDE 4JGUA 3EYSH 1W0YT 4L4TD 1JWUB 5DQ9A 5LKNA 3T2NL 3OV6A 3QPQD 4ZMAT 2ADFL 4OCYH 2HRLA 1MFEH 3LS4H 4ODTL 2B5IC 4PJGB 5F6HI 5CAYB 3QR2A 2HFGL 2B4CH 3I85A 2HFEA 4I8DA 1S5HA 1XGQA 2Y9RT 4YFLI 2C3HA 5JZ7D 2BOBA 2HLFC 1IQWL 2AJUL 1AHWC 4FQPA 4TTDC 5DR5L 4GRMB 3DTXA 2PCPB 4RZCB 3AB0C 5K93A 1FFNA 1JGDB 5CJOL 1WEJH 5IB1B 5JMOC 4H20L 3O45A 1JTPA 3M1BB 5DC0A 3OX8B 3PGDA 1TIUA 4S1RL 5F3BB 4OD2A 4UUJA 4CVZB 1WT5C 4PGEA 4JFEB 5DEFA 4LHUG 4FFZL 3UYRH 4OAWA 1OP9A 5GGUA 3ZKXB 1YMME 3VMOA 5CJXC 4WY7H 5HPMA 3UTZA 2Y6SC 3GJFA 1TZGL 1UZ6E 5FCUL 1CDBA 3DX6A 3FB6A 3LH2H 4X7TA 3QO1B 3S88H 5EH1A 2X05A 2R9HD 3HG1B 5BS0B 3QDJA 5SWZE 4IIQC 1OP3K 3X3FL 3MXWH 4JRXE 4XAWL 3OGCA 1DQTA 1KLFA 1UFUA 3U9PL 3AMLA 5TDNA 1MAKA 2WWKT 1ZLUH 4PJEE 2OYPA 1J86A 1FFOB 4ZAKC 4WI7A 2XQBL 3HRZA 5I1EL 2C4FT 2VQ1B 3MJ8A 1Q72H 2Q1EA 4LLMA 4UQ3B 5HI3C 4UT6H 4R8WH 4L8SC 2LE9A 3NCJH 1SM3H 2Y06H 4KY1H 5LJYH 1NEZA 3CVHH 3FN9A 4LRNH 2OJZL 1VB9A 1XFPA 4UU9B 5F97E 2V9TA 3OPZH 5KS9B 1D9KC 2R2EA 5C0CB 4G9FB 1WC7B 3S3PA 5D2LE 4X6EB 3HZYA 1U8MA 3MLRH 1B6DA 4Z95L 4LSQL 4CVXA 4QTHB 3DARA 5CZKA 1BWWA 5BCAA 1BOGB 3D69B 5CMAB 3Q6GL 4MNGA 4JY6A 5E6YA 1PW3A 4PJIE 1KC5H 4YFEA 5DD6A 3VXSD 4MNGE 3L3DB 3D6GA 2M1KA 2NTFB 3QUZD 4MS8D 5IROC 4LFHD 5F21B 4JREC 4JG1L 3UZQA 2Y36L 3SKJH 1AR1C 2W9EH 2G60L 4QHNB 1N5AB 4NQCD 4HWBL 1G1CA 2XNAB 5LCVL 4Y8AA 2AXFB 3QI9A 3QXWA 3T0AA 1GPOL 1QOKA 2FYYA 2ARJB 2EDHA 4OFVA 2YUWA 4HWZA 1HEZB 3H9SA 1BJ1H 4I0PA 1XIWA 3DMMA 3V5KB 4JJ5B 5JHLH 1A8JH 2HTKC 1WZKA 3OAYK 3W11D 1X9QA 1V5JA 4GS7C 5EU4A 1HQRB 4YDLB 5C0AA 3QUMB 1AH1A 2VLKE 5DJ8B 3I9GH 1LO4L 5D1QA 3LN4A 3VXRB 2R1XA 1YEJL 1O7VA 3BSZH 4OLWH 3VI4E 1HQ4A 4FXLA 4N0YL 4N8VB 3G6AA 4XAKE 5ICXA 5KSVB 3REVB 5GGQL 2VERN 2YPVH 2YOCA 4S1DD 5CZXD 4DK6A 3TBSA 1IL1B 3G6JE 3SKNB 3VG0L 4UV7L 2GAZA 5HBBA 2X6MA 1DBJH 1RHHB 4N1HB 5C0IA 1IARB 3STZA 1YEDA 3RA7L 1KENH 4ODSL 4ODXA 2NY1B 4YAQB 1EHXA 1DCLA 1I7ZB 2AP2A 1CFNA 1ZLUK 4W70A 4XAWH 4MQTB 4TPRL 4OLXL 5AZ2H 3GJFB 1WAAE 4H8WC 5DLML 3MBEA 3VFGH 4M6OL 3H8NA 5GRUH 2AJXH 3MFFA 5ABDE 2E9BA 3GMQA 2L0DA 4WNQB 3R0MA 5JW3L 2XKNA 5DLMH 4HXAL 4HFUL 3LB6C 1H5BA 1A7PL 3TIEA 2EC8A 5BVPL 1RULH 3VFSA 5A43C 2WQRA 4W6YB 1GOGA 4KUCF 3BZ4B 3K4AA 2A9ML 3KWWA 4Z7WA 4PRPE 4XMKL 1RUML 2EXWC 3PQYB 3B8YA 4WV1C 5E99H 4FXKB 4YXHL 5DJ6B 5HI4C 2X89A 1ONQB 2ZG1A 2ED8A 2VDKL 5DS8A 4WI3A 2YPVL 1J12A 3KPQA 1X5YA 5FB8A 2BK8A 1ED3B 3S34H 1LD9B 5FV1L 6CGTA 2D31B 2YXFA 1H5BC 2OR8A 4Y4FA 3JWNC 2A83A 1OGTB 2I9LA 5E00B 5FO9A 4X9HA 1R3LA 3PE9A 1GC1L 2IFFL 4K94L 4OT1L 4TVPH 1U3HD 5ENWA 3T0EE 5K9OB 3QZWG 1T6WA 3MGOA 1NAMB 1T89A 4OLYH 2Y4SA 3OB0K 3QO0B 3SE3A 4A6YH 4JFPA 5BRZE 4NT6A 5KVEH 2DD8L 4Z18A 2DICA 3PIQB 3G6JA 5A40E 4Q7DA 1HINL 3LKOA 1VHPA 4ODWB 5FYJE 1S5HB 1XGQB 4AL8H 5KAQF 1NFKA 4YNYA 1E4WH 4DKDC 1K5NA 3SDDD 3QB7C 4LASL 3V2AR 5T3ZD 3IGAB 2UWEB 1WV7T 4N8CH 4JKPH 4X6DE 1B0RA 4OM1H 1T5XA 1NPUA 4XMPL 3KJ4B 1MFBL 4NUJA 4QRPB 4UTAL 2XZAL 1IGTA 4QTHA 3BDYH 3KPNB 5HHPA 1P7QD 3VDCA 1XCTA 4L5FH 4QYOB 1KCRL 1FG2A 3FO1B 4NO0B 3WSQL 2IPKB 3LEXA 2QADC 1U8LB 3RQ3A 1N5YH 1HK6A 2O26U 4X6BB 3P4NA 1P4IL 4XTRD 5IB2B 3NFNB 3FFDB 3O3EB 4MA7L 1VFMA 4MA1B 4OF3A 1ZT7A 4QHNA 1IAMA 3TYGL 4U7SA 1NBQA 5CJ8A 1CLYH 3TM6A 2VLKB 1D5IH 5DVMA 2VDKH 3PJSA 4MLIA 2WWKO 4PRPA 5IWLA 2EE2A 4R7DA 4MWFB 3O0RL 4JLRB 1CCZA 2W91A 5IG7B 3L7EA 4F37K 5FKAA 2VR9A 4L4VB 1J05A 4QRPD 3UTPE 4NUGH 1A4JB 2FATL 2XZQH 2ZPKL 4JY5H 4PJCB 5T1LB 4G6MH 5HPMB 3ARFD 4NOFA 4WHYH 3GIZL 4TNWF 4NQDD 3UTSB 3BO8B 2ATKA 4FQXA 4RGMB 3N1MC 1NCDH 1X7QA 4GRLA 1MELA 4Y5YA 4JRWA 1OWWA 1NGYA 1LVEA 4KMTL 4NQEE 4YDKL 3O9WC 1MFDH 2JLLA 3O4LE 4HW6A 3TO4B 3BP4B 4OZFB 3RWJA 4EI6A 2NY3C 4WW2A 5E8EA 5AZEH 4ZNEE 1NCNA 2PUQT 4OUUA 5E9DE 5GGVY 3HRZB 4LCYB 5KSAD 2ADJA 3MREB 2YD1A 2ZNWA 3GGWB 4PUBL 4RAUA 3JBG7 4L3CB 4F57H 1EO7A 1AGFA 1ES0A 3F62A 1N59B 3VGAB 5CSZA 3RA7H 3HUJB 4OGYH 3UX9B 1CDIA 4RNRA 3O9WA 2NY1D 1QEWA 3STBA 1A6VH 3PQYE 3VFSB 1KPUA 1T1YB 2VISA 4GRLC 1MUJA 2VLME 4KV5F 4KTYA 4MAYB 2ERJC 4XC3L 4J2XA 5B8CC 1T5WB 2ID5A 3D0VB 3NZ8B 3BKJH 4XCFL 1HYRC 1KIRA 4RGMC 3HLAA 2MKLC 4XMLL 5JOEA 3N85L 4DTGH 4GBXC 2ZZUT 1MCEA 2BZDA 4XCNB 1J8KA 4F2MA 5AYUH 3T77B 5CHNB 1CL7H 4U2YA 1HQRA 3V5HA 2R23A 4WU7A 3MJ7A 3UTPD 1GIGL 1NAMH 4ONHA 5DHYB 2EH7H 1F5WA 3MXVL 2I07A 1EXUA 5DRWA 4GLRI 5DVOA 1BJ1J 1UWEL 3AREA 3QNXB 5EU7E 5SWSB 4U1MA 4PJ9C 2A1WL 2BDNL 3LRGA 1SEBA 1PG7L 5CIPA 4LSPL 4IDLA 1GVIA 1QRNE 1WCBB 1A7OL 3DVNA 3HNVL 3TN0D 5C8JA 3ARPA 3N06B 5A2LH 1UA6H 1DE4A 3VD5A 4QCIA 1K8DB 2UUDK 2EXYC 3M17B 4NHUA 2QADB 4C54A 2J8HA 1M05B 2EXYD 2X09A 5TE7L 1MIEH 5GRXG 3C8KA 2CR3A 4LHQB 4NDMA 3O3UN 1FL3A 6FABL 4WUUB 2AJ3A 2Y07L 5D2LF 4P46C 1MRFH 1YEEH 3L9RA 4KHTH 1ZGLP 2SEBB 2R2EB 32C2B 2P7TB 1RZFH 4X6EA 5F7EH 3TBTA 3MYJB 4I2XB 4WWKA 1MEXL 2XKNB 1BF8A 2DI8A 1AR2A 5F7WC 5IF0B 2GK0A 2A6IA 2OI9B 4ORGA 1NMAL 4IOFD 3TO2B 2EYSB 2PTUA 3RKDC 1JWSB 3ES6A 2BSED 4K7PX 2BSSA 5M7QA 5C92A 2R1YA 1NCDL 3MNVA 4HH8A 1SJEA 3MRRB 3TH4T 3EDDA 1AGDA 2IBBA 3IDUA 1MAJA 4TUKH 2VE6B 2Z93A 3ARWA 5H37G 3CU7A 3PQYA 4JO4H 4LOUC 1LO5B 3FN0L 5KSBE 3DO7A 4IEFB 5I75B 1ZHKB 4M7KH 4H25A 4ZQKA 5C70A 2ADIB 1RZKL 1U3HA 3P3YA 1SY6A 4JFQA 4NQCE 3QUZB 1J8HB 1F8TL 5HDBF 4P46B 3UCRA 2CKBB 1II4E 3VWJA 2IAMA 3VJ6A 3F65A 4LKCB 4TQEH 1BGXH 4YC2B 1K2DB 3DJ9A 3Q5OA 1LE5A 1KEML 1LGVA 3O2DL 4ZXBA 3CSPA 5JXEA 3IS0X 3UJIL 1BD2D 1Y6KR 5IKCA 5A2FA 4Q0XL 5DMKA 2AJYH 1EO8L 4ZS6C 5F7UA 4J1UB 3LPFA 1QFHA 1EUUA 3BDYL 1IQWH 3PL6A 3FAWA 3VFOA 4BZ1H 4YDJB 4JQVC 2ITDA 4N8CL 3ZLQC 2NYYC 5IB3B 1WBXA 4F33B 2F8XC 4ISVA 1DQDL 3OKLB 4LF3A 3WJLC 3RTQD 3B9EA 1FL6B 5HYSG 1PJ9A 3X3GL 2AGJL 5KG9A 4MA8H 1G7LB 5GS3A 4X6CA 5GGRY 1T1ZA 3VGHA 1CD1B 5B8CB 2NXYC 4YGVB 1YN6A 3UBXI 4ONGH 1MWAB 1CE1H 1WFNA 2UZIL 1MPAL 5K9KA 1CI5A 3SCMC 4M1DL 5HGGS 1JTOA 3OKOB 3TEUA 3HPLB 4DTGL 3HLAB 2VZOA 2X4OA 3O4OC 4GH7B 3MV11 3UYOD 1FG9C 1Z9LA 5GGSB 5E08H 1EIBA 4QHMB 2MPAL 2EDYA 4J8RA 4M93B 5JORB 3X17A 2GJZA 1KLUB 2AEQL 1MIML 3BHBB 1UXSB 1T22A 1U8NA 3BEVA 4O00A 4XPTL 1E27A 1KT2B 3OAUH 3I6LD 1I8LA 1DBAH 2X4PB 3FMGL 5MEOA 3FKUS 1MCOH 3KR3H 5DRWB 4P5TC 4GKOA 1G7QA 4ALAH 2IADB 2WQ8A 4E9LA 3CUPA 4NO2B 5JLZA 5TPWH 1QRNB 4YXHH 3HI6H 4RMVA 4L4VD 3MFGB 5HYJE 4M6NL 3FONA 1FRGL 4BM7A 3HC3H 3TJEH 3UTTD 2H3NA 1M7IA 4WO4A 5DRNB 2E7CA 3FT3B 3ZKND 2GUOB 4AENA 4NJAH 1CGXA 1PKQE 4KTEH 1QLEL 4I13B 3VRLE 2CDGB 3C09B 4F58H 3BKYH 2QQKH 1TPXC 4P3WA 3U4BH 5B39G 4RDQG 5F3BA 4U1HB 1A4KA 5DJXA 3VXMA 1QHOA 5GISH 4UAOC 3TT3L 1YYLH 4PJ7E 3B9KB 1VEPA 2HP4A 3I2CL 2AQ1A 1WFOA 5HI3D 4MX7B 1FYTD 4U3HA 3ARUA 3VFRB 3W2DH 1GAFH 2QHLA 4LLWA 2GJJA 2EYTB 1U36A 4FFWD 5F7DA 4Y4HA 1TFHA 4L8SA 1D5IL 2VWEC 2Q7NA 3MOBH 3SKOB 4WU5A 5D1ZD 3MRRA 1LO0H 1XR9B 2A6KB 1ZA3A 3STLA 3TA3B 4HMDA 4LCWE 2SEBA 4P2OA 3L95A 5DRXB 3UTQB 4BFEA 2PN5A 1U91B 2J8UF 5D7IF 1WAAA 2HLAA 5EU5A 4CDGC 1HI6B 1KCRH 2GK2A 4C83A 5JHLL 4RGNB 3KYNA 4A2LA 1N64L 1BQHB 2CKBA 3VWJB 1T1XB 2WIMA 2VH5H 2V5MA 3MNWB 2HFEB 4P4KD 4M1CC 3ILPB 4ZD3H 5FGBC 3OXSB 1MLCA 1CXKA 5GIRB 2IANA 3OKMA 3QEQE 1H0DB 3EDJA 3ULUE 4M61A 1NCCH 1UCBL 4JM4L 1UB6A 3HPJA 2BERA 1OD7A 3FQNB 3R1GH 1DUZA 4NQVB 1RIVH 3BT2H 3QG7H 4MB3A 3IAGC 3DPBA 3BRDA 2GJ6A 4QHKJ 1LO2L 1RZ8A 3QEGH 4JFEE 4UT7H 1UWGH 1ZLSL 3KNBB 3WE6A 2EH7L 3CVIL 4O02L 4ZTPL 1NAKL 4NQDE 5BZWA 3I50L 2ICCA 2C7UA 3SGEH 1F2XK 4R6UA 3QNZB 1TTGA 1PGRB 2DM4A 2OL3H 4PRIA 4K8RD 3L9RB 1RJCA 3EYFB 3QCUH 4J3VA 2IPTL 4HGWA 5C0BD 1VPOL 3IETB 3LKRA 3EYVB 3QDMB 3F7YB 1EMTH 3DBXB 3MCKA 4HUXB 4WTZA 4XWOD 1BJ8A 3RPIA 3S36L 5IW6B 3OJDB 4KROD 4L4TA 4PJXF 1TETH 1JF5A 4UDUA 2OL3A 1A64A 1S9XB 3UJJH 1ZLWH 4NKOB 2NY5C 1A9BB 2XQBH 3MBXH 4S2SA 4P9HH 2B1AL 3LSOB 3WS3A 4LCCA 4PJ7A 4XP1L 5ESQB 1QSEB 2CIIB 1FFRA 4OQTA 1MWAH 1P4BL 4M3JA 1T7VA 4TULL 2VDRH 1J0IA 2LU3A 3GSNA 3TFKD 2WIIB 5MERB 4G6JL 5KS9E 1CF8L 1DDHA 1FCCA 4NM4L 4HC1A 1R3KB 4KKNA 2F58L 1KCLA 3DSFH 4LSVH 1LK3L 5GGTA 3UBXG 3V4PH 3BQUB 4ZFZB 3RWHA 5TE6L 1NSNH 5FYLE 5JXED 3SOBH 4HXAH 3T2PA 1S9VB 1I3GH 3KAAA 4X6CF 4Y4KC 5FA4B 3RTQA 3O6MH 3QRFM 2IH1A 3LRHA 3U0TA 3JVGC 3T0XA 5HHXH 1IC7H 4DQOL 1B0GB 1I7RA 3U7YL 3QEHB 4J6RL 3SJVE 4OTXL 5IMMA 3DX7A 1G7MB 5DJZB 5E56A 3SY0A 4H1LG 1KOAA 1QFWI 3NIFF 5ID1A 1A3RL 1QQDB 1UJ3B 1T7ZA 1AXIB 4O51A 2NW2A 3PWPB 1I7UB 1N64H 1UB5A 1INEH 1UXWA 2FEDD 5C0GB 4M6MH 2J5LB 2YPLE 3BZ4A 1PYWB 2APXA 3QQ3B 4KK5C 3MV9D 5F1NB 3ULUF 2NY3D 4JB9L 2CUHA 3IF1B 2YSSB 2VDQH 3BEWB 1VGKB 4FQXD 4HJGB 3PHOA 4MAUL 4N0CC 5TE4L 3U9UB 2YS4A 2H9GA 5B22A 1AKJA 1T21A 1AI1L 3UTQA 1BVKB 1T2JA 2GKIA 3JWOC 2D03L 3VFVA 3MYJA 4I2XA 1LWRA 4Y2DD 3GHEH 3PDGA 3MCLH 1GAFL 4Y2DC 1JE6A 4TVPE 4KPHL 4NJ9H 1Z9MA 1REIA 1WIPA 3DIFA 3WFBH 2WLZA 1FZOB 4KKLD 4OFKA 2UZYB 4AZ8A 3G5VA 3WIIL 5IMOB 3TT3H 2XNAA 1WFUA 5C0IB 1XF4B 5CP3H 1L6ZA 5GJTH 1GPOH 3H7BB 4YAQA 2DLEA 4X6DF 3S96A 5BRZD 3BKYL 3A6CH 5IW1A 4PYHA 1TJHL 4W4OC 4BH7A 2IADA 4NWUH 2YBRB 1MAML 1A3LH 5HJ3B 3P0VH 2APVA 5EZOH 1KN2H 5GGVL 3WHE1 3ZTNL 4OZHF 1OW0C 3MLSL 2BNRA 1B4JL 2BXZA 3GBLA 4HCRA 4ODWA 3NPZB 3PP4L 2BY1A 5D71L 1RZJL 4OLYL 1JNNL 3QDAA 1U8MB 5ENWB 4JJ5A 2PYEA 2VC2H 3GO1L 1KXQE 3AM8C 4I0PB 5SX4I 3MRFA 4GMSL 2CRYA 1AE6L 2AVGA 4KK6D 1OL0A 4GMTL 3TVMC 4JFED 4IBLT 3KNBA 2ICWI 4KQ4H 1VERA 5CZVH 2F5AL 2EE6A 4ZS7L 4KVCH 4G80A 4F9PC 4Z8FL 5FECB 4W6WB 1W0WB 2HN7B 3CC5A 5E70A 5K9QG 4UV4H 1KB5A 3ECBB 3QDME 3KPQB 2Q3AA 5F9DC 1JUFB 1EHAA 2EYTA 3LRSB 1ODAA 3ARDA 4P4RB 3V6OA 2IAMC 5EPMB 1DANT 5KVDL 3RWDB 4JRYB 1A7PH 5KOMC 5T1MB 1BM3H 2ORBH 2IBGA 2XY1A 3IKCA 4K23H 4HUUA 2DJSA 2FZ3B 5E8OA 1T0NB 5F89A