1DAGA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid and 5'-adenosyl-methylene-triphosphate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 74
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dagA00
3HWSA 5EXTA 1DO0A 4ZV4A 5B30A 1CR4A 3R9IA 3PFIA 3SNHA 3SDZA 5FTNA 4RFVA 2HYIC 2J41A 2ZUCA 2CJWB 4RZ3A 1ZD1A 2G0TA 1AZTA 1DAHA 3I4LA 3IQXA 2DWPA 4TN1A 3TW4A 4Q03A 1DAGA 1HV8A 4GSYA 1FMLA 4WW0A 4BFVA 1P7CA 4LJ5A 1W5SA 2QENA 3A36A 1N6HA 221PA 4FMBB 3M4YA 4IDHA 3SOPA 1KK1A 3CWZA 1U81A 1VTKA 1X8KA 2DFNA 3T61A 4C2TA 3I8SA 1RYHA 2CHQA 1N5KA 3QEJA 1OKKA 4TLDA 4QNRA 2R9VA 2VL7A 5FPTA 1NP6A 1KNXA 1E9CA 2PL3A 4MKIA 2IHBA 4CEHB 1GM5A 1VG0B 4M53A 5IK2D 4PANA 5L3SA 3QPUA 3LVRE 2XXAA 3QBVA 4ASUD 3CF2A 3AP1A 1E0KA 1L8QA 1SVOA 4KBGA 3DDCA 5FBVB 4OHYA 4JVMA 2ZROA 3C41J 1Q44A 1NMXA 2D62A 4NYIQ 2YC2C 3CRMA 3HYTA 4U7DA 4G3XA 4Q9HA 3EPKA 1RPZA 2GXAA 4LYFA 3KB2A 1P3JA 2DYKA 2EFDB 2P67A 4OQLA 4URVR 1J2JA 4UNSA 1CP2A 4KCGA 1P73A 4IKEA 4A2PA 1I4TD 4ZIRB 1W36C 4I99A 3GP8A 2XOKA 1Q1QA 3OIVA 3FKQA 3QQ5A 4GOXA 3J81k 2NOAA 2ORIA 1KY3A 3MAAC 4ZI2A 1M6NA 2QORA 4LY6A 1Z8FA 4W5HA 1IN7A 1JPNA 3L8YA 4JL6A 1SVKA 3GLGA 3KKNA 3P26A 2ZJYA 4JVLA 2FSHA 3NXSA 4IRUB 3CM0A 2RGAA 1IJFA 2ZE6A 3SI7A 4C0HA 1SXJC 2J0UB 3QIAA 2OCBA 4JBWA 2WMNB 3MMPA 4G0NA 1AZSC 2WKRA 4B75A 2XJ4A 4FCVA 4ARZA 1KDRA 1RW4A 2LKDA 4A8JC 4B2IA 4JLKA 2D74A 4B3DA 1SULA 2PCJA 1OB5A 2R62A 4KXFB 2IYRA 3C15C 4KU4A 5JBQA 3IGFA 2HLDA 4NYJQ 1GVNB 1NF3A 4YLGA 5FL7D 4ZCLA 1CRPA 3P4XA 3CNNA 1F2UA 4MYHA 2CNWA 3AV0B 4Z51A 1K8RA 1S0UA 5G3YA 2NO6A 4OKSA 2XB4A 4DSOA 1Z2CA 1XTQA 1LS1A 4A8JA 5KNBA 2GJ9A 4HAYA 4ZKEA 3U7GA 421PA 4R98A 4JBXA 4PC2A 5BN4A 2IF2A 4XSGA 1M8PA 2CBZA 4LHWA 1SKYE 2F1JA 3KQUA 1KK3A 2VYFA 1R5NA 4DXAA 1G1MA 2OV2A 3CR7A 4JLVA 5L3RA 3ZS8A 4YMTA 4DB4A 3ND8A 1XJCA 1U98A 3FMFA 1Z07A 3B5JA 2GF9A 4M1MA 1NL3A 4YMVA 3K70B 2H17A 1G3IA 2DBYA 2P3SA 2WHXA 2GRJA 3BIFA 4LC0A 4QGGA 3RAPR 3THYB 4TLAA 1R5OA 3UMRA 3VR6A 2W0MA 1TTTA 4RZUA 1IN5A 4D0NA 4OHXA 4Q47A 3ETLA 3AGQA 5B58C 3AF0A 1A1VA 2MSEB 1WDTA 3NVAA 3TUJC 4LV6A 3SYLA 5B57C 4C9BA 1VECA 1OKKD 1XXHE 1VG1A 3ZD6A 3ECCA 3TQFA 1G8GA 2NO9A 2YV5A 2GTPA 2X2EA 5TARA 4M22A 4UJ3A 2WJVA 5UKDA 3DM9B 2BMDA 4HYYA 1JAIA 3ADDA 2DFKB 2G3YA 1XBTA 2F1IA 3N5CA 3VKGA 3PXGA 5H70A 4NYMR 4D80A 3QI2A 4Q4HB 1N6OA 4DJTA 1V43A 3NC0C 1SKQA 1KZGB 3A4MA 4IEEA 3LVQE 2PJRA 4RCZA 2GEVA 4ZCMA 4TQAA 2FGJA 4PC6A 1YU9A 1ESNA 2OBMA 4R2IA 1Y3AA 2ZRFA 2W2XA 2RGNC 2IYZA 3PUWA 1GL9B 5CK4A 3KXIA 2OFWA 3NBZC 5FR1A 1E2IA 2ZRLA 2XOKD 4R9UC 1AKEA 2X19A 1RZ3A 1TEVA 2UKDA 1G5PA 1Q0UA 3AVVA 3M1IA 3IPXA 4DVGA 3EASA 4DLUA 3X1WA 1HEIA 2ORWA 1FPMA 3UG6A 4EFMA 1UM8A 1VYTA 3LNCA 1TX4B 1UJ2A 1VHLA 2QMOA 3QVUA 2CVFA 3CKLA 3JZAA 4MRPA 1P2SA 3EA0A 5JSZA 1OXXK 1VIAA 2WM9B 3B1ZA 4M1WA 1EFRA 3T12A 2OAQ1 3DMDA 2C04A 2GA8A 3VR5A 5DYIA 3B13B 1G5TA 2FPMA 2GZHA 1Z5ZA 1KSHA 2Z5FA 2IYQA 1PLJA 2NGRA 3IIMA 4Q19A 3THWB 5IT5A 5GVRA 2ZR7A 3LQRA 4V0KA 4W5JA 3IEVA 3H4MA 5BYKA 2C98A 4QBHA 4OJKA 2Z4SA 3PITA 3BH7A 1DAIA 3KUCA 3L8ZA 4BLRA 1E69A 1EFCA 3AKCA 3MLEA 4A9AA 3AF3A 4QFMA 3ADCA 2HLDD 4LV5B 2JLVA 2ZI7A 2I4IA 1QHNA 3RS3A 4Q5IA 1E2KA 3NHAA 4TLEA 3VX4A 3AGPA 4YMSA 4KFSA 1N0UA 1TUIA 1D2MA 2CNWD 4MGZR 4L15A 3S1AB 2RHMA 4TMXA 2ANCA 3A6PC 4DT1A 5FBRB 2OUKA 1XFAA 4BRUA 3SJBA 1GNRA 1EFTA 5BWMA 1N25A 1Z0DA 1ZNWA 1R6BX 4PX9A 1AGPA 1TU4A 3BJIC 5J40A 4II7A 2W2VA 1J99A 2LCFA 4PQFA 3U4QB 3K0FA 2ZSAA 1W0JA 2ZITA 2BEKA 3E5HA 4CW7A 2DCUA 1H8EA 5E95A 3NBFA 3L0OA 4DC9A 3QKTA 3RC3A 3TJZA 1IHUA 3KTAA 3FWYA 4NBSA 1COWA 3DPUA 5G41A 2F7SA 4QBFA 4CEIB 3MWJA 2GJAA 3GLHE 1ZINA 3PG5A 4GFDA 4IJMA 3Q3JB 4V0NA 3U7FB 2NTYC 4JBYA 1KHTA 2BM1A 4LRWA 2ERYA 4JLDA 4FINA 2ZRDA 4IVPA 2ZETA 4LUCA 3BORA 3M0EA 2FSGA 4IXNA 4EPXA 2BCJQ 4EPYA 2IEZA 4PSKA 4OI2A 1KAGA 2IYWA 1GG2A 2WVJA 3QSYA 2GXQA 3QNUA 3SBDA 2RH5A 1D9ZA 1R0ZA 1JEDA 1Z6GA 2AHOA 3BB3A 4QJ3A 1DADA 1YRAA 4XJXA 2CJWA 4OHWA 1GNQA 2GEUA 2GK6A 4B71A 1CBUA 3LRPA 2IBMA 1II8B 3SQXA 4D26A 3TBKA 3U5ZB 3UXMA 3EIHA 3ASYA 2WTUA 1F6BA 2REXB 4ZDWA 3LBNA 1J7KA 3W5IA 4PHFA 1MH1A 1CRQA 4A6PA 2OT3B 2O52A 3K0SA 4KO8A 3G0HA 3K09C 1E99A 2IEYA 4IOMA 4LGMA 4AIIA 4BLTA 2D4HA 3LY5A 4HEJA 5IHPA 3BH0A 3T5GA 8OHMA 4RZXA 4WOPA 4B2LA 2ZIAA 4OHVA 1FNNA 1KTVA 2CE7A 4UXIA 2F55A 1NIPA 5KDOA 1Y63A 4FMCB 1IAQA 1P4SA 2PZGA 1CIPA 3MJRA 1UBCA 3TQCA 3FE2A 2F1RA 3DZ8A 2IYVA 4P0TA 3K09A 3T1VA 3QE0A 4JJKA 5FUYA 1EFRD 3ZJYA 4LYAA 4ON9A 3GLIB 4GP7A 2QG6A 3ZYCA 2OEPA 3FHOA 5EE9A 4K8OA 4EJSB 2ZSDA 4EPRA 3O47A 4Q1DA 4CZ2A 1P62B 3AM1A 1YZKA 1GOTA 1OE0A 4NCNA 1P9RA 4DCUA 1YZUA 3VQTA 2VSFA 2MMCA 2WV9A 3B2EA 2PZEA 2WKPA 3EXAA 4TMWA 1UBFA 5E7IA 4Q18A 2BHRA 3C5CA 4GBMA 2JA1A 4OK3A 4HLCA 5KPDA 4XIGS 2WIAA 2NZJA 1WBDA 1E2EA 2IA5A 1OH5A 4RFSA 1AQYA 1ZCAA 1IXSB 2FSFA 4DDVA 2J0UA 5L3VA 2WWYA 1GL7A 2J7KA 1Z06A 3HPQA 3PUZA 2FMXA 1T8UA 1JQLB 4PPQA 1N0WA 2BJWA 3RS0A 3SYKA 1Z6XA 1E2MA 3CONA 2Y8EA 5J4HA 3KQKA 4D82A 4DEXA 1MABA 3QPWA 4Q7KA 5KDDA 1FP6A 5CDFA 1VYUA 5FH9A 5L3SB 4XVQA 2A2ZA 3QG5A 4EFNA 2XJ9A 1RJ9B 5EE1A 1R0XA 1W0JD 1H8ED 3AVWA 4O2RA 4GZMA 4PFSA 3BWDD 1COWD 5CIQA 3SQWA 1AQUA 5JI3E 1VDZA 3OIWA 4TL7A 3E70C 3MRSA 4QHTA 1KI8A 3DO6A 1NSTA 2VHUA 5JRJA 3VR4A 5F98A 2RMKA 4RVCA 4RD0A 2JIZD 1U8YA 3W90A 5JWOA 3H0KA 4Q4AA 3F8TA 1C9KA 1GL6A 2J5XA 1LF5A 4MRNA 4CF7A 1YR7A 4YC7A 2QP4A 1LTQA 3PVSA 1Q12A 4EUNA 2AD1A 2JATA 3GLGB 3R9XA 1E32A 2TMKA 5HE9A 1VCNA 4B73A 4NPHA 1T3SA 2VP0A 5EP4A 1LFDB 1CJMA 4OQFA 4P4SB 4LV8B 4Q7MB 1ZUNB 2C9CA 1E96A 5CLQA 5FI1B 1XCMA 3QPVA 1W36B 3G5UA 1XWIA 2GAOA 4ARZB 4MDFA 2QMEA 4A2WA 1E0JA 3LQQA 1D2NA 2CK3A 2FN4A 2C78A 2EFGA 4XD7A 5KSYA 1KO5A 2W6JA 2Q21A 2XNSA 4HB3A 3RNLA 4TTRA 1YE8A 5EXSA 1N5JA 3MG9A 2QQEA 3CIOA 2ZVPX 1SHKA 1UKVY 2AN9A 3GJ3A 2UZ3A 3FHTA 2C9OA 1SXJB 1R8QA 5E7JA 4M1SA 2J7PD 4D81A 1UAAA 3EA5A 5EJEA 2QP3A 1DVRA 4N1AA 4A8JB 1GDDA 1XPRA 3NDPA 2R6DA 2OZEA 1JNYA 4ITRC 1ANKA 5D3QA 3VX3A 1R0WA 3C7KA 3EG5A 4M9ZA 1UEJA 1OLOA 4UJ5A 4XTCS 3AP3A 1T91A 1R10A 1ZMXA 2PCLA 4F92B 3IKJA 2HXYA 3VFDA 4I4LA 1VIYA 3GJ5A 3LLMA 1QG4A 1SVIA 3QF4A 4HAXA 2PH1A 4M9QA 1G7TA 3U2QA 1AS2A 2F6RA 4NP6A 2V55B 2IYSA 3W9YA 2X1VA 5JWHA 1CJVC 4RY2A 2IS2A 2RGEA 3B1WA 3K1JA 3K53A 1DAMA 4JIMA 1G8FA 1XEWX 5BN5A 2ZUDA 4PSVA 3P1JA 2FDCA 1GRNA 3RS7A 3W5JA 5KU1A 1B23P 4URXR 4A2QA 2OLJA 2Q9CA 3IEUA 4L16A 1Q3TA 1Z6YA 4NCJA 4KLNA 2QUZA 1JB1A 4FIDA 5FPHA 2FG5A 4DUGA 4ZDKA 3DVLA 1KZ7B 5BN3A 2QROA 4AKGA 1L4UA 2KSQA 1T0JB 3WXMA 4BZXA 2R6FA 5DN6A 1XEXB 2XITA 3RYTC 1SVWA 4EPWA 4L8GA 4ZKDA 1UBEA 4OBEA 1JXOA 3S1AA 3VR1A 3LA6A 2PT7A 1JXMA 4HB4A 4HAUA 2OFOA 4RD6A 4URYR 1KAOA 1UF9A 2CCJA 3OAAA 4QNMA 1R0YA 4WIAA 1W49A 2FZ4A 2YOHA 4MKHA 3VKWA 1VHTA 3I62A 1VCIA 3WRYC 2A30A 4KFRA 2JGNA 5B2ZA 4QOSA 3EC2A 2FH5B 1P6XA 3RSOA 3PEUA 1KOFA 2R8RA 1NBME 1IQPA 2KWIA 4XOIA 1D8TA 4YONB 5G53C 3WNCA 5JSZB 2P6RA 4JVSB 5FOVA 1HT1E 1QVRA 1P60A 4JL5A 2QI9C 1KDTA 1NLYA 1WRBA 2JLSA 2MMGA 2D2FA 4B44A 3KQLA 3QVVA 3KQNA 1N6LA 2PX0A 3IILA 3FPAA 3CNLA 2C77A 4AD8A 1G19A 1M7HA 4YQFA 4O2LA 1QDEA 4D2IA 2J1LA 4AYTA 3Q7QA 1FTSA 3X1XA 3VKHA 1VG8A 1F60A 4LC1A 2CK3D 3BFXA 3BB4A 2OCYC 2XSZA 4HLUA 4HZUA 4XD7D 2IS4A 2ZRPA 5KSOA 1IJEA 2HEIA 2GETA 2V1XA 4HAWA 5DIFA 2ZRKA 5AJWA 2W6JD 2ZYUX 2J46A 3MGCA 1XJ0A 3R20A 4QM6A 4A36A 5DE3A 1JEEA 1E9DA 4G5OA 3L43A 5FBLB 5TV2A 3ZZ0A 5DHAA 2GESA 1BS1A 1F48A 2YJTD 1BIFA 1HH4A 1IM2A 4DT1B 5CB6A 5JCZA 1PUIA 1T3LA 4ERNA 5C2JB 3MSXA 3GLFE 1GILA 4PQRA 3RRNA 3TK1A 3X1ZA 2WSSA 4LI0A 1OH7A 3E2IA 1PUJA 3KKMA 1IBRA 4XWAA 1NN1A 2HYDA 1VG9B 1SQ5A 2B7BA 3TSZA 3VR2A 3L2OB 4KODA 1G9XA 3K0FB 3X1YA 4NKRA 5FTMA 1D2EA 3KTAB 3QXXA 2F9MA 1C4OA 1PLLA 5LD2C 1NN5A 1Q22A 2O8FA 4XTRA 2QBYA 1ZM4A 1CS4C 3MD0A 2YWGA 2DB3A 4GT1A 1YZNA 4JYBA 1G291 1ZM3A 4E07A 4MKFA 4ILEA 4QJ5A 2O0HA 1JR3E 2P0EA 1Z0KA 1MRNA 4EJSA 4PC3A 4F4IA 1G16A 2ZUBA 1X8LA 4TL8A 4LZZA 4DLVA 1S1CA 1Q1ZA 2LKCA 5FPYA 1U8ZA 2CL7X 3BOSA 2J0SA 1OH6A 4YDHB 2D7CA 4ZCIA 2NQ2C 5CITA 4MRRA 2FF7A 2XZLA 3Q9LA 4UXHA 3SHFA 3SFZA 4IHQA 3EARA 3WBJA 5FPSA 1GFIA 4DUGD 3WMEA 4TYNA 2AFHE 2CDNA 5KNCA 3WYFA 4BLPA 2JEOA 4A6XA 3NH9A 3RANA 1XD9A 2RGXA 5DN6D 2G6BA 4FWIB 3OIYA 4DB2A 1OHHA 1A2BA 4TZ0A 1VCMA 1DBSA 1KO7A 2BKEA 5JEDA 1JPJA 1NKTA 4C3ZA 3OAAD 1US8A 2AWNA 3I3SR 4GMXA 1ZUIA 2AD5A 2IUTA 5AWFC 3LXXA 2ZAOA 4R71A 1TAGA 5CLLA 1W4CA 1TADA 1EK0A 1RJ9A 1PV4A 1XD2A 1NN0A 1QBKC 3NBYC 3CR8A 4M4SA 4QL3A 3TH5A 4ZDJA 4PXAA 2RKOA 2P2LA 3REGA 1M7BA 1E6CA 3CZPA 2JASA 4NYIR 1U0JA 3Q85A 2OBNA 1A4RA 4HDCA 1XEFA 2MSDB 4TYQA 3EC1A 1JAHA 4JYCA 3EWAA 4FMDB 1UFQA 4DRZA 4M8NE 4AI6A 4LYJA 2IL1A 5EE5B 2PLRA 4HDQB 1G8YA 4D4KA 621PA 4YMWA 4DHEA 2XSZD 4KAXA 2FX3A 2DWQA 4CT5A 4BFTA 2O8EA 1DOAA 2ZRJA 1YZQA 1CJUC 1DG1G 4ESHA 1DE0A 4LJ7A 4P4SA 3AP2A 3PIRA 4RFSB 4PAQA 5AJZA 2QM8A 4FCTA 1JALA 2VF8A 4OQNA 4RD4A 5CB8A 2J45A 4D4JA 4FD2A 4LHVA 3RVBA 4BE7B 1FFHA 1MO3A 1QHIA 3KXLA 1WQ1R 2FGKA 1MABB 4M1OA 2WSSD 2ZS7A 3CWQA 4FI3C 2IWRA 3B85A 4HAVA 1SZPA 4NMMA 5L8VA 5JZVA 2ZANA 3NH6A 4F38A 3WBKA 5BYJA 1NSFA 3PUVA 2C95A 4M9SA 4Q4JA 3P32A 4QKQA 1ZRHA 1G7RA 1MV5A 3K0AA 4P33A 2WOJA 2W0SA 4WXRA 1SXJA 1MRSA 2DY1A 4NYJR 4IDPA 4AKHA 3SS8A 2CL0X 4LHZA 4NONA 1E9BA 1XNJA 3WNBA 5HZKA 1OFIA 2REBA 3B78A 2IYUA 3CUEF 4URUR 1S3SA 5FTKA 5E3HA 4IVRA 4PAOA 4DDUA 4A15A 1Z63A 5IDVA 2J87A 4AG6A 4Q4AB 2ZJ5A 1NVVQ 4N3NA 3AKYA 3FHCB 1MO5A 2C03A 1Z2AA 2C9YA 2Q9BA 4IOJA 4B3BA 1EFUA 2VHCA 1GKIA 5EP1A 4EIWA 4YMUA 3LX8A 2XTZA 4K81B 1G7CA 2FJUA 5GJVC 4NE2A 1OJLA 4YXWA 1VCOA 2E1RA 1E3MA 2VEDA 1Z0JA 3NBXX 1DAFA 4KJZA 1N2CE 4BWYA 1LNZA 2XNDD 4Z8XA 4DWJA 3NHBA 3HR8A 2BIFA 1IONA 1OFUX 4JSTA 3ZGXA 2ZM5A 5HPYB 1OSNA 3BD9A 3FOZA 4KVAA 3IIJA 3SC3A 3W6NA 1OHHD 2ZRCA 3THOA 1XZPA 1NVWQ 1FL9A 4C4PA 2GKSA 3FMPB 1E1QA 3CZQA 3MUFA 3U3OA 2CLSA 4QM7A 4B3GA 5AJVB 4TT3A 2Q3FA 4US0R 1JECA 3UATA 1U94A 5TVKA 2F3TA 5JCPA 1FTNA 3O8DA 3CRW1 1FOEB 4Q66C 1CR1A 1Z0FA 3AKEA 4DLRA 3NC1C 1OYYA 1XEXA 1YVDA 2D06A 3LX5A 2YINC 3U60B 1KMHA 2XB2A 1JBKA 2A5JA 4AY2A 1GSIA 1ZM9A 5JRZA 1E2NA 2A78A 5A4JA 4CRWB 1XCPA 4BGDA 3KQHA 1ESMA 1EWRA 1NY5A 2ZE7A 4J0QA 2PX3A 1I2MA 3N2IA 2FU5C 2PEZA 2P5TB 2A5GA 2QL6A 1R2QA 2O5VA 4M2LA 3QF4B 3U3MA 2IS6A 1FMJA 1XXHB 2OILA 1ZC3A 3FFAA 1KI2A 1KI7A 4OQXA 2O8DA 4WVFA 3C5HA 4TYYA 4F91B 5JJLA 1KI4A 4TTPA 4JKYA 2GZAA 4N0DA 4L9WA 3I1FA 4QG7A 3B82A 2B7CA 1XMVA 3WMGA 4D4LA 3PEYA 1W4AA 2NG1A 3N2EA 2RGNA 3BE4A 2I1VB 2ZRBA 4IEIA 4KBFA 5CK5A 4S2EA 4BFUA 4KI0A 3KB1A 3KKOA 3VMFA 1W36D 1Z47A 1OXSC 3O8BA 2EQBA 1TMKA 4LOAA 2XGJA 3DHWC 1E2DA 3WNDA 5JS7A 2JLZA 2NZ8A 5E4FA 5J47A 3F5FA 4RD2A 3W3AA 2XTNA 2ZI5A 3DEFA 3SR0A 1XMJA 4X8OA 3HU1A 4F4CA 1R4AA 4JSYA 3L82B 1E9SA 2QM7A 4A92A 1SXJD 5G40A 1LVGA 3WP1B 3IHLA 1U0LA 1P9WA 3GFOA 3BAFA 3AKDA 4LHXA 2GXSA 4MYUA 3FGNA 3QOFA 3REFA 1XPOA 2ZREA 1PZNA 1SHZA 2ZEJA 4IVQA 1DO2A 5JEEA 1MR3F 1FW6A 2ZRGA 2IT1A 3OEHA 4WAUA 3AVTA 4RSGA 3WYGA 2V3CC 1G6HA 2QGNA 2WAYA 2YWHA 4RCYA 1XX6A 3FFBA 2E87A 1XD8A 2HJVA 2VP5A 1ZIOA 3D7MA 4FCWA 4GMDA 1OIWA 4JT2A 4KLZA 4BEBA 4YDSA 3T5DA 4D6PA 4FW9A 2OLKA 1TNDA 1BMFD 3I73A 1XMSA 5HKKA 4TMZA 5HR5A 1HY3A 4I1VA 1ZNYA 3AF1A 2AR7A 3DMNA 2W00A 4YXWD 1DAEA 1E2QA 1OIXA 4TWZA 5A0FA 5LDDC 2JLUA 4O3MA 1C1YA 2JIZA 2OXCA 5GJBA 1S2MA 2H57A 3B1VA 5LPNA 1CJKC 2JJ1A 5K8IA 4PC7A 2ECKA 4MQBA 1D6JA 2G83A 2WJJA 1HE8B 3AH8A 1W7AA 4Q21A 1LW7A 2ZI6A 4PTLA 4HZUB 5F9FA 2IUUA 4E03A 4LJ4A 4OK6A 4W5WA 4F4JA 1CR0A 1E9AA 2B21A 2HT6A 2R6GA 4GDFA 5K8LA 4GPTA 1E1QD 2GNOA 3FB4A 2PEYA 3PUYA 2AFIE 4HSEA 4TT3D 4BUJA 5C1BA 2YVUA 3EPLA 1GRQA 3KKPA 2BKUA 1NRJB 2GHIA 5DHFA 1M74A 1S9HA 1Z28A 3SHWA 1IOZA 2ERXA 4LBZA 1E9RA 2FEMA 3U61B 1OYWA 4PPGA 1BO6A 4QJ4A 2ASEA 4LWZA 5GADl 2PBRA 4TL6A 5TDHA 2O8BA 4IDQA 3IPYA 4V0MA 3ND9A 4BFXA 1E1RA 3MWKA 4EPTA 4KV9A 3AVXA 3GLIE 1SVSA 1P61B 521PA 5JMTA 5KSZA 2IYTA 4QXAA 4IXMA 2CXXA 2RGBA 5J4KA 2O8FB 2ZI4A 4O0MA 4ZO4A 2J7PA 2QA5A 4IW3B 3SZRA 4ZDIA 2QBYB 1U9IC 3B9PA 3LWNA 3PV0A 2A5YB 1IN6A 2D3WA 2DFLA 3NG1A 1HE1C 2QTHA 2ZRIA 2WJYA 1ZW6A 1W0KA 4Q02A 1EG7A 5E7MA 1RYFA 2GCNA 1UPTA 4BFYA 5KO2A 3DZDA 3EIQA 1XF9A 3UG7A 3AVQA 1G3UA 3M6AA 3B9QA 1I4DD 3Q8XB 1TF5A 5J4YA 4KYIB 5DI3A 2ZJAA 5LD2B 2ODWA 4DZZA 2WOOA 1N3BA 3TUIC 4LHYA 3BERA 1JJ7A 2CHVA 2XZOA 4HAZA 5EP2A 3QF7A 5F9HA 1U9IA 4C0KA 2D7DA 1IN8A 2QRNA 4EFLA 4PQYA 3TRFA 3W6OA 5H1YA 2PMKA 2R44A 5FI0B 4WZAE 2ZE8A 3TR0A 3UWKA 3UANA 3DL0A 3VHXA 2ODNA 2KB0A 3P20A 2YHSA 4U5XA 3WY9A 2V7QA 3TVTA 4E5UA 3IBGA 3CX6A 3H84A 3GEIA 2WJIA 4LJ8A 3RSLA 2ZJBA 3KUDA 4Q01A 2FEOA 1G4UR 5SZHB 1NBMD 2B8WA 2R6CA 5DO9A 2RGCA 4ACBA 2VTKA 2GILA 1US8B 5EQTA 5GJCA 2AKYA 2H16A 4C0AC 2VF7A 5H68A 1QZXA 1ODFA 2OO7A 1ZIPA 3OEHD 1EESA 1W5TA 3LLUA 2QAGC 1G20E 2ZRHA 1XD2B 1P2VA 2GJ8A 1KJYA 2NO1A 1YR6A 1KJWA 1NN3A 2ANBA 5GJWC 4P32A 2AK3A 4OJQA 4M21A 2ZRNA 3IHWA 2BVNA 1G8HA 1KO4A 1S1MA 1Z6TA 5HKKD 3I5XA 3U3JA 4JL8A 4JS0A 2QNRA 4Q1BA 3GLGE 5JFGA 2QEQA 1HYQA 1S4QA 1LF0A 3T06B 3EZ2A 4B76A 2IYXA 1Z6AA 4H9GA 3RRYA 2JJ1D 2V8OA 2WWFA 2GWHA 3U44B 1CU1A 2QAGA 4C0BA 2HDNB 4V03A 2HJGA 3PQCA 3GJ4A 1ZVQA 1WCV1 2B8TA 2H7VA 2O8EB 2GAAA 4B3FX 2PZFA 5CYOA 1FX0A 3I5YA 2QRZA 4Q7JB 4KFUA 4PPNA 4E22A 2N46A 1N6PA 2ONKA 1U2RA 1OF1A 4HUTA 2X77A 4NL4H 3A37A 5FFMA 2KE5A 2ZSEA 3QXSA 1I2DA 3EZ6A 4MGYR 4NHOA 3BFKA 3MJHA 4HB0A 3D31A 4BPBA 3JVUA 2FWRA 1NI3A 3T34A 1Q57A 3U3RA 2IS1A 4TTQA 2X8AA 3GEHA 4C7OA 4L5BA 1E98A 4IFEA 1CTQA 4ZI3A 1MO4A 1E1RD 4NCIA 4Q4JB 2DHRA 4HATA 4DLZA 1EGAA 1GIAA 4X8HA 3CF6R 1Q3HA 3K0AB 2A9KA 1XTSA 4TSFA 1RC8A 2ZI9A 4DCNA 1H65A 4P4UA 1OT3A 1AKYA 2C96A 3BBPA 3IO3A 3RDPA 2BCGY 2AX4A 3Q7PA 2WKQA 4A0GA 1VPLA 5EE3A 2VSOA 1KKLA 1UBGA 2FA9A 3VTKA 1E0SA 1W0KD 5AUNB 1M1YE 4A0FA 5CYPA 3T1QA 3RRMA 3UK6A 4LX0A 4TQUS 4IDNA 2XX3A 4B6EA 5JHHB 4AKEA 1NJGA 2VHQA 2BBWA 3TAHA 1W48A 4P4TA 1XTIA 4LJYA 1W2GA 1UKEA 1XXHA 2V9PA 3SYNA 4A0HA 2WSMA 3WYAA 2JJ8A 5CM9C 4BASA 4V0LA 4Z8YA 1W4RA 1OIVA 3U7HB 3L0IB 3CLVA 1QHXA 2XTMA 3V00A 1RRCA 2WPDA 2V7QD 3MWYW 3LW8A 1O3YA 5DSZA 4ABYA 1E4VA 4URWR 3LD9A 3LBHA 4MYCA 5JLJA 3ZLJA 4DSNA 2QP9X 4WZBE 1Z3IX 4KSBA 2QY9A 3SJAA 4CEJA 5M04A 3A4NA 5TMPA 2JJ2A 1OXVA 2FOLA 3D8BA 5DLQC 1BH2A 2IC5A 3OESA 1AJEA 3ZVNA 1KMHB 4PO9A 4RKFA 1XU4A 3U6BA 1X6VA 1NY6A 3KJGA 1OB2A 1TPZA 1ZU5A 4DLWA 1W46A 1KSGA 3U3KA 2VIIA 4K46A 4DKXA 2QN6A 5IRCD 4DDWA 4B33A 3PR1A 2FPLA 4PZYA 2C5LA 4CGZA 3RC8A 5LB2A 1UDXA 5SZIA 5B64A 2OCPA 5H8WA 2O8DB 1ETUA 4W7SA 1O87A 1XP8A 2YYZA 3IBYA 3QXJA 3BB1A 1ZCBA 1Z22A 4RJLA 2P5SA 3EX7C 1NIJA 4MGIR 1NNEA 3BGWA 3R7WA 3K8YA 4L4UA 3CBQA 1J90A 1RRPA 5FUWA 4PHTA 1GITA 1P2UA 3V4FA 2CMKA 3FKSA 2ZU6A 2ATVA 4Q1FA 1Q20A 2IYLD 3D3QA 4Q9LA 1M7GA 3RS5A 1L7VC 3KDSE 4OK5A 5EXXA 5K8TA 4FWTA 1TU3A 1EX6A 2LWIA 4BZPA 2DR3A 2WMOB 1DPFA 3SEAA 3PENA 2JLQA 2Z6VA 2FSIA 3DKVA 2JLRA 2EYQA 3A1TA 2EFEB 1IY2A 4DSTA 4B47A 4LPSA 3U7EB 3ZVRA 4B6FA 2Q9AA 2ONJA 2QE7A 3BFVA 4E09A 5AUOB 4TSFD 4KITB 2BMEA 2G0NA 3NKVA 1WF3A 3CPEA 4LJ9A 2CHGA 4MA4A 1N6RA 1RVDA 4BFSA 4QGFA 1I4LD 4UNQA 2EW1A 2VP2A 3GLHA 2J59A 3WHLA 5FUXA 2BM0A 3B6EA 3QKSB 4I1SA 5ANRB 3V4RA 2O8CA 3ZD7A 1NJFA 2H92A 3BS4A 3UMFA 3DM5A 1AA9A 1SGWA 2R65A 4H1UA 2V1UA 2EFCB 1G6OA 1G5RA 4LPKA 1U99A 3FMIA 1RFLA 4BZQA 2ZPTX 2YWFA 5JECA 3CH4B 1QHGA 3ADKA 1II0A 3QKRA 3H86A 1V5WA 3X2SA 3KX2A 1YQTA 4BLOA 2OBLA 1KI9A 2WPDD 3EPHA 2YWEA 4OHZA 4N0EA 2AL7A 3GLFB 3W8RA 4DIEA 1TL7C 1J70A 3ICEA 3K9NA 3QJYA 3CB4A 3A1SA 5C4GB 1GNPA 4NCKA 1T8TA 1RKBA 1YZLA 1E79A 2N42A 4L9SA 4LBYA 2IUSA 4EAQA 721PA 2QT1A 3I8XA 3QXHA 5EZ5A 4NDZA 4Q1CA 4DLSA 1N6IA 4DCVA 2XNDA 2JJ2D 3JVVA 3N70A 3WRXC 5L3QA 2P65A 4B2PA 1GZSA 1F2TA 2BWJA 1K5DA 4XH9B 1ZP6A 1AS0A 1HQCA 1TQ4A 4BFWA 2O8BB 5AUQA 2AKAB 1NVXQ 2ZJ8A 4CVNA 4UXJA 4BRWA 3A8TA 4FMCF 3UPUA 3EPJA 2C99A 1MKYA 3EZ7A 2A5DA 5FPKA 2GDJA 4IOKA 5A5GA 3CNOA 1NG1A 5KDLA 1W44A 3T1OA 3EWSA 2ZYTX 4Q9JA 3H1TA 1R8SA 5DH9A 3EIEA 5LBIA 1HURA 3FDIA 1XPUA 5KTYA 3HDTA 2QPOA 2DFTA 3HYRA 1AS3A 5JI2E 1X8JA 1A7JA 4NTZA 3GPLA 4WXPA 3THXA 1LY1A 3TAUA 2WICA 1KI1A 1ZNZA 4OQMA 3FKSD 3GMTA 1EX7A 3ICQB 1NLFA 4PHHA 3I61A 5DI3B 5C4MA 1XZQA 2HV8A 2UVQA 3U44A 3GFPA 6Q21A 2Z0MA 3HU2A 1YR9A 4OI1A 4LDJA 1CEEA 5CJPA 3CF0A 5J4VA 5CDFE 3VAAA 1KGDA 2IK8A 3LDAA 1T0HB 3LFUA 1Z08A 3RWMB 2QE7D 2DPXA 1P75A 2O0KA 3QKUA 1Z83A 2ZR9A 4B3XA 2HXSA 1RRGA 5JHGB 3LV8A 4V02A 4A4DA 4G5GA 2WWGA 2ODEA 3GJ8A 5C46F 1YZGA 2VP9A 4DCSA 1WA5A 3GCGA 4U02A 1EWQA 5TY0A 1TQ2A 2WZQA 3L0SA 3RS4A 4ESVA 1HT2E 1NVUQ 2BOVA 3AF4A 2HUPA 4JJZA 4G5SA 5FOTA 3ZVLA 1T5LA 4XWOA 1M34E 3EZFA 4ZPXA 3NDBB 1XJQA 1ZD9A 1U90A 3FTQA 3LAWA 2WWXA 3B1XA 4PO8A 2VHJA 1OPXA 1K5GA 5HCIA 1HUQA 2MSCB 3P27A 4A82A 2GJKA 1S9DA 1Z0IA 1UKYA 3CRRA 1WP9A 1G17A 1YR8A 1UDWA 3MCAA 5JJKA 2QAGB 3KZ1E 3C16C 4JMPA 2JCSA 4QC2A 3KXKA 4AK9A 1VKJA 1UEIA 3ZIAD 5D3MA 1NVVR 2ZE5A 4JLMA 5EP3A 2BC9A 3BC1A 2BMJA 2BMFA 1FX0B 5CJ2A 1BYIA 4US1R 1BMFA 5J5CA 2UZIR 1E79D 4S35A 4XWKA 4IDOA 4JT4A 1PLKA 3GQBA 3SU8A 3TSOA 4AWXA 2Q3HA 3PUXA 2YNMA 4EQ6B 4B3CA 3CPHA 3ZQJA 4UNPA 3ZQ6A 5DISB 2FFHA 4GL2A 4CIDA 3OE7A 4GI7A 4D0LB 4XSHA 3RS2A 2EU8A 3CRQA 2H1LA 3KJHA 4C7OB 4BFZA 3RABA 4HUQA 2CEAA 2GCOB 2ZRMA 4TLCA 2ZJ2A 3Q72A 3HR7A 4XVUA 1KK2A 1IXZA 2ATXA 4TL9A 1J8MF 1E0AA 2G1KA 3SJZA 1TUEA 3UWOA 2VO1A 1ZU4A 1L4YA 3ZZTA 4MRVA 121PA 4DEYA 1SKYB 4TZ6A 3B8HA 5JJIA 1KDOA 3LXRA 3IUYA 4I81A 2Z4RA 5AR1A 4Q9IA 4KSCA 3MFYA 1II9A 4JLPA 2CLCX 1R7RA 1E2JA 4KYUA 3I32A 4C30A 3VU9A 2GVZC 4NYMQ 4GOJA 3LO5A 3X1DA 4MDEA 1E2LA 3A1WA 5F3WB 5JS8A 1NG9A 2QGZA 3LW7A 5BW8A 2F43A 3K0CC 2ZRAA 3OFNA 2OCAA 2O0JA 4KFTA 2ZXUA 1W47A 5JWRA 4AYXA 3ONWA 5IF9A 1W4BA 2NPIA 1WB9A 4EPVA 2OAP1 2REOA 1SVMA 2CL6X 2HT1A 4TYWA 3T35A 1MOZA 3NEJA 3W3ZB 1HA3A 2ORVA 3A1UA 2I1QA 4GNKA 1GUAA 1XRJA 4PSAA 1P72A 2AWOA 4Y0AA 2FFAA 2XAUA 3EZ9A 3K0CA 1A2KC 4NU0A 5C18A 4AC9A 1A5TA 3MWLA 1KYIA 1G41A 2GZDA 2WBLC 3C4JA 2BEJA 4UKDA 2D2EA 4CEJB 1WE2A 3AQ4A 3B7GA 3LBIA 3DOFA 1BYUA 1Q21A 1E9EA 2EWWA 4TLBA 2C2HA 3K9HA 1UADA 3KJIA 3O8CA 4X8LA 5KUTA 4QHYA 3KFXA 3CPJB 3TMKA 5EUMA 3RWOA 3ZVMA 4MRSA 1ONBA 1NBMA 2EVWX 3H2YA 3TR5A 1ZC4A 1KKMA 4GRAA 2IWHA 1IXRC 1KO8A 2QQ0A 2ZSFA 1BOFA 1CULC 2G9NA 4Z1MA 1E2PA 2IX3A 3DKPA 3AB3A 3QKSA 2GXUA 1E4YA 1XDBA 4WBSA 5SZJA 2GJSA 4AYWA 1N5IA 4M1TA 4LSGA 4Y0VA 4JLJA 2N1BA 1QHHA 3AUYA 1ZYUA 2WAXA 4BLSA 4LYHA 3R7WB 2EWVA 4TMKA 1KI3A 2B92A 1DEKA 3TW8B 2Q3MA 5KYKA 5CM8B 1Z29A 2YC4C 1XMIA 4H1VA 1DAKA 4F93B 2ZU0C 1G3QA 1XB2A 4URZR 3SN6A 1U8AA 4B74A 2ZJZA 1CJTC 3A58B 2ZSBA 4TMTA 4MUAA 4PR0A 2FFBA 3OE7D 3R9WA 3GLFA 2I3BA 3NEYA 5ELXA 3FYHA 4D4MA 3CX7A 4V0OA 1OW3B 1FZQA 3SJCA 2Q0HA 2CCKA 1CKEA 1G64A 1MO6A 3TGPA 2V6JA 1N5LA 1AGRA 4G5RA 5HCNA 3RLFA 1FUUA 2ZTSA 1WMSA 4MYTA 3C8UA 1FQKA 2V54A 1M2OB 4RD3A 1G21E 4G1UC 1ELOA 1KI6A 2W58A 5KPJA 1XTJA 1EXMA 2HCJB 2CLDX 4GOKA 4RD1A 3K9LA 3OIUA 1AN0A 4MH0R 3GLHB 3V9PA 1MT0A 2O8CB 4JZKA 3TLXA 2BJVA 2PLFA 1OXUA 4MKGA 5BXQC 2PT5A 1OXTA 5G3ZA 1F5NA 4IFBA 5AJYA 2A7QA 3EAQA 3QXCA 1ZM7A 4XVRA 1JR3A 5FR2A 3OFND 4A1FA 2KJQA 5BQ5A 4NZYA 4OI4A 1HQYE 2QZ4A 3W6PA 1N6KA 2IXEA 4G5QA 4JLOA 2J0QA 2FV8A 4AG5A 5EZ6B 3QKRB 2JAQA 5FOXA 3WMFA 3NIBA 1B0UA 3AVYA 1RIFA 1IY1A 1E9FA 4O25A 4CEHA 4R7ZA 1RE0A 1Z0AA 3G82C 2WWWA 3HPRA 2J3EA 3HP1A 3PEVA 4TYPA 2QMUA 5FBQB 4DBLC 2ZVQX 2ZQ5A 1AK2A 1CLUA 4HLDA 2OFXA 4JLBA 5DI9A 4B48A 5KNDA 2PMDA 3OZXA 3I72A 5EXPA 4A0RA 1GAJA 2SHKA 4PAMA 2JDIA 1Q1BA 4Q7LA 3CO5A 5AJXA 5DGXA 4D0GA 3TUZC 5FTLA 2A5FA 4RKEA 4JKIA 4Q9KA 4CDGA 5L3QB 2BBTA 3UMSA 3PJRA 1DS6A 3SBEA 2YZ2A 2R2AA 2ZJOA 4M0LA 2JLWA 3A4LA 3Q5EA 1F2TB 4G01B 3SE0A 1G4AE 4ZIRA 2BV3A 5KOYA 3ZS9A 2VP4A 1WBBA 2OE2A 2GCPA 4PO1A 5FOUA 4C2UA 4B35A 2RCNA 4LJAA 2YKGA 2OESA 3VNVA 1CXZA 3O8RA 4M1KA 2OSBA 4PHGA 1OH8A 1D5CA 4Z1MD 2EYUA 1CR2A 1KIMA 5GVSA 2OG2A 4LBVA 1GKUB 4D25A 2BBOA 2FNAA 1X3SA 1XTKA 1YJ5A 3ZDQA 1IN4A 2HF9A 821PA 3D6TB 1OFTA 1ZM2A 3AUXA 4HDOB 1HTWA 4Q1EA 4Q48A 2A3RA 3CH5A 3RRZA 3KKQA 2VPPA 1KY2A 1LV7A 1XTRA 3F0TA 2IXGA 2FFQA 3THXB 4FMDF 2IHYA 2VHTA 4DSUA 2XXAB 2OM2A 5FBWB 2VH5R 5EUQB 1JQJC 4P31A 4W9MC 4FXPA 2ZAMA 1T6NA 2NO0A 3B60A 2FZLA 2QSZA 2ZS9A 3VNUA 3CX8A 5CIWA 4Z54A 2IW3A 2Z83A 1DTSA 4I1OA 3BK7A 3K70C 2QPAA 2NMVA 2VLIA 2PJZA 4Q1AA 3K0EA 1XEWY 2F9LA 4EKDA 2WWIA 3ZH9B 4LCBA 1CF4A 2EFHB 1PVOA 4NH0A 1QHYA 2NIPA 1ZBDA 4LK2A 1TEXA 3OHMA 3GJ7A 5P21A 1ZUHA 3T15A 4EQ6A 3ASZA 3GD7A 3OF5A 3BH6A 1SXJE 3HJNA 4UNRA 5FL3A 5FTJA 2QTVB 1TF2A 3GFTA 1QHSA 3OEEA 4IOLA 4PPFA 3QBTA 4QBIA 1NMYA 5AUPB 1ZJ6A 1LS6A 2IYYA 4Q4LA 4UQOA 2GCOA 1QF9A 2H5EA 1E2HA 4PC1A 1JR6A 2W2TA 1NKSA 3R8FA 3QUSA 4OL0A 3THYA 2OHFA 4QGAA 1D9XA 1JR3D 1BKDR 4GZLA 4JLAA 4M9XA 2G1JA 4EDHA 5F2EA 1IY0A 3NWJA 1Q1EA 4U00A 1KDPA 3GJ0A 3AVPA 4FN5A 1KO1A 1YZTA 3TKLA 2F3RA 2ZYWX 1A82A 3B1YA 1XCGB 3TE6A 2DWOA 1G3MA 2P6NA 3EW9A 1K6MA 3PEWA 2ZYVX 4C0JA 2FPKA 2VQSA 1TQDA 3IQWA 4B32A 1LB1B 1DG3A 1F2UB 1GWNA 1GRRA 2K5UA 1DARA 1N0VC 4JLNA 5D3MB 4DLTA 2R6AA 5AK0A 2GVDC 2L0XA 2RGGA 1KNQA 5FOWA 1S8FA 4Q4HA 2BBSA 2VRWA 2G77B 2JDID 2IXFA 1ZAKA 3UIEA 3WHKA 3TSWA 5EE0A 4P3YA 4HLQB 4RZ2A 4US2R 2H18A 2P6UA 3VR3A 1F3OA 3GJ6A 1AM4D 3UKDA 2JLXA 4AURA 2V4ZA 3BXZA 1GP2A 1G3RA 2W6IA 3QY0A 4HI0E 4MGKR 3U6KA 4BQSA 1PJRA 2J9RA 2KBFA 2QU8A 2VBCA 3NTUA 4HUQB 4DIDA 3AVOA 3BRWD 5K8UA 1T5IA 4X8MA 5J4LA 1H8HA 2JLYA 2AXPA 2G88A 1KMQA 2W83A 2HCBA 5HTKA 1ZD8A 1U0HC 1T3HA 3K9GA 5FUVA 3AEZA 1TQ6A 4C0SA 5DNYB 4BLQA 3THWA 4QGHA 4KHZA 1YHNA 2B6HA 2ODBA 1GTVA 2Q6TA 3DOEA 3VU9B 2Z43A 4R2HA 1X1SA 4QHSA 2X2FA 2NPFA 5FOSA 1QG2A 4TMVA 5TB5A 2CCGA 2F43B 3QENA 3TVDA 4DLYA 1FP7A 4WA7A 4C0QC 1QRAA 1E2FA 3A1VA 4CYMA 2ZS8A 2QMHA 1FNMA 1G7SA 1W2HA 1WXQA 2AK2A 2GEDA 2XEXA 1G18A 1P9NA 3R8CA 4DDTA 2OXRA 1T4GA 4QBGB 2E9SA 2RHDA 1QVAA 1S3GA 2GK7A 2QT0A 2XZPA 3LH5A 4PZZA 4CT4B 2V6IA 1UKZA 3QG1A 1RRFA 2QTFA 5IK2A 5SZKB 4MUBA 3E1SA 4WZ6A 3CRVA 3FVQA 4OYHA 4ASUA 3AF2A 1J8YF 3JZMA 1NMZA 2WIBA 3HU3A 1KSFX 4HLUC 4B34A 3U4QA 1W1WA 3P4YA 1P2TA 3IIKA 3W34A 1X1RA 2QAJA 1DELA 3CW2A 2FE4A 3OEED 2GF0A 1FQJA 2RAPA 1G8PA 1E94E 3IDQA 1L2TA 4CEIA 1NLZA 3F3YA 1OFHA 2WJGA 3L0PA 3K70D 2CVHA 1GKYA 1AIPA 1JJVA 3I92A 3T1TA 1S96A 4HZIA 3ADBA 4Q00A 1EFHA 2QPTA 2VP6A 2KI5A 5DYGA 3WP0A 2AXNA 2HF8A 2VA8A 1YKSA 4AKIA 2VSXA 1T9HA 2NO7A 2KBEA 2ZR0A 4I1UA 1YRBA 2WWHA 1KK0A 2IF0A 3QEOA 2C8VA 1X86B 2RGDA 3KFVA 4DCTA 2YOFA 4M1YA 1SVLA 3ZZUA 2CE2X 2ZI3A 4POAA 4KVGA 4DLXA 1II8A 1QHHB 3GJXC 5TXGA 2BDTA 4BECA 3KJEA 1FUKA 1VYVA 1VMAA 2H8KA 4B43A 3RHFA 4MITA 3SFVA 4LBWA 4TQ9A 4OI0A 4BEJA 5HZHA 3Q5DA 4HB2A 3AVUA 3KL4A 1KSJA 1TF7A 2GBLC 2J0VA 5LB4A 1R5BA 4LJ6A 4QRHA 4EJSC 3W8NA 5FL7A 2W6ID 4ACAA 4C0LA 5KSPA 3ZIAA 4F7WA 5KHOC 2RB4A 1P5ZB 4NCHA 5HE8A 4GP6A 3VHLB 1KJZA 4JVNA 3C14C 1JI0A 4PZLA 3FMOB 1H8HD 4UNNA 1OV4A 3PCRB 3GEEA 1N6NA 3TNFA 2YOGA 4V0ME 2F1HA 3IO5A 3TIFA 1KI6B 3GLIA 2WJHA 2GBLA 2QSYA 1ZNXA 1E2GA
chains in the Genus database with same CATH superfamily
5ER6A 1P1BA 3HWSA 1DO0A 1JDUA 3PGMA 3V1LA 2VDPB 3LIPA 4HD8A 4GD3Q 4EG7A 3P9ZA 4KXUA 4MAFA 3E22A 1I1QB 2DUJA 2VYND 3RFVA 2V5VA 3SNHA 3FBTA 4F9FA 3UHOA 4J07A 4MUFA 2G17A 2ENUA 3O8NA 1RBZA 2CJWB 2DTEA 2AUMA 2WNSA 1DAHA 4TT8A 3UK2A 5A62A 1D2GA 3ADOA 1FVFA 1O2DA 4M1EA 4QEDA 4WOJA 4DV0B 1N8TA 1F6DA 1EEXB 4N40A 4BFVA 1FU8A 3V4SA 4K88A 1WG8A 5ALEA 4K6MA 1P7CA 5HTOA 3T4UA 3AF6A 2GGSA 4BQPA 4FMBB 4DVJA 4AS2A 3NCHA 5AI8A 5IXJA 4DR2B 2ST1A 1TJNA 3DLCA 3PC3A 1U81A 1C80A 3K7EA 3IAAA 3UHAA 2HR1A 3I9OA 4ZRNA 2CHQA 1IQRA 3QEJA 1YFJA 1ZFNA 4TLDA 5FPTA 1E9CA 5JO9A 4AQYB 1ORTA 3JQDA 4Q93A 5KINB 1GM5A 3GOQA 4CEHB 4YECA 5CLJA 2E6UX 1LCIA 4P54A 3LVRE 4LOKA 1MP0A 3KT6A 1NXOA 2D6FA 5HM8A 4JR0A 4KBGA 5I9IA 3PDIB 4YV0A 2HXGA 5ITVA 2D62A 4NYIQ 4RF2A 4DLPA 2QX4A 2WD9A 1L5RA 4QYIA 2YTZA 1AKUA 2WTNA 2V7BA 1X80B 5CPFA 3EPKA 2AF3C 1A8SA 3VISA 2ODTX 1SD5A 2JI6A 1RYYA 2QRVB 2P67A 2EFDB 2W70A 2GZ2A 2J9FB 3MYRA 4UNSA 1F8FA 4P82A 4G2NA 4IKEA 4NX2A 1VPWA 5ALWA 1GGJA 2POCA 1Z62A 1L7PA 4FEAA 4ZT6A 1UT5A 4ZOLA 1Q1QA 1IEWA 3NMUF 3V1TC 1HDGO 4E21A 3EBLA 2VUSA 1XGKA 1M6NA 4R05A 3YASA 2CLIB 1L3CA 3Q7RA 4AL4A 4WE3A 4XWWA 3F98A 1UZNA 4W5HA 2YIJA 3QLJA 3NJ4A 1DKPA 4RMGA 3TCXB 5IANA 3KKNA 4JEIA 3ONNA 4TTAA 4ZTBA 2FSHA 4L08A 1JT2A 3NXSA 4P7JA 1QORA 1YA8A 3LI2A 4TUYF 3AOEC 2WKWA 3WAGA 1IJFA 2O7VA 3Q3HA 1ZUNA 4C0HA 3B7WA 3C6MA 1VGVA 1C30B 4FM9A 2PWPA 1I4OA 2W43A 3ELDA 4JBGA 4BN4A 1I0LA 2C9MA 2AZMA 2G40A 2I9PA 2XGGA 4G0NA 4Z5XA 5ER9A 1B26A 4FCVA 2OC9A 4A8JC 4B2IA 1J2YA 1ZN2A 4RBNA 4BGVA 4D56A 4YDQA 4B3DA 1SULA 2PCJA 4MIEA 1OB5A 4GLOA 2IYRA 1EXDA 3TZEA 2H8GA 1FRZA 3WZMA 3EFEA 2ZWPA 4CLHA 4ZU1X 2HLDA 3AJEA 4V1CB 4YLGA 4M3NA 2AW5A 2PLWA 3CNNA 4FNAA 1F2UA 5LQAA 1X0XA 2WMYA 5ELMA 4E7OA 1HZZA 2O20A 2BFFB 2XTAA 5B7GA 3KK0A 1H2WA 1IOLA 5IM5A 4DA8A 1CUUA 4OKSA 5MN6A 1Z2CA 1XTQA 1MORA 4K26A 4HAYA 4D02A 4EI9A 421PA 3T54A 4JBXA 4WH0A 1PGNA 3ETCA 1Z7EA 4XSGA 1M8PA 3LT1A 4OREX 3SM9A 1UC4B 1UDAA 5E8RA 2CB0A 4QGSA 2PH5A 2F1JA 3LOQA 4MEAA 1KK3A 2VOEA 4RY9A 4C7MA 3CGWA 1BZYA 2C1ZA 3ZS8A 3ZUGA 4DB4A 4LQDA 3ND8A 4M7PA 1XJCA 4PRYA 3E0QA 1IOWA 1XIVA 3CUYA 3H04A 1SA0A 1G3IA 3KZNA 2H51A 3ZZ1A 1USVA 4CV1A 2XF8A 3GOHA 3MGGA 3QKWA 4P9NA 4Z4CA 4BB6A 1R5OA 2BY4A 4BMDA 3E23A 5JSFA 4XFJA 2Q1SA 2PA0A 2AJCA 1E3IA 4OHXA 4Q47A 1NW9B 2A59A 5DNAA 4EY5A 2ON6A 4J0HA 4HV4A 3FIUA 2OCLA 3C7CB 4OXXA 2QF7A 2NUTA 5B57C 5JAPA 4LF7B 1R64A 4C9BA 1U8EA 3HJCA 4P6VF 3V4OA 3BMNA 4GUDA 3GLQA 3TQFA 1UODA 2XW6A 4MWOA 5TARA 4C5BA 4KLAA 3RB8A 1XRLA 3D2CA 5UKDA 3DM9B 1LPMA 4RZIA 3ZV4A 1CS0B 4HUJA 2DFKB 3ADDA 3PQ6A 4BVAA 3VKGA 1T6YA 5H70A 1OFUA 3PXGA 2FR8A 4Y0NA 1PWYE 2NUPA 2JH9A 4TV9F 1S7CA 1U11A 3D4NA 1SKQA 2Y6VA 4X6LA 2QPLA 1KZGB 4IEEA 3SHTA 3LVQE 1ONSA 2A9FA 4C22A 1ZHFA 3AI7A 4PSDA 3FNIA 4ZCMA 1CLEA 3GUCA 5JD5A 4F2HA 1CV2A 4NARA 1ESNA 1Y3AA 2BSXA 2ZRFA 3PQ7A 4ND6A 5A9RA 2YXLA 3PUWA 3INYA 2HJSA 4BC1A 3KQSA 1T3GA 1RI3A 3MLBA 4PF1A 4RA6B 3VVMA 1FNSA 2IHVA 3RU9A 5I47A 3TQTA 2UKDA 1Q0UA 2A14A 2LVBA 3M1IA 1OPRA 4DVGA 1JEQB 2QTTA 5CRIA 3MT8A 4UD6A 1H0HA 1LC3A 5CVEA 2G0AA 3UC9A 1LRKA 1TX4B 2ZYIA 4W63A 3WMWA 4BKPA 4EMUA 1JIIA 3O8OA 1CY0A 1OXXK 4GKVA 3T12A 3IUPA 3GFGA 1ZPDA 3LWDA 4C6TB 2C04A 3VR5A 5KJ1A 4XFDA 4XOUA 4AMGA 4B5LA 1FEZA 1R4NA 3AHEA 1Z5ZA 3RODA 1KSHA 2Z5FA 2IYQA 1UBJS 5JCOA 3X3HA 4JBIA 5EMHA 1K98A 4PS0A 3W0LB 2NZVG 2D8MA 3BSFA 3EGCA 5GVRA 1PFUA 2PMEA 3OX2A 2QN9A 1E8NA 3A2MA 4W5JA 4YQEA 3IEVA 1MX1A 2EX4A 1NQXA 5AW6A 1QCDA 3RC9A 1NXVA 3PITA 2C9ZA 5F3DA 3RRBA 3Q88A 1E1CB 2FSUA 2CLLB 3LPNA 1H6AA 1N57A 4R8SA 4QT4A 1B2LA 4PYKA 4HDNA 5K3EA 3FFWA 4F06A 2XUFA 3NHAA 4TLEA 2IHTA 3AGPA 4X66B 1NNSA 4JYMA 1ZVKA 4UOZA 3IJ5A 1TYAE 2CNWD 2HTEA 2VHYA 3BMOB 4G67A 4Z9XA 3RQIA 4RVHA 4TMXA 4N7BA 4OIFA 1Q1GA 1YQUA 5DOVA 2WD8A 4R81A 2P4HX 1MJGA 2JLBA 5E7QA 4DT1A 1EUDA 4ZK2A 2BZGA 2OUKA 5FD8A 4BRUA 1OT5A 2AC7A 3OHPA 1EBFA 2G67A 4L50A 2QTZA 3RD5A 4BX9A 4DMCA 5KNBD 4BP1A 5KTPA 1L5LA 1R6BX 3K5PA 3W5HA 2O2YA 2YV1A 4FQ5A 1J99A 2ID9A 4FLEA 4CTJA 1RCUA 4BNIA 1FYFA 2BEKA 1X77A 3GRRA 2DCUA 3P5BA 4HVTA 5E95A 2H5JA 3HDQA 3OTHA 5D2CA 4JY7A 3RC3A 3TJZA 2UUOA 1IHUA 3R09A 3KTAA 3S2SA 3G79A 2I4NA 4N5MA 1EM6A 3RUHA 2YBDA 1XR3A 2XOXA 1C8BA 2F7SA 4RK1A 1H6BA 1H2ZA 2PJDA 3MWJA 4KG7A 4LE2A 5G41A 3REQA 2ZJ3A 3ISVA 3GLHE 4GICA 1I9CA 4IJMA 1J0CA 2NTYC 1KHTA 3EGXB 2BM1A 3LBFA 4MWDA 2ERYA 1A4UA 2CFRA 2GCGA 3KPYA 4IVPA 4LUCA 3FZQA 4EPXA 3R7AA 3SD7A 4H7IA 2DQZA 2BCJQ 4EPYA 2IEZA 1ZN7A 5G1PA 1Y1LA 2DUUA 4Y6SA 1F14A 1JHYA 4BVLA 3N9IA 1VPDA 3AIMA 1YMQA 3I4FA 2YW9A 4JN6B 2OXIA 2PVCA 3R5KA 4IFTA 3SICE 1DADA 4YJFA 4E0BA 1JEOA 4MMZB 4ODIA 4C7VA 4WK2B 2CJWA 4EEZA 2X41A 1GNQA 1XLTC 2GEUA 3HJRA 1G8MA 1RKXA 1V41E 4DOMA 2IBMA 5FT9A 3FNGA 1IBLB 3U5ZB 3UAGA 2Z2YA 5DBHX 3UXMA 5J5AA 2F17A 3ASYA 2WTUA 1F6BA 3H1GA 4F21A 5JAMA 4XSVA 1CRQA 2OT3B 5TF4A 2XKBA 4KO8A 3G0HA 4AIIA 2HQBA 4IZHA 4IOMA 1TO2E 4BVEA 3GZNA 2FX2A 1WU8A 2AFIB 4HEJA 1IMOA 4DFDA 5MFPA 8OHMA 1WXWA 4KFCA 4F2DA 3R0JA 2GPNA 2ZIAA 1TLLA 2XWJI 1FNNA 4HO1X 1SC6A 4UXIA 3OUZA 4M8LA 2OFPA 3P0RA 5AIBA 3IOCA 2BM9A 4UMFA 3UFXA 1WB4A 2UAGA 2PZGA 1A0OA 1CIPA 3OX3A 5ADUS 3HBFA 3EZNA 5DBIA 1RQ7A 3FRJA 3A9RA 1NJ8A 3C3PA 3UO8B 1DG9A 2IYVA 3DXYA 3EFHA 4GYWA 4P0TA 2JGAA 2P2CA 3B3QA 5HG0A 5NULA 3MTQA 1RJGA 3LX6A 4QARA 5FWYB 3ZJYA 4LYAA 3GLIB 4YWHA 3CIFA 4WVLA 1SY7A 3A26A 3LF1A 5HHTA 2OEPA 3NAMA 3HRHA 4L9RA 4RSMA 1XVVA 1XZHA 4RJ2A 2BHLA 4GBJA 1TMGE 1NWHA 2GR9A 2Q6VA 3LYHA 1E6UA 2FYTA 3RAGA 4HGOA 3RTEA 4R1TA 3ZNQA 3GUVA 1PJBA 1FFAA 4BB9A 1V7PC 3VQTA 4PZDA 1XRQA 2VSFA 3ANNA 1S8AA 2MMCA 3NASA 2RIPA 3RYIB 2VQFB 5A4DA 1WUIS 3A6LA 2PZEA 1BX1A 2WKPA 1ZEJA 3CXUA 2A9JA 2IZOA 3EZLA 3NUZA 1XF1A 4TMWA 3H5TA 3C5CA 1RTTA 1N4DA 4AP6A 2JA1A 3HWX1 1N2SA 1RYMA 4LXIA 2X5KO 3GHYA 3E6AA 1WUJS 2IA5A 4C4YA 2PPVA 5EFOA 3JQ8B 3N8HA 2EEPA 3OD5A 1AQYA 2FSFA 4NJEA 1T4MA 4RFSA 2WWYA 2COUA 1GL7A 2J7KA 2HU8A 3PUZA 4R2JA 4RFLA 5ALGA 1U7HA 1N0WA 1QR2A 1Z6XA 3M8KA 1QCZA 1S2NA 3G2NA 1VI6A 3BM5A 2WU3A 2C4NA 4DEXA 1MU0A 1L7OA 3EBPA 1FP6A 3WGVA 1SQ0A 1VYUA 1MAAA 3OLYA 4P7FA 5L3SB 1JDJA 2HFJA 3ZUPA 2G5TA 4XWTA 3FKJA 1U7UA 4FFVA 1SBQA 1NNUA 4UATA 5EE1A 1RWWA 3KXPA 4MQLA 5AOAA 3GUZA 4JV5B 1XQYA 2E89A 4ARAA 3HGQA 1C1DB 4BPRA 3BWDD 1XA0A 5A2QA 3D2AA 3SQWA 1AQUA 3PJDA 4WJKB 3CXRA 5ALLA 4MTCA 4LOHA 3DO6A 2HSDA 3GAMA 2I62A 4N5HX 4ND8A 1BFUA 2VHUA 4UCXA 3TFQA 2BTQA 4AO8A 4DIOA 4XLZA 5JRJA 1DGQA 2UYCA 1I7SB 2RMKA 4RVCA 5LZ9A 4DSAA 1U8YA 5JWOA 4IJWA 3ISJA 1YJ8A 1YRLA 3VPDA 2IIVA 4GMGA 2J5XA 4YJ2F 4DCJA 2VDOB 2Q7XA 4MRNA 4CWAA 5EYPA 4YC7A 3ROPA 1RKUA 4Z7NB 3SSOA 5F2NA 3PRJA 3EXHC 3GLGB 1QAQA 3R9XA 3FSEA 1J5XA 1RLOA 1WDKA 3C7AA 1P74A 3VZRA 1LFDB 1CJMA 4MWEA 5E9JA 4LV8B 2H59A 1R6DA 4PZPA 1M8FA 1Q92A 3DOHA 3QVGB 5ULLA 2P4UA 1VL1A 1JDTA 3LTNC 2XOEA 2WIDA 1IWBB 2CK3A 4XD7A 3E9DA 3A4IA 4UOEA 5KNLA 4DILA 5DCUA 3RIMA 2E4WA 2W6JA 1SG9A 4JQZA 2O5EA 4IZIA 1GLGA 1Z35A 2HNBA 2XNSA 2OY0A 4CMGA 1D6SA 5JNRA 1YE8A 5EXSA 1N5JA 5ARCA 2QQEA 1WX1A 1X15A 4YAWA 4EK9A 1MZVA 5I8ZA 4HNVA 2AN9A 3OTQA 2UZ3A 5BR8B 3R3YA 5F4BA 4J2TA 1FA9A 1SK8A 3ZIUA 2VK4A 1UJBA 2OHHA 3ETHA 1YCDA 3H4TA 4G1VA 5GGYA 3UVEA 5A4MS 3IQFA 2QMYA 4KPUB 1UAAA 4CCWA 3VXKA 3ZZMA 2QP3A 4A8JB 1L5WA 1W88B 2V96A 4IWXA 3P19A 5K3FB 3KSBC 3W9SA 4AY4A 2R8ZA 1KMCA 3FOBA 3VX3A 3X43A 1R0WA 3F6YA 1E3LA 4L9AA 4GRIA 1FSPA 4M9ZA 3LQ2A 5H3CA 4JI5B 1MZPA 4WFIA 2Y1EA 4BBZA 4RA6A 3IUSA 3DD1A 4BQIA 1R0CA 4KZPA 2PCLA 1ISPA 4F92B 1RWOA 2ZUTA 3UJDA 2HXYA 4J9UE 1QNFA 4WFKA 3WIUA 2FLKA 5DTJA 4OP2A 3PQ5A 4I4LA 5BOSA 3GJ5A 4HAXA 3PFBA 4M9QA 4DV5B 1ZMRA 1YQWA 2PH1A 1GO2A 3L6RA 1AS2A 3R2JA 2XUQA 4KUHA 4NP6A 3LLCA 3ORFA 4HRYA 5CX1B 1EDDA 2ZYHA 3TMAA 1XN1A 4XGRA 4GLBA 2VN8A 5FPPA 5CG2A 2IS2A 1GCGA 2FPOA 3SQMA 3NQ41 5LA6B 2R6HA 3VZDA 5CVTA 4R1MA 4BY9E 4C6TA 3R75A 2PUDA 3T3GA 1YZFA 5A9TA 4U4AA 3R0ZA 4MJ3A 4YP5A 3C8HA 3RS7A 1D04A 1YH3A 2EG9A 4URXR 1B23P 2D2XA 2JJMA 2OLJA 2EKDA 1E6WA 3IEUA 2AI3A 2AV6A 1Y48E 4P4LA 1Z6YA 4MZDA 1BE8A 4FIDA 3LT2A 4A26A 2FG5A 3IB3A 4PCUA 5C7OO 9LDTA 3BXFA 3ESQA 4EENA 1RXWA 1F0KA 1KZ7B 1VKNA 3WLOA 1L4UA 5B5SA 4KRYA 1W8IA 5BUQA 4CKBB 5DN6A 2XITA 4F7DA 3JASB 1UBEA 2WC1A 1NOJA 4KMRA 3EXG1 2WE8A 5KAMA 4EHFA 2H9IA 3O1JC 1YF3A 3R40A 2QUAA 1EJ0A 1PJAA 4RD6A 1B1CA 1I1OA 2B0JA 1SG6A 1X1EA 3E3LA 4F46A 1QIKA 1ND6A 1W49A 3DV0B 3OPNA 3RUIA 4E33A 4FUTA 4BNDB 1T9BA 3L7LA 4MKHA 1RRVA 3LM8A 3UW3A 3VKWA 5AJTA 1Y6QA 3G17A 5U1PA 4I50B 2A30A 4Z4QA 1QJ4A 2HDWA 2X9LA 4JBNA 4TZTA 1B6SA 1P33A 4QOSA 1P6XA 1HK7A 2OM6A 3HEMA 1W4ZA 5DGIA 4CPDA 2C4TA 2DUWA 3WNCA 1IQPA 4DJEC 3OP4A 4C4SA 1NI4A 3D0OA 2X5OA 4NS1A 2R97A 2VWHA 3IPCA 3N2GB 4JVSB 2NV0A 3V4PB 3UBTA 1WL8A 1I6LA 1B0AA 3D0QA 3NHWA 3U7IA 1SHJA 1UC9A 4I4CA 3IKMB 2JFPA 5AXBA 4PNEA 4RTQA 2D2FA 5CDSA 1H0KA 4EZIA 2HBYA 5J58A 1ILEA 1M5RA 1N6LA 3NKLA 3IILA 3ZGNA 5LIPA 1JHPA 3CNLA 4AD8A 1M7HA 2VJYA 4OXYA 3TNYA 1RRMA 1QDEA 3CKKA 4K6OA 2GUWA 3Q7QA 2VWQA 3E7WA 3LE8A 2Y93A 2WVGA 3H6GA 4HLUA 1VJDA 2ZRPA 5HJEA 2AQIA 5DIFA 2Q49A 3D6MA 4HAWA 1QIMA 3H5VA 4OP1A 1ZGCA 2ZYUX 1GARA 3Q7IA 2I2FA 3I9V1 2WJZB 2R8PA 3FNRA 3BSYA 1HDYA 2YZKA 2O2HA 3BGOS 3L9WA 4Y9SA 4AKSA 1P7YA 3L43A 5T4BA 5TV2A 4HGNA 1QH1B 2JI7A 1EP9A 5DHAA 4XPIB 1BS1A 2Q0SA 4AY5A 4BRZA 3OCUA 1UBTS 1KEWA 4F3KA 1T8PA 2H85A 3T94A 2X15A 1HH4A 4ZANA 4ZI5A 1F7VA 1D8AA 2WF8A 3GLFE 3MSXA 3TDMA 1F1JA 1GILA 3TFWA 1EZ1A 4BNWA 4Z49A 1NI5A 1DQNA 1PJSA 3E2IA 4FFDA 3BMQB 4AJLA 1VLQA 5F7ZA 2O14A 1RWKA 1Y81A 1EZ4A 1LH0A 3H5AA 3O0TA 2J4FA 2X0IA 3CEPB 1G9XA 1LK5A 1MJFA 1DQSA 4BO0A 4KRFA 2QN3A 1JHOA 1ESCA 2GPBA 4LZPA 1X0VA 1TJ4A 5FNVA 1D2EA 2PY6A 1PHPA 1KOJA 3UC5A 4OCZA 1CDEA 3QXXA 4TV8F 3VU1A 1JHDA 4PTYA 1NN5A 1Q22A 3LP6A 4XTRA 3GJQA 3LJKA 4ALLA 2GH1A 5EL0A 1FYDA 2QRLA 4KN8A 4DLKA 4DMGA 4ESEA 3O94A 3R6TA 2EF1A 2X3FA 4B8ZA 4ECAA 4KO2S 1YZNA 3BK2A 2P8JA 1V8DA 1Y3DE 1ZM3A 3EQ8A 5AIAA 4CV0A 2QM3A 1YCGA 4ILEA 1K2WA 4LW8A 1VLLA 2BGTA 4QJ5A 1P44A 1C4WA 1JR3E 2P0EA 4Z6KA 2WPNA 1C9DB 3IP7A 3PA8A 3KKKA 4MS1B 4UHKA 4F4IA 4C0XA 5JAUA 1X8LA 4DLVA 1S1CA 2ZLBA 5EJAA 1HETA 2CL7X 4V3BA 1PIWA 4ZCIA 2FUKA 2NQ2C 5F78A 1SIUA 1TB4A 5K5EA 1X1CA 4R51A 4P98A 3IAUA 4INAA 1VL8A 3ZHBA 4DQDA 4DUGD 2J33A 2PKWA 2CBGA 1A8QA 1TEHA 2GO1A 3KBOA 3KG2A 1L9XA 1V5GA 4YMIA 2ADFA 5FWDA 2AVNA 2BLLA 4ALMA 2RGXA 3IVXA 5HM6A 4BB0A 3QXGA 4NK4A 3QTLA 3HCAA 2XUPA 3EB9A 3ENQA 1JQBA 3KPWA 4WI1A 5THQA 3HXOA 2N0SA 3HB4X 2LIVA 1A2BA 3NHPA 4TZ0A 4GDMA 1DAOA 4FVTA 3KOZA 1NP3A 2WWTA 1AMUA 4J3NA 3IA2A 5K8VA 4N49A 3OM8A 4QULA 1BX3A 1EDEA 3D81A 2JGJA 4L5AA 4LWQA 1BWQA 4R8LA 3JV7A 1XMPA 3PLNA 4GMXA 3HUUA 1TAGA 1W1IA 1TADA 2FR0A 3C45A 4MYDA 1HFKA 5GM1A 1SAYA 3PE3A 1MNAA 3NBYC 3JWGA 1YJCA 4H7KA 4HDMB 1Y0BA 4O4LF 3OSZA 3ISTA 4MCHA 1U0JA 1ISRA 4GI5A 4JAVC 3TRHA 1OI4A 3G1UA 2MSDB 1J0AA 3ZOKA 2LP4Y 4A8HA 3WGQA 5K6TA 1YGYA 2YYYA 4JYCA 4CHGA 4FMDB 4GSKA 2RAVA 5A05A 3W6UA 4UBNA 2OLEA 2FPUA 5BPHA 3GUYA 3A1DA 2P7HA 3B20A 3EXIA 4L4ZA 1G8YA 4D4KA 3QV1A 4E14A 5IM4F 4BNXA 2XSZD 2B94A 4B6RA 4BX2A 2FUG6 1HFWA 3STVA 4BAZA 2O8EA 5BSHA 4CIWA 1MQAA 1PEYA 3H1FA 1SM4A 4ALNA 1DOAA 1ACJA 1YZQA 2L82A 2ZRJA 4NZMA 3N53A 4K8RB 4YFVA 1FLDA 2IZ7A 5AJZA 4NULA 1SURA 3Q3EA 4PAQA 4B6PA 4FCTA 3E81A 2VF8A 3EDQA 2UVPA 3FRHA 3R1IA 4RD4A 4D4JA 4FD2A 1FFHA 1XTBA 3KOOA 1DKNA 3ENWA 2WSYB 2UZ4A 4TS1A 4GSLA 3TQHA 4YA6A 1F0NA 3CWQA 3FSGD 3PQ8A 3KXDA 2C4UA 2FWMX 3DR5A 1MV8A 4FIZA 4N5NA 4NMMA 3UB4A 2ZANA 2D7JA 4MQEB 1JG6A 3IT1A 5EIAA 2L2QA 4QYXA 5BYJA 1JA1A 3UMYA 3AYZB 1C3VA 1YK1A 4M9SA 1WZIA 3DVRX 4Q4JA 1ZRHA 2OORA 1G7RA 4RK4A 1MV5A 5K2MA 4QKQA 4QOEA 5DRYA 3K0AA 4P33A 4YCSA 2WOJA 2W0SA 4D3FA 4B7ZA 1Q1AA 3FLBA 5IBQA 3UOAB 4QVKA 1QX3A 4IDPA 2C2MA 2FMIA 4AKHA 4LHZA 4NG4A 3OZGA 4QBTA 2REBA 4KPUA 2FFJA 4Y2XA 2GEJA 5DU2A 1PTJA 4IVRA 1LPOA 4C4RA 1Z63A 5G0SA 5K3FA 1SC4A 3HBAA 5GZ6A 3AR4A 1JR4A 4HAOA 1NVVQ 1Q50A 3G7SA 3AKYA 4EF4A 3FHCB 3KEMA 2BE9A 3H6KA 3W5VA 1TVKB 2C03A 1C3XA 4GRDA 4Q3OA 4IOJA 2ES4A 4P83A 3QX8A 1MAUA 1IG3A 1VP9A 3E5NA 3HXKA 2VDNB 1V16A 3HP4A 2B4AA 5F7OA 4ZWNA 1J07A 2JIOA 4GAEA 1EK6A 4L8VA 3L6BA 3OPYI 4D9IA 1VCOA 3KR1A 3ZCUA 4KL8S 4EG6A 5CG1A 5CX1A 1VJ0A 1N5DA 2W6PA 5DIZA 3FGPA 3DBLB 1LXCA 1K68A 2CV1A 2PUCA 2WSLA 2Y9PB 2XNDD 4Z8XA 5FA5A 4DWJA 2NYAA 4HNHA 3KB8A 4IH9A 4FI3F 1HYBA 4IS2A 4JSTA 4MXDA 2PZ8A 1OHHD 1R1DA 1UBMS 4M9RA 5AXCA 3THOA 1XZPA 4IFIA 1X14A 4UUBA 1WPGA 4KX3A 3EXHB 1E1QA 3U3OA 2WWRA 3SP1A 1OZFA 3U5TA 2CUTA 5FBZA 5HYVA 4X1IB 4B3GA 2GPJA 4TT3A 3JR7A 4R2LA 1WD7A 1JIJA 1VZ2A 4HDAA 1L0BA 1SIOA 4DAOA 2XGSA 1SEPA 3CRW1 3DEJA 1R66A 1CR1A 2C8JA 3AKEA 5K0NA 2YRFA 3D59A 1OYYA 3WVNA 3KZOA 3LX5A 4BCBA 3U60B 1R0BA 4RKRA 2KPOA 1Y5LA 4TXHA 4BC0A 4CM5A 3T3OA 1ZM9A 4Y2HA 1JU4A 3E1GA 1GKKA 1NXQA 3RKUA 2Q46A 3H1PA 4F56A 5A4JA 2P3QA 3FAKA 4BUZA 5ERYA 4CF4A 4N12A 4BGDA 2VNIA 1MDBA 4Q3DA 4TPKA 2EZ8A 1EWRA 1P4HA 1ZXBA 1L5SA 2ZIZA 4UHBA 1NW4A 1VL0A 1Z56C 1OZGA 4E70A 1PO7A 2Y0BA 3MUOA 1BFDA 2O5VA 3C3KA 3QF4B 3BT7A 3KKZA 1XZLA 4ZAFA 3J80A 1XXHB 1ZC3A 1GY8A 1KI7A 4DGQA 3S8YA 2Z3WA 1ADYA 1HMYA 1WUKS 3C5HA 3QX3A 5JJLA 4TVSA 1KI4A 4N0DA 1G5FA 3OFSA 4QG7A 5DKFA 3ZCSA 1NVMB 3B82A 1KEPA 5KWVA 2VT6A 4G0OA 3JTEA 4RC9A 1W5EA 3BTUA 4WJLA 3WMGA 4D4LA 4MWTA 3QTTA 4KEAA 5JDIC 1XO1A 5BN5B 3N2EA 5K4HA 4Q16A 3A6KA 2I1VB 4IEIA 4KBFA 2XUJA 3HCEA 3PPWA 5CK5A 3ZTYA 3BK1A 2ATEA 4BP9A 1YO6A 1OLSA 3CLSD 3K1ZA 5EAIA 4AP9A 4JJ6A 2XUZA 3KKLA 1QYDA 1JHQA 4AX4A 4XXHA 5F12A 4KN5A 5E4FA 5C7LO 3DMRA 4JIGA 2FWAA 3W3AA 2AS0A 4NATA 4UM5A 3HN7A 4CG2A 2AB0A 1YGPA 4X8OA 3P9KA 2WG1A 2H1OA 1QH1A 1SFRA 4XPIA 1R4AA 3CF4G 1E9SA 3UJ9A 4ZJZA 1I14A 4GC9A 2FUNB 5EGSA 3WP1B 1UJ5A 1J8QA 2IGTA 4EI8A 1E7RA 4KC0A 1INLA 3OQMA 1IXKA 2X4GA 4F12A 1ORRA 2HMSA 5ESXA 3ROGA 3W7AA 4UZFA 3OCVA 1V8ZA 2HLNA 5C8ZA 3F4LA 2ZEJA 3U81A 1VSTA 3OETA 5FI3A 4CKEB 5D00A 2WTAA 2ZRGA 4KQ6A 3OEHA 2ZB8A 4R1OA 1T43A 4BB5A 2B25A 4HEHA 5KMGA 3AVTA 4RWZA 2YWHA 5DEIA 1P4GA 2EJVA 4BNHA 2HD4A 1DU4A 2VP5A 3EQ9A 4R3NA 4F6RB 1IZ9A 2D00A 5CLGA 1ZA1A 2CD9A 3WMRA 4OKNA 2WU0A 3T5DA 1STOA 3IE2A 3G9ZA 2GB4A 1E3WB 1RXUA 2H06A 3I73A 3T4EA 4TMZA 2JIQA 4H27A 3AF1A 5AVXA 2AR7A 4REMA 4YXWD 1DAEA 1OIXA 3ZHOA 5LU9A 5A0FA 1PBTA 2JLUA 1T4CA 2DR2A 4CL3A 1S2MA 2FEKA 5LPNA 2YRXA 3PHGA 4F45A 4IIFA 1KXZA 1RSZA 1D6JA 3PDUA 4MQBA 2GS9A 5T4EA 4F60A 1NJSA 1NMQA 3G2MA 3FX2A 5F9FA 2BZ1A 2IEAA 3MCTA 4EF6A 1UT8A 3R0QA 4LJ4A 4OK6A 1MHPA 3ZGYA 2HT6A 3GQVA 5K8LA 4GPTA 1SXHA 2B1RA 2G4VA 4TWIA 4LDZA 3MEQA 2AFIE 4HSEA 4JXXA 1ZD4A 4DKJA 4IZOA 2F3UA 3OCYA 1SUIA 1XI2A 5ABPA 3FF4A 3VSAA 3F74A 3K72B 3KZKA 2BTOA 3K1TA 3T7DA 4Y2GA 4QEKA 2FX5A 2I91A 2JHFA 4G8JA 4OF4A 1PL0A 1Z28A 4LRYA 4OH7A 4N7RA 1YJXA 5FUQA 3AUTA 1ZITA 3JD0A 5F23A 3U61B 1BO6A 3M9XA 3VR0A 3L4JA 4QJ4A 4ZA2A 2WU1A 2B1GA 4FEGA 4PICA 2PUHA 4X41A 2ETVA 2PRIA 5GADl 3CN9A 3JWHA 3D8RA 2QVCA 4N76A 1HRDA 5I3ZA 1GU1A 3MWKA 5G4KA 4OUDA 5K0JA 2HRBA 2ZTLA 2I71A 4KV9A 4A8TA 3GLIE 1NM5C 1P61B 2EW8A 5JH7F 4V0SA 5E6RA 521PA 1SOUA 1V1JA 1EHIA 1PT8A 5KSZA 3RAEC 4IXMA 2CXXA 2VF5X 3OLWA 3R3JA 5J4KA 2QLFA 1RD4A 4MS3B 5J2UA 1QE5A 2CNNA 2HQOA 1PR6A 5BUSA 4DRXB 3LWNA 1DRVA 2A5YB 3VO1A 1MXHA 4GMHA 4PG4A 1P0IA 4MVJI 3VZPA 2QTHA 5DTQA 1A96A 2WJYA 1XDWA 1YI0A 3BHMA 5E7MA 1PFYA 1NTRA 2OL4A 2XIJA 4BFYA 3SXUB 2DECA 4JI4B 5EIEA 2YJ3A 4E12A 3VI4B 1I2ZA 3H87A 2X23A 4MUMA 4N65A 3EVAA 1X7ZA 3MRTA 4LJLA 2QJFA 2CLFB 2O2SA 2WOOA 7ADHA 1N3BA 4LHYA 1Z39A 2Y1KA 3BERA 1P1HA 1YDHA 1E4OA 2CHVA 4A5SA 1GT91 3G0OA 4DLAA 2XZOA 5F9HA 3UT5B 4U7HA 1PP4A 2QRNA 5IJWA 1Y8QA 2HSGA 4EGAA 1YSCA 2R44A 3OJ0A 1USIA 5FI0B 5JZMA 3WO0A 2ZBRA 3IXMA 1YDWA 4KACA 3VHXA 3JQRA 4F4HA 2F8SA 1QCYA 3P20A 1GA1A 3WY9A 3W8DA 2IRWA 2DFPA 4JGBA 1VM6A 2P9JA 4KSYA 3CX6A 3H84A 3HMKA 4UBJA 4Y1EA 2ZJBA 1S8OA 2FEOA 2VJBA 3JATA 2R6CA 1QCCA 5DO9A 4EY7A 4H1TA 2RGCA 3DTTA 2HA0A 2GILA 2OV8A 3HB1A 1US8B 1XLVA 3IUEA 3PTLA 4L2IA 4K7JA 2AKYA 4M0CA 4O4HF 5EQTA 3VO8A 1EINA 3KCNA 4C0AC 3ETNA 4E5DA 1XSEA 3F9IA 4CQLB 1Z13A 2OO7A 5JSUA 1J0EA 3GAAA 3UMMA 4MVJD 3TCNA 1R12A 2QAGC 2V65A 4MQEA 1QP7A 2JK1A 2WV7A 3E05A 1ONPA 1NN3A 3BL8A 3FGOA 5F3RA 5I9LA 4AJ2A 3OY7A 3WA6A 4UM9B 5DRTA 1BA3A 2AK3A 2A92A 3KOUA 2BVNA 4Z9YA 2YXNA 1RYDA 3PXUA 3MHTA 2E82A 4L0QA 3U3JA 3TSAA 4JEHA 2XBMA 2Z8XA 4C6HA 4R1QA 1KBZA 3GLGE 1XOIA 1OTXA 2QEQA 3EK2A 4M0MA 5GGXA 4AJNA 4N6GA 4P93A 4DNFA 4AJJA 1PW7A 1SO8A 3T06B 1XMQB 1GAXA 4B76A 2IYXA 1B6RA 1Z6AA 3RRYA 3S0JA 2EHJA 1CQIA 2WWFA 2QW0X 4IDEA 4D99A 3PL5A 4BQRA 2EGGA 3S5JA 3FCYA 4C0BA 2E5WA 2RCYA 3PQCA 3R7FA 1ZGGA 3GJ4A 1WCV1 4ERXA 2WUGA 1Y5RA 4B3FX 3LPDA 3PHLA 1QPGA 1ZR2A 2CGEA 1REQA 4EG0A 4EJ0A 4ITVA 2GEBA 1KZHA 2E4VA 3VZBA 4ZYZA 4G4SP 1WSAA 2X77A 1DSSG 5LR6A 1T4BA 5B7NA 1ATZA 2CYCA 3DBLA 5FLKA 2R11A 2YZ7A 5I4KA 1FMFA 1VA4A 2ID7A 5AM4A 1FYEA 3AUSA 3V1UA 1E7MA 1OLXB 1RWXA 2VPXA 2VZEA 3BCSA 3NM4A 3PDHA 1T2EA 1C5KA 4HB0A 2Z58A 1Y33E 4W1SA 1QONA 1VRVA 3T34A 1XKTA 1NRIA 3GEHA 2A9PA 2O5CA 1QE0A 2EQ5A 2B98A 3BKWA 2ASVA 3DTVB 3SLKA 3IOBA 1MO4A 4ZI3A 3FDJA 3V2HA 3DE0X 2WHPA 4FYXA 4G81A 2GN9A 3MC1A 1EGAA 1XQ6A 4DLZA 1WVGA 3KB6A 4HH3C 3QLVA 1Y7PA 4AG3A 3HCFA 2A9KA 4TSFA 4HMQA 3G8DA 2P9ZA 1MEEA 2ZI9A 4YREA 2AQ8A 2OQIA 1AKYA 2C96A 4MPDA 1N9GA 4O4JA 3RDPA 3UUGA 4MA5A 5I8WA 1E3MA 2OP1A 3AY6A 1Z74A 2FRDC 4DC0A 1H42A 2WKQA 3Q7PA 3TTUA 4JSRA 5AESA 1KKLA 2PMFA 3VTKA 2PUFA 1E0SA 1W0KD 3V4LA 2XGMA 5AUNB 3PF9A 4KGVA 4A0FA 1JRLA 1IMJA 3A9WA 3A6DA 4GGOA 1F2VA 4AN4A 2ZIVB 4IDNA 3NETA 3A0RB 2Q07A 5JHHB 4C43A 1Z5OA 2PQ6A 4ZQCB 3Q8MA 2A1UB 3I2GA 2O0LA 2D5AA 1C7EA 1UK8A 2DMRA 1WCXA 4JJ4A 5AKXA 3TAHA 1E5LA 3DNMA 4JC4A 4ZYTA 5AQEA 3OO1A 5I7AA 1CY4A 1XXHA 3E18A 1Q1NA 3SYNA 4EO7A 4RU1A 4RTNA 2RK3A 1GR1A 4LTMA 4OG2A 3OZ7A 4LXHA 3RHTA 3DYBA 1BS9A 5FKJA 4FK8A 4BASA 3G49A 4V0LA 4XE5A 4NJMB 4RA9B 4TQGA 3U7HB 3GRUA 4UAUA 3V00A 4U7JA 3AW9A 5DLYA 1DLIA 5BNZA 2V7QD 3RCBA 5D86A 4EHKA 2HK7A 2D0OB 1K88A 5DSZA 3WTCA 1E4VA 4FFRA 3PGVA 4L5IA 2X1HA 2Q3CA 2CW5A 3OOWA 3ZLJA 4IWYA 1D1QA 4KSBA 1W29A 2QY9A 4GVXA 3V4VB 5M04A