1DAGA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid and 5'-adenosyl-methylene-triphosphate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
total genus 74
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dagA00
2WV9A 1G6HA 2GEDA 5H8WA 4B6FA 1FZQA 3K09A 1J90A 1G5PA 1G18A 2QTFA 4QFMA 2ZRJA 4ITRC 4BFXA 3ZVMA 3OZXA 4R7ZA 4Y0VA 2V7QA 3LW8A 4DLWA 2IC5A 3IILA 1IY0A 2JLYA 3C5CA 3FHTA 1N0UA 1A2BA 1RFLA 5DH9A 3U3JA 2ZPTX 3SYNA 4RZXA 2F1IA 2P0EA 2DYKA 2YV5A 2QSYA 1UDXA 1MO3A 1ZJ6A 3L0SA 2EFCB 4H1VA 4W9MC 2QBYA 3QXJA 1KI7A 5J4LA 4FI3C 3X1YA 4CEHB 1Q1ZA 2WAYA 4FIDA 6Q21A 1Z83A 5AUOB 2V6IA 2VP5A 1HEIA 3QKRB 1KTVA 1JALA 3RLFA 2DFTA 4IDOA 3JVUA 2ZRIA 1FW6A 2AK3A 3OE7A 5CM9C 5CITA 2QAGA 2Z4RA 1NVVR 2X2EA 3ZD7A 3E70C 3PG5A 1KHTA 1OSNA 1G16A 4DC9A 3DHWC 4P3YA 4A0HA 3RRNA 1W1WA 2RHMA 1RYHA 1SXJA 3OEHD 1XTKA 4A0FA 2GEVA 3U44B 4AC9A 2GWHA 2J0QA 3FKSA 1UJ2A 1E9DA 4DLZA 2QT1A 1COWA 1XEXB 2AXPA 4X8LA 4B3DA 4DB2A 3VKWA 1G3IA 1CLUA 1MT0A 4FMDB 1S4QA 1KI2A 1QRAA 2J0UB 1KZGB 1P2VA 1YZUA 3NG1A 4OK5A 2FSFA 2BM1A 3T12A 4QOSA 121PA 2OAP1 5EXXA 4LJ5A 1E2EA 5IT5A 2AWNA 2YC4C 4U00A 2W00A 3AVVA 3BH6A 4DJTA 4Q1FA 1E9BA 1KDOA 1HUQA 2NO6A 2ZYVX 3BFKA 1Z6GA 3C5HA 1M2OB 3NDBB 3LO5A 5H1YA 5JJKA 3GJXC 1IN7A 2REBA 2FE4A 2IYQA 3W6NA 2IA5A 3FMFA 3TSWA 2I3BA 1G3MA 2SHKA 3VQTA 2HJVA 3IDQA 4DSUA 4HYYA 5J40A 4K46A 4TSFA 4BUJA 2WM9B 1E9RA 3TSOA 3U3MA 3FKQA 2GJAA 2W2VA 2X1VA 4KU4A 2HUPA 1GNPA 3CWQA 3SZRA 1NSFA 3QVUA 4BLQA 3GQBA 4AD8A 2WJYA 1ZRHA 4Q9HA 4FCVA 3A4NA 2FEMA 4HAYA 1DPFA 4CIDA 1E69A 3LY5A 4US0R 1X8JA 3LFUA 2CCKA 1IY2A 3PFIA 1AGRA 4XD7A 1OXUA 2YWEA 2WWFA 1Z6TA 2IW3A 3R7WA 3VKHA 5IK2A 2CE7A 1T9HA 4MGYR 4XSGA 3AVXA 1QVRA 2Z6VA 4D4MA 1G8HA 4TYPA 4NYIR 3WBKA 5AUQA 1TUIA 2Y8EA 4GT1A 2GCOA 2WJGA 3NEJA 4RZ2A 2QAJA 4JLKA 3I5YA 2ZRPA 3CRRA 1KJWA 1UPTA 5FOUA 1DADA 4M22A 4JT2A 2XJ9A 3ZQJA 2FMXA 1KO4A 3IIJA 4XWAA 3X1ZA 1VHLA 4HUQB 1MH1A 4QJ4A 2R6DA 2ZSDA 2CK3D 3PR1A 4RCZA 4HLQB 5JSZA 3TBKA 5A0FA 2MMGA 2QPTA 1GVNB 2BCGY 4PC3A 2ZETA 2QMHA 1SVLA 3FGNA 1DE0A 1T5LA 4JYCA 2OFWA 5FOSA 8OHMA 2OCBA 2J46A 4QJ3A 1MO4A 4AKHA 3QBTA 2KI5A 1N5IA 5J4VA 3SJZA 1E1QD 5JZVA 3W9YA 3W6OA 2DFKB 3D31A 1OXTA 2X2FA 2ONKA 3EARA 4W7SA 2A2ZA 2H18A 4XWOA 5JCZA 5TMPA 1PLLA 1IM2A 3PENA 3RWOA 2FOLA 2QP9X 1RJ9A 1GDDA 2NIPA 2CLSA 4F4JA 2JIZA 3HR8A 4XVUA 4URXR 4Q9KA 4DCSA 4EQ6B 4CEJB 2WOOA 5SZIA 5SZHB 1OIXA 5FPHA 2ERXA 1ZNXA 2FG5A 4A0RA 1VCMA 4F4CA 1BMFD 1M7GA 5FL3A 3GLHA 1G64A 4LHYA 5GJBA 1M8PA 1FTNA 2OBLA 2X8AA 4NYJQ 3RNLA 1T4GA 2F1HA 4G3XA 4IEIA 2HV8A 1E0SA 1F2UB 1KJYA 2OCPA 1T3LA 4Z51A 5HZHA 4ARZB 1PVOA 1CBUA 3MMPA 3NC1C 4Q4AA 3MFYA 2ORWA 3QXXA 4L4UA 4Z54A 2J3EA 1SKQA 1WQ1R 3H2YA 2WKPA 4RD3A 5DO9A 3A8TA 5CLQA 4KLZA 1UDWA 4LHZA 4MH0R 4P33A 1GTVA 2W58A 5D3MB 3A4MA 1QBKC 1D9XA 1LFDB 2EFEB 2ZR0A 2GCNA 2XNDD 4RVCA 4LHXA 2A5FA 4O3MA 4NYJR 2ZJBA 3CM0A 1G8PA 4A2WA 4Z8XA 3UG7A 5FH9A 1R5BA 2NO0A 4DLVA 1KYIA 3EZ7A 2ZI3A 2JEOA 3PITA 3QXSA 1JR3A 3FFAA 1JJVA 2F9LA 4N3NA 4YXWA 4XWKA 4Q4LA 5CJ2A 1YVDA 2PEZA 2ZRCA 4Q9LA 4DEYA 3L43A 4I81A 2VF7A 4PFSA 3DL0A 4BLRA 5JI3E 2G83A 2QQEA 2YWHA 2IYRA 3LLUA 3AVWA 5CB6A 1XCGB 1PV4A 2RCNA 1FP6A 4Q4JA 2JLUA 2ZREA 4LBWA 2CK3A 4ESHA 1U8AA 4LDJA 1EX6A 4E03A 4B75A 5HR5A 2KSQA 3BB1A 2ZE5A 3W3AA 4KYIB 1G4AE 5G3ZA 4B74A 2WVJA 5DGXA 2GJ8A 5GVSA 3F5FA 5FBRB 2GA8A 3DVLA 5JMTA 3U5ZB 3SHWA 3L0OA 4QXAA 1ZYUA 1XDBA 1P7CA 1SVKA 4M4SA 3IEUA 2VP6A 2WKRA 3REFA 1I2DA 1KMQA 3OESA 3I61A 3HPRA 1G19A 2BC9A 2ZE6A 2ORIA 4TLDA 1KZ7B 1VIAA 2CL6X 3TUJC 1WP9A 1T91A 1TU4A 1L4YA 3OEEA 2J5XA 4PC1A 4RFSB 2ZJAA 4BLTA 1OPXA 3MSXA 3AF3A 1BMFA 4LI0A 2IUSA 1Z3IX 3QNUA 5E7MA 5CK5A 4OK6A 5JCPA 1AKYA 1SQ5A 4B3BA 1E2KA 2OZEA 3CRMA 1Z29A 1WDTA 4NL4H 2PX3A 1P60A 3D6TB 3K0AB 2QSZA 3KB1A 3SR0A 4A8JC 2RGXA 1N5JA 1W44A 1Z0FA 2WIBA 3E2IA 5DN6D 3ADCA 2JLVA 3WRYC 4LJ7A 5EXTA 3WP1B 1ZINA 4UNNA 5DI3B 5TV2A 4GMDA 1G5RA 2R2AA 2CL0X 3SEAA 3B1WA 5KNDA 4LV6A 3GMTA 2O8BB 2CE2X 1XZPA 2ZEJA 3ADDA 3U60B 2ZRHA 2WSSD 2GKSA 5FOXA 4Q7JB 2C99A 3D7MA 2CDNA 4HDCA 4MKFA 1RC8A 1E9SA 1YU9A 2IS4A 5FTNA 1R0ZA 2RAPA 4TYQA 2Z43A 5CK4A 2OXRA 1QHNA 2V55B 2G88A 1H65A 3CR8A 2IF2A 4KCGA 4L8GA 3TR5A 2J7PA 2ZRDA 2NPIA 4HZIA 2Q9BA 1KK1A 1D2MA 4D0NA 1UKEA 1YZKA 5FI0B 4BE7B 1OH7A 1KNQA 1TNDA 1Z0JA 1KKMA 4PC6A 1G8GA 2DY1A 4BWYA 1XEWX 4TLAA 1VYVA 1HY3A 1N6LA 3CUEF 4BGDA 2NO1A 1QZXA 4EPXA 1ZD1A 3RSOA 2WPDD 1CP2A 2V4ZA 4UNQA 5LB4A 3FWYA 4OHZA 4CYMA 4U5XA 1YRAA 5K8TA 2EYUA 1GAJA 2BV3A 1X86B 5EUMA 2NOAA 2WAXA 3RABA 4D2IA 1DAEA 3R20A 2D06A 3K0CC 4HSEA 4EJSA 5FUWA 2ZI4A 2IWRA 5TY0A 3CW2A 4JZKA 3SU8A 3RRZA 4Q01A 3KJHA 2OV2A 1XJ0A 4GRAA 1IJFA 1DAMA 1AQUA 3GEHA 1GITA 4IVQA 2DHRA 1XXHA 5A4JA 2Z83A 1G6OA 4MGZR 1GL6A 3ZIAA 2QG6A 3BORA 4H1UA 1DARA 4QM6A 1E2NA 1G7CA 2IF0A 1HQCA 2MMCA 3IQXA 5LPNA 4GZLA 4X8MA 1Z2CA 4OHYA 4A4DA 3NBZC 4A82A 1T0HB 2RGAA 4Q4HB 4JVSB 2AKAB 3WNBA 3GEIA 2NO7A 1QHXA 2XEXA 3B7GA 4AIIA 4WOPA 2IEYA 2WJJA 3RRMA 2XITA 4HI0E 4PHGA 4US2R 2FU5C 1EESA 1ZU4A 4LJYA 5HCNA 4JLAA 4MKHA 1BYIA 2GHIA 2E1RA 5AR1A 3QVVA 2A5JA 4JS0A 1E32A 4DIEA 1E96A 2UVQA 3GD7A 4EFNA 2YNMA 4QKQA 1KI4A 1E2PA 1P5ZB 4NCHA 2F7SA 3MGCA 4YC7A 1TMKA 2WWIA 3LVQE 1KIMA 4DSOA 3GFPA 3AP1A 1NMYA 4IHQA 4B33A 1Z6YA 3THYB 4S2EA 2GBLC 2BKEA 3KX2A 3NHAA 2OT3B 1VG0B 1HT1E 4PTLA 4JLPA 5JEDA 2PMKA 1A5TA 3GLGB 3KKMA 4URYR 4AG6A 2IYTA 4P31A 3NH6A 4FN5A 3TE6A 3L82B 1K8RA 1SULA 4RD2A 2RGCA 1E2GA 1BO6A 3I92A 4TMTA 1NI3A 2OUKA 3FDIA 4LV8B 1J8MF 3AH8A 1R10A 4LJ9A 3DKVA 3VMFA 4TL8A 1P73A 1P62B 2V8OA 2R9VA 1G291 4ZPXA 1N6HA 4WZ6A 2RMKA 1R0XA 4K8OA 1OIVA 3LD9A 1A4RA 1SHZA 1TUEA 2X19A 3C4JA 3CPJB 1VDZA 4RKFA 4XD7D 2F3TA 1PLKA 4TMWA 4PXAA 2A30A 2IYZA 5IRCD 2AHOA 2R6GA 3QJYA 5IK2D 1U2RA 2O8DB 2RGGA 5BW8A 5BN3A 3AGPA 5GADl 4W5JA 2JLWA 1HE1C 3UMRA 3PEUA 4C0HA 1I2MA 1H8ED 1HYQA 2MSCB 2QEQA 1KI6B 1VCNA 2IYWA 4TL6A 2FJUA 1CJUC 3S1AA 5L3RA 1XD8A 1UEJA 1SVWA 3TVDA 3AVTA 3NHBA 4RZ3A 1P2UA 1ZMXA 2FEOA 1N2CE 4PZLA 1HT2E 1Q1QA 2OFOA 1U81A 2A3RA 2DWOA 4C9BA 4W5WA 5BXQC 1G8YA 3KQHA 5CYPA 3BD9A 4M53A 3X1WA 4D81A 4B3GA 3T1OA 2NZJA 1CULC 3GLGE 3IPXA 2BBOA 4FMCB 3RS0A 5JEEA 1CEEA 1N6PA 1W4RA 1T8TA 5EXSA 2EFDB 1KY2A 2ODEA 5HTKA 1XJQA 4JBWA 1AJEA 5SZKB 2LKDA 2WOJA 3T1QA 2Q9AA 3G5UA 3VNVA 5FPTA 1N0VC 4LY6A 4ON9A 5KSYA 4MDFA 1AS3A 2IT1A 3DOFA 2R44A 3BFXA 1L8QA 2Q6TA 2ZJ5A 3Q5EA 3GLFE 4HLDA 3A1TA 2AX4A 2UZ3A 2I4IA 1GG2A 1UBEA 3FFBA 2EFHB 4CT4B 3QKRA 2CHQA 2V1UA 1RYFA 1U0LA 5JRZA 3RS7A 5EE1A 2QAGB 1CF4A 5EXPA 1Q12A 1AKEA 2ZVPX 1EFHA 3GJ7A 3A1UA 4Q1BA 1G17A 2FGKA 3UKDA 5BYKA 2A78A 4HUTA 2H8KA 1SVOA 1Y3AA 2FZ4A 2F43B 2HLDD 1SXJB 1NKTA 4KYUA 4HB4A 4U02A 4D26A 4EPVA 2QPOA 1VECA 1L7VC 1XEXA 3QE0A 1COWD 2HXYA 2IYLD 3QENA 4A6PA 1AZSC 1E99A 4PSVA 4B2PA 821PA 2OCYC 4AYXA 3TGPA 1ZIPA 3IPYA 1FFHA 1RKBA 3K9NA 3OFND 2OFXA 1U94A 1U98A 1CR2A 4CZ2A 1OB2A 3CNLA 3IGFA 2QTVB 4URWR 2BOVA 2DWQA 5IDVA 2PZGA 1XPUA 4US1R 3BWDD 2J41A 3ECCA 3Q9LA 5FI1B 2G0TA 3EZ6A 1G7RA 4Q1DA 2DR3A 3LV8A 3KKPA 2J0VA 2PL3A 5FTMA 5KSPA 2VHQA 4MRNA 2KBFA 2PLFA 4Q21A 1M74A 5AUNB 3CRW1 3TR0A 2ZIAA 2CMKA 1YE8A 1A7JA 4DLUA 1N6IA 4WBSA 1F48A 1OHHD 3NTUA 2DWPA 3KJGA 2GNOA 4Q18A 4OYHA 5FOTA 5JI2E 4BFTA 1L4UA 4IJMA 3A1SA 3MWLA 4G5OA 5G3YA 1AZTA 1VCIA 1GSIA 3LXXA 2VH5R 4TLBA 2CNWA 4AY2A 1PUIA 3GJ3A 4Q7KA 2P5SA 3RRYA 4LHVA 4PHHA 2ATVA 4JLBA 4IDPA 3W8NA 4HDQB 1OYWA 3ZZUA 4TTQA 1DEKA 2JATA 2BJWA 3LRPA 3QIAA 5EE3A 1XFAA 4PPQA 4TQUS 4TZ6A 2F9MA 2GDJA 4LC1A 2IX3A 4RD6A 2GCOB 4MRPA 4M1TA 5FTJA 2GXAA 4DKXA 3CLVA 3ZDQA 3GJ6A 3SDZA 3T5GA 1G9XA 1H8HA 3B2EA 4F7WA 4DDUA 1KKLA 3TAUA 5BN4A 1KO5A 5DN6A 4HUQA 5FL7A 3GPLA 1AQYA 2HDNB 5KPJA 1YHNA 5UKDA 2ZROA 2A5YB 3VR2A 5JSZB 1G8FA 2PX0A 1HQYE 5JWRA 3FMOB 2C78A 4DB4A 3AF2A 2CLDX 3DKPA 4WVFA 3TNFA 1XJCA 2FZLA 1G3QA 4GMXA 2F6RA 3GLIB 3PUZA 4IDNA 2Q0HA 3AUYA 2WMNB 4RZUA 3BC1A 1G21E 1U8YA 1FMLA 5GJVC 1NLZA 2WSSA 4YMWA 3RYTC 5IF9A 5EE9A 2D4HA 2R6FA 1JEDA 1W5SA 3BBPA 1E2QA 5D3QA 3ND8A 3B82A 4BZQA 4TMVA 3IIKA 1KI1A 1TF5A 5B30A 4LUCA 4OJQA 1KK0A 1R4AA 3PVSA 2KWIA 2REXB 2JIZD 3CPHA 1ZNWA 2D7DA 2Q3HA 4G01B 3UMSA 4MGIR 3T1VA 1P3JA 3HWSA 3K0FB 4MYTA 4CEIA 4Q48A 2NPFA 2QL6A 5DLQC 2X77A 4P4UA 1YQTA 2QN6A 2YKGA 1T0JB 2ZSFA 3SS8A 3O8RA 1VG8A 5JWOA 1EWRA 3T34A 2NZ8A 2XXAB 2FDCA 3CONA 1F2UA 4E09A 5L8VA 4QGAA 4ARZA 5HCIA 1ZU5A 4PHTA 4Q4AB 1UBFA 2IHBA 2QENA 1ZM4A 3HU1A 2ZUDA 1XX6A 1JPNA 1KMHB 3CF2A 4V02A 3MG9A 3KTAB 1GFIA 4HB3A 1MRSA 5D3MA 1YZQA 4F93B 1DAHA 3EX7C 1M1YE 1TU3A 5KUTA 4CRWB 2WIAA 2D74A 1WMSA 2YWFA 1YZTA 1N5LA 3IKJA 1NN3A 3EIQA 1Z8FA 2C9CA 4PPNA 3DM5A 1OFHA 1TQ4A 1BYUA 2IBMA 4FW9A 3RVBA 4BFYA 1P2SA 2ZRMA 3A58B 3WBJA 4DUGA 3LA6A 5CYOA 1Z6AA 2RGBA 3I5XA 3KXKA 2XTMA 1TADA 1RRCA 3HDTA 4PO8A 5FBLB 4YXWD 4DLYA 4ZDJA 5JJLA 2PCJA 3O47A 2W83A 1FUKA 4C7OB 2CHVA 2HCJB 3KJIA 4Q4JB 1US8B 1LVGA 5FBQB 4B3FX 4O2LA 1ELOA 4Q03A 1CTQA 5KO2A 2CCJA 1YR7A 4C4PA 4A92A 1FX0B 5DHFA 5CJPA 3IIMA 4K81B 1TAGA 1GP2A 1EK0A 3VFDA 1AK2A 2MSEB 1X1RA 3PUXA 4KLNA 2OCAA 1ZC4A 2HCBA 1E79D 4GOJA 1JXOA 4QBGB 3SJAA 3BGWA 5DHAA 2PLRA 2V6JA 2VP0A 3B6EA 4RFSA 3B13B 3QPWA 4GP7A 5FR1A 3Q7PA 1ZM3A 3T1TA 1QG4A 2YHSA 4DZZA 4EUNA 3OIVA 3LBHA 4BFSA 4FCTA 5E7JA 2DFNA 1WRBA 3W5JA 1Z22A 1P4SA 4EKDA 3FOZA 3SFVA 1L2TA 2F1JA 2OE2A 3K0AA 4KVAA 2PZEA 3ASZA 2VHUA 2MSDB 4URZR 4TWZA 2VSOA 2HEIA 3GFTA 1M7BA 2C9YA 2TMKA 2ZJOA 3DDCA 4WZBE 1JPJA 3WMEA 4E07A 2GXSA 2VSXA 1CJMA 2O8BA 5J47A 3OHMA 1Q44A 4PX9A 1ESNA 1JR3E 4D82A 1QHYA 2GJ9A 4A9AA 1UBGA 1NVXQ 2B7BA 4BFVA 3C41J 2O8CB 4MRRA 5AWFC 2EFGA 2RH5A 3QG5A 4L9SA 1OH5A 1W36D 3B8HA 4UXJA 2J1LA 3CNOA 5L3SB 3FTQA 1PZNA 4ZV4A 1DAGA 3IUYA 3MAAC 4RFVA 4C0QC 5IHPA 1AA9A 4LRWA 4NP6A 3LQQA 3CH5A 3DOEA 1DG1G 3QI2A 2CL7X 1S0UA 2FN4A 1DELA 1LNZA 4I4LA 1GIAA 2ZJ2A 2FFAA 2WPDA 4IOLA 1EFTA 3UWOA 1UEIA 1QVAA 3CH4B 1WB9A 3PEYA 1JAHA 5DE3A 3X1XA 4D80A 1EGAA 2JJ8A 4KHZA 4M9QA 5BQ5A 4TN1A 1Z08A 4EJSB 4NPHA 3RC3A 3SC3A 4DDTA 4TT3A 1R0WA 1E79A 4C2TA 3WNDA 1AS0A 2N42A 4A1FA 2JLQA 3UWKA 2HT6A 2ZTSA 3DO6A 4EFMA 3EPJA 1ZD8A 1KK3A 1XXHB 2VTKA 4PAOA 3QEJA 4UNRA 5JECA 4NHOA 4CT5A 2WHXA 1GKUB 4TYWA 1W5TA 1XRJA 4DCUA 4TLCA 3K9LA 2EW1A 4OQXA 4C0BA 1UAAA 1CR4A 2OBMA 3VR1A 1GL9B 4JL6A 4A36A 4NCJA 3OF5A 2WJVA 1TTTA 4Q4HA 1B23P 2AD5A 1JNYA 2C8VA 1RRFA 2C77A 3FHCB 4B3XA 4D0GA 3BXZA 2JA1A 3LBIA 3QQ5A 2ZU0C 3AB3A 2OG2A 1TF7A 4Q66C 3M0EA 4IFBA 5KYKA 2WWYA 1JEEA 2O0JA 4LYAA 5JHGB 2QNRA 2ZSAA 4QBHA 4DLRA 3TJZA 4QC2A 4JL8A 4Z1MA 2D3WA 1WBBA 2B21A 3L8ZA 3NIBA 1C9KA 2IXEA 5BWMA 1JECA 2J9RA 2WJIA 2J45A 1II9A 1MV5A 5L3QA 1E6CA 3I8XA 1FMJA 4ZDKA 2ZR9A 4TTPA 1U0JA 1XD2A 1NG9A 1HURA 1UBCA 2QT0A 2QUZA 2GVDC 2ZAOA 1KNXA 2ZI9A 3N5CA 4JKIA 4P0TA 3CBQA 4XTRA 5EP3A 1VYTA 1FUUA 1T6NA 4AKEA 2FPLA 1XTQA 3IEVA 2QI9C 1BOFA 5CDFA 1GNRA 3BERA 4KITB 3F8TA 4LC0A 1K5DA 2OESA 4EPWA 2R65A 4OQMA 1SXJE 1TL7C 2LWIA 1JQJC 2QM8A 4PZYA 4NDZA 1KK2A 4MRSA 1SHKA 3CRVA 5F98A 5LB2A 3RSLA 4C0LA 2F3RA 2ZUBA 3GLIE 4BEJA 2QROA 3KKOA 5EE5B 1GNQA 1DG3A 2YYZA 2QAGC 5JBQA 4E22A 3NWJA 2BWJA 3NVAA 2BMFA 1R6BX 1ETUA 3UPUA 3CZPA 3TAHA 5HKKD 1E94E 2P6NA 2CJWB 3U3KA 3UIEA 4DLSA 2ZAMA 1YR8A 4TQAA 1F3OA 4ERNA 1Z0KA 5C18A 4Q1EA 1QF9A 2YC2C 4AG5A 1OT3A 5G40A 2PBRA 4XIGS 2QGNA 4GNKA 3LNCA 3Q3JB 2ORVA 3SE0A 4DCVA 5J4HA 3DZ8A 4B43A 4C0SA 3TRFA 2GAAA 3LWNA 4LSGA 1VKJA 3R8FA 4N1AA 5H70A 4AURA 2C96A 3S1AB 4KJZA 1Z0DA 4DLTA 4IOMA 4DSTA 3BB3A 3E1SA 1S3SA 5B64A 3VNUA 3PJRA 4TTRA 3NBYC 4M9ZA 4U7DA 1XEWY 4LYFA 1OXXK 3TUIC 1Q1BA 4JLNA 1S1CA 4MYCA 4URVR 4O2RA 2GRJA 2XGJA 3Q8XB 4G5RA 4DBLC 4JLVA 2WTUA 1XWIA 2YJTD 1IN4A 4Q1CA 2GK6A 4PSKA 5G53C 4CDGA 3EPLA 3P32A 1XNJA 3QF4A 2Q9CA 4UKDA 4TMKA 5EE0A 5EJEA 4GI7A 3TLXA 2F55A 3AP3A 2QP4A 2WWXA 4HAUA 3G82C 3HU2A 3THWA 1Z0IA 1Q1EA 4ZCIA 5E4FA 2WKQA 4C30A 2XNDA 2XSZA 5F2EA 4D0LB 2O5VA 4PSAA 1IN6A 1GZSA 1K5GA 5AJVB 1W4AA 4MQBA 1E1RD 2IYXA 5FUYA 4IRUB 1IXZA 4HAWA 3MWKA 1VTKA 4AKIA 3AVQA 2W6ID 5DYGA 1W47A 4NE2A 3U61B 2XAUA 3GEEA 2IYUA 3THXA 1W0JA 4C2UA 3R9XA 5TARA 1KI3A 1T3SA 3GP8A 3P20A 3H86A 4JMPA 4TL9A 4X8HA 2F43A 5FL7D 1VG9B 3MD0A 3P4YA 1QHSA 2JASA 5AUPB 1Z2AA 2ANCA 4V0NA 3ICQB 1NMXA 2GBLA 3ZQ6A 3CWZA 4MGKR 1NF3A 2CXXA 3A36A 3KB2A 1NBMD 1KDPA 1OXVA 4GFDA 3G0HA 4ZI3A 1XZQA 3MWJA 2RGNA 5CIQA 5C4GB 1CR1A 1J8YF 1KAOA 2CBZA 1FNMA 4NU0A 3RAPR 1WE2A 4DT1B 3AKCA 1FOEB 2CEAA 3VU9A 2NG1A 4DUGD 1OKKA 4AYTA 2ZSBA 1D6JA 4QL3A 3TKLA 4C0AC 4AK9A 2PH1A 2BDTA 3JZMA 1P9WA 1DAIA 2EWWA 1JAIA 1DO2A 3M4YA 4RD0A 3RS2A 1CJKC 4KO8A 3NXSA 1E9FA 1EXMA 2GZDA 5E95A 2HF9A 5LBIA 2GEUA 5CIWA 3U6BA 2HJGA 3I1FA 3BOSA 2VRWA 4I1UA 4IDQA 2N46A 3ADKA 1XTRA 2RGEA 4HDOB 4UQOA 2GJSA 3LVRE 4R9UC 2ZYUX 1ZUNB 2J7KA 4AYWA 3QXHA 4RD4A 2GXQA 1E9EA 1N0WA 1E2FA 4GL2A 2CNWD 3I72A 2ZXUA 4YMVA 4YMTA 3EASA 1TPZA 2QZ4A 4ACAA 3I62A 1GRQA 2FFHA 3RS5A 2RB4A 3O8DA 3ND9A 2JJ2A 1LW7A 2XOKD 4LCBA 1Z0AA 5FUXA 1XB2A 3GCGA 3ZH9B 3B1YA 2F1RA 4Q00A 1U8ZA 2HXSA 4KXFB 3F3YA 4IVRA 2IXGA 2D7CA 3PUWA 4TMXA 2Z4SA 2GESA 2J7PD 4CGZA 3FVQA 3W34A 5L3VA 221PA 1LY1A 3MWYW 2ZYTX 4LGMA 2G1JA 1OF1A 3WMGA 4OI4A 4LZZA 3SNHA 2ZRNA 2JLXA 3CF6R 3UANA 4B2IA 3N2EA 2BHRA 1WCV1 1E3MA 3AQ4A 4QHTA 4Q9IA 2IS2A 2O8EB 3KQNA 2ZI5A 4B48A 2OAQ1 3GLIA 5B58C 3LH5A 4YMSA 2ZRFA 2V9PA 5KSOA 2ZITA 3NBFA 2N1BA 4YQFA 1S9DA 4A0GA 4F91B 1ZM9A 4UNPA 2FPMA 2HYIC 1P6XA 2JJ1A 4OI0A 1OKKD 1Z07A 3KKNA 4J0QA 2FGJA 4PZZA 4D25A 3L0IB 2ODNA 4NTZA 1W2HA 2FA9A 2QY9A 4MITA 3TQCA 3MRSA 4FCWA 3K0FA 1D5CA 2GZAA 3K09C 4MYHA 2RGDA 3ZIAD 4A8JA 1Q0UA 5FTKA 4CEIB 1IN5A 1Q21A 3KXIA 4PAMA 2BEKA 2QE7D 3I8SA 3UATA 5KOYA 3RC8A 4BECA 2H92A 2VF8A 4OBEA 4DEXA 2XXAA 2BBWA 1OFIA 2FWRA 2H7VA 2IYYA 3B9QA 2FPKA 3I4LA 4QBIA 1KSJA 5FR2A 2VHTA 3ZS9A 3OAAA 2GK7A 5A5GA 3CNNA 1KMHA 3CKLA 1OYYA 1OIWA 3NH9A 4A15A 1AN0A 3KTAA 3WNCA 2I1VB 4UNSA 2FSHA 3ETLA 4I99A 1Z47A 1E4YA 1ZM2A 2YOFA 4LJ4A 1KSFX 2ZS9A 2PZFA 5E7IA 2IWHA 1Z06A 3BH7A 1GKIA 4MKIA 5KPDA 1RPZA 3TSZA 2RKOA 4HZUA 1NL3A 521PA 2R6AA 1R0YA 4KFSA 2EWVA 4WA7A 1CXZA 2XOKA 1R5OA 4B6EA 1Y63A 3K70B 4CW7A 1II8B 2PT5A 2V1XA 1OFTA 4PR0A 3U4QB 2B92A 1P2TA 2A5GA 2JAQA 3FPAA 4JLDA 4PQFA 2KE5A 3EZFA 2J0SA 4BLOA 3B1ZA 4JSTA 2AWOA 2QRZA 3X1DA 2AL7A 4AI6A 3CF0A 4C7OA 5EZ5A 4F38A 1US8A 3V9PA 1LTQA 4FWIB 1LS1A 3B60A 4QGGA 3AVUA 5EP4A 1N6NA 1HE8B 3B1XA 4JKYA 1FX0A 4RJLA 1CS4C 2XZLA 1LF5A 1XD9A 1M7HA 1N6OA 1W4CA 2FF7A 3RWMB 2IS6A 1ZVQA 3CR7A 1NN5A 2GTPA 4Q02A 2OLKA 2P6UA 1HV8A 3T35A 4D4JA 2O8FA 3O8BA 2P65A 5J5CA 3KDSE 3U7HB 2O0KA 2E9SA 4BEBA 1CRQA 2AR7A 4Q7MB 4CVNA 4TT3D 2XJ4A 4OHWA 2OILA 4HAZA 1GILA 2ZRAA 4KI0A 1IXRC 3Q7QA 4YLGA 1C1YA 1GRRA 4LYHA 4UXIA 4OQFA 4B3CA 1DAFA 1LV7A 2ZVQX 1ZAKA 3RS3A 1UKVY 1A1VA 4O0MA 2NMVA 1RW4A 2XZPA 3QOFA 2ZRBA 2IS1A 4FMDF 1H8HD 4G5QA 4X8OA 4BZXA 3SBDA 5KDLA 4IKEA 4TSFD 4NCIA 5FOWA 1E2IA 1Q20A 1DS6A 5HE8A 5B57C 5H68A 1NBME 4PO1A 1X8LA 2DCUA 4DWJA 3MJRA 4BQSA 3SOPA 1W7AA 1XMJA 3ZD6A 4OI2A 5DI9A 3AF1A 3CIOA 3Q5DA 1SKYB 3W90A 2ANBA 2VIIA 3QBVA 1ZC3A 2IYVA 1IJEA 3VR6A 4Y0AA 3OFNA 3KJEA 4PPFA 4PC2A 3GJ4A 1ZNZA 2O8CA 4LK2A 5KNBA 2HF8A 1ZP6A 1HH4A 4DDVA 3AF0A 1GUAA 3FYHA 4EDHA 3O8CA 3KKQA 4FD2A 5FFMA 4LBVA 5FUVA 4R71A 5L3SA 3P26A 3Q85A 4FMCF 3U3RA 2PJZA 2NTYC 2ECKA 3QY0A 3SQWA 2Q21A 4E5UA 5AJWA 2WBLC 1IAQA 3SBEA 2ZQ5A 4RD1A 2O0HA 3EWAA 3ONWA 1YR9A 3EWSA 4P4TA 1TX4B 3PQCA 3K1JA 5AK0A 1E2JA 2XB2A 4P32A 1I4DD 2J87A 4XTCS 3ASYA 1JI0A 1KO8A 1MABB 1ZIOA 5GJCA 2HYDA 3BIFA 2ZJZA 1U9IC 2OO7A 5GJWC 1KDRA 2PMDA 4UJ3A 1XCPA 4FINA 2JDID 2EVWX 2L0XA 2OHFA 3KXLA 4OQLA 2ASEA 1WBDA 3VR5A 1VMAA 4NBSA 3SI7A 4N0DA 2VPPA 4JYBA 2FSIA 5CB8A 3EA5A 2ZE7A 1ONBA 4JVNA 2JLZA 2ZRGA 4TYYA 3HYRA 1UKZA 1X3SA 3HPQA 3BRWD 4GBMA 3K70D 3UK6A 1RVDA 4PQYA 3HYTA 4HAXA 4R2IA 1ZCAA 2R62A 1K6MA 2FFQA 4KV9A 2W2XA 3K0CA 4JVMA 4M1KA 4WW0A 1TQ2A 5JJIA 3PXGA 3TUZC 1J99A 1MO6A 1GL7A 1EFRA 1M34E 5TVKA 3VX3A 5LD2C 2OSBA 2C04A 3UXMA 1XEFA 3BK7A 5KTYA 4FWTA 5F9HA 1QHHB 2BBSA 4QGFA 4UXHA 4GPTA 3TW4A 2WWHA 4LV5B 2XB4A 5TXGA 5CM8B 2IHYA 4Z1MD 3MUFA 3BFVA 2R8RA 1E2LA 3EXAA 1KY3A 3IBYA 3X2SA 3DPUA 2QGZA 1TEXA 2JGNA 1JJ7A 3IO3A 2ZRLA 1E1QA 2ATXA 4HLCA 3RHFA 2DPXA 4JBYA 3WYFA 5L3QB 1P9NA 5JHHB 1XD2B 1XF9A 3WXMA 4KFTA 4G1UC 4HAVA 4OHXA 3AGQA 2ERYA 3SJCA 3NKVA 2DBYA 3KZ1E 2RGNC 2ONJA 4DXAA 4D4LA 3B5JA 3THOA 1DTSA 4EPTA 2G9NA 2AD1A 4ASUD 3WYGA 2B8TA 4POAA 4V03A 1XP8A 1Z6XA 1G3RA 2GF9A 1Q3TA 2XTZA 1R7RA 4DRZA 1FQKA 2P5TB 4II7A 3A1VA 3BH0A 1CR0A 4B47A 1NVVQ 1AGPA 2JLRA 4C0JA 1P9RA 1X1SA 1BKDR 3TMKA 2GXUA 2GVZC 3UG6A 3D8BA 1SVIA 3GJ0A 1VPLA 3GLFB 3VTKA 4AWXA 1KGDA 1J7KA 4KBGA 3KQKA 1GM5A 4IOJA 1F6BA 5EZ6B 5BYJA 1G3UA 4TMZA 3PUYA 1G4UR 5HKKA 2CJWA 2C9OA 1PLJA 3AVOA 1BIFA 1T8UA 4I1VA 3T06B 3HJNA 2B6HA 4S35A 1JBKA 2XSZD 3IHWA 3EIHA 1E0AA 2JCSA 4HLUA 1D8TA 4XOIA 3T5DA 4OJKA 1KI8A 3QPUA 1UM8A 2BVNA 4ZI2A 1E1RA 2H1LA 2AK2A 4IOKA 1WXQA 5JLJA 5P21A 2W6JA 4OHVA 4ABYA 3B78A 2YOGA 4PAQA 1XXHE 2BBTA 2QQ0A 1YRBA 4MA4A 4P4SA 3WHKA 1DBSA 4RSGA 2BKUA 1IHUA 3LAWA 4KSBA 4ZIRB 2AKYA 5LD2B 2FH5B 1CKEA 1E0KA 2ZS8A 2QM7A 3QKSB 5FBWB 1F2TA 3GJ5A 4L15A 3UMFA 3AM1A 5C2JB 4V0KA 1SGWA 5EP2A 1YZLA 1E9CA 4OQNA 2ZRKA 1ZW6A 1IQPA 4V0OA 3QF4B 3W8RA 1E4VA 1E0JA 1E2MA 1NN1A 5K8UA 1UF9A 3AKEA 1ODFA 1U90A 2OLJA 1R8SA 3B1VA 2PJRA 5CDFE 4DSNA 1CU1A 3BE4A 1M6NA 1S8FA 3DMDA 3K70C 3THWB 1NN0A 2Q3MA 4JLMA 2NQ2C 4IXNA 4DCTA 1E98A 3PCRB 2H5EA 4HATA 3AKYA 2GAOA 4NMMA 1S3GA 4HEJA 4B73A 4EAQA 2D62A 2QBYB 3AEZA 3MJHA 4CEHA 1Q57A 3OEED 4GP6A 1N6RA 4D4KA 4YDHB 2JJ2D 3CB4A 1A2KC 4XJXA 4F4IA 1W0KD 1GKYA 2LCFA 3L8YA 2QE7A 3VHXA 2YWGA 3L2OB 3REGA 3QEOA 4M8NE 1VG1A 1KJZA 3EIEA 3VAAA 4YONB 1ZM7A 2VA8A 1UKYA 2IUUA 2EU8A 1ZUHA 2VQSA 2W6IA 4TQ9A 3T61A 1R8QA 4V0ME 3THXB 2QPAA 3P27A 1SKYE 1OJLA 2ZJ8A 4ZO4A 5CLLA 3WP0A 3TK1A 4B44A 1NVWQ 1OXSC 3KFXA 2XZOA 3FB4A 5KU1A 3U44A 3FE2A 4B71A 2C98A 4G5SA 3AP2A 4PC7A 3QPVA 2E87A 2A9KA 1KO7A 4M1OA 2ZI7A 1NIPA 1S1MA 3FMPB 1IOZA 1R5NA 3JZAA 4B32A 2J0UA 1YR6A 2G0NA 3I3SR 4DT1A 1W4BA 4B2LA 4GSYA 3VU9B 2P6RA 3MCAA 1G7SA 2B7CA 1XCMA 4G5GA 1OH8A 1V43A 1U0HC 1XTSA 4NCNA 1JR6A 3NBXX 2ZUCA 1KI9A 2ZANA 1KOFA 4MYUA 1EWQA 1ANKA 2Z5FA 3NDPA 5DYIA 2Q3FA 3LLMA 4RKEA 5FBVB 4TLEA 1D2EA 2BMJA 3A6PC 1HA3A 4L16A 4BZPA 1NKSA 2FNAA 5F9FA 4WIAA 1GOTA 3K9HA 3CX8A 5J4YA 5KHOC 2LKCA 1AIPA 2ZSEA 2CCGA 1IONA 3MLEA 3ZJYA 4JVLA 3EG5A 3D3QA 2FX3A 4PPGA 4WXRA 1W49A 1ZUIA 2IUTA 2QU8A 3K0EA 3IQWA 2UKDA 3LW7A 4LX0A 2V54A 4OK3A 3W3ZB 2JJ1D 1FPMA 2P3SA 5G41A 5E3HA 3QSYA 2CVHA 4GZMA 1SXJC 2VO1A 4EPYA 4XSHA 1MOZA 5EQTA 4KFRA 1WA5A 3PIRA 3R7WB 1OLOA 2C95A 1N3BA 1ZNYA 4L9WA 1N25A 5EUQB 4F92B 3VR3A 4LOAA 1IN8A 4QBFA 1YZGA 3TH5A 4ZDIA 5FPKA 2FV8A 1F5NA 1NVUQ 4TYNA 2BEJA 1LS6A 2YOHA 621PA 3BS4A 3LBNA 4ZCLA 1XPOA 3A37A 1XBTA 3AKDA 1W36C 1OV4A 4L5BA 4I1OA 2AFHE 3FKSD 4WXPA 2C5LA 5KDOA 2BIFA 5FOVA 5HPYB 4H9GA 2KBEA 3GJ8A 3U2QA 2O8EA 3QG1A 3ZVRA 1DVRA 3N70A 1IY1A 3M6AA 2EQBA 3ZVLA 3SFZA 3KQUA 4KSCA 3FMIA 2HT1A 5KNCA 1CIPA 1JXMA 3U7FB 1P72A 3BAFA 3ZS8A 5AJYA 3ICEA 1FQJA 5JRJA 2DB3A 1RJ9B 4HB2A 2QMOA 4MKGA 2W0SA 1W36B 2O52A 4LPSA 4JJKA 4QHYA 3WHLA 3V4RA 1CJVC 1IBRA 1SVSA 2XNSA 5TDHA 4EQ6A 4CEJA 2ZU6A 1O3YA 4A8JB 5KSZA 1NIJA 2ZYWX 1P75A 2UZIR 3GLHB 3BB4A 3I32A 1BH2A 2H16A 4V0LA 4B34A 2VHJA 1VHTA 2OM2A 1E2DA 2G6BA 1G20E 4HB0A 4IVPA 3OE7D 4Q47A 3LX5A 4A6XA 4BRWA 1W0JD 4NZYA 1G41A 3PV0A 4IFEA 4Q19A 4JIMA 2PEYA 4XH9B 3V4FA 1NLFA 3KQLA 3VKGA 4LHWA 1MKYA 1PJRA 721PA 4QJ5A 3EZ9A 4IDHA 4BLSA 5LDDC 5BN5A 3KUCA 3PEVA 2IL1A 3JVVA 1A82A 1EG7A 1FTSA 4BFZA 1XU4A 2BMDA 2B8WA 4RY2A 3ZLJA 1CJTC 4JL5A 4B76A 1YZNA 3OIYA 1BS1A 2VYFA 4M1MA 2VP2A 4M0LA 4HZUB 3H4MA 3TVTA 5JS8A 4FMBB 3WYAA 4MDEA 1II8A 4LJ8A 3U4QA 4LBYA 4OI1A 3U6KA 3B9PA 4QHSA 3EZ2A 3EPKA 1W2GA 4ACBA 4PQRA 1RIFA 2VP4A 3VR4A 1R2QA 2OEPA 4LPKA 2ZS7A 3TQFA 3N2IA 3R8CA 2C2HA 1TF2A 2J59A 2QP3A 1XPRA 2C03A 4NCKA 3CZQA 1J2JA 1NP6A 2WSMA 3P4XA 3CX7A 4BFUA 2WWWA 3TIFA 2IYSA 4V0MA 4LJAA 2V3CC 4MUBA 5DNYB 4M9XA 4AKGA 2D2FA 3HP1A 4QRHA 2D2EA 4G0NA 2CHGA 4LJ6A 2BMEA 4DVGA 4M1YA 3J81k 2ZM5A 1S2MA 3LDAA 1ZD9A 2O8FB 1UADA 3P1JA 5TB5A 1E9AA 4UJ5A 5FPSA 4JLOA 1EFUA 3RANA 3Q72A 4BLPA 4D6PA 3ZVNA 2QRNA 4C3ZA 2ZI6A 5K8IA 2R6CA 2I1QA 3HR7A 1NY5A 2PT7A 3EPHA 3IHLA 4WZAE 3NEYA 1WF3A 5JWHA 4JSYA 5C46F 1T3HA 2VBCA 2REOA 4YDSA 3SQXA 4O25A 1G5TA 2FSGA 4EFLA 1RE0A 2GF0A 3C15C 4ASUA 2XX3A 3B85A 3F0TA 3VX4A 3SJBA 3ZGXA 4TZ0A 1AM4D 1DOAA 1Q22A 1B0UA 1FNNA 1D9ZA 1MRNA 3QKUA 3LXRA 4ZKEA 5JFGA 3QXCA 1XTIA 2QMEA 1ZBDA 5M04A 3KFVA 2ODWA 4NH0A 5KDDA 1KSHA 1C4OA 3EC2A 4KODA 3U3OA 2GETA 2IEZA 4QGHA 3A1WA 3EA0A 2G77B 3HU3A 3SHFA 3H0KA 4EPRA 2OBNA 4XVRA 3V00A 4M9SA 2NO9A 3SYLA 1OB5A 2A7QA 2HLDA 4Z8YA 2JDIA 2VEDA 5DI3A 5C1BA 1EFCA 3U7GA 1RRPA 4JT4A 5ANRB 2WICA 4IEEA 4FXPA 3KUDA 1VYUA 1O87A 3GFOA 3SYKA 1N5KA 5SZJA 4DDWA 4OKSA 2K5UA 3U7EB 1Q3HA 4I1SA 1AS2A 1II0A 421PA 1OE0A 3IO5A 3NC0C 4PHFA 4DCNA 1OH6A 1JR3D 4RCYA 1LB1B 5ELXA 2VSFA 1NJFA 4R98A 4JBXA 4TL7A 5EP1A 1X8KA 4IXMA 3WMFA 3CRQA 4LYJA 4ZKDA 2BJVA 3I73A 3EAQA 1EFRD 4BFWA 3L0PA 3A4LA 4BASA 4EIWA 1J70A 4DHEA 1RZ3A 3R9IA 2G1KA 4KVGA 3IBGA 3AV0B 3K9GA 2IK8A 3OIUA 4OL0A 3W6PA 5HZKA 3RS4A 1UFQA 2IXFA 3DMNA 4HLUC 2YINC 1MABA 1Z5ZA 4A2PA 3OAAD 4ESVA 4PO9A 4LWZA 1YJ5A 2WMOB 5FTLA 1RRGA 1QHGA 4Q5IA 1NMZA 1N6KA 1PUJA 3CPEA 3ADBA 4GDFA 4ZCMA 4BRUA 2AN9A 5DISB 4M1WA 1NSTA 2BM0A 1S9HA 1SVMA 1NBMA 2H17A 3EW9A 2W0MA 4MUAA 2JLSA 2QTHA 4KFUA 1KSGA 1QDEA 1F60A 1NRJB 2P2LA 2XTNA 3AF4A 4KAXA 4C0KA 1FL9A 1YKSA 2G3YA 2WZQA 1U99A 2WJHA 1ESMA 3C8UA 3LX8A 2KB0A 1LF0A 1KO1A 1TQDA 5GVRA 1GWNA 3SN6A 2GCPA 2VP9A 3AUXA 4ILEA 1FP7A 1E2HA 3EC1A 4GOXA 4IW3B 1EX7A 1SZPA 1P61B 4NONA 4M21A 2BCJQ 2YZ2A 3H1TA 2AXNA 4Q9JA 1MO5A 1QHHA 3FHOA 4Q7LA 4CF7A 3K8YA 3DM9B 3M1IA 4BPBA 1ZCBA 3AVYA 1Z28A 4XVQA 5AJZA 3AVPA 1S96A 2VHCA 3K53A 4URUR 5JS7A 5F3WB 1TEVA 2ODBA 2PCLA 2V7QD 3T15A 2WWGA 4ZDWA 3QKTA 5HE9A 2VLIA 1W46A 2A5DA 5FPYA 4NYMQ 3KL4A 2OXCA 2QA5A 3WY9A 4M1SA 3THYA 4WAUA 1DAKA 3C7KA 3DEFA 1QG2A 3GLHE 4QNMA 4W5HA 3RDPA 3ZZTA 4EJSC 2VL7A 4N0EA 1KDTA 2ZR7A 2GJKA 4R2HA 1G7TA 1T5IA 2NGRA 4QG7A 3ZZ0A 1HTWA 3GLGA 2GZHA 1I4TD 1NY6A 3K0SA 3DZDA 1MR3F 2Z0MA 1OW3B 4B35A 3PEWA 3R9WA 2CLCX 2GILA 4A2QA 1X6VA 3CO5A 2RHDA 4NKRA 3CX6A 4Q1AA 1XMVA 4JJZA 1VIYA 3PUVA 5K8LA 1OHHA 1I4LD 4QNRA 3TW8B 2DFLA 1CRPA 2AFIE 4NYMR 3LQRA 5J4KA 1TQ6A 1KAGA 1NG1A 1QHIA 4LBZA 2FFBA 1SXJD 3OEHA 3W5IA 4YMUA 4MRVA 5C4MA 1Z63A 3OIWA 1NJGA 3GLFA 1NLYA 4KBFA 5DSZA 4DIDA 3QF7A 4GOKA 1XMIA 1W48A 2P67A 2H57A 3E5HA 3ZYCA 4JLJA 2KJQA 4DLXA 1DO0A 5AJXA 2O8DA 5B2ZA 2YVUA 2CVFA 1GRNA 1W0KA 1G1MA 2ZJYA 4NYIQ 2QORA 1JB1A 3C14C 1VCOA 4PANA 1H8EA 3BJIC 2W6JD 5DIFA 1KI6A 2ZE8A 4P4SB 1OFUX 3QUSA 3WRXC 1JQLB 3C16C 4ZIRA 1IXSB 1U9IA 2QMUA 1D2NA 1V5WA 3QKSA 4M2LA 1F2TB 1XTJA 4QM7A 1XMSA 3H84A 2W2TA 2EYQA 3VHLB 1NNEA
chains in the Genus database with same CATH superfamily
4L4ZA 5AHKA 3HDHA 4IL5A 4U63A 1FZQA 4G23A 2XNKA 1HG1A 4IDBA 2H7CA 3UGQA 3M6FA 4WY2A 2HRCA 1E89A 3FRHA 1N9KA 4UPDA 3ZHBA 4B7CA 2AG1A 2YHAA 3OZXA 5DYTA 2OFFA 2I4NA 1MDFA 1Z6QA 2V7QA 1FNBA 1ORWA 2GK4A 3GELA 3PGKA 3G23A 3KQOA 1PEYA 1VPDA 3IQEA 3IILA 5EWLA 1IY0A 1WMBA 3FHTA 3GH3A 3RYFA 1C5KA 1A8IA 3ANYB 4FGWA 3C85A 4DCOA 3FCSB 4BE4A 4ETNA 2F1IA 5FWYB 2JB9A 1XZBA 4INPA 4ZO6A 4QEDA 5KYYA 2QSYA 1UDXA 2P27A 2EFCB 4L72A 5EHIA 3SVLA 4W9MC 2QBYA 1KI7A 5F9HA 4FI3C 3X1YA 4CV2A 1ZD4A 2WAYA 3O0DA 4OBBA 1H2EA 1Z83A 3WB2A 5EIWA 1ZMOA 3C6MA 4K03A 9MHTA 2VP5A 1HEIA 3AESA 3QKRB 4XFDA 1KTVA 1SKAA 4IDCA 4ZJYA 5CX1A 3SGLA 3CN9A 5JSQA 5K8CA 3AFOA 1M9NA 2YWBA 1DQPA 3OE7A 5CM9C 4CM4A 1TJNA 2Z4RA 5CITA 5D7NA 3D7KA 1VPVA 1EJ2A 2ID8A 3ONDA 3DZHA 3PG5A 4H3HB 5SY4A 4LFAB 4JI3B 3RVJA 3CZCA 2XBMA 4EO9A 3OKCA 4A0HA 5EMMA 2YW9A 5LBTA 1RYHA 4U0JA 5IK2D 4G4SP 4A0FA 5ALJA 4ICIA 4NMLA 1PR4A 2J0QA 5T4BA 3DMFA 2FEWB 4XLZA 1E9DA 2IHTA 2OZVA 2R8PA 2GI4A 4JP5A 2QT1A 3RBXA 1Q74A 3ITKA 3ZYZA 1I2BA 4B3DA 3GGCA 2WTXA 3VKWA 5E8RA 4LF6B 2CWDA 3LUCA 3NUGA 4FMDB 4EHIA 1QS0B 3LWBA 1KZGB 1P2VA 1PFQA 1LJUA 1U9YA 1YZUA 1ZMTA 2GASA 3DHNA 3QEBZ 3T12A 4ETMA 121PA 2AZDA 4H4EA 2JBAA 3I5MA 3CG4A 3LUGA 3VVCA 3DEZA 4JELA 3VOTA 5I7HA 3NR2A 2AWNA 2W00A 2CSXA 4GQBA 1E9BA 1LWOA 1XMXA 1WZEA 3PDWA 2O59A 1MNQA 5IW8A 1ZD3A 2C4NA 2EQAA 3BFKA 3I3OA 4P5PA 3ZHTA 9ATCA 1VHWA 3UM9A 4RVOA 3SD7A 2GM5A 2BFCA 3EVBA 1LDEA 1OASA 5C8VA 2Z1DA 1Z7YA 3UAWA 1K0FA 1D1SA 1WP4A 2OORC 2A35A 2PTGA 2IA5A 1ECGA 2PUJA 2YXNA 4Z9AA 3HBLA 4EG7A 3G7UA 3FPLA 4RMNA 1SU6A 1ORDA 1K8ZB 2SHKA 2PUTA 2XQIA 4KTTE 2H4JA 1TVEA 2QX9A 3FUUA 2ZTVA 4LFCB 5BN5A 4DSUA 4HYYA 4XCQA 5J40A 4CLHA 2GZ1A 3JRXA 4K46A 1CC1S 1JILA 3TSOA 4G6ZA 5AW1A 3E5MA 4E3WA 1L8LA 4HPWA 4KU4A 5B7NA 1GNPA 2Q2QA 3WYNA 4LVCA 1XTTA 4TRMA 3GQBA 5JQGA 1UWCA 2J48A 4MZDA 4FCVA 4DPMA 3A4NA 2NU7A 3PHLA 4HAYA 1NXWA 4JGGA 4JOQA 2Q1SA 1X8JA 1QQ5A 1VL1A 1IY2A 2CCKA 3QVWA 3EIOA 1AGRA 4Q6WA 4RH3A 4ZYTA 1QF7A 2BFBA 5HKAA 4P38A 5J3JA 3K96A 1Z5GA 4HD8A 2PKRA 3H11A 4DADA 3EOZA 4U1RA 1OX4B 3RYCA 2X5JO 4CWAA 3AVXA 1QVRA 4GKVA 2HN9A 3HYSA 4CN8A 1G8HA 4TYPA 1RXWA 1ECPA 1ZA1A 3LDUA 4KXQA 4YP5A 5TEVA 2W2PA 1TUIA 4GT1A 2GCOA 2VNSA 4GLJA 1EQUA 3UFBA 3DOHA 2CVQA 3EJWA 3I5YA 2OBFA 1ZOOA 1RHKA 4WKBA 1WD7A 3OMLA 4JT2A 2XJ9A 1U65A 2FMXA 1KO4A 1U7ZA 2Z3ZA 5GONA 3ED1A 1V8ZA 2X4GA 3A9VA 4JR2A 2QPLA 3BXOA 3IKTA 1Y89A 2R6DA 1C3EA 1F4VA 5JS1A 1G9SA 3RWBA 3TBKA 4FFOA 5A0FA 2MMGA 4LOIA 4BLSA 5KVSA 4OIMA 5JD3A 4PC3A 2CV2A 1MJFA 1EBFA 5IASA 4XGKA 3SVZA 1O4VA 2OCBA 5GQSA 2FR0A 3P9QA 1E4EA 1A5ZA 4AZTA 4BOYA 1XRMA 3E48A 5BNIA 3QIVA 1IQUA 3ELDA 4AKHA 1P74A 1RYBA 3A9WA 1SBIA 3C5VA 2VOJA 3PHBE 1V8PA 4HQNA 1V16A 4CM3A 2IPAB 4YYZA 1PV2A 2A2ZA 2H18A 3NATA 2GAJA 5BSFA 4I1PA 2C82A 3OKFA 4C4YA 1IIRA 4IQ8A 4RGBA 1NJSA 1U0FA 1L7DA 3HR8A 4UBNA 4BV2A 1NJ8A 2D0IA 4IIXA 3WSWA 2RHTA 4CIVA 5SZIA 2RBKA 5IFKA 2XUQA 4Y6RA 3GRKA 1BMFD 3ICWA 2R751 2XMPA 4HEA1 1G64A 4WNCA 4AJ4A 5COBA 5LMCA 5GJBA 1M8PA 1V3TA 2VCEA 3PRJA 4R9RA 1GEGA 4X1IA 1T4GA 4GOOD 5DHRA 1V5GA 5FAXA 1V1JA 3UB3A 1KJYA 1T3LA 1PTKA 2XE4A 2JGDB 2I3GA 1BWRA 4NOJA 3NC1C 1DGQA 5CW1A 1LBHA 2RHBA 1ADCA 1BS9A 1XRRA 2CBXA 1Q7TA 4NE7A 4ZTBA 3UAXA 3Q7SA 5K2OA 3EY4A 4ARUA 4YUYA 4L57A 4RD3A 5AM2A 4DJ5X 3A8TA 5EPUA 1XLTC 1DL5A 4MH0R 1BS2A 1Q16A 1QR2A 4G0QA 2EFEB 4U2GA 4YJ3B 3HBNA 3PDIA 2QV7A 2X8JA 2H48A 1UZLA 3IAS6 1FU8A 2ZJBA 1ZFNA 3CM0A 4R2KA 3OOHA 2CLFB 1EWTA 3WFZA 1IIBA 4IEFB 1RADA 2XCUA 4UOQA 4O4JF 1NC1A 3ZLBA 4U9HS 4RTNA 1UP4A 4OLBA 5CJ2A 2Q4DA 3R77A 2HIMA 4KIUA 4DEYA 3AETB 4BLRA 3R41A 1DCFA 4IGKA 2YWHA 3MCVA 5TQJA 4ER0A 2P0AA 5EHNA 2PTHA 3BDIA 3D3WB 3GJRA 4GYJA 2PUEA 2VXCA 4TRJA 7MHTA 4U7JA 1MQSA 4ESHA 1U8AA 4LDJA 4C7KA 2X7JA 4GO1A 1LTKA 3CS3A 4MVXA 1P6UA 1ADGA 3G5AA 4JUDX 4BUZA 2I67A 3NAZA 4D9NA 2P9JA 1I5EA 1ULUA 1UBKS 2ZTUA 3AR4A 3FPBA 3I9NA 5DGXA 5J5AA 3RR2A 2A0FA 2ZZNA 3SHWA 4ZFNA 1ZYUA 5AW8A 2XEDA 2HK6A 2DE0X 3IEUA 1U7OA 3GDFA 3BWBA 1ZD5A 2Z3VA 2Z5LA 1KMQA 3OESA 3LFHA 3AI1A 3DPIA 1G19A 3LBAA 3HO1A 2E6UX 5U9CA 4TLDA 2PUFA 1VIAA 2RI1A 2AUMA 5AT1A 2P3QA 2OO5C 5LQKA 1N7GA 1T91A 2IPXA 4J2TA 4C21A 2J5XA 4PC1A 3HO8A 1OX6A 2ETXA 4FUQA 4BLTA 5B3AA 1JB9A 1L5VA 3VR5H 3A1NA 2IUSA 3QNUA 2QAIA 5I7AA 1DC5A 4OK6A 4FDTA 4BO9A 4M0KA 3V5NA 3VC1A 4B3BA 2HHAA 2H29A 2OZEA 3QHAA 1WDTA 4REQA 4HNQA 2JI8A 1NVKA 3NOXA 3SF0A 1GNVA 4D9EA 3D6TB 2QSZA 3OQIB 4DNXA 4AKGA 3Q2KA 4PTZA 1Z0FA 4YJFB 1EJBA 4J43A 4CM8B 1FRNA 5A4FS 1L1QA 4RESA 2NNLD 3QFFA 4ZQIA 3FYUC 1CFJA 2WUEA 3QELB 5AOAA 4EWLA 2DETA 3JAMA 1M2WA 1IEXA 1N32B 2FPSA 1TYAE 2CL0X 3ZXSA 1EUDB 2DM6A 3DB1A 3GNSA 3T5BA 2P69A 2ZVJA 1SA0A 2CE2X 2IFTA 1UOEA 2VNHA 3VM6A 3WYEA 4ETWA 2JD1A 3GFRA 1QCCA 2Z58A 3FPHA 4HP8A 3ZK7A 3U60B 2WSSD 2AH5A 4HWOA 5CB0A 1O9GA 4MKFA 2CDNA 3ECAA 5HF6A 5CB4F 1E9SA 2CUZA 3GMDA 3MTIA 1EFVA 3VOSA 1Z4IA 3DEYX 4NU6A 3L3BA 5CK4A 4CKWB 4Z4CA 2Q3JA 3E4CA 2YMLA 1EK1A 2V58A 3EMKA 3H2IA 2J7PA 3ZU3A 2YUIA 3IJEB 2BRUC 3NNNA 3ILVA 2F3PA 2QYSA 3DE0X 3O83A 1KK1A 3UJAA 3R3ZA 4BE7B 4MEBA 2HDOA 3L6RA 1TYCA 1KNQA 1TNDA 2DTDA 2QK4A 2WA1A 3FGPA 1AY0A 1C9NA 1G8GA 2DY1A 3NBUA 3PGJA 3OETA 1BEEA 4TLAA 1VYVA 1N6LA 3PZRA 4G9BA 2MHCA 1SCUB 1YNOA 3HC7A 4I9NA 1KZHA 1WPXA 1ZD1A 1GNTA 3RSOA 1C1DB 1MC5A 1YHZA 4P5DA 4UNQA 1I2AA 2VHXA 2VBIA 2CXNA 1TCAA 3FWYA 4JR1A 4U5XA 5K8TA 2DJ5A 2EYUA 3O21A 2PXAA 2E5LB 4FWBA 1RZUA 1KAQA 1X86B 4E5NA 3OPVA 2AI3A 3FWNA 3RABA 3IA7A 2CNNA 1MIHA 3K0CC 4HSEA 4O08A 3STYA 4EJSA 1VHQA 4LMAA 1Y3CE 1QYWA 3I9JA 4EYKA 1PNOA 2IWRA 3ZXIA 2QJTA 1TZJA 4OY3A 5TY0A 2FWJA 4IDGA 1V7CA 5HZGA 5ISMA 2BUCA 4R0NA 3SU8A 1D1PA 3KJHA 1T4CA 2GM9A 5JAUA 1AQUA 3UJ8A 4D8TA 2DHRA 3D6AA 1XXHA 5A4JA 4DJJA 1Y5NA 3DD1A 4MGZR 1GL6A 2QG6A 4MW5A 1H1DA 1MG0A 1JJBA 3BORA 2P2GA 4FB5A 5A6VA 1BD4A 2MMCA 1PNVA 4EMTA 4B5KA 2F67A 2QUAA 4QXPA 5KYUA 3RKUA 4A4DA 2BYTA 4OHYA 1P5JA 3OWHA 4XM0A 1TFRA 4B6QA 1A2OA 3M33A 4M46A 2CXQA 4Q4HB 3WNBA 4ZU3A 3EY9A 1GFZA 1U1IA 4BGEA 2NAFA 4AIIA 5C5DA 2FLWA 4XQEA 2IEYA 3PWZA 2WJJA 3RRMA 4ZJUA 2XITA 1G21A 2XVYA 4PHGA 5C8YB 1EESA 3CT6A 4CI0B 3B3GA 4MDYA 5HRUA 3LQYA 4JLAA 4MKHA 2GHIA 3NNDA 4BBZA 3AXSA 1BC5A 2KLBA 1DBPA 1KEUA 4WA8A 2A5JA 1HLGA 4KQ2A 4I9UA 4MQ5A 3S0JA 3GD7A 3OCCA 1WXIA 4HYEA 4QU8A 3TL3A 1SCAA 2Q46A 3Q87B 3UO8B 5C3MA 1OZHA 4XARA 3HB1A 1HDYA 2F7SA 4YR7A 1NASA 1OWPA 2AUNA 2Q3EA 5AM4A 1X7DA 4FOOA 4KSYA 5LZ2A 3UHPA 5ESDA 3W9SA 1QIEA 1GTJ1 2DSNA 3TW0A 3AUAA 4OM7A 4IUYA 4IHQA 4JASB 5KWSA 4S2EA 3EQZA 3I37X 3KX2A 3UUEA 1O0CA 4GPD1 3R6WA 5I9LA 4ZZ2A 1VG0B 2OT3B 3QJ5A 1XDGA 4PTLA 4ZAZA 2PMKA 3KVVA 3QVSA 4OHKA 5EMLA 1GO2A 2FDCA 4AG6A 2PK3A 1OVMA 3PLNA 4NIMA 5BPFA 1K8RA 3GVCA 1SULA 3L4EA 4IH4A 3I92A 3OQVA 5CFNA 4RELA 3C6QA 3FDIA 1Z18A 3TW8A 1J8MF 1K27A 3FOBA 3AH8A 4KVZA 5IP5A 2IDKA 2VQEB 2F8TA 3VMFA 5HQ3A 1P73A 2R84A 4ZPXA 1VCHA 4PVDA 5ALLA 4RC9A 2A33A 4RTSA 4AP5A 4GYYA 4QPZA 1OIVA 3Q8WA 2O8NA 1R74A 4KO1S 2FUCA 3LD9A 1Y8RB 3KBBA 2JJMA 3MUEA 2X19A 3KAPA 4J0DA 3O92A 5KHOC 2QL7A 2AHOA 2C3MA 2BGWA 3E8MA 3LUDA 3CLKA 1PJBA 1ZRNA 2P9BA 3QU2A 3H9QA 3RIHA 2K7FA 4FFNA 3DAPA 2V9CA 3MSCA 4W5JA 1HE1C 2D5AA 1EKXA 3UMRA 3PEUA 2YRXA 2RH4A 1ZGHA 1NQXA 4HFMA 5F64A 5E9WA 2HTFA 2N3ZA 2YV2A 2FJUA 1CJUC 3S1AA 3UOAB 1SVWA 3K5PA 1L5HB 5BQXA 2OHHA 4BX3A 4HNUA 1ZMXA 1IZ0A 4MA0A 1N2CE 4PZLA 4C7BA 1EJ6A 4RLFA 4BCDA 5EKSA 3RRXA 4ZVQA 1VLJA 1Z75A 3NUQA 4JQCA 4MOWA 1QGYA 4C9BA 4LJLA 5BXQC 3SS9X 3GGSA 4GQAA 4YAOA 4M53A 2R1VB 3T1OA 1EFKA 2VAVA 3I42A 1NVFA 3HFRA 3RS0A 2G8LA 2PKYX 3I6QA 1W4RA 1T8TA 2C59A 4UTXA 3C3XA 4JBWA 4NECA 1LSJA 5SZKB 4E70A 2ZQYA 2PT6A 2A6PA 3JQQA 5T57A 3ESRA 4WACA 4F4UA 2Q9AA 3G5UA 4B5LA 5KU7A 3VNVA 3LQKA 1V96A 1AZWA 4K3VA 3S2SA 2F8SA 5COAA 3IR5A 2IT1A 4QEZA 3VZPA 5LJLA 3D6MA 4UE3S 2Q6TA 4RVDA 1NXOA 1IXKA 2IXBA 2P2YA 2ZJ5A 2B9EA 4M76B 5KTTA 1QK3A 4HLDA 3A31A 2VNJA 4B7XA 5IPFA 1E1CB 2GD6A 3ANMA 1SQ0A 3LOQA 3KDAA 4JI8B 5LM3A 4JOCA 1W6UA 1GUYA 1M2GA 2NUBA 2PD4A 2QN3A 2WNHA 1ZHOA 3GARA 2FG6C 2W8BB 1PQ4A 4KXUA 4WCVA 4ESOA 3COZA 3AFHA 1U0LA 3BF8A 3FOCA 5AHRA 4ZMSA 5EE1A 2DVMA 4XE5A 3L6OO 1Q12A 2Y9MB 2B3TA 3GJ7A 3A1UA 4Q1BA 5C7OO 1SCNE 1T4BA 1G17A 3C1AA 2DBZA 4OAQA 3FOFC 3R9XB 4HUTA 4X65B 2H8KA 1N7JA 1QAMA 1SVOA 4I1IA 2JFVA 4Q7EA 2VWQA 1WXXA 5E9JA 3BL6A 3FA2A 3FYCA 4N3CA 3N2LA 3MTDA 2I4OA 4KYTA 2XKKA 8AT1A 3ZE7A 5K3FB 4HB4A 4U02A 1SUCA 3C7DB 3M6IA 4EPVA 5BNZA 5HOQA 4D26A 4N0PA 4U2KA 5CGZA 5HOEA 3DAGA 2C8KA 2EATA 1IHXA 1KA9H 1W88B 1GR0A 2IYLD 2QD2A 2Y2UA 4MUKA 5F5NA 4B2PA 821PA 2JZNA 4CE6A 3AU9A 2OCDA 2ZXFA 1X7GA 3SKVA 1U3DA 1RKBA 5FNVB 3TGPA 4X5OA 3OFND 4XFKA 1U94A 1CR2A 2PHZA 4CZ2A 3IGFA 3D7LA 2UZ0A 3F96A 1PQUA 3PT9A 1NVMB 2AOUA 2DWQA 3FR7A 4TQGA 2NM0A 5CLIA 3MTQA 3BWDD 4RZIA 4US1R 1AGNA 3EXEA 4IJVA 2H9IA 5AHWA 3OQ6A 4Q1DA 2ZP1A 3LV8A 1P5FA 2JAHA 2J0VA 3VSEA 3PPWA 1Z5OA 1JG3A 4MRNA 3R75A 2H1CA 4Q12A 4Q21A 3DV0A 3ZX5A 2P6MA 1FVXA 4W63A 3VPHA 2I2AA 5LIRA 3G3EA 4JJ6A 3ZOZA 2ZAIA 4PLGA 4EB0A 5AUNB 1OTHA 2ZIAA 3Q88A 2CMKA 4CLOA 1YE8A 1TUBB 3SXJA 3P2EA 2FZCA 2B20A 4PG4A 1SMKA 4DPLA 1QKJA 3DMYA 3KJGA 3NTUA 5KNCH 5FOTA 2CVZA 4OKNA 4R3NA 1ZGAA 3SAJA 3P9NA 3G1TA 1T9AA 3A1SA 3JAKB 1DP4A 1HE5A 4YH1A 4ZHQF 3DT9A 4Q93A 1RLMA 5A3QA 2QVLA 2R7KA 5FLYA 1I24A 1IBLB 2VJMA 1UOOA 4KZPA 2CNWA 5IJWA 1XNQB 2HO4A 2NXCA 2P5SA 2R60A 1T1GA 4QYSA 3R3UA 2NU7B 4GLLA 2Y93A 4X66B 3W8NA 5IXJA 4FNAA 1PS9A 5K03A 4Y6PA 5AJHA 1XZAA 2JATA 1U6JA 2I9PA 3JYLA 3JTMA 1CEQA 3OY7A 5JNLA 4JYZA 1OX4A 5AIAA 4TQUS 1SURA 1ZOSA 3PL5A 4OXRA 2F4VB 4TZ6A 2F90A 3T1NA 2W6CX 4J6EA 4N18A 3ETDA 5B5SA 3UGTA 3OJWA 3AM5A 4RGVA 3O26A 4G0XA 2GXAA 1Y3DE 3LF2A 1N1DA 3DWEX 5FBKA 3UV7A 7ABPA 1H8HA 3QHQA 3H5IA 4MPTA 1QQ6A 5F76A 4P34A 2ALJA 4DLLA 5FYQA 3T1YB 3PNVA 3OZAA 3P52A 4C5AA 1PYOA 2XV1A 1OAKA 4HUQA 1XVAA 2W4QA 3GPLA 2HDNB 5KPJA 1BD3A 1VLLA 3T4PA 5BYAA 2C4KA 2PX0A 1HQYE 4OHCA 3F5QA 4DB4A 1U04A 4ESEA 2V7VA 1QIFA 1XJ5A 4QPCA 4X91A 1G3QA 2AC2A 4GMXA 3DBIA 3HJFA 2C57A 1FYXA 4IDNA 4FBMA 4RZUA 3N0VA 4ZREA 2QRJA 4G36A 4N6NA 1G21E 1CEXA 3G8CA 1BNCA 1FMLA 2QR5A 2YZKA 5DTRA 3TI9A 5KBYA 3RYTC 1KS9A 3R23A 4XR4A 2QD3A 4HH0A 2D4HA 1XK7A 3AHEA 5JD5A 2VPIA 4JP2A 1RKVA 3SG0A 1T4MA 2F3QA 2LGJA 4IIHA 2BEVB 1L9XA 3B82A 1RQNA 1ZISA 1OA0A 4TMVA 2C54A 2XD9A 4BZQA 1EYZA 3GHYA 1ZCZA 4EUSA 4AZ0B 3I34X 3DBLA 1MJGA 3ETGA 3A6EA 3CPHA 1EP2B 1Z6PA 1ZGJA 2Q3HA 3L18A 7YASA 1VJTA 4CEIA 2HO5A 1E1DA 4PFQA 1HZJA 1QQAA 2QL6A 4RIIA 4JXZA 1KH3A 4EYGA 1KJJA 2IX9A 3OP4A 5BVGA 2QN6A 1T0JB 3O8RA 4QUKA 3SY8A 1NYRA 3LO8A 4DT1B 4LF5B 2CD7A 3RF7A 3T7TA 1B6SA 1EXVA 3T3MB 3D43A 2XXAB 1QQ7A 1F2UA 4KWTA 5L8VA 3UMMA 4QGAA 1V9LA 1IVNA 2Y2VA 4ZVUA 5HCIA 3CURA 1ZU5A 2VDOB 4PHTA 4Q4AB 4EMUA 5A4AA 1LBIA 1UBFA 2BW0A 1FTYA 2CXUA 2IHBA 2QENA 2QTTA 3PQ8A 3H2JA 4L9AA 3F98A 5K20A 1UDCA 2M6SA 3HU1A 4KQWA 2ZUDA 3WQQA 2CHEA 4QO7A 1XX6A 2M6RA 4BNWA 3FHLA 1KMHB 1HDGO 1N0IA 3BIOA 4A03A 5KOIA 1OFUA 4IZIA 4BN4A 3KTAB 1GFIA 1I32A 1MRSA 2IVFA 4HB3A 4LVOA 4R1PA 4NU8X 4UTZA 4F93B 2HHHB 2EEZA 1SM4A 1SCDA 2ZB2A 3PWSA 3EEFA 2XKAA 1ZSYA 2X8JB 2YWFA 3GLQA 2AC4A 3JSXA 2CFOA 3DEAA 4PPNA 1OFHA 4QUBA 3ESYA 2I6FA 2ID9A 3K9BA 5DWVA 2ZRMA 1L6IA 3C24A 2XYGA 3ILYA 4J76A 5C81A 2AN5A 3JQAA 1BQ3A 3I5XA 4DC1A 4AJ9A 2WUFA 4PO8A 3SXPA 1E92A 4ZDJA 2M98A 2ZVDA 4LY3A 3OJLA 3KHSA 5ICCA 1VXOA 4RTLA 1KEWA 1KBQA 3ZLTA 5CD1A 4Q4JB 5JATA 1AG9A 4ZVPA 3KETA 5FBQB 1YDFA 1RQLA 2YMQA 1ELOA 3A0RB 5CNKA 4J7AA 2V7XA 3S55A 1VRWA 5JZOA 2CLHB 2Q45A 2YXDA 4QDZA 4ROTA 5BSWA 3CLRC 4OF4A 3RC7A 5DHFA 2JGKA 5KVAA 3NAQA 1Y8ZA 2OWEA 4ADSG 3GROA 4K81B 3EGDB 3T3HA 2Z09A 1I6MA 1PZFA 2ZT8A 2MSEB 2E37A 3QI7A 3S29A 2HCBA 1ZN2A 2YRWA 3G8AA 4GOJA 1T1RA 4ID9A 1JXOA 4RK7A 3EGXA 3ZXYA 2FUG6 4AB1A 4EJ2A 3LWDA 1JZSA 4BNKA 3V34A 3IKMB 5K0CA 1HDXA 1OUMA 5DHAA 1GA6A 1VSUA 3ENVA 4F71A 2PLWA 2PY6A 2QUHA 3DZBA 4BB6A 2PLRA 4HV4A 1U28C 4MSUA 4L5CA 2V6JA 1EE9A 2XRZA 2Y1WA 3B6EA 1X1EA 5KOJB 2RARA 4H15A 5BUQA 3KV3O 2XCTB 3G59A 3HA5A 4ZI7A 3Q7PA 2QTNA 3RHTA 1WTCA 1ZGBA 3GZ4A 3T1TA 4LISA 1T36A 3KSUA 2YHSA 4EUNA 1X19A 1ISFA 1Y4ZA 1PFVA 2RC5A 1QO9A 3OIVA 4BFSA 4ZO9A 3RTGA 2DFNA 5MFPA 5T7BA 1WRBA 4EKDA 1CZHA 4REQB 3GGGA 4PN7A 4Z3DA 2RHCA 2PSJA 2OE2A 3MJFA 3RREA 2VQ3A 2PZEA 3S5UA 3BQ9A 3BTUA 4URZR 4CM8A 2VSOA 3OHPA 1LSUA 4C20A 3P2JA 3PE4A 3VPDA 2XRYA 1EZ1A 1PL0A 2FPIA 2VQFB 1NR1A 4M87A 1CJMA 4DC0A 3GCDA 1SN7A 2XWPA 2VUUA 3L0ZA 4PQGA 5BUSA 1M2KA 3HN6A 1OU0A 4HXEB 3ZQUA 5D5HA 3RSHA 1V35A 4MVJF 4DQKA 5I47A 2WQ6A 1U02A 2YZMA 4MRRA 1LJLA 2G4VA 3UH1A 3F6EX 3SXUB 2HU5A 5A9SA 3OZGA 2LZ0A 2FSVA 3SHQA 3HWRA 5HGXA 4KFCA 3NMUF 3I04A 2WB4A 3G0BA 1LI4A 3B8HA 3NWBA 4MV6A 3ABSB 4ZHQA 4WJZA 1DUVG 2J1LA 3CNOA 5L3SB 3FTQA 1DAGA 3M4ZA 3Q11A 1H69A 4FR2A 1I6WA 4C0QC 4KWCA 5C3UA 1ECCA 4NVRA 5IHPA 4M83A 3RFVA 2W2LA 3VTAA 1UBLS 3E7XA 2XE6A 1C9YA 1YVUA 1RJWA 1QIMA 1UODA 1RJDA 3QI2A 5F78A 3E9ZA 4R1SA 2BUAA 3KLPX 3WXBA 3L0BA 3ZDZB 1GIAA 3CEPB 2GBGA 2HPHA 3BL5A 1DTWB 3GNLA 4N5NA 4LMBA 3PNMA 4GUDA 4RS3A 1R1DA 1AQNA 4O4HA 1RAGA 1V9SA 4HJXA 2ORYA 2DLCX 3VDMA 3HDVA 4FNGA 4GLBA 4KHZA 2YFYA 4C06A 1FBTA 5DOVA 5B4UA 1IN1A 1KF0A 2FP4A 2EIXA 4MUEA 3R8XA 2ZJ0A 5AKXA 1BU5A 4TXJA 4XYMA 1DXYA 1JAXA 3SC3A 3UT0A 4JDPA 4Z3OA 4UZSA 3WNDA 2CNBA 3H0CA 3ND7A 1W85B 3E22A 3IAAA 1JZTA 3ESBA 2HT6A 2RG1A 4HDNA 3JQBC 4U3JA 5I01A 3ZWQA 1M72A 2VTKA 1XAIA 4V0RA 3CSSA 4PAOA 3QEJA 5ALMA 1IHOA 2JNWA 2R4UA 3VOAA 4OIFA 4UNRA 1Z5PA 2B99A 5CXQA 4WQMA 3P2KA 4ITUA 4OSPA 2ZQZA 4C0BA 1UAAA 1CR4A 1Z0ZA 2Q5HA 3A3PA 1WMFA 1YAJA 5GIOE 1GZUA 2EJCA 4IHJA 2FQXA 3N2GA 3N3AC 4F56A 1B23P 1H2BA 2AD5A 1JNYA 3I04M 3QBEA 4WNYA 4RTKA 4BN5A 2VNKA 1RQ2A 2BGJA 1H3FA 2OG2A 1TF7A 3B2QA 4Q66C 2ARKA 2EJUA 1RS0A 3HSYA 3C7TA 4N3GA 4R3UC 5AW0A 4Q7QA 3K16A 3G88A 1YL7A 2VAXA 3G79A 2WNIA 4ZCSA 3LMKA 3IQGX 4RTQA 4QBHA 1OLSA 1GCIA 1P4HA 4GPZA 5MGNA 5D84A 4QWMA 4BXOA 2D3WA 3NIBA 5DM1A 1C9KA 1BGWA 1JECA 1GQQA 2ZWMA 1H5QA 5L3QA 2X4LA 3I8XA 1IVSA 2VHVA 2X2PA 3T4EA 2ZR9A 5IJ9B 4WSOA 3M3HA 1A8UA 2QUZA 3OLCX 4JKIA 5EIAA 2V6FA 1JLMA 1GLNA 1KZ1A 3ENNA 3IUBA 5EP3A 5AOVA 1FUUA 1T6NA 1XTQA 4LNAA 2PZ8A 4OMCA 2QI9C 3BERA 4KQCA 4FNOA 4YP7A 4Q3OA 3OSUA 5IMSA 3BRCA 4EPWA 2W2QA 1CUGA 1U3UA 2CYBA 4OQMA 5HS6A 3V4ZA 3HJHA 2YASA 3LE8A 1TRKA 1JQJC 3BE6A 3X44A 1JLSA 2HJHA 5F98A 2DAPA 4MICA 4Y6QA 3TKAA 4UOZA 5LB2A 5IBCA 2O3QA 3Q3IA 3IJPA 2ZUBA 3M6MD 3A2KA 2GD2A 3MQ2A 1YACA 3CUTA 3KKOA 4I55F 4M0DA 5C1PA 5EE5B 5JS6A 1GNQA 3AUJB 3OIDA 3N7TA 1PYGA 3TQQA 1MN6A 3CEJA 4NABA 3QKWA 3O73A 5H80A 1ABEA 1Y8RA 3K72B 4QYIB 1V4BA 2P2ZA 3E8SA 5M3BA 3N7UA 3NYQA 3M34A 1DQSA 1JHAA 1U8TA 4H7HA 4MULA 5EXEA 2O7QA 5H9WA 5BN3B 4N5LA 4AG5A 4AP6A 2R66A 5G40A 2W7TA 3B12A 1I9CA 2YV1A 3MNFA 2DWCA 3LNCA 3Q3JB 4REMA 1ESZA 4MLCA 3SE0A 2IZOA 3BMOB 3C3KA 4JI7B 4LSGA 4I3GA 3EEYA 3DJYA 4N1AA 1N8KA 3RVPA 3RFXA 4AURA 1Z0DA 5AXAA 1GSHA 4X1KB 4AJOA 2V7TA 1CLEA 3LECA 4IOMA 4DSTA 3YASA 1G55A 2RGUA 3BB3A 1YB1A 1Z35A 3ZV6A 4YCCA 5B64A 1DX4A 4TTRA 4M9ZA 5ITSA 1XEWY 2SNIE 4LYFA 1U7TA 1JNXX 2B36A 3FR8A 2APJA 1Q1BA 4MW0A 4MYCA 2R1VA 4IQFA 2CNOA 2XXJA 3G7NA 4BCBA 4DIOA 2XGJA 3C3AA 2JH9A 3Q8XB 4DBLC 1SIUA 4IP0A 4JLVA 4I46A 1XWIA 3A6KA 4PSKA 2OGZA 2IV3A 1WS6A 1OMOA 3QF4A 4ER5A 1XV5A 4UKDA 5EE0A 2GYWA 3UPTA 1GYPA 4UTRA 3TLXA 1JHUA 2MYTA 2JVIA 2FSPA 4WASA 3HU2A 1E1YA 4ZOLB 1DBWA 3HCFA 3F73A 2XI4A 1J0BA 4M1ZA 2YJZA 4PGAA 4FYMA 4DFDA 5HF9A 4LDNA 1KWGA 1ZJJA 4KOEC 1O5OA 1GVHA 4JOSA 4B9AA 2XSZA 1C81A 3N28A 2HWUA 1KBOA 2O5VA 3I39X 3PKJA 5F2EA 4D0LB 1PE0A 3E1KA 5AJVB 4BL5A 1SHLA 1E1RD 2Y1FA 3ONVA 1DBRA 4PCLA 1I0ZA 4WN9B 2RD2A 4U9UA 4AULA 2G7ZA 2IYXA 2X5NA 2WVHA 5FUYA 4IDEA 3BKXA 1VTKA 3T0IA 5A5FA 3AVQA 2W6ID 3F4BA 5CGQB 4YRKA 2MYUA 1OI7A 1W47A 1HEYA 4RMGA 1OX5A 3THXA 4HWPA 1YRYE 4F9EA 3I9V1 4FS3A 3GP8A 1WETA 1ZVKA 2Z3WA 3P20A 4X8HA 5FL7D 2F43A 3RIGA 3ZCPA 4B1FA 4W5OA 1VG9B 1V7PC 3P4YA 3PIIA 4M60A 1U63A 5AUPB 2P9TA 4YCMA 1Z2AA 5ALEA 2QSUA 3IE0A 4LOHA 1P91A 2GBLA 3CWZA 4J0FA 3ZQ6A 1SU4A 3JSAA 1HPLA 4RDCA 1SIBE 3R9KA 2CUNA 3WAKA 3G0HA 4FFMA 3EXG1 1P7ZA 1XRPA 2FK7A 5CIQA 1L4LA 1CR1A 1X9HA 2ZUTA 3G2PA 4AL4A 5K8VA 1KAOA 1MVOA 1X1DA 3DWFA 1GADO 4NU0A 1L5OA 3KCQA 1FOEB 3X2FA 3ZDRA 3OJXA 4TKUB 2QTVA 5JO0A 2Z6UA 3RSZA 1LNSA 4A8TA 2PMBA 2X1MA 1A88A 3L06A 3KKZA 4RSMA 4KEAA 3CLTC 1D6JA 3EXEB 2QU7A 1SWVA 3Q1KA 2X58A 1E1KA 4M8IA 1UK8A 3EAGA 4LZNA 1UXJA 3ORFA 3M4YA 3OWXA 4AJKA 1CJKC 3VH1A 4K0RA 3MOIA 4OGWA 4YJHA 3DV0B 4MV0A 2GZDA 2JGEA 2BFEA 3IAUA 5K6AA 1NPTO 3P9KA 4MP3A 4OQQA 4DAEA 5A71A 3NWPA 4ANFA 2GEUA 1R64A 2HF7A 2VRWA 4LSMA 4IDQA 1M2JA 2Y76A 2HI0A 1SB8A 5AKLA 4NOMA 1ZUNB 5A4MS 3JARA 2W2KA 4J6FA 1PW5A 3L07A 2BR3A 1GZ7A 1BDIA 4EY8A 3EB9A 4A0SA 1OZFA 3MBOA 4ZQFA 1CUCA 4E6PA 2R85A 2ZGVA 1YGYA 5A2GA 1CYEA 4HGOA 3TRKA 4YMTA 4JWTA 3E5RA 3EASA 2Q2WA 4QOHA 1JKIA 1ID1A 2A0YA 3X1MA 4UHEA 3H5LA 3U81A 1PGPA 2BE7A 1XYGA 2LVBA 2AR9A 4I55B 3GH1A 4FW8A 3DC2A 2FFHA 3C3MA 4CLRB 1QYDA 1K3UB 2RB4A 1GU1A 1KYZA 3N05A 2JJ2A 3FFXA 4HNTA 3HXMA 4GSLA 1Z0AA 1S2IA 1RZVA 4WFJA 3B1YA 4Q00A 1E0DA 3HDGA 4ZHQB 3F3YA 3ABRB 3PYMA 3UAZA 1IEVA 3NFRA 3TIXB 2OCIA 1C9EA 1Z4QA 2VJLA 4GBJA 1DINA 4GEKA 3V2IA 5L3VA 4XEHA 4O0LA 3JTEA 4UFPA 4IJWA 3H2GA 1VBNA 1MB2A 4FYJA 4LGMA 2G1JA 3T5CA 4IVNA 1LC0A 4EKEA 4JYAB 2FI1A 4MQ6A 3FTNA 3KUXA 3MHTA 3N2EA 2B0CA 2I6UA 2HEGA 2YZ7A 2BHRA 1M6YA 2OQRA 1WCV1 4UATA 2JHFA 3AQ4A 2ZTLA 3RC2A 4DABA 5LKRA 1HX7A 3KQNA 1RWWA 2XA1A 2OAQ1 2ZI5A 1L7XA 3KM0A 3STTA 2FR8A 3IL2A 2V9PA 1LEHA 3PNPA 1BJKA 5KWVA 1KMNA 1OC2A 4DGQA 3CWCA 5A5DA 3GNTA 3FVTA 4QSHA 4HYQA 4QYXA 2N1BA 4ZVOA 2X41A 4PG6A 3CZAA 3DC7A 4WOKA 1OZAA 1ZM9A 3EUAA 3F5SA 1RC0A 2I66A 2BFAA 5H3HA 4EI8A 3H6GA 1ZA2A 4DR1B 4XUDA 4J03A 1JHMA 1H6AA 1CYDA 3L0IB 1AZLA 3NHFA 4TROA 4BLWA 2I2CA 4EGSA 2HPAA 3NM6B 4GKJB 1F17A 3L8HA 3QW4B 4RVSA 5HFAA 1KEZA 1SOAA 2BI4A 2WD8A 2YJ6A 3K0FA 5DP2A 1D5CA 4CEIB 3ZIAD 2RGDA 2MWMA 2RIPA 2OK7A 4KNVA 3WWYA 2Q8PA 5BVGB 5EJ5A 5KVVA 4XM2A 2P9FA 1U2TA 2BEKA 3DYBA 2QE7D 1VBFA 1H5UA 1ZKDA 3LOPA 4D79A 5KOYA