1DAGA

Dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid and 5'-adenosyl-methylene-triphosphate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 74
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dagA00
5FOVA 2OAP1 4B33A 5JEEA 3CKLA 3LW7A 3PJRA 4FW9A 1OIVA 1E2NA 2ZYTX 5JI2E 5EP2A 3O8RA 3MJHA 1Q22A 4DCSA 1UBCA 3EIHA 2FWRA 1KI1A 4AK9A 3QPVA 3NH9A 1JAIA 3D8BA 4L16A 2BOVA 3WP0A 3THYB 4BFSA 2ZE5A 1US8B 1XTQA 4BFYA 2ZE7A 3FDIA 4CEIB 4DUGA 1VG9B 2ZRFA 4LCBA 3X1WA 1IJEA 1S96A 2QMOA 4I99A 1VCIA 4AD8A 5JZVA 3Q9LA 2NPIA 4LJ9A 2GCOA 2ZRAA 1Q21A 2MSDB 4TMZA 4QOSA 2WWXA 3HPRA 3K0EA 1T5IA 2OFOA 1OXUA 5KYKA 1ZM3A 2CK3A 4B3BA 2KBFA 4XVUA 2CCJA 1OKKA 5CIQA 5CIWA 5EQTA 5FTMA 3PQCA 4EPVA 1UKEA 1Z6GA 2O0JA 4RFSA 4Z51A 4LBZA 1OB5A 5IDVA 4TYNA 4P4SA 5AJWA 4LUCA 2F7SA 4KLNA 2CE2X 2P3SA 1CRPA 1M7BA 1G7RA 1NVVQ 1Q3TA 2CJWB 5FL7D 4FWTA 1EWRA 1NKSA 4OJQA 4QXAA 3J81k 4BEBA 4IDQA 4PHHA 2BMEA 2R6DA 4H1UA 4WXPA 1SHKA 1GAJA 3BC1A 3B6EA 4F91B 4AWXA 2ZVPX 4ACBA 2RHDA 2C9CA 3AF2A 4E03A 2FZLA 1S1CA 2ZUBA 1E1RD 3E1SA 3EXAA 4AY2A 1OYYA 4L9SA 4F4CA 3SN6A 5FBRB 4C4PA 2WJGA 1VYUA 2H1LA 3TUZC 3LVRE 1DO0A 4TL9A 1E2JA 5EXSA 5JECA 3KQKA 3QIAA 3EG5A 1JR3A 4Q03A 2GEVA 3BB1A 4BQSA 1RRGA 1XTRA 3ZS8A 4KHZA 3MD0A 3QKRB 4JBWA 3W8NA 5KNDA 4O2LA 1HQYE 521PA 1PVOA 2BV3A 4TLDA 5GJWC 3HWSA 4DIEA 3OEED 2CLDX 4LV5B 4G5OA 3A8TA 1D9ZA 3PEWA 2GNOA 2OBLA 3AP1A 2LKCA 3L8YA 5JSZA 4EJSA 2GAOA 3CZPA 1OXTA 2QBYA 2WJHA 3GJXC 4WIAA 3AM1A 2CHVA 3EARA 4XH9B 2IYZA 4I1OA 4BLRA 3KJGA 3PUWA 4Q1FA 2HEIA 1IN4A 2RGNA 3FMPB 3ZIAA 1E98A 2N1BA 1AS0A 1OLOA 2GJ8A 4DCVA 1AKYA 3WYGA 2YNMA 4YDSA 3SNHA 1IAQA 1P72A 2HT6A 3LAWA 3U61B 4JVNA 2ZRCA 5FBWB 5SZJA 1I2DA 3X1ZA 1RRPA 5TVKA 2VL7A 4DSUA 2CCGA 1FNMA 3ETLA 2OHFA 3B1ZA 1KJWA 1C9KA 1CLUA 4EAQA 3K09A 3KX2A 5LBIA 4NH0A 3K1JA 2NTYC 1X1SA 2QMEA 1U0HC 1W5TA 4BE7B 3CZQA 3M6AA 1XCPA 2QY9A 4AYTA 2GZHA 4PANA 4E5UA 1KI3A 4RD6A 2JLXA 1NN0A 2NPFA 3REFA 2VP6A 3TIFA 3RS0A 4TWZA 4I1SA 4E22A 4L8GA 1NI3A 5JS7A 1M6NA 3GP8A 3QPWA 3L0IB 3RANA 2ZSAA 4PPNA 4EPRA 5KPDA 1D2NA 1FZQA 2XXAA 2Q3HA 1NNEA 1R7RA 4RD3A 1KAGA 1NN1A 2NGRA 4TL8A 3PV0A 3QVUA 1G17A 1Z0AA 5JRJA 2I4IA 2ZJ8A 3AKDA 5HKKA 2HV8A 3GQBA 2HF8A 4V0ME 3G82C 4ZDJA 4GFDA 3ECCA 4Q9JA 1ZIOA 4JJKA 5DHAA 3VTKA 5CK4A 4OK6A 4AI6A 4PHGA 3SJZA 3EAQA 2KJQA 2QM7A 2NOAA 2GXAA 3OE7A 1N6LA 8OHMA 4GP7A 2DWQA 4IDPA 4HZUA 2ECKA 1GZSA 2VA8A 1NLYA 3VR6A 3H4MA 5J4LA 4TSFA 1Q3HA 4C0AC 2CE7A 1JJ7A 4TTRA 4EPWA 3THYA 3TE6A 3NTUA 5FOUA 4OQXA 3FHOA 3TNFA 1AIPA 2OT3B 1US8A 5BQ5A 2PCLA 4CEIA 3LX8A 1GITA 1GVNB 1W0JA 2TMKA 4U5XA 4B2IA 4D0LB 1YU9A 2BCGY 3OIVA 1LY1A 1G4AE 4MRVA 3X1DA 1KI6B 3RYTC 3KDSE 1CJUC 2VP4A 1GWNA 3ADKA 3AV0B 1FL9A 3B2EA 4M8NE 4B6EA 5JI3E 1KSFX 5HCIA 3SJBA 2GESA 3DM9B 1E1QA 3FKSD 2YOHA 2ZI5A 2Z4RA 3PUYA 1IQPA 3DL0A 1KDRA 3K9GA 3Q8XB 3RC8A 2QSZA 3H0KA 1KK0A 4YMTA 3SDZA 4LPKA 1F5NA 1E9SA 3NDBB 2WTUA 1Z2AA 3THOA 1TX4B 1ZUNB 2H92A 1H8HD 3K9HA 3GD7A 3TRFA 2WAYA 2DWPA 1OH6A 3BWDD 2QMUA 2CJWA 2XOKA 2FSHA 1UJ2A 2WSSD 1PZNA 5KSPA 5IK2D 1E2GA 4Q47A 3AEZA 2DFLA 4TTQA 221PA 2H5EA 3W3AA 3THXB 1H8EA 1II9A 3HU2A 1QHSA 1KI4A 3W6OA 2GBLC 1G7SA 1W4CA 3U3JA 1G41A 1KNXA 3SQXA 1FW6A 4C0SA 2WAXA 4Z54A 4KYUA 3B8HA 4QRHA 4H9GA 3EZ7A 1Q57A 1JI0A 3QXXA 4NL4H 4PAMA 3PUXA 4LC1A 4B43A 1VECA 5JRZA 1HE1C 1HA3A 3ADBA 1FOEB 3AP3A 1S3SA 1XD9A 2R6FA 3K8YA 4RD1A 3A1SA 3PUZA 4RZ3A 2OESA 4Z1MD 4WVFA 5A5GA 4KI0A 4HAZA 1WA5A 2IUSA 2MSCB 3TLXA 1KO5A 2WJYA 2G83A 4WZ6A 4CW7A 1S9DA 2EFCB 4CEJB 4PQRA 3ONWA 3QKRA 1Z0JA 3MWKA 3WMEA 3W90A 1N6NA 1SQ5A 4URYR 4JLMA 4XSGA 4DJTA 1DAGA 4ON9A 5CJ2A 1E2HA 1J90A 2Q9AA 1IJFA 4HAYA 3GLGB 2OBNA 4NCIA 3U6BA 4EUNA 1VYTA 2G77B 1SXJE 2WWGA 1ZJ6A 1TEVA 1II0A 1Z3IX 4HDCA 2HCBA 3T06B 2YC2C 4C7OB 2D7CA 3SS8A 3VNVA 4ASUA 1LFDB 1MRSA 3IIKA 2Q21A 1MH1A 1XCGB 1VMAA 4A4DA 4W9MC 3QG1A 4PO9A 2FNAA 2QENA 1I4LD 1TMKA 4L5BA 1FMLA 2FPKA 2CDNA 2QP4A 1P9NA 4NCJA 1ZMXA 1R8SA 2XSZA 4OI4A 3U3MA 4QJ3A 1Z47A 3LRPA 4JVSB 2A78A 4QHTA 2EWWA 1II8B 4BFTA 1TPZA 2C96A 1DAHA 2FE4A 3AUXA 4CIDA 1S9HA 4KBGA 2C95A 3SYKA 4JT2A 4JJZA 4N0DA 4M22A 4DEXA 2O8DB 3LD9A 3IIMA 3LNCA 2F3TA 1XZQA 3RDPA 3W9YA 2RKOA 2V55B 3TW4A 1B0UA 2C04A 4A8JA 3V4RA 3CF0A 4Q7JB 1JEDA 3TK1A 3FMOB 2V7QA 4QJ5A 1JPNA 1F48A 2BJVA 2ZJZA 2ZRKA 3GJ6A 5FI0B 4ZCIA 2EW1A 1RKBA 1L8QA 3KB1A 2PZEA 4GRAA 3IDQA 1BS1A 1CKEA 2QRZA 2O5VA 2HLDD 2I1VB 3CPJB 4GBMA 3W6PA 2ZITA 3BORA 3MGCA 4DLUA 5AJVB 2XZOA 5C4GB 1YZUA 3WRXC 1Z07A 2NMVA 1COWA 4IFBA 1FPMA 2AFIE 1I4DD 4EKDA 4ERNA 4NYMR 4IDOA 3QY0A 3VR2A 1SVWA 1KJYA 2XTZA 4D26A 2IEZA 3VQTA 4F92B 3QXJA 3TMKA 2EVWX 3DDCA 1SKQA 1YZTA 3FMIA 4TL6A 1LV7A 3PIRA 5C1BA 5HE9A 2ZJ2A 2J0VA 4TYWA 1XB2A 1SHZA 3IO5A 4DLVA 2V3CC 3RRMA 2IYSA 4M9SA 1VHTA 5EE3A 1A2BA 1OFIA 2XNSA 2GVZC 2FMXA 2IS4A 4L9WA 1IXZA 4D4JA 3EA5A 3QEOA 2X77A 1KI6A 3PENA 1XF9A 5E7JA 3GLFE 1CS4C 3V00A 1W4BA 1NY5A 1W44A 3ZVMA 5JJKA 5H1YA 1P4SA 3A4MA 1Z63A 5HZHA 2YYZA 2PMDA 1R8QA 1HE8B 3C15C 4GT1A 3ZD7A 2WV9A 5KNBA 3U7GA 4GL2A 2Q6TA 4B3FX 2NZJA 2QAGB 3KKQA 4FD2A 5JCZA 4MDFA 3O8BA 2OCAA 1XMVA 2NZ8A 4B76A 1E2DA 1CR4A 3JZAA 1MR3F 1ZCBA 3THXA 2DR3A 1KI8A 4TQAA 1U94A 4PXAA 2YOFA 2ZPTX 1W49A 2ZRIA 3DKPA 1NN5A 4R9UC 5CM9C 5FPSA 1YZNA 3SOPA 3PFIA 1R6BX 2EYUA 3R8FA 4QHYA 4A36A 4URXR 5KSOA 3WHKA 1OXSC 3ZVNA 5DE3A 4Q9LA 5TXGA 2A3RA 1Z08A 2A7QA 4O0MA 2R6CA 1JQJC 3A37A 1KYIA 4I1UA 3FVQA 4JLPA 4B35A 2REOA 1G3IA 2BWJA 5JFGA 3THWA 2QEQA 4L4UA 3S1AB 1QHXA 3C8UA 4BFVA 1U9IA 2OXCA 2FSFA 2ZR9A 2CHQA 4FMDF 3SQWA 4FMDB 4D4LA 1A2KC 2IUUA 1CJMA 1WP9A 3W8RA 3GLHE 3TJZA 4NCHA 1M34E 3D31A 4PPFA 4EQ6B 2IX3A 1P2UA 1T0HB 3IEUA 4PHTA 4M1OA 2OBMA 4FMBB 3NIBA 1YRBA 3I5YA 3LFUA 2LWIA 1LF5A 4LV8B 4XIGS 2ONKA 1CXZA 4A6XA 3KQLA 2ZANA 1G5PA 2JLQA 4TZ6A 2KSQA 2ASEA 3AKEA 2N46A 4N0EA 3EWAA 2DYKA 4DKXA 1G20E 1T5LA 1MO3A 3RABA 2V6JA 3ZQJA 4BRUA 1T6NA 3K0AB 1Z22A 5K8LA 2XZLA 2E1RA 3IHLA 3SBDA 3RVBA 4JSYA 3LBNA 5B30A 1KI9A 3N5CA 4BFXA 3IIJA 4HB0A 3AVUA 3LA6A 1ZUIA 1II8A 4HZIA 4Q4LA 4CVNA 3UATA 4CF7A 4X8MA 1KHTA 1OIWA 3L2OB 1XDBA 2AR7A 4JBXA 4S2EA 1NBMD 2C8VA 4QFMA 2QT0A 4Q21A 3BB3A 3QNUA 4LYAA 2O8DA 2RGXA 4YMUA 2IEYA 1XEWY 1U98A 1SXJA 4LHXA 2NIPA 2XJ4A 2DHRA 3NBZC 1N0WA 1GM5A 4NHOA 2WBLC 1P61B 2ODBA 3AGQA 2VF7A 2RGEA 2RGBA 3DKVA 4US0R 5L3SB 2J46A 5FTKA 1GUAA 1ZD1A 5DN6A 5JBQA 5JLJA 3CO5A 2V6IA 4JLOA 3MG9A 3QBVA 3GJ0A 4UXJA 5FI1B 1W0KA 4TT3D 4IEEA 3PUVA 2WICA 5UKDA 1WDTA 3L8ZA 3RS4A 5AUNB 2R8RA 4GNKA 4QC2A 4TMTA 3O8DA 2Y8EA 2YHSA 5E95A 3U5ZB 4QBGB 2WMNB 4LI0A 4JS0A 3R9WA 2ZYWX 1VIYA 3FFAA 2ZEJA 2NO7A 2IYWA 3BE4A 3NHAA 4NYIQ 1TQ2A 4P31A 2AD1A 4PC2A 4RVCA 1TU3A 4EFMA 3QF4B 1KY3A 3VR5A 1E79D 4UNPA 1RC8A 5FUXA 2X2EA 2BEJA 1BOFA 3I1FA 5CB6A 3R9XA 4F4JA 1VYVA 2RGAA 4II7A 4PAQA 4URZR 1KAOA 1XXHB 2FSIA 1D8TA 2HT1A 4DLTA 1T91A 1CP2A 1XZPA 4IVRA 3T1VA 2KE5A 2J0SA 1DPFA 2C9YA 1U99A 2W2VA 4ZI3A 5J47A 1XEFA 3QXHA 1RVDA 4PHFA 1ZM9A 1P5ZB 1F2TA 1Z2CA 3IQWA 5AK0A 3K0CA 2JEOA 3BH6A 1L2TA 1GFIA 3TSOA 1RFLA 2WMOB 3ASZA 3CRVA 2GVDC 2D74A 3OEHA 2F3RA 4YQFA 3I5XA 1GSIA 2FFQA 1GP2A 2QL6A 2QAGA 4MYTA 2IHYA 2QTHA 4Q5IA 4IDNA 4BLTA 4UXHA 1G4UR 5LB4A 3WNDA 4QBIA 5B2ZA 4LBVA 4IOLA 4Q19A 2QE7D 3ZZUA 4ESVA 2WM9B 4KCGA 4QG7A 4PQYA 2OFWA 1CU1A 1GNRA 1IN5A 1VHLA 5DSZA 1DTSA 2ODEA 5BWMA 3V4FA 4QBHA 1ELOA 2JJ2A 1HEIA 2FPMA 3K53A 4LY6A 1XNJA 3CB4A 3LO5A 4KYIB 5EZ5A 3NC1C 5TMPA 3G5UA 4IDHA 4PQFA 5BYJA 1G9XA 1KZGB 3GLFA 3RRNA 1XJCA 1YHNA 4KSCA 4WXRA 1E0SA 1G6OA 3AQ4A 5JHHB 5AR1A 5G53C 4C0HA 1HY3A 1H65A 1CJKC 2G6BA 2OSBA 5A0FA 4A82A 2ZRPA 4UNNA 1KI7A 4Q4JB 4DLSA 1T0JB 5AJZA 2GKSA 2R9VA 2QG6A 1ZC4A 4LOAA 2JDIA 5LD2C 3AKYA 2NO6A 3KKMA 1L4UA 2O52A 3QG5A 4QGHA 2BMFA 3VKWA 3X2SA 4TN1A 5G3YA 4KJZA 1YJ5A 4D81A 1N6PA 4MQBA 5K8IA 4EQ6A 3FTQA 3U3KA 1TF7A 3CNLA 3RHFA 4Q4HA 4B32A 3EX7C 1UFQA 1X1RA 1N5IA 4JLNA 4Q7LA 1G19A 1U0LA 3OF5A 4PC1A 1WE2A 3D3QA 5L3RA 1GILA 1ZP6A 5C4MA 3D6TB 4DHEA 2OCPA 1MKYA 4MGKR 3RS3A 3X1YA 4RCZA 4BZXA 1FTSA 1DAEA 2JIZA 2OE2A 3K0AA 1BKDR 4ZO4A 2X8AA 4CT4B 1XFAA 3I8SA 2IYXA 1W36D 2XNDA 4Q1AA 5D3QA 3CR7A 1A5TA 3K0SA 4NONA 1ODFA 2G0TA 2ZUCA 3MMPA 4JL8A 5F3WB 3QKSA 3OIUA 3WP1B 4BLSA 2CEAA 2VLIA 3UXMA 3I4LA 4M9XA 1OH7A 2HJVA 5JJLA 2GWHA 2VSFA 1UADA 1QVRA 3GLHA 1HTWA 3L82B 4Q4AA 5SZHB 1NL3A 1UM8A 1EFTA 2DFKB 1BMFD 2BDTA 2XZPA 5DI3B 2HYIC 2BBSA 1EG7A 3P1JA 5LDDC 1QHGA 3QENA 1ZCAA 4RD2A 2OCYC 4BFWA 5LB2A 1YRAA 2QORA 1S0UA 1G1MA 3IPYA 4UNSA 4BASA 5L3SA 4IEIA 1C1YA 1UDWA 5DIFA 3BD9A 3P27A 4HUQB 3GJ3A 1M74A 1QHIA 4RJLA 3RS2A 3GEHA 3EIEA 3GEEA 3VHXA 4AYWA 4HUTA 3EZ2A 1XBTA 4ZCMA 1L4YA 1Z6YA 3B1VA 1CR2A 4X8OA 2J9RA 1JPJA 2AK2A 1NSFA 1MABB 3UWOA 5E3HA 1E2PA 3Q85A 4P33A 3CX7A 3AGPA 1S2MA 4QHSA 2GF0A 4KAXA 1GOTA 2GK6A 1JBKA 4AKHA 2JAQA 4IW3B 2F6RA 4DLRA 5SZIA 3SHFA 2QN6A 3ND8A 2WIAA 2BKEA 3NWJA 2IXFA 1W46A 4WAUA 4URVR 3BXZA 2PJZA 2VHUA 3RRYA 1RYHA 1XU4A 1P2SA 4D25A 4M21A 1OHHD 4PPGA 4EFLA 3A6PC 2BVNA 2ODNA 1XXHA 1KSGA 3KL4A 4WBSA 3TSWA 1NLFA 1FUKA 1U81A 1XMSA 3BH0A 3HU1A 4G5RA 1SZPA 1ZU4A 4KLZA 5AUOB 4PC3A 1E9EA 4M0LA 2HJGA 4KSBA 4NTZA 1OSNA 1FQKA 4M1MA 4QM7A 3K70D 1M7HA 1XMIA 2Z83A 1E9BA 3A4NA 3AVQA 1TQ4A 4D0NA 4LK2A 3UPUA 3UMFA 2BMDA 1MO4A 4PC7A 4C0LA 3RWOA 3SU8A 1HT2E 3BK7A 2H57A 4UNRA 5JWOA 1ZRHA 1X8JA 2OG2A 2REXB 4NPHA 5CM8B 4G1UC 1XD8A 5FPHA 4RFVA 5L8VA 3TVTA 2I1QA 3AKCA 1KKLA 4HB2A 1T3SA 1JJVA 3LWNA 2JLZA 2R2AA 3CLVA 2QP9X 3TKLA 4Q18A 2C9OA 3GMTA 2AKAB 2ZE6A 5HR5A 3QQ5A 1R5OA 4U00A 2F1HA 5E7IA 4AKEA 2G9NA 4Q4JA 1EWQA 2JLWA 3IUYA 3OFND 1EFRD 3FHCB 2CVFA 4AG5A 3AVTA 2RAPA 1UBGA 1DAKA 3SZRA 4D80A 4MA4A 1YR7A 4AG6A 1Q44A 1LS6A 4YMWA 3H1TA 3ZD6A 1YR8A 2J7PA 4IJMA 1TU4A 3ND9A 2J3EA 3RSLA 5CB8A 4TZ0A 3WYAA 3T35A 3P32A 2BMJA 2ZI3A 3JVUA 2Z5FA 4A0FA 2J0UB 1SKYE 2NO1A 3ZVRA 2RB4A 4DDWA 1YQTA 2PT5A 1WBBA 2ERXA 2IYRA 4DUGD 4LHWA 1G64A 4MITA 4NYJQ 2A9KA 1EX6A 1OW3B 2H17A 2WWFA 4LSGA 3QBTA 4R2HA 2GF9A 4DT1B 2G0NA 3WRYC 3WMGA 3QF7A 1MO5A 2W6JA 4QGFA 4LJ4A 2WPDA 1EXMA 2ZSEA 4TL7A 3TH5A 2FFBA 1D6JA 2CL7X 2Z6VA 1VG8A 2CK3D 4MKFA 1IN8A 3AVPA 3B1WA 5FUYA 2XJ9A 2ZSFA 4MH0R 3MWJA 1OKKD 4DDVA 5EE0A 2H18A 1G18A 2F43B 2OILA 1G8PA 3BGWA 1PUJA 1P62B 4DB4A 3BFKA 2WJIA 2YWGA 2B6HA 3GJ7A 4KFUA 4JLKA 4UNQA 3B1XA 1LTQA 2GK7A 4TQ9A 1MO6A 3CWZA 5GVSA 3LY5A 2FG5A 4R7ZA 3KUCA 2YOGA 1GKIA 3AP2A 4TQUS 1SKYB 3W6NA 4C9BA 4GI7A 4OHWA 2JLYA 1D2EA 3IHWA 3QXCA 1G16A 3CPEA 5DI3A 2NO0A 4DEYA 4Q1DA 3CWQA 3T34A 4HB3A 1UPTA 5BN4A 2J7KA 4A2QA 3LQQA 1G3MA 2IYLD 621PA 5F9HA 2LCFA 4OQMA 5F98A 3EZ6A 4ZDWA 2ZYUX 3VFDA 2ZUDA 3L0OA 4OQNA 3WBJA 1HYQA 4ABYA 3GLGE 2CLSA 4LV6A 2ZRMA 1IBRA 1JR3D 1LF0A 4HUQA 2ZSDA 2G1JA 1N0VC 3RLFA 4PZZA 3NDPA 4MUAA 3MJRA 3O47A 3CBQA 2AWOA 1UAAA 4B3DA 2JJ1D 2W0MA 3C4JA 1OPXA 3TQCA 1XP8A 4G3XA 1GNQA 2CHGA 1IXRC 2OEPA 3CF6R 2GZDA 4O2RA 1AKEA 2WHXA 4MKGA 3H84A 1K5GA 2CL0X 2OFXA 1T3LA 4TYQA 3RSOA 1DOAA 1G8HA 5P21A 5BXQC 4RD0A 4YXWA 3QE0A 1X8KA 1Z0DA 5DYGA 1GIAA 2ZI9A 1UKYA 5J4KA 2IF0A 4B47A 1BYUA 2OAQ1 4LC0A 3K9LA 2EWVA 2QM8A 3CNNA 3Q3JB 4G5SA 4DSTA 3ZIAD 2W0SA 2CCKA 3UANA 4B75A 3AH8A 5L3VA 4TMWA 3U4QB 2IL1A 3C41J 1N5KA 1OXVA 3GFPA 2VO1A 2A5GA 2CXXA 3NC0C 2GDJA 2FX3A 2ORWA 1N5LA 2WJVA 3DHWC 4JLAA 2FV8A 3F8TA 2ZSBA 2BBTA 3ZS9A 3DPUA 4HYYA 1VDZA 4W5JA 3T1OA 4CEHB 1SVIA 2RGCA 4OQFA 1Z6TA 4V0OA 1AZSC 1N6RA 3ZZ0A 1IN7A 3A1VA 4YMSA 1IY1A 1FP6A 1R10A 4RSGA 2QP3A 1ESNA 1FNNA 2H8KA 3BRWD 2GXSA 5GJCA 2VTKA 4KBFA 4OHXA 3K9NA 3OAAA 2AL7A 1P60A 2F1RA 4M1YA 2VHCA 3B78A 4BECA 2XX3A 5EP4A 1X3SA 1YZLA 1KDOA 3CM0A 2WJJA 1W36C 4M9ZA 5KDDA 1E4VA 2DPXA 2XEXA 4EPTA 5HKKD 5J4YA 2QNRA 2FEMA 2YINC 4YC7A 1XD2B 3SFVA 2AK3A 2D2EA 1Z0IA 3EW9A 5GJVC 1JXOA 2B7CA 2X2FA 3BS4A 1QHYA 3BFVA 3REGA 1KI2A 3OIWA 4LBWA 3WBKA 1ONBA 3SYLA 1UKZA 3I8XA 2OV2A 4QNRA 3BBPA 4GMXA 5DGXA 2ZU6A 2O8BB 4YONB 1TQ6A 4TSFD 1G3UA 1LVGA 2ZETA 3NXSA 3KQNA 2JLVA 2WWIA 2WVJA 2J0UA 4YLGA 5FTJA 5FL3A 1PLLA 2IW3A 1W0JD 4TLBA 1QRAA 2JASA 4C0BA 1GTVA 2A2ZA 3K0FB 4IOMA 1Q1ZA 3CX8A 3KXLA 2P65A 2IYYA 4K46A 3RAPR 4DT1A 3QKUA 3U6KA 1J99A 1AQYA 1E1QD 4V0KA 1W48A 4BZQA 5TDHA 2VH5R 5AUQA 4YDHB 1KIMA 1GRQA 3TUJC 2HF9A 3FHTA 1F3OA 1EFHA 1Z0KA 1A7JA 1RJ9B 5EP3A 1SVSA 2XITA 2F43A 2PH1A 4JL6A 2P5SA 3LW8A 2E87A 3KFXA 5CLQA 3KTAB 3VNUA 1CULC 2EFDB 2WKRA 1M7GA 1OE0A 3LVQE 2PLFA 2KWIA 2O8CB 2XOKD 4B73A 4XD7A 3HYTA 4AKIA 2ZVQX 3QVVA 3KJHA 4HB4A 1H8ED 2VHTA 4F93B 1ZC3A 3UMSA 1CTQA 1S4QA 1Z28A 3N2IA 5HCNA 3AUYA 2ZU0C 1EGAA 3PG5A 1VIAA 3DZ8A 2ZJOA 4S35A 1TF2A 3HDTA 1N6OA 4DC9A 3F5FA 2FZ4A 5J5CA 5JHGB 2ATXA 5FOWA 1I4TD 4IRUB 4JIMA 3K70C 5K8TA 4B48A 3BB4A 1Q1QA 1G3RA 2OLKA 3IKJA 2QZ4A 3RC3A 2W6IA 4Q66C 2QGZA 2VP2A 1VG0B 2J59A 5EP1A 3PR1A 4M1KA 2CLCX 2GETA 4B74A 4DLXA 4KXFB 3SR0A 4W7SA 5CLLA 5F2EA 4C30A 2MSEB 3PITA 4KFTA 2IHBA 5J40A 2IS2A 2VSXA 4TTPA 1EX7A 2GBLA 4KITB 2DFTA 1HT1E 3KZ1E 2D7DA 1C4OA 1E2EA 2ZYVX 4DSOA 1NG1A 1E0AA 4CEJA 3I3SR 1KO7A 1NIPA 3KXIA 5GJBA 2CNWA 3MRSA 3BJIC 2K5UA 1DG3A 4QKQA 1U8AA 4ARZB 4LYJA 4W5HA 121PA 4ASUD 3QUSA 3A1TA 2ZI7A 1E2FA 1G8GA 3U4QA 3MWLA 3KQHA 1XTKA 2EYQA 2DY1A 4HAUA 2AWNA 3RRZA 3GLGA 3R7WB 2ZIAA 4NP6A 4FWIB 4OK5A 4MYCA 4WZBE 1T4GA 2XSZD 4C7OA 1FUUA 2XB2A 3LDAA 2ZJ5A 4DCNA 3BFXA 3NHBA 1E9AA 4M1WA 3NKVA 1ZNYA 2D62A 1HV8A 4HSEA 2CVHA 2IA5A 3NBFA 4IXMA 2JLSA 2B92A 1ZD9A 3T12A 1XTSA 2R44A 1G5TA 1DAFA 1NN3A 5KSYA 2ZREA 1UF9A 1ZBDA 3UIEA 1JXMA 1DS6A 3MSXA 4CRWB 3DOEA 4CYMA 4B6FA 4GZMA 4B3GA 4K81B 2FGJA 2V7QD 3PEYA 5KHOC 1SVKA 1OFHA 1VCMA 3KUDA 4LPSA 5M04A 1E69A 1JAHA 2XAUA 2QT1A 3CH5A 2JJ8A 5E4FA 4M4SA 2FEOA 1G291 3VX4A 4MDEA 2Z0MA 5G41A 4DVGA 2OCBA 3IPXA 3KFVA 3VR3A 3B7GA 1XD2A 4CZ2A 5HPYB 3TVDA 4B2LA 1COWD 1YZGA 1KY2A 1P75A 1KDTA 1P6XA 1MV5A 2D2FA 1E9FA 3A1WA 3AF0A 4Q00A 5AJYA 1XXHE 3FKQA 3SHWA 2JLUA 1DAMA 1NVWQ 1W4AA 1GDDA 3H2YA 2B7BA 4JVMA 4PSVA 4BLPA 2SHKA 1HH4A 3W5IA 4KVAA 1TQDA 2Z4SA 2IYTA 1Z06A 1ZVQA 4BRWA 1W4RA 2PL3A 4BEJA 4E09A 4NYMQ 1U0JA 3ZQ6A 1ETUA 3TR5A 5IT5A 1LW7A 4RZ2A 3WNBA 4OKSA 2GHIA 1KO8A 3C16C 4UJ5A 2IXGA 2GXUA 3BAFA 3LXXA 1QDEA 3I73A 5FOTA 5FTLA 3P4XA 1NVVR 2E9SA 3K0FA 3JVVA 3QKTA 2YKGA 1LNZA 4AYXA 4TLAA 2QQEA 2X1VA 1BO6A 2WOJA 2YWEA 2HYDA 1AZTA 3DM5A 4HATA 1CIPA 4JL5A 4RKFA 3TUIC 2QMHA 1N3BA 4TYPA 4JYCA 3TQFA 2FGKA 5FL7A 2ZS8A 4R98A 2ZRLA 4Z8XA 3VKGA 4FN5A 1WBDA 5DNYB 1OV4A 1RJ9A 5DYIA 3MLEA 4LHVA 4C0QC 4PR0A 2OUKA 1N25A 4K8OA 5K8UA 4FCWA 2RGGA 2WWHA 2NQ2C 5BN3A 4EJSC 2P5TB 4G0NA 4PZLA 5FH9A 3I92A 4LBYA 1E1RA 3NEJA 1XJQA 3CX6A 3EIQA 2O8CA 2RGNC 2ZJAA 5HTKA 1QHNA 5FUVA 2BBOA 3MAAC 4DRZA 2P6UA 2C5LA 4D2IA 1T8UA 5KDLA 1NJGA 3SI7A 1E0JA 2FSGA 2RH5A 4LZZA 1SVMA 5KOYA 4DLWA 1MRNA 4EJSB 1SVLA 3GFOA 3IBGA 1TL7C 4PX9A 1IY0A 1W2GA 2EU8A 2PLRA 3KJEA 4Y0AA 3K09C 3MCAA 4B3XA 2ZQ5A 1KMQA 2UZ3A 2GJ9A 3FPAA 3OEEA 5FOXA 4R71A 4LX0A 2DB3A 2Z43A 2HXSA 3U3RA 1CEEA 4V03A 2IWHA 1GL6A 5EZ6B 5GADl 4M2LA 1PV4A 4LJ8A 2GTPA 3C14C 1G8FA 1N0UA 3E70C 2KI5A 5EXXA 3HU3A 4UKDA 1ZM4A 4MRSA 1SVOA 1X86B 1NMYA 4LWZA 3VU9B 3ASYA 1RRFA 5EUQB 3IBYA 5BYKA 3S1AA 3W3ZB 4ZKEA 2CL6X 3T1TA 1M2OB 4AC9A 4QGGA 1AK2A 3G0HA 1R0YA 2AFHE 1QZXA 1YZQA 1NRJB 3Q7PA 4XTRA 1EFUA 4ARZA 3GLIE 4QL3A 1WF3A 4IOKA 3ZLJA 5AWFC 2VBCA 3TR0A 3FE2A 2XXAB 4A0RA 4OI0A 2ZRNA 2FJUA 4C2TA 821PA 1KNQA 3DO6A 2EQBA 5JS8A 2ONJA 3X1XA 4FINA 3O8CA 5LD2B 2VRWA 3JZMA 4M1SA 4Z8YA 5TV2A 3T15A 1Y3AA 1ZUHA 1T3HA 2JCSA 1QG4A 2UZIR 3QJYA 3TGPA 1NP6A 2NG1A 4HDOB 4JKIA 4IFEA 4KO8A 4EIWA 1NIJA 2DCUA 3Q7QA 1TTTA 1JQLB 4PO1A 3NBXX 2F1JA 3E5HA 3T61A 1YZKA 3H86A 1GKYA 3EA0A 5H70A 1ANKA 4BLOA 3OZXA 1G6HA 1SXJD 2RCNA 4ILEA 3CH4B 4HZUB 2W2TA 3FB4A 4NYJR 5KUTA 1Q1EA 3EWSA 3EC1A 4GZLA 3Q72A 2A5JA 4PC6A 2AXNA 3GLIB 2GEDA 5FPYA 1W1WA 2HXYA 1DG1G 2IYQA 1NVXQ 4V0NA 1WB9A 3R8CA 5AUPB 2P2LA 1KO4A 2Q3FA 5DN6D 1E2QA 1NLZA 4F7WA 1TAGA 1W0KD 3GFTA 2QPTA 2JATA 2HDNB 2VSOA 4G5QA 4EPXA 1OFUX 3CW2A 1RW4A 1WRBA 4GOXA 4BZPA 2YV5A 3P26A 4ZKDA 4Q01A 1E99A 2VF8A 4MGIR 1TF5A 3KKNA 5CYOA 2Q9CA 2ANCA 2ZRDA 3WY9A 1OXXK 4NMMA 3FGNA 4AIIA 2A5FA 2V54A 2IK8A 4I4LA 4Q1BA 2VHJA 1U8ZA 4MUBA 3LXRA 2C03A 3FKSA 1XMJA 2ZJYA 2PCJA 5HE8A 3I62A 3M1IA 4Q7KA 1XWIA 2GA8A 5F9FA 1RIFA 4P4UA 4GPTA 4DZZA 2R6AA 3U7FB 3EPLA 4LJ7A 3LLMA 1OJLA 1RPZA 1H8HA 1GNPA 3QF4A 3BIFA 1V5WA 1E3MA 3LH5A 3CPHA 1AJEA 4MYHA 2WSSA 3B82A 5IK2A 5FPTA 2PBRA 2G3YA 4LGMA 2QPAA 6Q21A 4NDZA 1AS3A 1OFTA 1FMJA 3OEHD 3QEJA 3SC3A 4B2PA 1E2LA 1ZD8A 2MMGA 5D3MB 3DMDA 4JLBA 4X8LA 1K6MA 4N1AA 2JJ1A 3A1UA 4RKEA 1P2TA 4Y0VA 4BFUA 1SGWA 1MOZA 1JNYA 3EZFA 2VYFA 3KXKA 3QOFA 2KBEA 1F60A 3B5JA 1JR6A 4BUJA 4Z1MA 2AD5A 3TSZA 2KB0A 1VPLA 5C18A 1F2UB 4LRWA 2PX0A 4Q1EA 1QHHB 4D4MA 1IONA 2JJ2D 4NE2A 2P0EA 2ZR7A 1G7TA 4D0GA 1AS2A 4LJ6A 1U2RA 2R65A 4MGYR 1E96A 2FFHA 4OHVA 3DMNA 1NBME 4Q02A 1VKJA 1TUEA 1R2QA 1GL7A 3IILA 1Z8FA 3QPUA 2OO7A 4XVQA 2D3WA 5SZKB 3CIOA 4OI1A 3UKDA 1CBUA 2FA9A 4US1R 1R0XA 1XJ0A 2JDID 1Q20A 4PSKA 1XCMA 3EPKA 4A8JC 1LS1A 2GJKA 2P67A 4BLQA 3VU9A 2BJWA 3U44B 1G5RA 1QVAA 1SULA 3BERA 4FCTA 3AVWA 2PMKA 2XTMA 3CRRA 4DXAA 4DIDA 3PXGA 1Z5ZA 4JBYA 1KOFA 4POAA 5C2JB 2C77A 1N5JA 3IO3A 4A9AA 1K5DA 3EZ9A 2AN9A 3W34A 1IOZA 4PFSA 1EESA 1R0ZA 5FFMA 3VAAA 1GRRA 1W47A 4A8JB 4HAWA 1VCOA 1ZIPA 2PEZA 1AN0A 5H68A 1W7AA 1UEIA 3ZGXA 4Q9KA 2JIZD 3R20A 2ZS7A 4P3YA 3LV8A 4B44A 2Q3MA 2BBWA 3Q5EA 3UG6A 5EE9A 1ZM2A 4V0LA 2XNDD 2O8EB 3TW8B 1UBFA 1P3JA 2FU5C 2J5XA 3AF3A 4HLQB 2ZI4A 4KV9A 4A1FA 5IF9A 2DBYA 4NCKA 2FH5B 3LX5A 4Q9HA 2PZFA 5TB5A 5TY0A 2WZQA 1P9WA 4JZKA 4OQLA 1KK1A 1TADA 3A4LA 3AVOA 4ZPXA 2YZ2A 5FUWA 3W5JA 1CJTC 1WMSA 2HLDA 2X19A 3KQUA 1CRQA 2UKDA 2YVUA 4HAXA 1FP7A 2J41A 1A82A 4R2IA 2QQ0A 3CUEF 3OESA 4BPBA 2W00A 1L7VC 3GLIA 5BW8A 3B13B 4OHZA 1T8TA 3LQRA 4DLYA 4P32A 5E7MA 2R6GA 2GEUA 2GILA 4QGAA 2ZTSA 4GOKA 3PEUA 4WOPA 2QRNA 4ESHA 3MFYA 4GP6A 1XPOA 2VP5A 4C2UA 2RHMA 4D4KA 4I1VA 1FQJA 1J70A 1JECA 1NVUQ 2CMKA 1J7KA 1AGRA 3SJCA 2EFEB 3RS5A 3AVXA 2J87A 2V4ZA 2WKPA 3EPJA 3GEIA 3MUFA 1R4AA 3NBYC 2C99A 3U7EB 5EJEA 2IS1A 2OZEA 3BH7A 3F0TA 2BKUA 4PSAA 1MABA 4GSYA 3NG1A 2C78A 4Q9IA 4B34A 3AF1A 2PX3A 1G8YA 1KSJA 4TMVA 2W2XA 2W58A 2ZXUA 1E9RA 2BM1A 2VP9A 3FYHA 3EC2A 3VKHA 3CONA 2XB4A 4CT5A 1DADA 3HP1A 2O8FB 3CRW1 4QJ4A 2Q9BA 4TYYA 4JSTA 3DOFA 4ZCLA 2IYVA 4CGZA 1U9IC 1J2JA 1YVDA 2C98A 2FPLA 2ZJBA 3N70A 3WYFA 2IXEA 4B71A 4ZIRB 4MRRA 1Z6XA 2ZRGA 4NBSA 4I81A 3BOSA 4V02A 1XPRA 3FMFA 2ATVA 5FBLB 1ZYUA 1TUIA 1NKTA 1E9DA 2N42A 1NG9A 5EE1A 1CJVC 4IKEA 1IM2A 1KTVA 2B21A 3OHMA 5D3MA 3THWB 4PO8A 3ICQB 1Q0UA 2BIFA 1YE8A 4CDGA 4F38A 1XEWX 5LPNA 3AB3A 3B9QA 1OB2A 3F3YA 3KKOA 1CR0A 1NMZA 5G40A 2RGDA 4IVQA 2GAAA 3V9PA 1F6BA 2QUZA 2YJTD 4AURA 2VPPA 1AM4D 4GDFA 1F2UA 5JEDA 2BCJQ 4U02A 1P73A 4EFNA 1QHHA 1ZNWA 4HLUC 3SJAA 4QM6A 1E2KA 2IS6A 1XEXB 2HUPA 4HLDA 1IN6A 1QBKC 2I3BA 4YMVA 1JEEA 1KJZA 4IXNA 1OYWA 3EASA 2CBZA 2V8OA 1PUIA 3M0EA 5B64A 4DB2A 2VHQA 3UMRA 4US2R 5KU1A 3L0PA 3CRQA 5CDFE 1DEKA 1JB1A 2LKDA 4KFSA 4MRNA 1JALA 1X8LA 1BH2A 3B9PA 1EK0A 4DCUA 1G21E 421PA 2PJRA 1SXJC 4F4IA 5DLQC 4DLZA 1DBSA 1T9HA 2IUTA 4XWKA 3PVSA 4ZV4A 1KK3A 3Q5DA 4JLJA 2J7PD 4A92A 3I32A 3U44A 2GZAA 1YKSA 3NVAA 3EPHA 1OT3A 1S8FA 4HAVA 2PT7A 3TAHA 3OE7D 1W36B 3U3OA 1N6KA 1P9RA 5AJXA 4Q48A 3CNOA 1MT0A 1SXJB 3FWYA 1XPUA 1FX0B 1KDPA 4HLCA 3T5DA 2W6JD 1W5SA 3GCGA 4WW0A 2WPDD 4AKGA 1NBMA 4LJAA 1RZ3A 1AQUA 1ZAKA 4NKRA 4OJKA 5JWHA 4C3ZA 4DWJA 4ZI2A 1GL9B 1R5BA 1E94E 2O8EA 3HPQA 4IHQA 3GPLA 2J45A 2C2HA 5G3ZA 4NU0A 4E07A 1NY6A 5EUMA 3QI2A 1ZW6A 2HCJB 1RRCA 2F9LA 2OXRA 1D2MA 1YR6A 4FIDA 2H16A 2JLRA 4U7DA 2QPOA 1NMXA 4HEJA 4TT3A 2GJAA 4URUR 2IBMA 2AXPA 2D4HA 2XTNA 1HURA 1ZNZA 1E0KA 4NYIR 3HYRA 2ZROA 1XTJA 1U90A 3K0CC 4FXPA 1D5CA 3LLUA 2OM2A 1A4RA 1J8MF 721PA 2QTFA 5FTNA 3DVLA 4QNMA 1DELA 3I72A 5B57C 1PLKA 3UG7A 4EPYA 4DSNA 4UXIA 4DDUA 5FBVB 3IQXA 2QAGC 1ZNXA 4A0HA 1CF4A 4KU4A 2F9MA 2V1UA 1E6CA 4V0MA 1E79A 2WKQA 3DEFA 5TARA 3GJ4A 2AX4A 1TEXA 1F2TB 5B58C 4OI2A 1O3YA 2VQSA 4LHZA 3M4YA 4M9QA 3HJNA 4XWOA 1R0WA 5DO9A 4YXWD 3KJIA 3SE0A 3ZVLA 4OBEA 2QU8A 4WA7A 2GJSA 5KDOA 1NF3A 1DVRA 2FF7A 4MRPA 5EXPA 4KODA 1QF9A 4TLCA 4EDHA 2ZRBA 4P0TA 2AHOA 5L3QB 2GCPA 3VHLB 4A15A 2O0HA 5KNCA 3K70B 3U2QA 4ZDKA 2O8FA 2ZE8A 1XTIA 1M1YE 4L15A 3FOZA 2QGNA 2WWWA 1I2MA 2GCNA 2FDCA 3NH6A 5HZKA 1Q1BA 5JCPA 3GLFB 3GJ5A 2XGJA 4ZIRA 5DH9A 2QE7A 2OLJA 4MKHA 2ZS9A 3E2IA 1ZINA 2ORVA 4IVPA 2F55A 1S1MA 3KKPA 4A6PA 4XVRA 1R5NA 2QA5A 4WZAE 4LHYA 3WMFA 4HI0E 2A5DA 3VX3A 4BFZA 1U8YA 4CEHA 3OAAD 4JYBA 5IHPA 3B60A 2ZR0A 4LYFA 2EFGA 2VP0A 4O25A 2JGNA 2H7VA 1S3GA 1KMHB 4OL0A 1AGPA 1IY2A 3U7HB 2V9PA 4Q4HB 1XEXA 4G5GA 4QBFA 1BYIA 4RZUA 4XWAA 1LB1B 3QXSA 2B8WA 2G1KA 3LBIA 3SBEA 4BGDA 1E2MA 3IEVA 4O3MA 4LJ5A 3UK6A 4G01B 1RE0A 4UQOA 2YC4C 3C7KA 1A1VA 1KGDA 2QI9C 1O87A 3P20A 4FI3C 4IOJA 3B85A 4NCNA 4TMXA 4JLDA 3RS7A 1Z0FA 1HQCA 5IRCD 1N6HA 1EFCA 2PZGA 1V43A 5FR2A 1FTNA 1KSHA 3TBKA 3A36A 2IWRA 5ELXA 3ICEA 1FFHA 5CJPA 1UBEA 4HLUA 3SEAA 4UJ3A 2ZAOA 5J4VA 1KO1A 3ZDQA 5J4HA 3ADDA 2GCOB 3KB2A 2EFHB 1OH8A 3VR1A 5CYPA 1N6IA 3QKSB 2NO9A 1X6VA 5BN5A 3GJ8A 1NSTA 3PCRB 5FOSA 1HUQA 1JR3E 1GG2A 3GLHB 4M1TA 2QSYA 3HR7A 3L0SA 4Q4AB 3MWYW 1KKMA 1KZ7B 2W83A 4A2PA 2J0QA 4RFSB 5CITA 1QG2A 2ZRHA 4HDQB 4PZYA 5FR1A 2O8BA 4RD4A 4LJYA 5KSZA 2ANBA 5GVRA 4XSHA 4PTLA 4P4SB 3CR8A 5KTYA 1FX0A 2FN4A 4OHYA 1OIXA 4Q7MB 4OK3A 1BIFA 4NZYA 2ZAMA 4RZXA 4ZDIA 2IYUA 2WIBA 1UEJA 1Z83A 3T1QA 5JJIA 2F1IA 2BEKA 3FFBA 1RYFA 2BHRA 2IT1A 1ZM7A 2D06A 2P6RA 5CDFA 1BMFA 1W2HA 1P2VA 4N3NA 4JMPA 2PEYA 3AF4A 4MKIA 1ZU5A 2B8TA 1G7CA 1K8RA 5EE5B 3SFZA 1VG1A 4A2WA 3ADCA 1B23P 1WCV1 1Z6AA 4PPQA 3CF2A 2ZI6A 2JA1A 1IXSB 4XD7D 2IF2A 2DWOA 1VTKA 2WWYA 4LYHA 3P4YA 4P4TA 4PAOA 4D6PA 1VCNA 3WHLA 5H8WA 2BC9A 3KTAA 3NEYA 1AA9A 3ZZTA 2WOOA 1J8YF 1WQ1R 2V1XA 2BM0A 3OIYA 5DISB 4C0KA 4GMDA 2FOLA 4LDJA 3AVYA 4RCYA 4FCVA 2MMCA 3A58B 4X8HA 3VR4A 5KPJA 2VIIA 5A4JA 1E2IA 2Q0HA 5KO2A 2VEDA 3UWKA 2YWHA 3ZH9B 3I61A 4ACAA 4URWR 3CRMA 4KFRA 3VMFA 4FMCF 2FFAA 3U60B 4FMCB 5DHFA 1PJRA 3N2EA 5JSZB 4ITRC 2QBYB 2W6ID 1M8PA 2A30A 1OH5A 3RNLA 4JVLA 2R62A 4B3CA 2RMKA 2ODWA 4XTCS 4TLEA 3HR8A 1D9XA 1UKVY 3AVVA 4OYHA 1OHHA 4JLVA 3C5CA 2IC5A 4D82A 3B1YA 4W5WA 1IHUA 4Q1CA 2J1LA 2DFNA 3PEVA 1WXQA 4XJXA 4A0GA 1E4YA 3T5GA 4TMKA 4J0QA 4GOJA 3L43A 2CNWD 1G3QA 2ZM5A 2ORIA 1TNDA 1CR1A 1XX6A 1E32A 1UDXA 3ZYCA 5FBQB 2L0XA 5JMTA 4DCTA 1DAIA 5L3QA 2WSMA 4MYUA 2REBA 3WXMA 1KK2A 3TAUA 2QAJA 2QTVB 4BWYA 1ESMA 1OF1A 1DE0A 5C46F 4DBLC 2AKYA 4C0JA 3DZDA 5DI9A 4H1VA 4DDTA 3LBHA 4JKYA 3C5HA 2YWFA 3ZJYA 1XRJA 4RY2A 3R7WA 3IGFA 5FPKA 3QSYA 2GRJA 1DO2A 1YR9A 2QROA 1GKUB 2P6NA 2GXQA 3R9IA 2ERYA 1Y63A 1PLJA 2G88A 1Z29A 1Q12A 2O0KA 4M53A 2A5YB 1GRNA 4JT4A 3D7MA 4XOIA 1DARA 1P7CA 1E9CA 2UVQA 2ZRJA 5JWRA 4KVGA 3WNCA 4MGZR 3SYNA 3OFNA 5CK5A 1EFRA 1KMHA 1N2CE 5ANRB 5EXTA 3RWMB 1NJFA
chains in the Genus database with same CATH superfamily
3ETDA 2OAP1 5FOVA 1T2UA 3CKLA 3CN7A 4TRMA 3UW1A 1QKJA 1CVRA 4BU1A 2GS9A 3TO5A 4BDTA 3STWA 3QXGA 3OQJA 3R2JA 2FWRA 2QVZX 2WHPB 4I19A 3QPVA 3NH9A 5CFRA 2CW5A 1NZJA 4ZD6A 3W1EA 1CFJA 3HEBA 3NJ8A 3OTIA 5I7AA 3W77A 1T4CB 2JG3A 1KJQA 2R8BA 1C0IA 1JH8A 1ODIA 1YDGA 4I9NA 4KK4A 2HXGA 1AQIA 1M8FA 1WDWB 2VPWA 4Q7QA 2Q5QA 3MA0A 1IJEA 4XGIA 4Z6KA 3DZHA 1S96A 1ZOPA 2HRBA 4S24A 2CYAA 5EWJA 1WY7A 4OCZA 4AD8A 4CKWA 3FOEC 3TPCA 2NPIA 2JBAB 4DV5B 2GCOA 1PL0A 3L0DA 1DJLA 1LI7A 2GO1A 4WN3A 2HD4A 2WWXA 1JHRA 3U0VA 3N8GA 4YJHA 2Q4RA 2O3SA 2OFOA 3VM6A 2G9RA 2HU2A 2WF8A 2WTNA 2FCAA 4KRGA 1ZM3A 4B3BA 1ZN9A 4RVSA 2J32A 4B46A 4BB5A 2CCJA 3V1LA 1NNUA 1OKKA 2PLNA 3AI7A 5BYAA 4RWZA 5AW7A 5CIWA 5EQTA 3I53A 1YC2A 3TPFA 1UKEA 3G2MA 1Z6GA 2O0JA 5HZMA 4DJDC 1T2NA 2Y05A 4Z51A 3K1TA 5EWMA 4KMOA 1ZK2A 1ZJWA 4PFJA 1I3KA 1C0PA 2F7SA 3TTTA 5MF6A 1GGKA 4KLNA 3EE6A 4Y9RA 1NVVQ 4YP9A 1Q3TA 3RIHA 5H4GA 2V3VA 1YQ9A 4PHHA 4YMIA 1SXIA 2UXDB 5DLDA 5EEHA 3FZEA 3N8NA 3FSEA 2XHEA 4WXPA 1JVBA 1GUFA 1VE6A 3HA7A 1GAJA 4N18A 3NETA 3KVNA 2PWBA 5AVQA 4ACBA 4C2BA 4RQAA 5IKXA 3F98A 4WD3A 1B41A 4AY2A 2BFBA 4L9SA 4RDHA 2WUEA 2ZBRA 3EVFA 4IUBS 4YMHA 2LV8A 1DO0A 3LGXA 3SYRA 1E2JA 3QIAA 1GPUA 3TM5A 3TL3A 3LKVA 2CBGA 2PPLA 2BUBA 1S02A 4BQSA 3W1VA 1YK1A 4OLHA 1RRGA 1M2EA 2C2XA 1L5WA 3S2SA 2FCRA 4WEQA 1D0SA 2ZDQA 2HBRA 4MMYB 1UFRA 4UAUA 3ZS8A 1DWQA 2DSTA 1L5OA 2GUWA 2OGWA 3MD0A 3QKRB 4IXDA 4KHZA 4O2LA 1OGIA 4G5YA 1PVOA 2H54A 3OA2A 3RFXA 3HWSA 4DMGA 1QAMA 2RH9B 1OBCA 4LV5B 3OO0A 2YZ7A 2OBLA 1E3WB 3M89A 2LKCA 4YJ2F 1J42A 2GAOA 1OX6A 5CXXA 2JAPA 3ROFA 2WDZA 6ABPA 3ZNPA 3Q2OA 4WIAA 4II2A 5G02A 2CHVA 3V7WA 3N2GA 1C8BA 1QP8A 1V2GA 3GFRA 3LE8A 5DBGA 3KWMA 1U5BA 1JL3A 3FMPB 3HGQA 2C83A 2N1BA 2HF2A 2NSHA 3CFYA 3C45A 4ZP1A 4DCVA 4ZVRA 3CEAA 2C3MA 3WYGA 1JDUA 1N2HA 1LDYA 2JFBA 3COVA 1XI2A 4R8SA 1SKAA 2HT6A 1T8WA 1EDZA 1N2ZA 2JD0A 1M0WA 5FBWB 3SDBA 5D85A 1CDEA 1NUSA 4M87A 4DSUA 3CN9A 3JWGA 5KX5B 1Q0RA 2WM2A 2ZBVA 3B1ZA 1BFKA 1C9KA 3RRJA 3ZK8A 1MV8A 1PJSA 4RAQA 3WL4A 1H4TA 1JKXA 2A57A 3V33A 3GGJA 2Z2KA 4L5JA 4U4AA 4N76A 3E7WA 3GIDA 1WCXA 4HNQA 1V4NA 3GEGA 1UMCA 4IGKA 5JW6A 5KQPA 2B4YA 1MH9A 3IDAA 4J1NA 3GLQA 4J3JA 1VJDA 2QTVA 3U81A 3UC5A 3FCAA 1UIMA 3KKEA 1NQUA 3D6VA 1W6UA 4PANA 2C5GA 1DBVO 1NN0A 2NPFA 3H2SA 4E1VA 3RS0A 3UAZA 3KAKA 3EFOB 3RCBA 4NZOA 3JQ8A 1XTTA 1ADCA 3F6PA 4H2DA 4Y1EA 5HDQA 3QPWA 4OAOA 2QYSA 3L0IB 5ALRA 4DPKA 5HRCA 3L9WA 1B1CA 2Z5GA 3LA8A 3GXBA 2G6TA 2QTCA 1NNEA 5A9RA 4ZALA 4G9BA 5EL0A 5J23A 5F33A 3QVUA 5ADUS 1G17A 4NABA 3VOAA 1UBUS 5HKKA 3W0LB 5JRJA 3GQBA 3G82C 4OP3A 4D4IA 4ZDJA 1R16A 4GFDA 4LGCA 5TQVA 5A1JA 3ECCA 3DQQA 3EUFA 3PDIB 1YL5A 1B43A 4K9MA 4Z4CA 1H2YA 2P11A 4K6CA 4AQDA 4ZO6A 1V6CA 1QRSA 4P86A 2A35A 4KQMA 1WG8A 4BCDA 4PHGA 2PKEA 2MSWA 2PUHA 3HDJA 4AJ9A 4N40A 3HB7A 2P9YA 5TPWB 2R7KA 4ARSA 1HNXB 2GXAA 3GZ4A 4MRMA 4GP7A 1FYWA 1NXVA 4HZUA 5DM1A 5LZ8A 3ZUPA 3ZHSA 3OQMA 2GN6A 4DV6B 1NLYA 4FJ0A 1QGDA 3OEYA 3VR6A 3R0VA 2AMJA 1Z6QA 5GY7A 4PZPA 2RH8A 2WU8A 4C0AC 3UV7A 5BWBA 1T4CA 3QOWA 3TE6A 3ACBA 4MVJF 4OQXA 1A88A 4MLCA 1PDOA 2OT3B 3ANLA 2O4CA 5HVNA 4I5GA 4BFCA 2XQFA 3LX8A 1W0JA 1NF9A 2TMKA 3RS7A 3W04A 1JFRA 1YU9A 2APJA 1MB3A 5TEWA 1T0PA 2XXBA 3OIVA 3IIEA 4HEA6 4W6ZA 1JDVA 4MRVA 2PNFA 3M49A 3QBEA 4YCJA 5DDIP 5H0IA 4NEQA 1DPGA 4HS4A 3RYTC 1CRZA 1GWNA 3AV0B 4LY9A 1FL9A 3USCS 4B6EA 5LU8A 2JBAA 2VTBB 3NDIA 2QD1A 4QIHA 1E1QA 2RAVA 2QTRA 4I9UA 4YCNA 2Z30A 4GPAA 1IQPA 4L22A 2PA3A 4EW3A 3RC8A 2QSZA 3I2YX 1H9CA 1KK0A 2P2ZA 1GDHA 3RSHA 1C3EA 2ATEA 2O3QA 4LE0A 3SDZA 4MYSA 1E9SA 3I2KA 3NDBB 4AY3A 1FFBA 2H92A 3THOA 1H8HD 2IHKA 1EUZA 4TTIA 5ALUA 2PBFA 3BCRA 4XSVA 3HP4A 3ORRA 2DWPA 3BWDD 4FD3A 3FTEA 4DN6A 5HK9A 1AGYA 2Q4TA 5DXJA 3VBEA 2FSHA 4BV8A 5BV0A 1PZNA 1E2GA 1MQ8B 3AEZA 4LMRA 4Q47A 4TTQA 1OX4B 2H5EA 2VYVD 1II9A 5AM1A 1AURA 1JEQB 1LPBB 1J25A 2GBLC 3NIDB 2OGTA 5H3HA 3QX3A 3B52X 3NI2A 4JJAA 1XZ8A 4EK9A 4Z54A 3H2BA 4QRHA 3TW0A 3EXIB 4FLEA 2YFYA 4H9GA 4P8RA 4K86A 4QYTA 4GWGA 3SKVA 3A2MA 3HDGA 5TQ0B 4LC1A 4Y2SA 5DK6A 2HHCA 1HE1C 3VHRA 2YMMA 3ADBA 4OIFA 3LUCA 3AP3A 1S3SA 4RZ3A 2CD9A 3PUZA 2OESA 1K86A 1YONA 2G9UA 2J9ZB 2OVFA 4MUJA 4RHYA 1YIDA 1JTVA 1W87A 3IURA 1J22A 4R9SA 2H2HA 4X3CA 4BQPA 3IDFA 4MARA 3TLXA 4XM0A 2EJUA 4O63O 3ONWA 3QKRA 2XUZA 1OGYA 1YFKA 4KG7A 3GJRA 3A4VA 1F8UA 3M3DA 3JVIA 1V5EA 2OV3A 1SD5A 1W5BA 1L6RA 1WSAA 3NHJA 1RYEA 1KYVA 1L8AA 1XLWA 1TJ5A 2X5XA 4HAYA 4K2AA 5DMHA 4NCIA 1IM8A 5EJ4A 3NVDA 1ZJ6A 1TEVA 4HXGA 4OD0A 1Z3IX 1R18A 1H6DA 2AYYA 2IVFA 1OU4A 4MWOA 4DWVA 4IP0A 3OETA 4KNVA 2YC2C 1A9OA 2GERA 1IB0A 2YHUA 3AM3A 2AOUA 1DOHA 3SS8A 1LFDB 2C31A 4E0BA 5CA0F 4TOIA 3WKEA 3DTVA 1G2OA 2IDKA 4WMLA 4W9MC 3F3KA 2FNAA 3BREA 2C0CA 1TJ4A 4BZWA 5ULLA 3KJZA 2DWCA 2HLPA 2GB4A 1P9NA 2YXEA 3ZC3A 4ARVA 4FHDA 3IERA 3HO8A 3AEYA 2XSZA 3E61A 3HCEA 5KX5A 1QOPB 4FS8A 3LRPA 2AW3A 1SC9A 3E9CA 3M5CA 2WU4A 3A4YA 4JFRA 1Z5GA 3UH0A 2EQ5A 3BZWA 1II8B 3ILSA 3UXHA 2C96A 4C29A 1ZOSA 1ZZEA 3AUXA 4OMUA 1MUUA 3RHSA 4ED9A 1RABA 2VVTA 4WXYB 3UMVA 4YCAA 3ZV4A 5FO1A 3UAXA 4JJZA 4IL5A 3LOPA 4DEXA 5KC9A 1SG6A 3C3CA 3IIMA 1KVUA 3LD9A 4LVNA 3RK0A 2F3TA 1XZQA 1XU9A 3RDPA 2OMKA 3A3KA 3W9YA 1C3XA 3DLIA 4X1IB 1QX4A 1VBMA 4A8JA 3PHLA 3EFOA 3HB4X 3TK1A 4KXNA 5G4LA 3P0EA 3QNMA 1F3LA 2P6PA 1ZGZA 2CF5A 4B4OA 4JAVC 2B6NA 3V8RA 4EF5A 3IDQA 4GR4A 4RHTA 2QVCA 5DX0A 1BS1A 1CKEA 2QRZA 3TW8A 2YBEA 2L42A 4Q3LA 2Q7XA 3PNVA 4GBMA 3W6PA 2I1WA 2PSFA 1TC2A 3R5KA 1V8BA 1JHUA 1YZUA 2OAGA 1Z07A 1KR5A 1YQDA 2I4NA 2JFPA 1Y1QA 3FVVA 1PS0A 4OKNA 4V24A 1Y8AA 4DV2B 1CZKA 2YVAA 1N5OX 4XE5A 1I01A 1ZHOA 4EKDA 4ERNA 3HCOA 4NYMR 1SVWA 1KJYA 2A4MA 5DBOA 1U1DA 3IVAA 1YU6A 1MC1A 4D26A 2IEZA 5TPWA 5B7PA 3MCTA 3IJEB 3JQDA 3QXJA 5B1DA 4BUCA 1KQFA 4W9NA 2F8SA 2Z9BA 2REQA 1TCBA 3N2KA 4GI5A 4YO8A 4BNUA 1AKWA 4LRQA 2BZGA 4YJGB 5C1BA 3E3OA 1QRTA 2ZZMA 4TYWA 1KH3A 4CM5A 2FN8A 2CHFA 1XQVA 3QMMA 4YRDA 4FOPA 4X7RA 3IO5A 4DLVA 5EJ6A 2V3CC 2VC2B 1DI0A 1VHTA 2GEJA 1A2BA 4OU4A 2ZK7A 2FMXA 4BJ3A 3BDIA 4GMGA 4EYSA 1IXZA 1SU6A 1M6VB 4DCJA 5AXCA 3QEOA 3ZJ4A 3DR5A 2X77A 3G5AA 4DC1A 2QTWB 3CF4A 3CUSA 3KKKA 1HI9A 1RADA 4WPGA 2VTBA 2QLTA 3GK3A 3FFTA 4KH1A 3HY6A 4CR6A 1Y6RA 3ZVMA 1ESEA 4RK0A 2UZ1B 2I66A 1J8FA 5JZMA 1Z63A 1I36A 1Y4DE 5CVVA 2YYZA 3FPKA 1TZ2A 2B0JA 4GEGA 4CLRB 1GA6A 1BVRA 1R8QA 2PMDA 2LDXA 1Z35A 4IWXA 3IMGA 5EIBD 1CW2B 2WV9A 2YASA 4ZANA 6LDHA 1ZKMA 1YI0A 4GVLA 2IHNA 3PPXA 2QAGB 3PLNA 4IS2A 4NAUA 3KKQA 5I9SA 3ROTA 1A4XA 4KQJA 2QF7A 4P3PA 4QNNA 1E1CB 4V2UA 3F6RA 2OCAA 2NZ8A 2X0DA 3THSA 3T3EA 4B76A 4L85A 2DUMA 1QFZA 3HCBA 3OX3A 3WE7A 1A8IA 4KPEC 2J9GA 3UYLA 1XZLA 2ZT5A 1KDVA 4MTLA 5IFLA 2DLDA 2DWUA 2A33A 1RYYA 4WKOA 4TQAA 1JEQA 1U94A 2L2QA 4ZVSA 5THQA 3VPXA 2IGTA 1DJQA 3HUEA 3IAHA 1W49A 2Z98A 2PGOA 1I10A 1YZNA 4RHCA 3PFIA 2HBZA 3KOOA 2JVKA 4RHEA 3I9KA 1QQBA 4Q39A 1Z7GA 5KSOA 3BL6A 4ZICA 3O0DA 3ZHQA 3JSAA 3PXDA 1OYOA 2GCIA 3BE6A 4GPBA 2JARA 2YJ6A 4ZV9A 1M5TA 1MORA 1I7DA 3CLUD 3RAEC 1JQJC 3MCZA 2DFPA 4I8IA 4EY7A 3NEPX 3FVQA 4JLPA 5JFGA 2BWJA 4GIBA 1MOSA 5CLJA 5HRUA 1DC6A 3TCKA 1XCOA 3MHTA 1JHMA 1VPEA 2Q1XA 3ANMA 4XDZA 3ELUA 4Y3UA 1U9IA 2PAFA 3VVMA 4B6GA 1Z16A 3Q4GA 3ZDFA 4NJMA 4C06A 4FMDF 3R24A 1FNBA 1A2KC 3VTAA 3D7SA 2KS6A 1TM7E 4U9UA 3JQFA 3ZNNA 1PR5A 4LE2A 4M36A 2F17A 1M34E 2C2BA 4BE4A 1IJBA 1Y48E 3V97A 4PHTA 1MJGM 3MAJA 3ORSA 2C8JA 4M1OA 1J23A 4FMBB 1ZSVA 4IJQA 1XKLA 1QCYA 1RACA 2IH2A 1PX2A 1JA9A 2AQHA 1XTVA 4R6WA 1YRBA 3NGMA 3LFUA 3QLJA 5K51A 4IJUA 3VPCA 4E2WA 4JCCA 3L1UA 1L5KA 3D3WA 4A6XA 3IT1A 3LY8A 4HFMA 1QFSA 2RI6A 1R0RE 2ASEA 2KSQA 2J9XB 3AKEA 4K9RA 4N0EA 2RK3A 3ET4A 4P9NA 3R76A 1I7PA 2X6TA 3LI2A 4ER6A 3PJFA 4FZJA 5K8LA 1NMEA 1Z22A 3DPSA 4EEKA 2E1RA 3SNKA 1V6SA 4JSYA 4ZJYA 2J31A 3PQ4A 5AM0A 2H7CA 1FXWA 3RTEA 5B30A 1KI9A 4QLOA 2GBGA 3FNEA 1MW9X 5JUWA 2WE8A 1K7XB 2OP1A 4WX2B 4ZZ3A 2PAAA 3LA6A 4B4KA 1K8XB 2H1SA 1L7AA 1ZUIA 4QQNA 1II8A 1CERA 2PS9A 1KHTA 4B09A 4S2EA 4X6XA 4O6VA 3MBOA 3V8VA 1ZA1A 3AL0C 1NBMD 4QFMA 2QR3A 5IUKC 1U2QA 1XKTA 2PUTA 1M34B 1A5BB 4FFPA 3ZGVA 2QT0A 5AKHA 4LYAA 4L7VA 1DXHA 2QN8A 1USGA 5GZ3A 4E12A 4Z9FA 4ZCTA 1N0WA 1GM5A 4NFHA 1PL6A 3T9DA 4B5KA 1Y6GA 3HLKA 2BDUA 3AGQA 4NX2A 1BFUA 1EZ1A 1S2NA 1P17A 4OTZA 3UBMA 1OZFA 4TWAA 1U04A 3L7LA 3BHNA 4ZI7A 2P9QA 3ZY4A 5FTKA 1ZD1A 2HMUA 1T9CA 5JBQA 1YJCA 3LKDA 3NALA 2P90A 1BD4A 5EJ7A 1MC5A 4Z86A 5ENDA 3P0RA 1NDHA 1SQSA 2VRNA 4G97A 4V38A 5JPDA 1C0KA 1PU2A 1ZR4A 3IT2A 3PC8C 3GYGA 4FEGA 1RVV1 2G9VA 4TWIA 2YHSA 1DU4A 1O58A 4IH4A 4JSRA 4CUJA 1PJCA 2FI1A 2WMNB 4JS0A 2F62A 2ZYWX 3WLSA 4EY4A 3R9WA 4TKMA 1T9BA 3FFAA 1QG0A 2ZEJA 3RROA 3T5BA 4DA8A 1QRUA 4LX8A 4Z9AA 2YJ5A 4ZOBA 3NHAA 2AE1A 2QN3A 2QZPA 1U0RA 2Y9PB 2JIQA 1P0QA 4NCAA 1YGPA 2PH3A 2W2MA 4E5VA 1UDAA 3FAKA 3RAJA 4B0PA 1DUSA 5CTJA 4EFMA 2ZUUA 1CB7A 1EGMB 4ENQA 3T7RA 3VR5A 4UNPA 5ALLA 1RC8A 5AFSA 5ELLA 1ZW1A 2HQBA 1INLA 1BOFA 1XZAA 5IARA 1M6VA 3HI4A 2CSUA 1KAOA 1XXHB 3EJWA 5ALEA 3AJRA 4K2HA 5HGXA 2C7RA 2GN2A 3IUEA 2AZTA 3AJ8A 2CNNA 2C9YA 5TS2A 1CY2A 4RLSA 2G9ZA 2II6A 4AKSA 3FR8A 4N03A 4CN8A 4R1LA 2VP3A 3TIGA 4PYKA 2V65A 3DP9A 1QOZA 3FZYA 3PDWA 4MEBA 5M3BA 4C7KA 1GFIA 1LDNA 2NV6A 3DH0A 3ANXA 2RK6A 3X1KA 4NXNB 1GGNA 2WMOB 1I0LA 1L5SA 3ASZA 4HXFB 1KOLA 1BE6A 4GGMX 4M46A 4ZAYA 5K0LA 4R05A 2DR0A 1MW8X 2HTEA 2QL6A 2QAGA 3G8YA 5D86A 2CL5A 3PI6A 5CVTA 1RE1A 2P9FA 3AFHA 4BLTA 1PFWA 3HB5X 1RRMA 4RU1A 4P7FA 3WK9A 3ON5A 1G4UR 1FU4A 1X2BA 4QBIA 5B2ZA 1HK7A 1OAAA 4IOLA 4XJSA 3PPIA 5F5NA 2R00A 3ESZA 1ULTA 2OFWA 2EZUA 3W5VA 1IN5A 3ML1A 4P3OA 2YY7A 4ZHQF 3IKVA 2X9QA 1CT9A 3WJ7A 4KQ6A 2BMVA 2JJ2A 2FPMA 2QD4A 4PRZA 1Y3HA 3M82A 4LY6A 3CB4A 4KYIB 4RGYA 5TMPA 3NC1C 2BY4A 4IDHA 4PQFA 4LFAB 1NLMA 1WDMA 3I39X 1O54A 1AB5A 1XZJA 1YHNA 4WXRA 3REOA 2O57A 2GHQA 2XUGA 4R31A 3RTAA 4M1EA 4Z0TA 3Q10A 4C0HA 5G1NA 3TXYA 1TRHA 2G6BA 5KJCA 3QYFA 4IQGA 3I12A 1KI7A 3ZX4A 4DLSA 3CSUA 4KO2S 2FR8A 3H6KA 5CAEB 1RLIA 3GY0A 1DAPA 4RSMA 2JB9A 4CIVA 2XA9A 3WGQA 1NUHA 2Z6AA 2OVBA 2D2IA 1I1QB 1OZ0A 3GAFA 3GMDA 1LI4A 5H82A 4ENSA 3KKMA 1LBIA 2O52A 3DMRA 2IITA 4KXXA 4OGKA 1K6JA 4Y2JA 1SKBA 1L7EA 3YASA 1E6UA 2GZ3A 3WDMA 4D96A 1JQAA 2A3NA 5B7NA 1O7JA 4MQBA 3PRKE 5L3ZA 3R74A 3W6UA 1U28A 2A1TR 2YN4A 4O5AA 1TF7A 3CNLA 2HEGA 2XGGA 1J0DA 3C6KA 3ZTWA 3DV9A 4B32A 1TYZA 2C4WA 4W5OA 3U4IA 1N5IA 1S2LA 3NORA 1IFXA 2FSVA 1NNSA 1PJAA 4BX0A 3UJCA 1K3TA 1WE2A 4CR8A 2AN1A 2VK8A 3D3QA 1WZIA 2DU8A 2VCYA 3FNBA 5AYVA 5L6LB 1ZP6A 3URKA 3D6TB 2AJTA 2OCPA 3ITNA 4IO1A 3RS3A 1W52X 1K06A 4MGKR 3ZCPA 4YT4A 4NE9A 4BZXA 2O8BA 2NT4A 1DOZA 2Q1SA 1G98A 2CXSA 3EQ7A 3GIWA 4ZO4A 1GU1A 1EP1B 2XH8A 2DOKA 5CW1A 2XNDA 3OFVA 4X63A 4C7MA 1JFTA 4K6KA 3CR7A 5A03A 3MJVA 2K6GA 2JZOA 1TTQB 2IYAA 5F3WB 3FYUC 3MS4A 1ZQ9A 3QKSA 2AFHB 3ABSB 1PNOA 2V4MA 2VLIA 3IQHX 3KZXA 1VLLA 3GG9A 4LEIA 5JJLA 1MFPA 2GWHA 2VSFA 1QVRA 3L82B 1HTWA 4OHUA 4Q4AA 1M34A 2XCUA 5SZHB 1NL3A 5I7WA 2PR7A 1BNCA 3UFXA 3IOEA 1KZ4A 2DFKB 3WHPA 1TTHA 1UP6A 5DI3B 1W73A 2EQAA 1TFUA 1A9SA 3UJPA 1LXCA 2DBZA 1KFJB 1T26A 1TM1E 5BV2P 3EODA 2VWHA 4DJEC 1ZONA 4WCFA 3TXAA 3WGTA 1ZCAA 1DUIA 1O4WA 5LB2A 1E3TA 4CTMA 5ECYA 2QORA 1S0UA 3IPYA 1WEKA 1PJ8A 5EIBC 4IO0A 1EFLA 2OFFA 5CEJA 2Z58A 3HBMA 1C1YA 1FYXA 3BD9A 3P27A 3I9LA 4HUQB 3GJ3A 1IZYA 1FUYB 4NV1A 2R47A 4NNJA 1S4MA 5DCYA 1NM5C 4R84A 2N9UA 4HBGA 4AYWA 2BR4A 5LIRA 3EZ2A 1Z6YA 2C9BA 1EVLA 1JPJA 2AK2A 2FMUA 1MABB 2Y6UA 3AHGA 4MUMA 3ZWYA 5EIXA 4KOEC 3AGPA 4MLPA 4MW2A 1MC4A 2X0JA 4G41A 1SBNE 4KAXA 1K68A 2J5RA 3WO0A 1GUDA 2JAQA 3FTNA 5SZIA 1JN0A 2EJVA 5JOQA 3ND8A 1JUDA 2H51A 2VHEA 2WIAA 2Q46A 1UFVA 3BGIA 2UYYA 2W6QA 3NWJA 1W29A 3PK0A 1W46A 4QYXA 3IP3A 2PJZA 4UEOA 3ZHVA 4XM2A 1RYHA 3BFPA 4BAZA 4CCYB 5JSUA 1Q2UA 5KOHB 3UK2A 1R9GA 4XW2A 3CLUC 4PPGA 1JFFB 5JAQA 1QU3A 2ODNA 4AO7A 3U1TA 1NU8A 1XXHA 4QFCA 3KL4A 1M2NA 2X0NA 4OB8A 3TSWA 4B84A 2WU3A 4KQKA 3K9FC 3QX7A 4MIEA 2A9VA 4Q9AA 3O3OB 4MHSA 3QVGA 2V8BA 2MU1A 3QELA 3R3HA 2VZLA 5FI3A 4V3CA 2DERA 2XVYA 1CUGA 4YPFA 1HLPA 1FQKA 3D4IA 2PT9A 3LJKA 3ABOB 3NWOA 3FF4A 3HVIA 4QYSA 1E9BA 3MAGA 2E4WA 3FUXA 4L4SA 5IM5A 4F3KA 2PD6A 2Y71A 1IZ9A 1M72A 1X94A 1TQ4A 2XMGA 3FX2A 3E58A 2DBRA 3ADOA 3GBVA 4O2AB 3UPUA 2H4FA 3IB6A 2PUGA 3ZN2A 3NZEA 4RV5A 1QRRA 3GRUA 4YRTA 3ZQKA 3BWXA 4BTVA 3TL2A 1KKUA 4B81A 5KJ1A 5I3CA 1QK5A 4AO6A 5I3ZA 4WNAA 1RM0A 2Z9DA 3IQFA 4CF4A 4I4TA 3AI3A 2G80A 4JQOA 4Q15A 5HMMA 4WA8A 1YB6A 1HDGO 1P6QA 1FRNA 1XD8A 3INYA 5CM8B 2I4OA 4U0JA 1ETHA 1W85B 1H2BA 1PG5A 3MGAA 1NGSA 3CLVA 1PFUA 2QP9X 4Q18A 3TKLA 5AOAA 2C9OA 3GMTA 3GAMA 3TNDA 2ZM6B 2AKAB 4RVOA 2HIGA 4M8IA 2BE9A 2WIKA 3ESQA 4ZK6A 2WG1A 5MFPA 3OFND 4UREA 1EFRD 2J3IA 3ZDEA 3FHCB 4LFBB 3KOUA 2CVFA 4AMGA 2RAPA 4EY6A 1DAKA 1MT3A 1GGJA 1N1MA 2NU6B 1P0CA 1Q44A 2I2WA 2JFWA 3KQMA 4YMWA 3H1TA 3ZD6A 1T29A 1YR8A 3H9UA 1DX9A 3PFKA 2C57A 2HCFA 3GVCA 4IJMA 5CB8A 1JFVA 4TZ0A 4AXXA 4G67A 1XF1A 2BMJA 3JVUA 4A0FA 1P2GA 1Z4PX 2NO1A 1VCHA 4WV3A 3RIEA 3S6JA 1YL7A 3ZVRA 4QZVA 1YQTA 5TLSA 3KWJA 2ZATA 2ERXA 4H7KA 3I5MA 1NAHA 5C5CA 2OBBA 4LHWA 4ZVOA 5JJ5A 2B99A 1EX6A 3I42A 2C54A 3IEKA 2OECA 1NVTA 4YRKA 5KWVA 4ER3A 1AQ6A 1DKRA 2C0PA 5ALXA 1OAKA 4IIBA 4P6VF 1PR6A 3ZV6A 4HCJA 3LQ4A 1EXMA 4OMFG 1W34A 1WD5A 1CC1S 2FFBA 2GOYA 1VJRA 3MGKA 3B1WA 3FD8A 1OKKD 4HGPA 4NCXA 5EE0A 3Q9NA 4DLNA 1HF3A 1SQGA 5IJAA 4QLAA 4DB4A 3BFKA 1GYRA 3UT0A 1MX1A 3A6DA 2WJIA 2LP4Y 1MEOA 5K4AA 4G1MB 1IC6A 3DWIA 1LTQA 2PZBA 2GK7A 3LZDA 4LDRA 3KEGA 1IOLA 1MO6A 3WOHA 4YGXB 1V25A 2YYYA 1EBUA 2YOGA 1NXWA 1GKIA 2X4DA 3AP2A 5EJGA 1Q0QA 3LRXA 3ND7A 3UJ6A 3D0KA 3W6NA 4TS4A 4DNXA 4OHWA 5JFOA 3NRCA 5DI3A 2Y77A 4NOKA 1K6IA 5JARA 4M9UA 4MS1B 5F5XA 1RQRA 2Z56A 2PWYA 3MTAA 3WLHA 4WASA 2CYCA 3M6VA 4A2QA 2FK8A 3LQQA 2O5RA 1G3MA 4TXHA 4BLUA 5F9HA 4Q3OA 5F98A 3EZ6A 4ABYA 5JASA 3R1IA 4FFMA 3WBJA 1HYQA 5JCXA 1TW3A 2ZRMA 3A05A 1VMIA 1C14A 3OUZA 4OX9Y 1RWXA 1J49A 1E5XA 1LF0A 1Z4LA 3O91A 1SU8A 2A9QA 4HUQA 5FP0A 4KLRA 3RLFA 4DCCA 1M73E 5JY1A 3QX8A 4RF2A 1DHRA 1AF7A 5DEIA 5I5GA 3O47A 3IKTA 3P45A 1UAAA 2C0QA 1ACJA 2JJ1D 3BMNA 2W0MA 1U5CA 3VH2A 2VLBA 3K5PA 4B6QA 4DW8A 1HZZC 4G3XA 1IXRC 4OIMA 3CF6R 1R50A 1GUYA 2H2GA 2I3DA 3L4BA 2XE4A 5AK5A 1K5GA 2CL0X 4R2JA 1T0BA 1T3LA 1G8HA 1GNSA 1PGOA 3LL7A 3V7NA 2CLLB 4RD0A 1MJGA 1P1FA 2PWAA 3QE0A 5AJUA 1GIAA 2ZI9A 5FD8A 4BJ1A 2IOYA 3BTVA 3FPBA 1E3LA 2FMIA 3O8QB 5BR4A 3UAGA 2H1FA 4TX1A 3TDMA 1NP3A 2R1ZA 4TSKA 3BMCB 2O20A 1HX7A 5KOHA 3VMMA 4DSTA 1G4HA 2W0SA 3AH8A 1YS9A 2EZ8A 5AW6A 1JFFA 3DUFB 2XDWA 4HWKA 1LNQA 5EFOA 3ASUA 1JKJB 1N5KA 3VU0A 1J09A 1T2VA 2VO1A 2WFMA 3DT6A 5JVDF 4EPXA 3BT7A 2NX2A 5WRFA 2GDJA 1FJHA 2FX3A 1W1IA 5JNTA 4UVIA 3D9QX 2R1TB 5ALDA 2GZSA 1TJNA 2BBTA 2ZSBA 3DPUA 3OQBA 3ZNOA 2AI1A 4FKZA 4D9FA 4NBLA 3GLVA 4GE0A 3GA0A 5AP9A 4TXMA 2C5FA 2WWTA 1KPHA 4YNBA 2I78A 1AZSC 3ZZ0A 1JLLB 4YMSA 1I13A 1TK3A 3Q6IA 1H4VB 2D0DA 4RMHA 4RSGA 4G26A 1U63A 5GJCA 4F7DA 4HNTA 3S2ZA 3C4QA 3K9NA 4K28A 5AI0A 1KDYA 4O2AA 1XVVA 4IIJB 1UJ5A 2Y27A 1THMA 1WXIA 5EIOA 1AOXA 2JVJA 2AL7A 3AERB 3M34A 3P7MA 3BIXA 2O3TA 1U6KA 5K2OA 4HMPA 3DGFC 1ZPDA 2I22A 3VSCA 2PKWA 1P60A 4BVLA 1USVA 1U0TA 4I5DA 2XX3A 4QDXA 1KDOA 3ELWA 4AT1A 1ZLYA 3CM0A 4B8WA 4DQKA 2RJ3A 5D6NA 1CUVA 3DXXA 2XEXA 3P2IA 3KELA 3GFSA 5HKKD 5DTJA 4OGFA 3S99A 1KMCA 4P22A 4YC7A 2V6MA 3O94A 1K08A 4ABTA 4MZDA 1Q16A 3WTCA 4MI6A 2B7CA 3RUEA 1RXEA 4KPGA 4ZTUB 4KMMA 2JPDA 3WSTA 3LPCA 1ISPA 9LDTA 4CKEB 5JDCA 1N2OA 4Z9XA 1K7SN 1IIBA 3S2UA 3DD5A 2M6LA 3VI3B 1VJTA 1VL2A 2XYGA 3ZLTA 3N2YA 2M1XA 4BO9A 3LWBA 2GCGA 1IHPA 4TLMB 3JD4A 4DV4B 1Q15A 1RLMA 1TQ6A 4XIJA 2QZZA 1YS4A 3VR6D 3PL1A 1QS0A 3KQNA 1UXKA 3B48A 3FMGA 2GYUA 1RRKA 1Q0TA 2B3TA 1I7SB 4JUAA 4YLGA 1MOQA 3GRZA 5FL3A 3IMCA 4ZI5A 1W0JD 5F9MA 1QRAA 2JASA 1SXPA 4IGEA 1GTVA 2A2ZA 1Q1ZA 2P4SA 3NU1A 3D2CA 2P9ZA 3KYBA 1SB9A 4RANA 4LW8A 4IHJA 2IYYA 4JMLA 2XGOA 1G21B 4CUKA 1J99A 1IUKA 1E1QD 3K9CA 4KQEA 3FSJX 4CIBA 2YR0A 1KP3A 1HE5A 2JGIA 3WIEA 3IVGA 4MUHA 2ZIWB 3OPQA 3FHTA 3K9WA 1WQ3A 2QXTA 4RDXA 1F5SA 4CMIB 4CV1A 4GG1A 4DLKA 1SVSA 2X0KA 1FYEA 5G2OA 1KQPA 3GT4A 4JL6A 3QPCA 1F2VA 2P5SA 3GVXA 2VJMA 3KQPA 1YQGA 1QE3A 2E87A 2FEKA 3KTAB 5DLPA 5ES3A 4BKOA 1CULC 2EFDB 3E84A 4Q3EA 2IEIA 3L41A 1K4KA 3NHKA 1K1EA 1VMDA 1T9GR 1Z0SA 3IA7A 4L50A 2KWIA 1TUBB 2XIQA 2O8CB 1Q0HA 3EEFA 2JHGA 4YQEA 3MGBA 3QVVA 4HB4A 4W5TA 2VHTA 1A8HA 1HRDA 3TDKA 1ZC3A 2GTIA 3K5HA 1CTQA 2Q2QA 2QNIA 3IPCA 3DE1X 5KEIA 3N2IA 2WA2A 3SMQA 1VIAA 4UZEA 4OUKX 1X1QA 4MJ3A 1XZHA 1DKNA 3EMKA 4H6VA 1MLDA 3ZE0B 4RSHA 4DC9A 3HM9A 2YZMA 2Y2UA 3DDNA 3FWHA 2JFHA 1OZHA 3R5FA 1KY4A 5K8CA 1BAPA 2ZWOA 3BDAA 1QK3A 3T0FA 1C1DB 3BB4A 4GPIB 4GUDA 1Z62A 4IDEA 1WUHS 1U3TA 1S2IA 1MJ5A 1C5KA 3BQNB 1BHSA 2VCEA 2EDAA 3G59A 4NFSA 4UM8B 1D2AA 1CHDA 5GWXA 3BILA 5J1SB 3HMKA 4K9SA 2H4HA 1CY6A 5EP1A 4B4DA 1ODKA 3WG9A 5CLGA 5CLLA 2PX5A 1O57A 4Y1GA 3OA0A 4G23A 4YLYA 3W6ZA 5L4SA 3FIJA 1NAIA 4HP8A 4XXHA 4FVTA 2ZYVX 4HPXB 1NG1A 1BX0A 4CEJA 2Q1WA 3GRFA 3O8QA 5GJBA 5L9AA 2VWGA 1CJSA 1DG3A 4KN8A 1S7GA 1PZMA 4MO2A 3WTBA 4IDAA 2Q2VA 3BMCA 1KOJA 2FZVA 3A6JA 3JQEA 2HJSA 4RNDB 1OWNA 4O33A 3T7KA 1VKOA 1ZICA 1K5HA 1YGYA 2ZI7A 1NQVA 3DTVD 3PD7A 4Q82A 2G17A 5K6AC 4F5ZA 2WKSA 3PGMA 4G1EB 4D98A 2QKYA 3R7WB 2YDXA 4JC8A 4JYZA 4OX9B 4E6EA 2YVLA 4ZT6A 2I91A 3I2JA 4NP6A 4WKGA 1E77A 3SIRA 4QUGA 3TQQA 1QE0A 1EJ6A 1DJMA 1T4GA 2XSZD 4C89A 5ENVA 2W6MA 3LDAA 4EYGA 5DSXA 4DCNA 3LF1A 4M1WA 2BM8A 2YFQA 4TTVA 2WF5A 4DNOA 2FYTA 1X7WB 3DC7A 3WWEA 4EA9A 1TRKA 4D44A 1V37A 2IUEA 3PQ5A 5KYWB 4EKGA 3KZNA 1J2YA 1WKCA 1TIPA 3H2HA 3T12A 3TD9A 3JPYA 2JAHA 3WYEA 1UF9A 1ZBDA 2BFCB 3D6JA 5C5EA 5LBTA 1J2RA 2JHCA 3CO0S 3EQ9A 1JXMA 1QHFA 1R5JA 2G06A 3FKJA 3O92A 4TV9A 3TZQA 2GAIA 5ALPA 3DW1X 2C3OA 2G5PA 3AERA 1QQTA 4GZMA 4B6FA 3F7MA 4PGFA 1MXFA 2AC4A 3JSXA 4QGBA 2ZZKA 4YUVA 4EENA 4LPSA 3N0VA 1UXHA 1E69A 4OREX 1K7YA 4EHFA 3HVJA 5HQ3B 3CH5A 5BQFA 2E0IA 2JJ8A 2EP8A 4ICIA 4M4SA 2FEOA 1RI1A 1P4HA 5AO9A 5EHNA 1VSBA 2NNWB 2Z0MA 2OGSA 3AW9A 3HP7A 5ECDA 1F7VA 5K20A 3T7DA 2Y1FA 1DRJA