1DAGA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid and 5'-adenosyl-methylene-triphosphate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
224
structure length
224
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
molecule keywords DETHIOBIOTIN SYNTHETASE
source organism Escherichia coli
molecule tags Ligase
total genus 74
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dagA00
2CEAA 1KMHB 4GRAA 4TZ6A 3AKYA 1HE1C 5KYKA 4B44A 1XTRA 2QRZA 4URUR 4Q1EA 1CRQA 4N0DA 4EPTA 2ZSDA 2QT0A 1J90A 3AP2A 3B9QA 3QBVA 1Z6TA 4MKGA 1W2HA 3SR0A 2ZJ8A 1VHTA 1G3QA 1ZUNB 2AN9A 4MYUA 5FOXA 4TYQA 4JBWA 4AI6A 3UKDA 2DY1A 5DN6A 3THWB 3QPWA 3NBFA 4EUNA 2PLFA 1NP6A 4A9AA 4BFTA 1X8JA 3CX6A 2Q3FA 1QHHA 1E1QA 1YVDA 3QE0A 5TV2A 4YMUA 1E1QD 1DADA 4C7OB 1D6JA 4Q1CA 3W90A 2R65A 4LHZA 1P2SA 3IPYA 1ZU4A 4H1VA 1HTWA 4V0OA 5BW8A 4FMDF 5CB6A 2IYRA 4DDTA 2ONKA 1HURA 2BJWA 3GJ5A 3VR3A 2BOVA 2QPTA 1M7HA 1W5SA 2J0UB 3PEYA 5KU1A 2D2FA 1BYIA 3I8SA 4D4KA 2ZRLA 3EW9A 2BJVA 2GJAA 3U3OA 5TARA 3FKSA 3C14C 4LZZA 2DR3A 3A37A 1OFIA 3FKSD 2GZAA 3NWJA 3TQFA 3LAWA 1FNMA 3UWKA 1JJVA 2GBLA 2GAAA 4LHVA 5AK0A 4CF7A 4G1UC 1Y3AA 2A5FA 1T5IA 5KDOA 4RKEA 4O0MA 1OIXA 3JVUA 2CVHA 1FX0B 4Q1DA 3LBIA 3EASA 3UANA 4AIIA 4B35A 2Q0HA 5FPSA 4TL7A 1T9HA 1Z28A 1LVGA 3GD7A 1PZNA 1NN5A 3AKEA 3EC1A 2E9SA 2Z83A 1N5JA 5B57C 1G7RA 3H86A 3SHWA 3MJRA 5IT5A 5F9FA 4TN1A 4A8JA 5IF9A 2OFWA 1E0AA 3FPAA 3TR0A 1HQYE 2EYQA 1L8QA 2ZRCA 5H1YA 3KKPA 1DE0A 3IHWA 4XSHA 4DUGD 5JCPA 1PUJA 3QXJA 2Q6TA 3ASYA 4O2LA 1MT0A 1RJ9B 1OKKA 4TSFA 4OQXA 2V55B 4ASUA 4TSFD 3HP1A 5H68A 2VHUA 5J4VA 4ASUD 1LY1A 3AVWA 1KIMA 3AVXA 4D82A 4EPVA 2VP9A 1LF5A 2A7QA 2Q3MA 3AF1A 1GM5A 3G5UA 4KODA 1HT2E 3TW4A 1DPFA 4Q1FA 4G01B 1L2TA 2XJ4A 3AF0A 3N70A 4C0AC 2R6CA 2YC2C 4LPSA 1W4BA 2HDNB 1XCPA 2CE2X 1H8EA 1RYHA 3N5CA 4PSAA 4FN5A 1U9IC 4PHFA 2GJ9A 4FWIB 4DDWA 2ZI6A 4NU0A 1LV7A 1Q21A 3C15C 3MD0A 4K8OA 4PAOA 5KDLA 2RGDA 1DS6A 4RD4A 3BH0A 5J5CA 3SBEA 2V1UA 2FJUA 1OB5A 2YWGA 1LS6A 3KTAA 2DFLA 4OK5A 1VMAA 1GITA 5JI2E 1O87A 4ZPXA 4BZPA 1XD9A 4NONA 3O8RA 3FHCB 1OFHA 3GLFE 3GLIE 3QY0A 3K0CC 4DVGA 4AYWA 1OJLA 4RCYA 1KDOA 2RGEA 4TLDA 1FP7A 1L4YA 1YR7A 1D2MA 1XU4A 2HJGA 2LKDA 2X19A 1XTQA 4TLAA 3AKDA 3W34A 4TL9A 2AK3A 4NYIQ 1G1MA 3RRNA 4CEIB 3FFAA 3LW7A 5EZ5A 1QHIA 2BHRA 4Q7MB 1YRAA 4ZIRB 5GVSA 3U44B 1NVUQ 3GJ8A 3CH5A 2ZYWX 4YC7A 2QAGA 3W3ZB 2P6RA 2ZU6A 2MMGA 3I62A 3U4QA 1IN7A 2ZEJA 2H18A 3BE4A 2QP3A 5K8TA 1OSNA 3QUSA 3KQKA 5CM9C 3CNOA 3WYFA 3TW8B 4A0FA 1M7GA 4BGDA 2O8CA 2G0NA 3ZJYA 3HR8A 2JIZA 5C4GB 4MKFA 1QBKC 1MV5A 2JIZD 1QHYA 3QPUA 1AS0A 5L8VA 1XZQA 2FA9A 2OUKA 3IBGA 4BZQA 2C03A 4D6PA 5FUYA 2QTHA 3LNCA 1SVWA 2C9OA 1W46A 2OG2A 2GJKA 2W6IA 1N5KA 3H4MA 1KI3A 2GZDA 3GJ6A 5SZJA 2QGZA 2W6ID 2IS2A 3BB3A 3P26A 3ZZTA 3TUZC 5DE3A 2ZJZA 3A1WA 3DOEA 5BN4A 2QBYA 2XNSA 4A82A 4JZKA 3U5ZB 4FMCB 1TAGA 4JBYA 2ZANA 1E3MA 4RKFA 3NHAA 4H1UA 1AM4D 2QTFA 1ZM3A 5A4JA 4UXIA 2VH5R 1W5TA 3QVVA 2ZJ2A 4GMDA 3PUZA 1NG1A 1G8PA 4JJKA 3K9LA 4EPYA 5F9HA 3PR1A 2P65A 1HUQA 1UKZA 1XJ0A 3TLXA 1XEWY 3A6PC 3FVQA 4RFSA 721PA 2JA1A 2JLSA 3KJEA 5JWHA 3CO5A 2PT7A 1VECA 4DKXA 1L7VC 1OYWA 2CLCX 3PUXA 2W58A 1GZSA 3T35A 3U3RA 2NGRA 5DGXA 4X8HA 1X8LA 1E0JA 2V9PA 2Z5FA 4HAZA 2RHMA 1G17A 4JMPA 5EE5B 4DLWA 5C1BA 3TGPA 5CLLA 4XTRA 3D6TB 1ANKA 2NO0A 1WXQA 3F0TA 4CEHA 5DI3A 4C0HA 1U8AA 3IHLA 5EP1A 3FYHA 1F60A 1JAHA 4F92B 2OT3B 5FTNA 3WYGA 2WSMA 4LCBA 3R8FA 2OCBA 1NVVQ 3T1QA 3QF7A 4JT2A 2IXFA 1DAIA 2WJJA 1KSGA 4JVMA 1ZCAA 3CNLA 1E4YA 3KDSE 4JKYA 1RE0A 2IF2A 4NYJQ 2ZRIA 5CB8A 4UNPA 4HLCA 2VF7A 3P1JA 4G5GA 2GCOA 2R2AA 1CJVC 3WXMA 3B6EA 2PBRA 4NYIR 4DSNA 4DLZA 4V0MA 1JNYA 1W36C 1G5PA 4GPTA 2FE4A 2HXYA 2IS6A 2FG5A 3LWNA 3SN6A 5JMTA 4PZLA 1FTSA 3RNLA 3MG9A 3RS4A 5C2JB 4CYMA 1JPJA 1SXJC 3QKSA 4OQFA 4NE2A 2BIFA 3DZ8A 5JHHB 4LPKA 1GRQA 2RHDA 1GIAA 3K0FB 3B1WA 5FI1B 2ZVPX 4MRPA 3CZQA 4US0R 4CZ2A 1SVMA 1N6OA 5BYKA 1XMJA 2EU8A 4D2IA 2RGNC 5BYJA 3CM0A 2N46A 3VU9A 4ZDJA 1IN5A 1N5LA 1ZAKA 3U7FB 2BDTA 2R6FA 1DG1G 1G3MA 2IA5A 3U3MA 4IVRA 2IUSA 3RS2A 4US2R 2YOGA 4Q4JB 3LX8A 3VMFA 2RAPA 2UVQA 4TL8A 5EE0A 3RLFA 3UXMA 2AWOA 2FN4A 1E96A 1YZQA 4TQAA 5FPYA 4MKHA 2O8BA 3EAQA 4HAWA 1E32A 1Z8FA 1EWQA 4I99A 3U60B 1OW3B 3EZ2A 1TX4B 2DWPA 2VA8A 4LJ9A 2D06A 3C16C 4UNSA 1G6HA 5J4HA 4QGFA 4C9BA 1I2DA 4JLJA 4MA4A 3WHKA 4NKRA 1E2MA 2ZE6A 3PUWA 2YZ2A 1D5CA 4V0KA 4ZDKA 3NEJA 4M2LA 4QBIA 3Q7QA 1IHUA 1J2JA 1G5RA 1XD2A 1QHNA 4IOJA 4KJZA 4EFLA 3OIVA 1Z0FA 1IN4A 2HV8A 2UZ3A 2WKRA 1YQTA 4X8OA 1F2UA 4KCGA 4B73A 4ZI2A 1O3YA 3MCAA 4TT3D 5HCIA 2EQBA 5F2EA 1NVVR 3CIOA 1OFTA 2F1HA 2OFXA 4HLQB 2J5XA 4MYHA 5JWRA 1XXHA 2CCJA 2IYZA 2QI9C 4OK3A 2E87A 3GEIA 4NYJR 1B23P 3AGQA 2BEKA 2MSEB 1W1WA 1TF5A 2W2TA 1CBUA 2IK8A 3LV8A 2BMDA 2CBZA 3B1VA 4JLDA 4M53A 5D3MA 3RSOA 5DI9A 4A2QA 2XX3A 1CLUA 5FBVB 3HU2A 1EK0A 4HB4A 2REOA 2JLVA 1WE2A 3QPVA 4B47A 2NZJA 2G1KA 4B74A 4G5QA 4Z54A 4KXFB 2RKOA 4KI0A 3QF4A 2V8OA 1E4VA 4M1KA 1VCMA 3Q85A 2BBTA 2PJRA 3EWSA 1VCOA 3B8HA 2NMVA 3GP8A 1GSIA 4BFXA 1HE8B 4Y0VA 3PJRA 2EFDB 4M1SA 5B2ZA 3U6KA 3K0EA 2WKQA 4YMVA 2J0SA 1X1RA 2EFGA 3RC8A 4B3GA 3K0AB 4EQ6A 2W0MA 5DIFA 2ZI3A 5JI3E 1SKQA 4DT1A 4K46A 5FOVA 2R6GA 1LTQA 1AGPA 5A0FA 2H5EA 3CX7A 1W4AA 4OHWA 1ZBDA 1P61B 3QXSA 3ONWA 2IWHA 5FI0B 1IQPA 3ZDQA 1Z63A 3CLVA 2OM2A 4MRNA 3QKRB 2WZQA 4DCUA 1KMHA 3ZD6A 1P75A 1XNJA 2IYLD 2WAYA 3IUYA 5FOTA 3AF4A 4A0RA 1NF3A 2H8KA 2J87A 4JIMA 4RZ2A 3K09C 4PHGA 3CRMA 1C4OA 1DEKA 2C96A 1K6MA 4EDHA 3NBZC 1VTKA 2OV2A 2F55A 1S96A 4HAVA 1D9XA 2R62A 3KKNA 3AF3A 3H84A 4F4JA 3THWA 4CT4B 1WRBA 1UM8A 3NVAA 2OAQ1 3ND9A 5DH9A 4J0QA 3C5HA 3WYAA 3TJZA 1E79A 1FQJA 2GCPA 4QJ3A 4M4SA 4NCIA 1WBDA 4LDJA 4AKGA 2GILA 1E79D 4AYTA 4ZDIA 4QGAA 1S9DA 4C0SA 2VSOA 4C7OA 1X6VA 3CRRA 3B7GA 3W6OA 4LHYA 5IK2A 2B21A 4FI3C 1KAGA 5IK2D 5G3ZA 3D31A 121PA 4QRHA 3O47A 2IYXA 4YMTA 2RH5A 4B6FA 5LD2C 5FTJA 1ZIOA 1KSHA 5FR1A 4QKQA 1JB1A 1IBRA 1GNRA 5KDDA 4IJMA 3MWJA 2XXAB 1YRBA 3MJHA 2A5YB 3LVRE 3GFPA 1CJKC 3KL4A 3P20A 4XWKA 4Z8YA 1KO5A 4NH0A 3SNHA 2CCGA 4A2PA 1YR6A 4Q4LA 3VFDA 4IVPA 2JLYA 3GPLA 2VP4A 4TL6A 1KSFX 3TUIC 5C4MA 4WXRA 3CB4A 1WB9A 3B2EA 3B9PA 5SZIA 4DSTA 2PL3A 4ZO4A 1XMIA 3AH8A 1T8TA 2O0HA 3H2YA 1FX0A 2ODNA 1J70A 4FIDA 2ZRPA 2Y8EA 5KHOC 4R2IA 2NPFA 5M04A 4I81A 3B1XA 1G64A 5EP3A 3ZS9A 4HEJA 221PA 2VP6A 4Q01A 1NNEA 4MRSA 4Q5IA 3GJXC 4N0EA 3C41J 4RFVA 2ZRMA 1PJRA 3SE0A 3A1VA 1IXZA 2ORWA 2PCJA 2ORIA 4AG5A 1LB1B 4NBSA 2GNOA 3C5CA 4MH0R 2EFEB 3PENA 4RD2A 1GFIA 1P5ZB 3V00A 2ZS8A 5FPKA 3QEJA 1U2RA 2IEYA 3RAPR 3BFKA 1KO4A 5KPDA 2CK3D 2OLJA 3VAAA 1GAJA 1YZLA 1RJ9A 4TYPA 4S2EA 2JLZA 2O8FB 3OIWA 2ZI9A 1Y63A 3LFUA 2X1VA 1ELOA 2F1IA 1G8FA 2F43B 3PUYA 2EVWX 4IKEA 4Q02A 1EXMA 5CDFA 2XZPA 4OI4A 2P0EA 2EW1A 2ANBA 4DXAA 4PR0A 4EKDA 1U94A 1S1CA 1YE8A 3BC1A 1S9HA 3D7MA 3AF2A 4JS0A 3EIHA 3AKCA 3BERA 3X2SA 1MO6A 1RW4A 3LXXA 2QE7A 3LD9A 3HR7A 1HY3A 1KSJA 2QE7D 5CLQA 2VP5A 4DLSA 3L82B 4HLUA 4US1R 4HDOB 4Q1AA 5AUPB 1JR3E 4BLTA 4JVNA 4OQNA 2WWFA 2B8WA 1R10A 2AKAB 4V02A 1W36B 1TF2A 4YDHB 2HXSA 4HB0A 4Q7LA 3NEYA 2KJQA 5GVRA 4OHXA 2HCBA 2KBEA 2GHIA 4M21A 5FBWB 3C7KA 3QXCA 5DSZA 5JWOA 2WTUA 1FOEB 1SXJB 4I1SA 4B34A 1COWA 1IM2A 1COWD 1AGRA 5J47A 5CK4A 2N1BA 4GZLA 4R71A 1E6CA 4F93B 4OJKA 2B8TA 1AS2A 4LV5B 3AEZA 2ONJA 1XDBA 2QEQA 3UG7A 2D7DA 2V6IA 3VKWA 3GLHB 3ZYCA 4CEIA 3UATA 1E0SA 3QENA 4JLBA 2CL7X 5CJPA 1VIYA 2ZJ5A 4ZIRA 5FTLA 2OILA 2CNWA 1NLZA 2ZE5A 3LXRA 3U44A 1GUAA 2CNWD 1IN6A 3OE7A 2W83A 4D4MA 3VTKA 3OE7D 4BE7B 5JZVA 3LRPA 1UBCA 2O0KA 4C0QC 2ZSAA 1NSTA 4C2UA 3DM5A 2QM8A 3RRYA 2YC4C 1LS1A 2VHQA 5A5GA 1Z5ZA 1P2UA 2P6UA 3W9YA 8OHMA 4BFUA 2DFKB 4LOAA 5KPJA 1FUKA 1ZC3A 1DAFA 1XZPA 1KZGB 2DWOA 1US8B 3EC2A 5J40A 4BFZA 2PH1A 3BGWA 2DHRA 3GLGE 4PQFA 3EZFA 1I4TD 1KI6B 5EXPA 1TQ2A 5AWFC 3TK1A 5J4LA 2XAUA 1M2OB 3GJ0A 4RD6A 2QROA 1TADA 4KU4A 3KFVA 1QRAA 1E2JA 1TL7C 2CDNA 2VEDA 2Z4RA 3FWYA 3I4LA 5G40A 4DB4A 2AXPA 1GWNA 1E69A 2GVDC 2OCYC 4EPXA 1SVSA 5B64A 3OEEA 4EJSB 2WJVA 4B3DA 1DELA 2JLRA 4LYJA 4IEEA 2VQSA 3OEED 3RS3A 1FMJA 2ZTSA 3A8TA 3X1DA 3H1TA 4M9ZA 2OSBA 4M1WA 2OEPA 3ZS8A 2DYKA 5HPYB 4YXWA 2MSCB 2PX3A 1DG3A 5FTKA 4YXWD 2CL0X 3EZ9A 3I5XA 2VYFA 1SVKA 1YZUA 2FSHA 1VG1A 2REBA 3F5FA 4C0JA 4TMWA 1T0JB 1ZC4A 4KLZA 4M9XA 4DB2A 2DFTA 3SEAA 1P3JA 2PEZA 4WBSA 4E07A 4JLMA 2ZSEA 5G3YA 4XOIA 2WIAA 3DOFA 5TY0A 4N1AA 2YNMA 4PQYA 1HH4A 5EUMA 4GZMA 2P5SA 3VKGA 1AA9A 1TQ6A 1RIFA 2BV3A 3QI2A 4EIWA 4JYCA 2JLWA 2NPIA 2DCUA 2AK2A 1P4SA 5G53C 1WMSA 2O52A 5JEDA 1DBSA 2PLRA 2BKEA 2PMKA 2FDCA 1C1YA 1Q1BA 3K9HA 1NBME 1CR2A 1R8SA 2FZ4A 4YDSA 4BLOA 3MWLA 1NKTA 4KVGA 3TVDA 4MRRA 5GJVC 4UXHA 4P31A 4XIGS 2J7KA 1AZTA 1ZUIA 1KYIA 2G88A 3W6PA 4PZYA 1XF9A 4BASA 3OAAD 1S0UA 2YWEA 1FP6A 2ZRKA 4PFSA 5FFMA 4OYHA 1B0UA 1OIVA 2NG1A 2AD5A 2BM1A 3SFVA 3JVVA 3B82A 4L15A 2AKYA 4NCHA 1IOZA 4KBGA 1S8FA 4TWZA 3T06B 3KKMA 2OCPA 5E95A 2VSFA 3AP3A 2IWRA 4C30A 2YINC 4JLVA 4NMMA 1J8YF 4DUGA 4NCKA 3K0FA 1GKYA 5KOYA 1R0WA 4LJ6A 2ZJYA 2VP2A 1GL7A 4LV8B 3TQCA 2QNRA 3IEUA 2YJTD 4F7WA 1P2TA 2P6NA 3A1UA 5CIQA 1TU3A 1VCIA 2V1XA 4A92A 4XWAA 1BH2A 1VDZA 4JKIA 5TB5A 4A6PA 1CR0A 4W5HA 1F2TB 2GRJA 2HEIA 4POAA 3X1XA 3AP1A 3SBDA 1E2PA 4Q4JA 1XEWX 4PC7A 4HUQB 1XMVA 3BFVA 5JCZA 1AS3A 2R44A 4UNQA 3T5GA 1KK1A 1QVAA 3CPHA 3MMPA 4XWOA 3T61A 4E09A 1LF0A 1I4DD 3L0OA 1T91A 1GNPA 3EARA 1KO1A 1V43A 1VPLA 4MGYR 4FCWA 1GDDA 2ZREA 3K0SA 1Q1QA 4Q4HB 1R5NA 2R9VA 1DAHA 1Q57A 4EPRA 2HYIC 2QN6A 1KJZA 4Z1MA 5LD2B 3FFBA 1IAQA 5B58C 4Z1MD 2W6JD 5H70A 2Q9AA 1A4RA 2BBWA 4LBYA 2BC9A 3MGCA 4LJ7A 1YU9A 4DDVA 1NIPA 1N6LA 3HU3A 4AC9A 4JL5A 2RGCA 2IHYA 4Q7JB 4Q7KA 5FUWA 5L3QB 2GXQA 2YVUA 2ZE8A 4PPGA 3KXLA 4TTPA 4KITB 3FOZA 2VIIA 1XPUA 1XTJA 4ZKEA 2W2XA 4QBHA 4QBFA 5JECA 2ODWA 4QNMA 3W5JA 1KK0A 4ITRC 3HYTA 3E5HA 4ABYA 3KKOA 4LHWA 1ZU5A 3FTQA 3KKQA 3QSYA 2N42A 1KI8A 2ODEA 1R5OA 3D8BA 2ZS7A 1XFAA 2CE7A 5HE8A 4W7SA 1IN8A 2GJSA 2O0JA 3CH4B 1XMSA 4LYFA 3I32A 2GZHA 3K70C 1P62B 3UPUA 1BYUA 3QBTA 1QHGA 1A82A 2A5DA 2RGBA 4ARZB 3ADBA 2KB0A 1XCMA 3KQHA 5KUTA 2Z0MA 1OH7A 3AVQA 1R0XA 5JS8A 1KNQA 1OHHA 3NH9A 1GVNB 3P32A 2OBMA 4Q18A 1W48A 1OHHD 1M1YE 1ODFA 2XJ9A 1KKMA 1ESMA 2P3SA 3GJ3A 1XX6A 1C9KA 1NRJB 1Z0IA 2NTYC 2VHTA 3BRWD 3WRXC 2BMEA 4BUJA 2G1JA 4V0LA 1KY3A 4UJ5A 1KDPA 1F48A 1L4UA 1HEIA 5BXQC 4D26A 2IYWA 3K0AA 3DVLA 4D80A 4OJQA 5EP2A 1EG7A 1KOFA 4EFMA 5JSZB 4TMXA 1E2NA 2WWWA 2ZI5A 2ZYVX 4GT1A 1TTTA 3HDTA 3FE2A 3SOPA 4BPBA 2FEOA 1EX7A 1SVIA 4W5WA 2CHGA 1CP2A 2FNAA 4RSGA 3WMEA 4B6EA 3VX3A 2AXNA 1W0JD 3CR7A 1E9RA 1AJEA 3RS5A 1G5TA 3FB4A 2I1VB 4DCVA 4UJ3A 2JEOA 3TIFA 3E2IA 1X1SA 3OESA 4UQOA 3TSOA 2EYUA 4IOMA 4PC6A 1U9IA 1Z22A 5BN3A 4NHOA 1OT3A 1Z6GA 4LSGA 3PXGA 2YWFA 1WDTA 3MFYA 4PC1A 1Q3TA 3QKTA 2V6JA 4D4LA 4OK6A 4U5XA 1VG0B 1Z2AA 5L3RA 4AD8A 3GLFB 3GLIB 3GFTA 4JL8A 4DWJA 2W0SA 2WHXA 4Q9LA 1CULC 1E94E 1M74A 2FSIA 1CRPA 5LPNA 2VO1A 4GFDA 1XJQA 4L8GA 4PPQA 3K0CA 4NCNA 2IL1A 1ZW6A 2WMNB 5FOUA 2HCJB 1UAAA 4OI1A 1AKEA 3QIAA 3T1TA 3UMRA 4NDZA 3IPXA 3MWYW 3EPHA 2CJWB 2ZE7A 1N5IA 1XTKA 1OFUX 2YOFA 3A4LA 3L0IB 4OQLA 3T15A 4LRWA 4G0NA 3BORA 1NVXQ 5F98A 3TSZA 1KTVA 4P32A 3W8NA 4CGZA 3AUXA 5SZHB 4AYXA 1U0LA 4FWTA 2HT1A 3KXKA 1OH8A 4DIEA 4M22A 4DBLC 5KNCA 1ESNA 1D2EA 4Q4AB 1XEXB 4OL0A 2XXAA 4C0KA 1EFHA 2NQ2C 2QGNA 1II9A 3I5YA 1Q3HA 3A4NA 4A0HA 4ZKDA 3K1JA 1ETUA 3THYA 1N6RA 1UFQA 1FQKA 5GJCA 1WA5A 2AFHE 2FSGA 3FMPB 1R8QA 3THXB 2QP9X 2H16A 4M1TA 4HDCA 4KBFA 5AUOB 2ZAMA 5HKKD 1YKSA 2G0TA 2ANCA 4CVNA 3Q5DA 3ZZ0A 4Q00A 2IW3A 1G41A 2Q9CA 4PHTA 1EFTA 1YZTA 4P4UA 1TF7A 3N2IA 3LLMA 4URVR 1RRGA 1E2FA 3IILA 3RRMA 1GOTA 2ATXA 4BLQA 2F1JA 1ZP6A 3Q7PA 1X86B 1NMXA 1K8RA 4Q1BA 3SYLA 5JS7A 1E2IA 1VYTA 2PZGA 3EIEA 1KJYA 2JGNA 3KJIA 5SZKB 4WZBE 4IFBA 4M8NE 1KHTA 4IDOA 3FHOA 3Q9LA 4NYMQ 2HF8A 2XZOA 4CIDA 2I4IA 4KFTA 5EE9A 2GWHA 2WJYA 3MWKA 3KB2A 1G4AE 1N6HA 2FU5C 3MSXA 4XSGA 3RRZA 3AVYA 3NIBA 2XITA 4X8LA 1P9RA 4L5BA 2O8FA 4EJSC 1QHSA 1GKIA 2E1RA 4X8MA 2J59A 2RCNA 3BFXA 4QFMA 3WNCA 4IHQA 5E7IA 2ZRBA 3GMTA 4DLXA 3QNUA 5EXSA 2DB3A 2ZUCA 2JASA 4TT3A 2OESA 1G18A 4LJAA 4B71A 2GEVA 4KYIB 2CL6X 1QG4A 1R6BX 2FWRA 2GF9A 3P4XA 1P6XA 3B5JA 3IIKA 5L3SB 3ZVLA 4MGIR 1GP2A 2FMXA 4QHYA 5JJLA 5EJEA 1R2QA 2IEZA 1VHLA 3RSLA 1XP8A 1VCNA 2X77A 2QMEA 1CJTC 3LW8A 1W36D 3OIUA 4S35A 2QRNA 1EFCA 1KK2A 2GK6A 3I3SR 4DSUA 2O8DA 2GDJA 3GFOA 3TH5A 3QKUA 4B3CA 4V0ME 1DAGA 5ELXA 2FEMA 1CS4C 3RHFA 3T1OA 1SXJA 3P27A 5HR5A 1SXJD 4B33A 4P0TA 4BECA 2NO7A 1TU4A 4N3NA 3T5DA 3KQLA 1E99A 1JR6A 2O8CB 2VF8A 3K9GA 1T3LA 2FFAA 2RB4A 1G3UA 2FPKA 2FSFA 2XOKA 3AV0B 4GSYA 4MYTA 4KO8A 2A3RA 2XOKD 2RGNA 1CEEA 4ZI3A 3GLHA 4FMDB 4NL4H 2JLQA 1W4RA 4LK2A 3TR5A 2VSXA 1FPMA 2FGJA 2ZJOA 4FXPA 4LYHA 2FPLA 1CU1A 3MUFA 4HYYA 3LBNA 3BIFA 5DISB 1VIAA 3BOSA 4M1OA 5LB2A 3WMGA 2V3CC 4PPNA 3FMFA 3BB4A 1E2HA 4A2WA 2VTKA 3PCRB 1RZ3A 1SKYE 2IXGA 4QNRA 3TUJC 3IQWA 5AJWA 1ZM4A 3AVPA 2QMUA 4PX9A 5DYIA 3VR5A 4Q47A 1BKDR 1NIJA 3BS4A 3PEUA 4LC0A 1Z0KA 1QG2A 2XZLA 4PC3A 1SVLA 2ZRFA 4MKIA 4OKSA 2QT1A 1US8A 1PV4A 3TAUA 3R9XA 2IYSA 1KI6A 2ZJAA 3FDIA 5KO2A 3KUCA 5GJBA 4OHZA 4NYMR 1G9XA 2OBNA 3RWOA 1R0ZA 2AFIE 1PUIA 4TMZA 1JQLB 3PQCA 2ZS9A 4TTRA 1X8KA 1OV4A 3FGNA 2D4HA 621PA 2GKSA 1OXXK 1ZMXA 1N0WA 2VPPA 4BQSA 4EJSA 1MOZA 1OPXA 4FD2A 4LY6A 3CRVA 5DNYB 1T5LA 1CJUC 2C8VA 2QPAA 4DLUA 4E5UA 2BEJA 4ILEA 1OB2A 2QENA 1BMFA 1G21E 1BMFD 4TTQA 4MRVA 5KSYA 1KK3A 1FW6A 1Z47A 2GXUA 1JXMA 1IY2A 1KO7A 1S1MA 1N6KA 4JYBA 3WBKA 4A0GA 2X2EA 3U6BA 2RGGA 3ZQJA 1R4AA 1E9CA 1BOFA 1S2MA 3PV0A 4RZUA 2X8AA 5K8IA 1J99A 3H0KA 5L3VA 2J0UA 1UF9A 1T8UA 2JDIA 4A15A 3HYRA 4DC9A 4CRWB 2JDID 2GCOB 2YOHA 2J3EA 1KMQA 1NKSA 2NO6A 4TQUS 4B48A 1XXHE 5B30A 1JXOA 3SHFA 3K70B 3CWZA 4A6XA 1UPTA 4PC2A 2QG6A 1W49A 1J7KA 1KNXA 1MO3A 2J45A 1RPZA 2CLDX 1YZGA 2D3WA 1Z06A 2AR7A 1KO8A 1WCV1 1MRNA 1K5DA 1MABB 3GQBA 3R8CA 2JLUA 2D2EA 1N6IA 2UKDA 4BWYA 3B1ZA 3LQRA 2A30A 3SU8A 3AVOA 1AKYA 1II8B 1NJFA 2GVZC 4TQ9A 2QAJA 5AR1A 1VG8A 2I3BA 5K8LA 2CVFA 3IGFA 4ZDWA 3SI7A 2GETA 4F4CA 3VR6A 1NVWQ 2VL7A 1CR4A 4Z51A 4RVCA 4AWXA 2QMOA 2FF7A 4AK9A 1NY5A 1HA3A 2QTVB 4HB2A 5FUXA 1XTSA 1MH1A 2CK3A 3EIQA 2ZETA 3VR2A 4JVSB 2G3YA 4GOJA 4JJZA 5KTYA 3WBJA 2JLXA 3HWSA 4HZUB 1G7CA 2AWNA 2F9MA 1E9BA 1S4QA 3M4YA 4HDQB 3LO5A 4W9MC 2CXXA 2VHCA 3TRFA 4B43A 1F2TA 1KI4A 3K09A 4KLNA 4LV6A 3DPUA 4NCJA 4XH9B 3ZQ6A 1XD8A 1R5BA 1XJCA 2GTPA 2XGJA 1A7JA 4MUBA 2C2HA 1N25A 4L9SA 2WJHA 1YR8A 2GJ8A 4HUQA 3B78A 4LJ8A 3X1ZA 1A2KC 2O8EB 2J9RA 2V4ZA 1U0HC 4B3BA 1G6OA 5F3WB 1OXSC 4IXMA 2QQEA 4AKEA 1AN0A 4UXJA 4HATA 1F6BA 4RJLA 1F2UB 5CITA 3ZD7A 1AQYA 1KKLA 1HYQA 2YV5A 3PFIA 4Q4HA 3CBQA 1G20E 1QDEA 3F8TA 1MRSA 2JJ2A 4BFWA 5J4YA 2DPXA 4P4TA 4YMSA 1G8GA 2JJ2D 3L43A 1K5GA 4FMBB 4QL3A 1XPRA 1P60A 4QJ5A 5KSOA 2PT5A 3CRW1 3PUVA 2OFOA 2VP0A 3QJYA 3SS8A 3KX2A 3V4RA 4II7A 4DLRA 3LQQA 4KSBA 1GKUB 4OQMA 4G5RA 2PZFA 2OE2A 2WICA 5JJKA 3RANA 3BBPA 1NBMA 1A1VA 3IEVA 2Q9BA 2JATA 3SJBA 1NBMD 5L3QA 1TMKA 4RY2A 1VYVA 3W5IA 1OF1A 3K53A 5DLQC 5JHGB 4PPFA 2GBLC 4XJXA 1G3RA 1KAOA 5D3QA 4YMWA 5BN5A 3SQXA 2ODBA 2W2VA 3FKQA 3AVUA 4QM6A 3ZH9B 4K81B 1PVOA 4F38A 3QXHA 1CKEA 2WMOB 4Q9IA 3Q3JB 4JLNA 1UKVY 3I1FA 4GOKA 2WOJA 4KSCA 3QVUA 2FFQA 4QGGA 1TUIA 1TUEA 4PANA 2FZLA 2FH5B 2C9YA 2OCAA 2KWIA 2MMCA 1DOAA 2B7CA 4KYUA 3SDZA 2WVJA 4ARZA 4M9SA 4DLTA 821PA 3A1SA 3WY9A 4P3YA 5IRCD 2YWHA 3AVTA 4KAXA 4A8JC 4JLPA 2WWXA 1P73A 3DDCA 4DZZA 4L16A 5E7MA 1JALA 1U8ZA 3ZLJA 4ACBA 2WIBA 2ZVQX 5HZKA 3NH6A 4HI0E 2J0VA 4PZZA 1DO2A 1MO5A 3I61A 3HPRA 5JSZA 1ZNYA 2J46A 3SJZA 3KQUA 2Q3HA 2I1QA 1GNQA 4DJTA 2NIPA 5P21A 3EZ6A 4O25A 5JFGA 1G4UR 4WXPA 3SYKA 5CDFE 2AX4A 3IDQA 3OF5A 5FBLB 5IDVA 5CIWA 5FBRB 2R6AA 4BFYA 1ZNWA 1NN1A 3CONA 5DN6D 3P4YA 4Q9KA 3T1VA 2IXEA 3THOA 1W44A 1IXSB 1LNZA 4WIAA 2HUPA 3A58B 2TMKA 2ZRHA 3WNBA 3OEHA 4GL2A 1UBFA 4MDEA 4IDPA 3OEHD 1DARA 1RFLA 2KI5A 2WWHA 4QBGB 4QGHA 3Q5EA 1KDRA 4HLDA 3R7WB 3GLIA 3GLFA 1G7SA 1X3SA 2WM9B 3I92A 2DWQA 4B3FX 4OHVA 3BAFA 4CT5A 2PEYA 4TMKA 4CW7A 1KI2A 1EGAA 1Q20A 3UWOA 3FMOB 3I73A 5EP4A 3MAAC 4YQFA 4R98A 2QL6A 4TLEA 1RVDA 5C46F 3L8YA 1SZPA 1I4LD 4LHXA 3DM9B 2JJ8A 1KZ7B 2DFNA 4FINA 4GP6A 4QG7A 4EAQA 4AKIA 4HAUA 4TYYA 3OAAA 2W00A 1EESA 2CJWA 2V54A 4WVFA 2ERYA 2O5VA 4BRUA 2D74A 3KJGA 5FUVA 1FL9A 1SHZA 3IIMA 3KFXA 5E7JA 2DBYA 2F3RA 1A2BA 1D8TA 1VG9B 3BJIC 2QAGC 3S1AB 4OHYA 4Q19A 4DLYA 5G41A 4PSVA 1MKYA 4R9UC 1NY6A 4LBVA 3DZDA 1JEDA 3T12A 4URYR 4YLGA 4LJ5A 4Q4AA 1XEXA 2BBOA 3X1WA 3AQ4A 1ZD8A 4Q21A 2FX3A 3SFZA 2ZRNA 1E2EA 1XBTA 1N6PA 3ZVRA 2IS4A 4G3XA 3GLGB 4CEJB 5JRJA 1YJ5A 1ZM2A 2PX0A 4C2TA 1RRFA 1ZIPA 2BVNA 5EE1A 1OH6A 3NDBB 3TVTA 4HB3A 3THXA 1R0YA 2WKPA 2R6DA 1UDWA 2WBLC 3UIEA 3M1IA 1CIPA 3AGPA 1GL9B 1M7BA 5HCNA 4MQBA 5LBIA 1BIFA 1F5NA 2ZI7A 2GF0A 2LKCA 4W5JA 3VHXA 2HLDA 2JJ1A 1RYFA 1TNDA 1OKKD 2HLDD 2ZAOA 2JJ1D 4EFNA 5JRZA 1TEVA 4F4IA 5CK5A 4LWZA 2PJZA 3WHLA 4P33A 3NG1A 4TMTA 3U7EB 3EPLA 5FH9A 1OXUA 2QA5A 1MO4A 3R9IA 2Z6VA 3ETLA 3NDPA 1I2MA 3WRYC 4LBWA 1CR1A 3RS0A 2QMHA 1WBBA 1UEIA 3VNUA 2QPOA 1Q22A 2W6JA 5FTMA 1G7TA 4MGZR 2OHFA 1P9WA 2IX3A 1H8ED 2IF0A 2WWGA 4I4LA 1FFHA 2K5UA 4P4SB 4B75A 3M6AA 3B85A 1UKYA 4LJYA 2V7QA 3REGA 2V7QD 4TYNA 4LBZA 2WAXA 2VHJA 3DHWC 5AJYA 2ZRGA 4NZYA 1G291 2GA8A 1CXZA 1D2NA 2HF9A 2GXSA 4GMXA 5JJIA 5JEEA 2C9CA 5L3SA 3W3AA 3CZPA 4JLAA 2ZYTX 2UZIR 1CTQA 1U81A 1T4GA 4V03A 2Z4SA 4XTCS 2ZR0A 4MDFA 4GI7A 1W0KA 3CF0A 1ZVQA 3PEWA 1S3SA 1W0KD 1JQJC 4JSTA 1T3HA 2FPMA 3DMDA 4BRWA 5EE3A 3CF2A 2Q21A 2F3TA 3ECCA 2X2FA 2SHKA 2J7PA 1UKEA 3VNVA 4IOLA 4IXNA 2IYQA 1P72A 2J7PD 3CWQA 4IRUB 4DCNA 1QZXA 1FUUA 1J8MF 3EWAA 4LI0A 1DAEA 1QVRA 3EXAA 1U8YA 1AK2A 5LDDC 2ZRJA 2XNDA 3ZVNA 4IOKA 4B3XA 2IT1A 2XNDD 2CCKA 3V4FA 3IIJA 5CJ2A 3AVVA 3LX5A 3HJNA 3TKLA 4ZV4A 2ZRAA 1ONBA 1LW7A 2L0XA 1Z0DA 3BH7A 3CNNA 4AG6A 2H1LA 3DMNA 1W0JA 1ZRHA 1T0HB 4URWR 4QHTA 1UADA 1NSFA 2RGAA 3QKRA 1N0UA 3MLEA 3OHMA 4IEIA 4MITA 5DO9A 1JI0A 1AQUA 1XPOA 2GAOA 4IW3B 3KUDA 1N3BA 1QHHB 4LUCA 1E9DA 3EA0A 3Q8XB 2A9KA 3BWDD 2AD1A 3W8RA 3L8ZA 4L9WA 1DAMA 1U0JA 4MUAA 2XB4A 2HJVA 2GXAA 4TZ0A 1Q1ZA 1XWIA 1NLYA 2WJIA 1SGWA 3K9NA 1E9SA 3CX8A 1M6NA 2B7BA 1Z2CA 1ZM9A 2C95A 2PZEA 4HSEA 4AURA 1JECA 4D0NA 4R7ZA 2ZSFA 2FV8A 5GADl 3CR8A 1PLKA 4NPHA 1IONA 5EXTA 3IO5A 2D7CA 4DEXA 1G3IA 2QORA 1MR3F 3UMSA 3U3JA 5KNDA 5J4KA 2IS1A 3IQXA 1GG2A 1HV8A 3CPEA 3X1YA 1DVRA 3EA5A 2FFHA 2H7VA 4UKDA 2LWIA 5FR2A 2XB2A 4QC2A 1RC8A 1LFDB 3IKJA 2CHVA 3D3QA 2ZXUA 1IY0A 1ZUHA 1N6NA 3QXXA 4RCZA 2G77B 1TPZA 4BLPA 3ICQB 3GJ7A 4IDHA 4Q9HA 2GESA 1H8HA 1OH5A 3PIRA 4DCSA 2QU8A 1H8HD 3IBYA 2F9LA 2G83A 4Q9JA 4KVAA 3K70D 4A36A 2C78A 1GILA 1FTNA 4UNRA 2KE5A 5AJZA 2ZUBA 4ACAA 5HKKA 2ZITA 4Q66C 4D0GA 3EX7C 2GEDA 5HZHA 5BQ5A 1E9FA 2PMDA 2GEUA 4A8JB 5FL7A 3QOFA 1MABA 1DAKA 1ZD9A 3CW2A 5FL7D 3NBYC 3LVQE 5DYGA 2PCLA 2VRWA 2ATVA 4XVRA 2IC5A 3BH6A 1II8A 3BD9A 2QY9A 3B60A 4U00A 3O8CA 4A1FA 5BWMA 4PTLA 4B76A 1Z0JA 3LH5A 3L0PA 1Q0UA 1U98A 4XVQA 2AL7A 1OXTA 4EPWA 4ZCIA 2XTNA 2C99A 1ZJ6A 2F1RA 2NZ8A 3OZXA 4I1OA 1NI3A 3FHTA 2A78A 2IUTA 4CDGA 3SYNA 3LDAA 1DO0A 1Z3IX 1U99A 3BB1A 1FZQA 3A36A 5TDHA 2F7SA 1Q44A 5GJWC 1YZNA 1BO6A 2QZ4A 4E03A 4GP7A 2WOOA 1JPNA 5FPTA 1UDXA 2BMFA 1TQ4A 3ADKA 3LBHA 3J81k 2ZIAA 1ZNXA 4HZIA 2ZR7A 4HZUA 4JSYA 2G6BA 4O2RA 5FL3A 5FPHA 5KSZA 4URXR 3TMKA 4WOPA 1JEEA 5TXGA 2F43A 3TNFA 2IBMA 4DSOA 1W47A 2NO9A 4LJ4A 4C0BA 4RD0A 4E22A 1N0VC 1ZM7A 2R8RA 2ECKA 5H8WA 3LY5A 3WP0A 3KTAB 4LX0A 4NP6A 4RZXA 3KB1A 1Z83A 4JVLA 4QHSA 4BLRA 2O8EA 1EFUA 1KI7A 5AUNB 4ESVA 2ZSBA 2QSZA 2WWIA 2P5TB 2YHSA 1E0KA 5AJVB 4D25A 1IJFA 1WQ1R 3ICEA 2B92A 4RD1A 1E2GA 1G8YA 1ZD1A 1PLLA 1Q1EA 1QHXA 5HTKA 4ESHA 2CMKA 2D62A 2C98A 2ZR9A 1ZCBA 4B32A 4QM7A 2F6RA 3EZ7A 3GCGA 3U3KA 1E2DA 3PEVA 1VKJA 2A5JA 1RRCA 4TYWA 1SQ5A 3GEHA 2WV9A 3QG5A 1JBKA 3NTUA 2QAGB 3RC3A 1TQDA 1Z6XA 1JAIA 4Q03A 3E1SA 4BLSA 3VHLB 1IXRC 4WZ6A 3U4QB 3A1TA 4DDUA 2XTMA 4PHHA 2FOLA 5FOWA 3WMFA 4DRZA 3UG6A 4DLVA 4BFVA 3ASZA 5JLJA 1WF3A 4TMVA 1XCGB 2IHBA 2J0QA 5C18A 1E2LA 2J1LA 2QP4A 1NN3A 2P67A 4I1UA 3SJAA 3WP1B 3F3YA 5E3HA 4LYAA 2A2ZA 2ZUDA 1EWRA 4LC1A 3QEOA 3RS7A 3K8YA 5CM8B 3Q72A 3PVSA 2GCNA 3L0SA 4MYCA 3KJHA 1E2KA 4JLOA 4JLKA 4QXAA 4WZAE 4U02A 4KFUA 3U7GA 3ADCA 4IDQA 2EFHB 2KBFA 3R9WA 1E1RA 3EG5A 3I8XA 5TMPA 3U61B 1E1RD 1R7RA 2QBYB 1UBEA 1W4CA 1ZNZA 4HUTA 2KSQA 3B13B 4D0LB 1GL6A 4KHZA 3RYTC 1YHNA 1H65A 3VKHA 1D9ZA 1HT1E 1NJGA 2H17A 3GJ4A 1P7CA 1AIPA 4TLBA 3ZVMA 1GRNA 4KV9A 5ANRB 4DHEA 1G8HA 1GTVA 1XEFA 4BEJA 2ZM5A 3RVBA 2WSSA 3C8UA 3JZAA 4WW0A 3WNDA 4D81A 2WSSD 2LCFA 1KY2A 2XTZA 1M8PA 3L2OB 1Z08A 1KI9A 1A5TA 3CUEF 1E98A 3DO6A 3HU1A 2ZPTX 4PSKA 3TBKA 2C5LA 1KJWA 4RFSB 3R20A 4BFSA 3U7HB 4GDFA 2BWJA 2IYVA 2NO1A 3AUYA 3NC0C 4OI2A 4QJ4A 4XD7A 2B6HA 3ADDA 4XD7D 1NG9A 3KQNA 3HPQA 4KFSA 4Z8XA 3VX4A 4PAMA 4C0LA 1OXVA 4DCTA 1GRRA 1NMYA 4D4JA 3EPJA 5UKDA 1RRPA 1UBGA 4I1VA 4FCTA 2OAP1 5CYPA 4B2LA 1NLFA 4CEHB 5DI3B 3CPJB 4FCVA 1IJEA 2EFCB 3SJCA 1XB2A 3VR1A 3CRQA 4G5SA 4AKHA 1Z07A 1JR3A 421PA 2CHQA 1JR3D 4O3MA 1II0A 2C04A 2MSDB 5IHPA 1FNNA 4RZ3A 4HLUC 3V9PA 1UEJA 3NKVA 1Z6YA 5E4FA 5HE9A 3TAHA 1SHKA 1E2QA 2BM0A 4FMCF 4PO9A 4URZR 3R7WA 2FFBA 4OI0A 2ZRDA 2IYYA 2FGKA 2QQ0A 3RABA 2QSYA 3REFA 4QOSA 5CYOA 1ZYUA 2XEXA 2RGXA 2ZROA 3QKSB 4C4PA 5FBQB 1QF9A 3NC1C 2ZQ5A 1SXJE 5EZ6B 4ERNA 1ZINA 2OZEA 3THYB 4B2IA 3O8BA 2ERXA 3G0HA 4KFRA 1M34E 4LGMA 4PO1A 5EQTA 3VU9B 1TEXA 5DHAA 1Z6AA 5FOSA 1KGDA 3C4JA 4NTZA 2YYZA 1SKYB 2NOAA 3W6NA 1CF4A 4PAQA 3GLHE 1SVOA 3OIYA 4OBEA 3EPKA 2BCGY 1E9AA 4M1MA 3S1AA 4JL6A 4XVUA 1G16A 4JT4A 4IDNA 5EUQB 4ON9A 2BMJA 4GOXA 2RMKA 1NL3A 1OE0A 3BXZA 5AUQA 3TE6A 1P9NA 3A4MA 2O8BB 4B2PA 3NXSA 4GNKA 1WP9A 5EXXA 2ZJBA 1W7AA 1G19A 3IO3A 3AB3A 3GLGA 4CEJA 2OLKA 1IY1A 2OXCA 1F3OA 3PG5A 3DEFA 4AY2A 1OLOA 3N2EA 1KI1A 3KZ1E 3TSWA 4RD3A 3QG1A 2ASEA 1Z0AA 2OBLA 4IVQA 2WJGA 3T34A 2Z43A 3UK6A 2J41A 3E70C 4UNNA 4WA7A 2VBCA 2IUUA 1UJ2A 2ZU0C 4JBXA 2JCSA 4DEYA 2HT6A 1VYUA 4PO8A 1RKBA 4M0LA 1XTIA 2A5GA 1T3SA 3ND8A 5KSPA 1EX6A 1XD2B 4L4UA 4M1YA 2REXB 4DIDA 1OIWA 2P2LA 2BCJQ 3RDPA 3NBXX 3JZMA 2C77A 3LA6A 4WAUA 2OO7A 3KXIA 3VR4A 2JAQA 1PLJA 3DKVA 3OFNA 3SQWA 2BKUA 1KDTA 3ZIAA 3OFND 1AZSC 3ZIAD 2HYDA 3LLUA 3NHBA 3RWMB 1NMZA 2EWVA 3UMFA 2XSZA 1XXHB 4GBMA 2H92A 2ZYUX 1DTSA 2XSZD 2OXRA 3ZZUA 4M9QA 4YONB 1U90A 2ORVA 4BZXA 4U7DA 2GK7A 3SZRA 4ZCMA 1FMLA 4PQRA 2WWYA 521PA 2EWWA 1YZKA 3DKPA 5TVKA 4P4SA 5D3MB 2QM7A 4BEBA 3G82C 1OYYA 3O8DA 3CKLA 3U2QA 2YKGA 1JJ7A 2VLIA 5LB4A 2O8DB 4C3ZA 1YR9A 4A4DA 1N2CE 4Y0AA 4G5OA 4IFEA 3QF4B 1V5WA 2QUZA 1W2GA 2CLSA 2ZI4A 3I72A 1Z29A 2AHOA 1P2VA 1SULA 4HAXA 5K8UA 1CJMA 2BBSA 3GEEA 3M0EA 3DL0A 1NN0A 5KNBA 2IYTA 1T6NA 3VQTA 4FW9A 4F91B 4MGKR 1S3GA 2IYUA 1BS1A 1EFRA 2WPDA 3FMIA 3CF6R 4PXAA 4R2HA 5DHFA 1EFRD 2WPDD 4HAYA 4EQ6B 1Q12A 3B1YA 1XRJA 1HQCA 2G9NA 4ZCLA 3AM1A 1E9EA 3BK7A 5AJXA 4DT1B 6Q21A 3PITA 2H57A 3QQ5A 4V0NA 3ZGXA 4TLCA 4Q48A 3SC3A 3MRSA 5JBQA 4H9GA
chains in the Genus database with same CATH superfamily
2RBGA 1YAJA 1D7OA 4TZ6A 3EY9A 3L8GA 2JCYA 3GEBA 5DKFA 2LRHA 4URUR 5JAQA 2VUUA 1AKQA 4E70A 3AP2A 2X7JA 4U2FA 4P2BA 1HYHA 1Z6TA 2AH5A 2QN3A 2B4QA 1W2HA 2X8JB 3LO8A 3SR0A 2Q3LA 3V2UA 4ICIA 5KCMA 3PE6A 4BO1A 4MYUA 3L41A 4TS1A 5FOXA 4JBWA 3U5TA 4HWRA 4AI6A 1SD1A 3VSCA 2O8NA 2JK1A 3WHPA 4E21A 3PGMA 3RFCA 2JBWA 1YCHA 1B43A 5AM0A 1XRNA 1ZWLA 3OUUA 3BIWA 4MVJF 4ZU1X 1RLIA 3NBFA 3USES 4EUNA 5DGDA 2PLFA 2BMWA 2P4HX 2WDZA 1RM4A 2AHRA 3PNSA 4DQLA 4EMBA 3CX6A 2DHEA 3FRIA 3N76A 4BGVA 4HNGA 1E1QA 3IQEA 4WHMA 1G20B 1OX4A 4DC0A 3TNDA 1UFVA 1E1QD 1U1IA 1WVIA 3WWOA 5CHEA 4C7OB 2FW0A 4RVNA 2XCRB 3JTEA 1XJWA 2R79A 1DIOB 1Q0PA 1UDBA 4ZVKA 4ZAWA 2VDLB 1FTGA 4G86A 4PRYA 1DUIA 5JD3A 1RC1A 3I5UA 5DNWA 2ONKA 3FOBA 4MMYB 3VR3A 2BOVA 2D5CA 5BSRA 3DVQX 3VR3D 4R01A 3A28A 1Z5OA 3F7OA 2Y05A 3QLUC 2D2FA 4TKVB 3V6MA 2IPMA 2I2CA 1R8XA 3OMWA 1ACLA 2YNMD 3EXHB 3UJ9A 4D4KA 1DMSA 1NW7A 2GJAA 2G9QA 3U3OA 3FKSA 2Q6OA 1RHRA 4U7JA 4CCWA 3FKSD 3GFSA 5INTA 1NMSA 3MRXA 3RS8A 3LAWA 3FCUB 5CBPA 5BORA 4NWIA 1FNMA 4EVIA 3CVVA 2VC2B 4QUDA 4MYSA 2GAAA 2JJYA 4G1MB 1S89A 2DUNA 1X15A 2NXCA 4JOQA 1FSGA 4CF7A 4MZXA 1DKQA 1OLSB 3RSFA 1T5IA 4MLDA 4RKEA 1T0BA 3OCXA 3TMYA 5LXTA 3MTGA 5I4KA 5CT6A 1ML3A 4C22A 4G9BA 4IF4A 4JASB 1NI5A 2BHLA 1SB9A 4EG3A 4CXMA 1Q1GA 4WWHA 4G9EA 1LCIA 1PCXA 3FXAA 4FNGA 5FPSA 3FAZA 1TA0A 1S7GA 1QDLB 2VDVE 3WLAA 1DKOA 1T9HA 1Z28A 1OT5A 1TYAE 1RWWA 4NEGA 3MTJA 1H2EA 3AKEA 4IJ5A 1O94C 2GASA 3IUSA 2E9SA 4P92A 2Z83A 4RETA 4PN3A 4AS2A 1ZGGA 3FCEA 1OXKB 1JYEA 2HBRA 5IBRA 4CV0A 1UKAA 5F9FA 4A8JA 1GGKA 3UEOA 5IF9A 3H2ZA 4MRMA 3FPAA 4NF2A 1HQYE 3TR0A 4DM3A 2D6FA 1SUIA 4EG4A 3KKPA 2GBFA 4K6HA 4XSHA 2XYVA 5LVAA 3OJEA 5FHRA 3SSOA 1OKKA 2FETA 1EWKA 4GPEA 2BONA 4X6UA 4CQLA 4GWGA 4BVAA 3RUCA 3HP1A 1INLA 3FX2A 3L1VA 4BMDA 5J4VA 1LY1A 2I2DA 3AVXA 3IUPA 3AVWA 3VPCA 1LDEA 3R5SA 1S8OA 4JITA 1G8MA 3DOUA 1Z2DA 3H83A 3OO1A 3Q3HA 4EG6A 1BMDA 2VDNB 1VSUA 3MGGA 5LLSA 1EZZA 3ROQA 1P7PA 1VP9A 3SAJA 4ZQGA 3URMA 4HGRA 5A0VA 4C0AC 3PF8A 4BYGA 3ELYA 1CD5A 1BU5A 4IILA 3OZEA 3NHLA 4EVSA 5JD6A 5IC6A 4MUGA 2EDAA 4MV8A 3TM5A 1IN1A 4J76A 4QD3A 3QFCA 4FN5A 1U9IC 3V2GA 4Q4CA 2VHXA 2ZI6A 3H5RA 3F6RA 3GP3A 4RU1A 3UHFA 2OLEA 2BH9A 2RGDA 1DS6A 4LXXA 1N57A 2VXYA 4CPDA 4AU1A 3BH0A 3PFBA 3SBEA 2AUMA 2DH5A 4JJAA 3UENA 1OB5A 1LPBB 1SRQA 4GP9A 4CMHA 4II2A 2REQA 4MINA 1XRSB 1RWVA 3KTAA 3WE7A 5HKOA 2QD5A 4DIKA 3QNMA 4PCAA 1XD9A 3FDXA 3UC9A 3W9BA 4EMUA 1AVTA 3GLFE 3GLIE 1JIKA 3DWFA 7MHTA 1UK8A 1I13A 4H7IA 4P0QB 4BFCA 3M2TA 1GZ6A 2AE1A 5F78A 1V16A 2G67A 2OG1A 3B3QA 1FUIA 1RAIA 4TLDA 4AO6A 1FP7A 3OZUA 2FPOA 4IIVA 2HX1A 4MUXA 1YHYA 2LKDA 1FLAA 5DLPA 2WU0A 5L7YA 4N3AA 1VA5A 1Z5VA 4DDMA 2WHEA 4MVJI 4RACA 2I87A 3MWFA 4W5QA 3N0VA 1VMDA 2PANA 1QHIA 2OB1A 4Q7MB 3A32A 5TE9A 3VDNB 4PZUA 3GJ8A 2YL2A 4JLWA 4QXPA 4B09A 5HIAA 4YC7A 4ZK2A 1EHYA 3W3ZB 4D41A 1K92A 2Q6KA 4ZV7A 3I62A 1IN7A 1BWPA 2RHTA 2PR7A 5CM9C 1Q7RA 5G1OA 3CNOA 5DXJA 1G2IA 1J2TA 1PW7A 4A0FA 4BGDA 1FC0A 5M5BA 2O8CA 1MENA 1ZN2A 4RHCA 4TUYF 3CW8X 3UJAA 3T7SA 3ZJYA 4J9UE 1D6SA 2XUGA 2P1RA 3SEFA 2K6GA 1D5WA 2JIZA 3L84A 3HHPA 3RC1A 2XDWA 3JD2A 4QJBA 5DIZA 1DJQA 3WV4A 2JIZD 2IPAB 3KZXA 3QPUA 5LZ7A 3LYLA 1UMCA 2O6LA 2Q9UA 3AG5A 2J30A 3MTDA 1AO3A 5KMGA 1ZHFA 1QU2A 1CQIA 2R1TB 5CIYA 3X1KA 1SVWA 3WDKA 1Q1AA 1J9ZA 3AIOA 2OZLB 1CHDA 5JTTA 1TC1A 2GZDA 4PLPA 1LJLA 4OB6A 2QGZA 3A3KA 4Q0MA 5SZJA 3SX2A 5HWSA 4XR4A 3RJ5A 2FG7C 2XNSA 4QPDA 3B9BA 3H11B 2JD0A 3GV0A 1VIMA 2O1SA 1W8DA 3V8RA 4A82A 4NBTA 2ZANA 1CRWG 4H1UA 1XOIA 4RKRA 4X3OA 1W5TA 3PIIA 3PT9A 4JA2A 3QUTA 5ALIA 4ZOQI 4AW9A 3AIIA 3PR1A 1OXBB 4MIYA 4NOLA 4D8VA 1ISFA 5ALPA 4E6PA 3KJQA 1I1QB 1XEWY 1PVVA 3C7TA 2I4OA 2XHEA 1UINA 3PQ6A 3KJEA 1EA5A 3W2FA 2DKNA 1A4XA 1SG9A 1L7AA 4M0KA 4I50A 3WJ2A 5JWHA 3K8OE 5FAXA 2OXFA 1FFEA 1JVBA 2I3AA 2QU7A 5LKRA 2CLCX 4WX2B 1E8DA 2YW2A 3RJMA 4AX4A 1Z82A 5DGXA 4LI3X 3HO8A 4X8HA 2Y3IA 1PKXA 5IKXA 3LG2A 5C1BA 4R8SA 4UBNA 4R1TA 4XTRA 3D6TB 2IYEA 4KXUA 5K4AA 5ITVA 1WXQA 1K6XA 1RXIA 2O48X 4HH4A 4LQCA 2WFZA 4C0HA 1A7AA 3IHLA 3JQGA 2DCMA 1JAHA 2PDAA 4PZCA 4DA4A 2OT3B 1KDYA 3BG5A 1GG9A 1BRMA 3K96A 3CLKA 3FLMA 1ZJ5A 3BPSA 2I71A 3T1QA 4EB3A 1DAIA 1CUHA 3D3WA 4LGVA 5EJGA 3BTVA 3LP6A 4JVMA 3KDSE 1KZ6A 1T5TA 2IF2A 1CZOA 3U13A 3Q1KA 4EW6A 5LDHA 4BU1A 4NX2A 4HLCA 2GCOA 2VHZA 3E3AA 4ZOLF 3B6EA 5LZ9A 5G2OA 4DLZA 5LQDA 1ZVMA 2VBIA 3LC7O 4XQCA 2Y93A 7YASA 5L45A 4EUEA 3N7TA 3KLPX 1GYQA 4U8GA 1RHQA 2BGTA 3BSWA 1K9SA 5JMTA 2IS6A 4QYMA 4PRZA 3RNLA 3NMUF 2DG2A 1NC3A 5JNWA 4AJ2A 1V45E 4ND6A 1XLUA 5IDYA 3VBCA 1QMPA 1PR9A 4M7OA 2FCRA 4E4RA 4IBOA 5AOAA 1XDUA 1P9LA 4NZPA 2H2DA 2VI5A 3DZ8A 4HXGA 3GGDA 1H22A 1TK3A 1GRQA 3A6HA 2EAUA 2RHDA 1UWVA 1A98A 3C43A 3MJSA 3OCUA 3PHBE 3HC7A 3RSSA 2XEDA 3V7UA 1GTL1 3MWDB 2P1ZA 4D2IA 3UAWA 4FWBA 1W94A 5EINA 3ZK8A 2LNDA 3KEGA 3UMBA 1LLDA 2BSAA 4ZDJA 3VU9A 3TD6A 3VSBA 4R1QA 1N5LA 3MOGA 4G25A 1QRDA 2RCYA 2R6FA 1DG1G 3ZY6A 1G3MA 1CUAA 5L40A 1PGPA 3KVYA 5ALQA 4EGSA 1Z35A 3GQVA 4NABA 3ZHTA 1YIAA 2NZ2A 2YOGA 3EZLA 3LX8A 2X3UA 2BHSA 4I2NA 4I4TF 1VBNA 2QTVA 6YASA 4TL8A 3K4PA 5AI9A 1VBFA 2X6RA 5FYQA 4G56A 2JD2A 4DA0A 1VP3A 4K87A 1Y4DE 1WZUA 1V8OA 3D8HA 3EAQA 3H1PA 3LX4A 2BKVA 4HAWA 2PWZA 1E32A 1RD4A 3ROKA 3HZZA 2CEKA 3SQLA 3ZCVA 3FWKA 4PX5A 4IH4A 3EZ2A 1TX4B 3CR3C 3HDHA 4HDKB 5CNJA 1DRKA 2I9KA 4EKNB 1YQQA 2VA8A 5JVDB 2DP4E 1QS0B 3C16C 3D4NA 4IJWA 5DV9A 1W25A 2BJHA 3KSRA 3PLNA 4OXYA 5J4HA 4QGFA 1I2DA 3T3IA 4M7RA 4M8IA 5DXFA 4HOYA 3RS9A 4M1ZA 1E2MA 1JEJA 1UL1X 3GA5A 3PUWA 6REQA 4PNHA 4V0KA 3NEJA 1HK7A 1XF1A 1T1GA 1SQGA 5C34B 1DWOA 1VE5A 4HRVA 1XD2A 1BKSB 3OHSX 4FC7A 3RUIA 1AHPA 5LOVF 3TSCA 1G21A 3F1LA 1K08A 4KX5A 1TAHA 4IOJA 4A73A 1QGYA 4N3BA 5KTMA 1LBSA 2VR1A 4JUDX 4BWGA 4BXOB 1Z0FA 4LVNA 4R69A 1KJ9A 4XSVA 1UZNA 4WXYB 1YQTA 4X8OA 1EAMA 1O3YA 2DQ4A 3MCAA 5FA8A 5C7IO 1VBKA 5F2EA 1L4EA 3IA2A 1EQUA 5AKHA 2C2BA 4AS3A 4F9TA 2GCIA 5KTRA 1BDMA 1F38A 3D81A 4HLQB 1YONA 1U7HA 4J07A 3R7SA 3C6MA 3GEIA 4NYJR 3QELB 3J7AC 1NYTA 2BEKA 3KUKA 4R1SA 5ELMA 2HHLA 1ZJ4A 4LF8B 2W2TA 3QMVA 4RSRA 5K0TA 2IK8A 3LV8A 2CBZA 4YRBA 1BXZA 4JLDA 3FDZB 1JDBB 3LHIA 5DI9A 5FUXA 2XX3A 1CLUA 3MXOA 1TGVA 3H6HA 4ID9A 5K6AC 2REOA 1T2VA 1VPTA 3GD5A 4RNDB 1WE2A 4CUJA 1F1JA 4YAKA 2J4FA 4B74A 1AKNA 4BTVA 4Z54A 4KI0A 4HPJB 4M7PA 1E4VA 4M1KA 1MOSA 3E1KA 3PRHA 3PR3A 3D6HA 1L4NA 2ORED 4MW6A 2ZB3A 4NZOA 2JGDA 2Q41A 3U0BA 4Z9AA 2DFPA 1UJCA 3OZVA 2WTXA 4FE7A 4KXYA 2H1SA 1HE8B 2IP2A 4BFXA 2B82A 1A88A 1QGED 4UVHA 2EFDB 5B2ZA 4BC1A 1T9BA 2WKQA 4D8XA 4PCUA 2EFGA 4EQ6A 1MG0A 3A04A 3ST7A 2QRPA 4FKBA 3ZEIA 1SKQA 3JD1A 4LG1A 4YO7A 3Q15C 5LYJA 1VFNA 5FOVA 4K86A 1CDZA 2PJDA 4G8JA 1TA9A 1ZAYA 4QUIA 4JELA 4W9NA 1YNSA 4J6FA 4RUKA 1ZBDA 4INOA 2A0WA 1JAXA 1JFFB 2JBAA 2ENUA 3CLVA 5T3UA 2D59A 3DAFA 3QKRB 5CVCA 4MW4A 4DCUA 1TJPB 2PXAA 4GZ5A 3E8XA 3RVLA 2IYLD 5F7XA 3IUYA 3Q9UA 5FOTA 4G09A 3AU8A 3DC7A 5B3JC 1W6RA 4GR9A 4A0RA 5JYCA 4X71A 5TS2A 5C7YA 2IEBA 4XCXA 4B6RA 2C58A 4C4TA 3K09C 4PHGA 1I32A 4KR6A 1LLUA 2FLKA 1L4KA 5SYMA 4UMFA 2C96A 2GPWA 4CM6A 3VAZA 4EDHA 1LTKA 4F8JA 1VTKA 1UBSB 4HAVA 4HGOA 1D9XA 2R62A 3BKWA 1MJHA 1RXEA 1Y33E 2IZ0A 3O4IA 1GAWA 3A4YA 4EI8A 2Y1OA 3NVAA 5DH9A 3C5HA 4EI9A 3UAYA 2CFRA 2GCPA 2X4DA 4RF3A 3SEZA 2OCIA 3WSVA 4HT3B 1L4MA 4H59A 3DO5A 4U7PB 1SKBA 4R6XA 5DM1A 4C0WA 5AW3A 3V1KA 4QFDA 2VSOA 2H48A 1PJCA 1TCAA 1X6VA 2BHTA 1PJAA 4QELA 5BPFA 1FDIA 3B7GA 3B6ZA 2RH8A 4LHYA 2HQRA 1UJ5A 4M6WA 5DMHA 3W6OA 3OQMA 1ISMA 1NKVA 1XTVA 2G4LA 2Q8PA 3IEIA 4OCZA 1V8ZA 4GF5A 5G3ZA 2FB9A 1NBEA 3FF1A 3JTMA 3O47A 2FW1A 2QZZA 2FX2A 1J0CA 4L4YA 3X0DA 3VC7A 5CGQB 4AWBA 3DP7A 3WWPA 2RH5A 5DK6A 3ZWVA 1KSHA 4L74A 4NAHA 1JB1A 1IBRA 5KYUB 5KDDA 3LOUA 2OV1A 3VU3A 3WB2A 5A62A 1TK2A 3H2JA 4IGAA 4DXHA 2ZM6B 3GFPA 1TZCA 1HSZA 1FZTA 3WGTA 4D5GA 4YJ3A 3G8BA 4NH0A 5DWQA 3HB7A 2R8XA 1IUPA 1SPBS 2C0PA 3SX0A 1MP0A 3ZWBA 5A4IS 4IVPA 2JLYA 1KMCA 2G40A 4OXXA 4WN3A 1F0YA 1KSFX 1EVYA 2YIDA 4BVGA 1F14A 3QVJA 4WXRA 3PL5A 5B1SA 3QYFA 4B8ZA 3UM9A 4WECA 5D5HA 5IC5A 4D0SA 1ZR4A 5KBYA 4XCVA 3ZZMA 3C3YA 1TIBA 5DGHA 4I55A 5HZMA 2O0HA 3MD9A 3H2YA 2ODNA 1YWGO 4HYQA 1BXRB 1UK9A 2NPFA 1OCEA 3JYOA 5BSKA 3EXIA 3B1XA 3GDOA 221PA 4TTVA 2ZAYA 4UBLA 3L6RA 4WFQA 3RGWS 3AFGA 4YASA 1NT4A 4UEJA 3HN6A 1T25A 3WNVA 5EA2A 4RFVA 4OOEA 4OAQA 4I8XA 4RM2A 3ZQ4A 4RENA 3KQYA 1IXZA 2PCJA 2NU9A 4NBSA 1T9GS 4LDZA 4F85A 5HEKA 1JJFA 3KDPA 1PD0A 3V00A 3A6FA 1P81A 2AB0A 2WVGA 3PNYA 4FX2A 4KP7A 3II6X 2IEYA 5IT0A 2J9ZB 4ZAGA 1M5RA 5HIIA 5KPDA 3U40A 2CK3D 5AESA 1YQXA 4I3FA 1ESEA 1RJ9A 5F3RA 3H5NA 4RH1A 2A9PA 4ZEXA 3OIWA 1Y63A 5JRDS 4XE5A 3E3OA 2UUAB 5SY4A 4M7WA 2O2HA 1VKHA 3GPDG 3LTEA 3SJ7A 4IKEA 2EVWX 1A9OA 5LXTF 1M66A 2XZPA 1EFAA 4EEXA 3HGQA 3O9MA 4D45A 2MYNA 3DCYA 1BWSA 3DF7A 4MGEA 4Y9RA 1DC6A 1RAHA 4TUYB 4ZAYA 4BO9A 3FM9A 1S1CA 1EJ0A 3BC1A 1S9HA 3BCUA 2YMLA 3CINA 2HHAA 3D7MA 3EW7A 3ORHA 3EIHA 2ZPAA 4XYBA 1K1EA 3E9RA 3BERA 4AT1A 1MO6A 1ZD4A 5ALVA 3LXXA 2QE7A 2QZPA 5F2NA 1OZ0A 1OAKA 4P4NA 2QE7D 3DDZX 5CLQA 4HLUA 2X13A 4OV6B 3ZJ4A 1Y6ZA 2FWPA 2QB5A 4Q1AA 4TQGA 1DDIA 4BVLA 1JR3E 5AUPB 4V1CB 1QB8A 1R10A 3BZUA 4V02A 1W36B 3OQ1A 4JXKA 2VKTA 3PNMA 3R3VA 4R2XA 3LOQA 5ALJA 3HSKA 4TKLA 4YR7A 1ZX1A 2BGMA 2HRBA 4M21A 2GHIA 1MFZA 1EMDA 2EKBA 2PH7A 2W8BB 2N0SA 1NI4B 3C97A 1FOEB 2AXQA 4I1SA 4BUZA 1XVUA 3OWOA 3CCCA 3A6JA 5LMZA 4L9RA 3R0JA 1GA6A 3FRHA 1M8JA 4B6SA 2W43A 2BE9A 1TD1A 3RBZA 2OPHA 1DXYA 2NZXA 5DHQA 1A7KA 5A5VA 1YRHA 5E38A 3PQ8A 3VKWA 4A3SA 2HQBA 3IOMA 4ALLA 1IXYA 1XRPA 1HORA 3NHJA 4BTEA 4TRJA 4DV0B 4U2KA 5KQPA 1C3OB 1FDSA 1L7QA 3U44A 1TM2A 1VHQA 1TT5A 2CNWA 2OILA 4JQZA 2WUWE 3LXRA 4PYRA 4WPGA 4FOOA 2CNWD 3OE7A 4D4MA 3VTKA 3OE7D 4IHJA 4BE7B 5JZVA 3LRPA 1KVRA 5SY9A 4UEOA 4X65B 1UBCA 2Q7XA 1IQUA 2IPLA 2OWEA 1O4VA 2ZSAA 3I2GA 3TW8A 2YUIA 1NSTA 1ZOOA 1Y1QA 4AQ7A 1MEOA 1WY7A 4BNGA 1LS1A 3KPYA 4UE3S 2I6UA 8OHMA 1RTKA 1GRCA 4HRYA 1RMYA 4BFUA 5KPJA 1O08A 1YJBA 1ZC3A 16PKA 1X1CA 4QPJC 4DC1A 4PFKA 3B36A 3TB4A 4CGYA 4EB6B 1Y7HA 1FJGB 1W30A 1ZWKA 2ZJ1A 2QVXX 1MPTA 1Q0SA 3H5WA 4RFLA 5EXPA 3PEEA 5F3DA 3SBXA 5AWFC 3TK1A 1JWLA 1RMTA 4ZOLB 4H7EA 4CR6A 2XAUA 3GJ0A 3WTBA 2ZIEA 3G0BA 4RD6A 2QROA 4IIYA 4KU4A 4OQEA 1E2JA 2Z4RA 5G40A 4CU2A 4JI4B 3W77A 1G4HA 1X9HA 2OCYC 2Y76A 4ZODA 4EPXA 3D3JA 1G42A 3OEEA 2WJVA 4EJSB 1DELA 2NACA 2NVUA 5ALYA 5FBKA 1GZDA 3OEED 1EJ6A 1UZUA 1FMJA 4EYSA 1L5OA 2ZTSA 4ZJUA 3S44A 2BEWB 2OSBA 2L42A 3L0ZA 4XRRA 2BUAA 4MW9A 2PX3A 1PG2A 1A0OA 4PGMA 4M0PA 1PRYA 2H07A 2CL0X 3H8VA 3IEXA 4ZGGA 5BVHB 2DETA 1PS0A 4MQUA 2O59A 1EM8B 1U31A 4M9XA 3VGJA 4B1FA 2QTTA 1KXZA 1EJBA 1P3JA 3T95A 4E07A 1TVEA 4LHEA 2VVTA 3ZCRA 3R7AA 3UJHA 4NULA 2VYCA 3V4SA 3ZUGA 1HH4A 4XM1A 2P5SA 2O6HA 5CG2A 4I4TB 1AA9A 1SJ9A 1K0FA 2NPIA 2OYCA 2B4YA 2AK2A 4GI2A 5ICCA 1I80A 1WBJB 1C9JA 2R751 1DBSA 2H4JA 5CDTA 2XOEA 5BSWA 2BKEA 4W7IA 4PXSA 1C1YA 2UUBB 2VZEA 3K9HA 3QYAA 3IJPA 4H0FA 4NG5A 4ODIA 2WD9A 4IWYA 4FQ7A 4CM1A 2VRBA 1NASA 1WUJS 4YP6A 2PKCA 2AYXA 3VYWA 3MT0A 3ZHCA 4BNWA 1AE1A 3UYKA 5JC1A 4K9DA 3VI4B 1DWQA 5LP6A 4UXHA 4G85A 2J7KA 4D6XA 1AZTA 2FDRA 3ZNQA 2CNDA 3ZBPA 1KYIA 4XGKA 3CKKA 1J0EA 3W6PA 1G5HA 3VZPA 3WK8A 2XUZA 4PZYA 4ZZ2A 4C88A 2E4VA 2VPIA 2XXJA 1ZD3A 3EXEA 5CXQA 1S0UA 2RIRA 2OO5A 2DFVA 2YWEA 4I50F 5FFMA 3WGMA 5LKAA 1KMIY 3MS7A 1OIVA 2DH6A 5T64A 3MJTA 1SD5A 2NG1A 3PXBA 2AD5A 3F3SA 5JNRA 5LOVB 3SFVA 3NOQA 1ZLXA 5CT9A 4KNYA 3ZKAA 4QG3A 1Q0ZA 2ZWIA 4Q3DA 1BS9A 2BL4A 1KZ1A 1YVUA 3K92A 4M1EA 3E7WA 2IWRA 2YINC 4MO9A 1I1HA 4JLVA 1J8YF 1HC7A 4TLLB 2P2SA 3JASA 3K0FA 1GKYA 3VPFA 1JLHA 2QYOA 2GMWA 4AJPA 1B1CA 4C21A 4CIBA 1Z2EA 1M2NA 1GL7A 1VSVA 2P2NA 3KZCA 4LV8B 3F2IA 3ZE9A 2QNRA 1UIRA 1AV7A 1Y37A 3IEUA 1P2TA 3N3BC 4F7WA 1O97C 1K5HA 4HRXA 3LT2A 4CLOA 1WW2A 2G9UA 2XCQA 4XWAA 1P39A 2Q2WA 4HTFA 4QSHA 4DNFA 3ZDBA 5F52A 3T9AA 1HZZC 3LUFA 3AP1A 3M9XA 3RC9A 2NO4A 4MV7A 3AETB 1E2PA 4Q4JA 1JVSA 1Z56C 4ZVNA 3KPWA 1RQRA 1SBZA 3NAGA 4REMA 4HUQB 1VMIA 2ZBPA 1YQ9A 3BFVA 4CDRA 3BSYA 3ELUA 3T5GA 1YS6A 1MXFA 2I2WA 1UBKS 4LSZA 4X93A 1TVKA 1KK1A 1JKIA 1QVAA 1D03A 3MMPA 5JE8A 1VE9A 2WD8A 3T61A 4E09A 2DGDA 1LF0A 2H7YA 3LCUA 4X1IB 3L0OA 4RX1A 4C7XA 3I1IA 1J56A 1SOUA 2P6OA 2ZB4A 1GNPA 2CZCA 4ZU3A 2J5QA 2QLLA 3CJRA 1MVNA 2ZJ6A 2AF3C 2GPTA 4MGYR 5U4QA 2ZREA 1PGQA 1X1QA 3LUCA 1ZESA 5L51A 4NJMA 3I09A 4KH1A 2XNHA 2VJOA 2C2MA 1KJZA 3SC6A 2X9NA 3FFBA 5LD2B 2ZLBA 4CF3A 5LA6A 1IAQA 1WZNA 3N2LA 4EG0A 4YAUA 2IDKA 3QLUA 3Q8LA 4PCVA 4QQKA 2Q9AA 5E9WA 4WINA 2F17A 2IBSA 4LBYA 1L3CA 3B3AA 3LP5A 3MGCA 5BRJA 1ODSA 1L5VA 1QFJA 3HU3A 1P33A 1MD9A 1O96A 4R8VA 1VKZA 4FFPA 3INYA 1O6FA 2YXEA 4Q7JB 4J0GA 5FUWA 1IWBB 5I3ZA 2GXQA 3HWX1 1YZHA 5JAUA 1QRTA 1JG4A 3ZU5A 1E3TA 3L0BA 1HDEA 2XPCA 1XTJA 5LLDA 3UHOA 4CM9A 5JMWA 5JFOA 5FQOA 5BN5B 3HYTA 4CM9D 4YRZA 1J06A 3KJFA 4XX1A 1E8NA 3PGLA 4LRUA 4ABYA 2CLMB 3CZ4A 4WCVA 2P75A 3FTQA 3KKQA 2N42A 4MQ4A 4YVFA 1DP4A 1KI8A 3L46A 5IP5A 3FSJX 4ZO9A 5HILA 1V9CA 3QI7A 2CE7A 4GQBA 3EUEA 1ZHHA 5J5AA 1X70A 3K15A 3R0IA 3TDMA 4W7SA 5DX0A 1IN8A 2O0JA 3OZFA 3OTHA 5GGXA 3GFRA 3I32A 2VYVA 3K70C 3Q10A 2JGLA 3QBTA 4X3CA 3GNSA 4JI3B 5JZBA 2VYVD 2NU7B 3DE6X 1ID1A 3K2IA 1O94A 2A5DA 2YHBA 5HFJA 5EIHA 1O94D 3BF7A 3ADBA 3R40A 3R6TA 1XCMA 3OI7A 1D0IA 4L51A 2HRRA 1R0XA 3AVQA 1GYRA 3P32A 3STXA 3TTUA 4WLNA 4G1EB 4Q18A 1WJGA 4GXQA 4MW2A 1A71A 1KETA 1M1YE 1ODFA 3S2IA 3BF8A 1FMCA 3M9WA 4HRAA 1OLXB 5DYYA 3UT5B 2FWBA 1XX6A 1C9KA 1EBFA 4Q3LA 1M67A 4D9NA 2NTYC 4CKWA 1PDVA 3LU1A 3OECA 3QEMA 3HMKA 4FOLA 2BMEA 1E5DA 5ALZA 2G1JA 3PKIA 4DLBA 5A2QA 4HKTA 4BNHA 4JUIA 1QVVA 3LPDA 5KOJB 1WOMA 4L6CA 1H93A 1OU0A 1PTKA 1MZVA 4P82A 1DWPA 4MKRA 2E82A 2IYWA 3K0AA 5D7NA 5EP2A 3UY4A 5BXQC 1KOFA 7AT1A 1NR7A 5JSZB 1E2NA 2ZI5A 2CUZA 2ZYVX 1P2BA 1VKNA 1Z17A 3CE9A 4WK4B 4KE7A 1VL0A 2A6PA 4KQ2A 2FEOA 1XZGA 2JS7A 4EGFA 4J4BA 1GUZA 1C80A 1FE8A 2W4QA 3Q2KA 3VX3A 2A92A 3WMEA 4B6EA 4QVIA 4W5NA 2YYSA 3CZ5A 1KRWA 3ANMA 5EIOA 2HMWA 3Q0TA 3FB4A 3PK0A 5AXAA 3U1VA 5CRIA 3UICA 3K6SB 3GJYA 2BGGA 3DDUA 3GG9A 1M1NB 4O4LB 2ZFUA 4RE5A 1JA0A 4M46A 1DQYA 4UQOA 4F45A 4Z5XA 2WM8A 4PC6A 4BNYA 3JD3A 3L8FA 1CUGA 1U9IA 4CMAA 1NUSA 1TIKA 2INGX 3PXAA 1Z22A 4PZ0A 2MOKA 3QHPA 4P5EA 3HA3A 3F73A 3E03A 5JYDA 4FEAA 2XWQA 1BQ4A 3EGDB 2HBZA 2Y1XA 1VKOA 2YWFA 1KBOA 4FYIA 4FYVA 5LBUA 1H3FA 2HEGA 4OK6A 1KAEA 3T7TA 1TKAA 3UB2A 1VG0B 5LU8A 1Z2AA 5L3RA 3GLFB 3GLIB 2TMYA 3IBSA 1WKVA 4AMZA 5A1TA 2XYPA 3S3TA 1JR4A 3ANSA 2FSUA 2A1IA 4L8GA 4PPQA 4Y1GA 5DTRA 5TNXA 4NCNA 3V80A 1ZW6A 1IOLA 5LYJF 3NM4A 2EIXA 4OI1A 3JQ7A 3KR2A 1P29A 3JWEA 1I2AA 1QMGA 1U7OA 3NHUA 4NCXA 3HRHA 4TKUB 2VSYA 5E1DA 2CJWB 2CJXA 1H1TA 5JFTA 4CIWA 1RRMA 2CF6A 2GSWA 9GPBA 4G0NA 3BORA 4TWBA 3ZX5A 2F4NA 5FWXB 5F98A 4OX9Y 3IVRA 4YX9A 3W8NA 3WGGA 3AUJB 4OGFA 5SZHB 1MX1A 2AFVA 3O8OA 3KXKA 4GLJA 4XFJA 3PFCA 4DBLC 3GDFA 3FW1A 4XEHA 1ESNA 4YWHA 2V0GA 1WWKA 1IZZA 5FB3A 5AHRA 3OPMA 4Q4AB 1XEXB 1CZNA 2C4VA 3E9MA 4ZO8A 3N8HA 4CFYA 4GBED 4P58A 1QTQA 2XXAA 1II9A 3QRWA 3WZLA 4J29A 4ZKDA 1H66A 5BW6B 1ETUA 3PWZA 3THYA 1DBIA 5TGTA 1NAIA 2PHZA 4QOEA 1KWKA 1FQKA 1QWOA 5GJCA 2X5JO 2VBFA 5A4DA 5KREA 2FSGA 3THXB 2OXTA 4M1TA 3O3MB 4BX0A 4IPTA 3JAMA 3HDQA 3QPBA 2G0TA 3BGOS 4CVNA 1A3CA 5AVYA 3VI3B 1I6KA 1Z13A 4Q00A 1JTFA 4ETMA 1PR0A 4H77A 4U7TB 3T99A 4R8LA 3ZU3A 4P4UA 2PGXA 2WLSA 1P44A 3CX3A 2J3JA 1IWPB 3IILA 1E4EA 4ALJA 2HJSA 2QMZA 2OQVA 1LEHA 3K5HA 3O73A 4CQLB 3Q7PA 4JYPA 4LMPA 3JATB 2ID4A 3TRIA 5DM4A 4RTKA 1DFHA 1X86B 1NMXA 2I76A 2WT9A 4PRLA 3LGSA 2HIGA 3VH3A 4K9QA 5JS7A 4DV6B 2FAXA 1RRKA 2PZGA 3DWEX 3KYBA 1FCJA 1FP4B 1P7WA 2JGNA 2TECE 3O6VA 3KJIA 4N3CA 5DBEX 4ZYXA 4HO1X 4TMYA 4OLFA 4W5TA 4MW7A 1E60A 1R15A 2WB4A 1J0XO 1MB2A 3FZGA 4FBGA 4IGKA 4B7CA 4RVUA 4EY6A 4YJ3F 5BQ3A 4FOSA 3O7WA 4REQA 5EE9A 1NT2A 4LRXA 3AU9A 4N0MA 4AJ9A 4CLXA 2UU9B 3KB2A 1G4AE 1FFWA 1N6HA 2HJHA 3D8SA 4XQ0A 4FBLA 3NIBA 4Y67A 5H4GA 2JIOA 1WSBA 1QHSA 1PT7A 1ZK2A 1DUVG 1UWKA 3PJDA 4FZJA 2RHBA 2J59A 3KO8A 5A3SA 2WP8J 5A4MS 4NMHA 5DRYA 4I55F 1EEHA 4RY8A 4DLXA 3QNUA 5EXSA 1EUCA 4TT3A 3OPQA 1C0IA 3VZBA 1QG4A 3A6GA 4HNAA 1YL7A 1R6BX 1SBNE 4Y9TA 5HRUA 5IZ4A 1R0SA 2C00A 3EDQA 3K9BA 1XZFA 2GF9A 1NW3A 3O1HB 1NW6A 2UVPB 3KK0A 1DTEA 1W85A 5JMPA 3F6CA 2BTQA 3ROFA 4ZN6A 3OT5A 4Y2VA 5I9BA 5JJLA 1GSHA 5REQA 3QV2A 3QIVA 3UA3A 3M89A 3UCFA 1AB5A 3RSLA 3WLPA 4P98A 4JMLA 4GGPA 5TPWA 1QH8B 4WJKB 2FWIA 3THRA 5KVAA 1HNNA 4E08A 1DL5A 1KK2A 4H1HA 5A6VA 5DT9A 5BUZA 1P8AA 1I7PA 1SU7A 3GDWA 4V0ME 3PDCA 5BVGB 5IU6A 2HA4A 4NECA 5HR5A 3QX3A 4JJ8A 4B33A 2H4HA 4ANFA 2G25A 4P0TA 4BECA 3T5BA 1Y5RA 1TU4A 4N3NA 1E99A 4CMGA 2G4VA 4P5DA 4Y6GB 2O8CB 2CJPA 3KUUA 4KR0A 2FQXA 3B8EA 1J6UA 2FFAA 2PRZA 1DXQA 2RB4A 3FVTA 3HCNA 1X9GA 3HWRA 3D0KA 4GSYA 3COYA 4L5JA 4CFZA 1B15A 3NOXA 1P0PA 3RUDA 3GLGB 1QYRA 3GLHA 4NL4H 3ME5A 2POQX 3BILA 4RMIA 1UMCB 5CCDA 2WQZA 4GX1A 2FPLA 2Q4BA 4C3OB 1E1NA 1CS0B 3CGGA 2FQYA 1P5RA 4ZD6A 3BOSA 5LB2A 3W5VA 4B3SB 1U5BA 4PPNA 3JU3A 4QICA 3FMFA 3BB4A 3KNZA 1JU3A 4U3JA 4WOCA 4MCIA 4F3YA 2VA9A 3CB2A 1RZ3A 1SKYE 2YZNA 3QEAZ 3P5SA 2EKZA 4OQYA 1ZM4A 3GP5A 1H85A 2JRCA 2RGWA 3MMNA 4O1HA 2QMUA 5JCJA 3TL3A 1Z16A 3QE9Y 3KV1A 5IDXA 5JCJD 1NIJA 4TVKA 3R3HA 4B0PA 1L5HA 4D3YA 4WZBB 1EGQA 1AKWA 1X7WA 1SVLA 2PUHA 4TSRA 5BSHA 2NVOA 5BYAA 1KQ3A 3TAUA 3C3WA 2PSDA 4ZYWA 3R9XA 3S29A 3FDIA 1PYGA 3C98A 3KUCA 2W6NA 3MM4A 1HKUA 1R8JA 1M2OA 1LTHR 1PUIA 1ZH4A 2HTEA 2ZS9A 1X8KA 2W4IA 3HR4A 2B9VA 1SQSA 3FB1A 3G8AA 2C29D 3USCS 1OV4A 3GC6A 1XU7A 1OXXK 2ISQA 4XM2A 2VQFB 1Z75A 1VKRA 3MHPA 2MINA 4LY6A 2Z58A 4DQDA 4X41A 2QPAA 4DLUA 3M9LA 4PHCA 5DB4A 5HQJA 1ZONA 2BEJA 3PQ3A 1PFQA 3GUCA 2OHJA 1BMFA 1JHVA 5IMBA 4CHTA 3ABRB 1BMFD 3SVLA 2GAJA 3QHQA 4MI3A 3SZ3A 4ND1A 5F77A 1PVDA 2NWQA 1JXMA 1IY2A 4A0GA 1O6ZA 3GT3A 3WBKA 1VLJA 3OOSA 1CP3A 4EAAA 2DBRA 3U6BA 3ZQJA 1R4AA 3AG6A 3DCIA 1S2MA 3P45A 2YWDA 2OC9A 4RZUA 4XX0B 1UBOS 4X7MA 1A96A 3MQ4A 2CNOA 1T8UA 2JDIA 3L8EA 1KJIA 3HYRA 4HYTA 4DC9A 1V37A 2JDID 2H4ZA 4BVEA 2GCOB 2J3EA 1KMQA 1ABFA 2VAXA