1DAHA

Dethiobiotin synthetase complexed with 7,8-diamino-nonanoic acid, 5'-adenosyl-methylene-triphosphate, and manganese
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dahA00
2H57A 1EWQA 4NYMQ 2ATVA 3P4YA 4IDPA 5BN3A 1F3OA 5KNDA 2ONKA 2QSYA 2NMVA 1IY1A 3NH6A 4RY2A 1FNNA 4HDOB 2NTYC 5D3MB 2ZS8A 1IQPA 2J7PA 3CO5A 4FCVA 2RGCA 2ZSBA 1GKYA 3E5HA 4OHWA 3LXRA 2MSEB 2OLKA 1D8TA 1FX0A 3UMRA 2FPLA 5EXSA 1GL7A 4OI1A 2VTKA 3A8TA 4C0BA 1M2OB 4LV6A 5JZVA 1UAAA 2ONJA 4TYPA 1NMXA 2OBMA 4QFMA 2GCNA 1A5TA 4C4PA 1EFTA 1XF9A 3CUEF 4C2UA 3AP3A 5JECA 1QG2A 5EE1A 2XTZA 3W3AA 3Q85A 4MKFA 4R71A 2ZU6A 3A1VA 3TK1A 2GVZC 4TQ9A 5AUPB 1E32A 3CRQA 5JLJA 3QKSA 3S1AB 3RC8A 4DHEA 3T1TA 2XAUA 2CMKA 2YOHA 5FI0B 3W3ZB 4I99A 1UKEA 4LJ4A 4BRWA 1Z0AA 2GBLC 3BB1A 2A78A 2BKEA 4B48A 1OFTA 4LBWA 1HEIA 3AKEA 3AGPA 4UXIA 2FGJA 2FSIA 4Q4AA 1GRQA 1GITA 5KPDA 3HPQA 3SC3A 4AKHA 2IBMA 5EXTA 3A4LA 1W4AA 1G19A 4TMVA 1Q1BA 1OH6A 2WPDD 4XWAA 2WSMA 5AJVB 2IYTA 3EZFA 2DWQA 3GCGA 3LLMA 4E22A 4BGDA 1D9ZA 2CLCX 2ZRDA 1Z5ZA 4MRPA 5DYIA 3U4QB 1M1YE 4G5GA 5J4VA 3WMEA 3O8BA 3GEEA 5KDLA 4QKQA 1W4RA 4HUQA 4RFSB 4II7A 2FE4A 1DARA 2KB0A 2RAPA 4YONB 4CDGA 1F2TA 3LD9A 2C03A 4KODA 1KO7A 5FR2A 1D2NA 3H4MA 4MITA 4JVNA 3PIRA 4Q01A 2JIZA 1EFHA 2IWRA 5CDFE 4PSKA 2ZE8A 1RRCA 5DE3A 1Z08A 1QHGA 1IN4A 5JFGA 5D3QA 4EQ6B 4DIDA 1NKTA 3B9PA 1S1CA 1PUJA 4IHQA 3UMFA 3GP8A 2ORIA 1U8ZA 2PJZA 4D2IA 4PZZA 4M1WA 1K5GA 2VP5A 1DVRA 2WMOB 3RS5A 1N6LA 4R2IA 1JBKA 4Q47A 4B44A 1P62B 5F9HA 1CR0A 4PAMA 2KI5A 4BLPA 3RS4A 1KTVA 3SOPA 4G5QA 4WXRA 2IUSA 2YZ2A 3C41J 5CYPA 3QF7A 2A9KA 2B7BA 4PHFA 2WWHA 4KYIB 3EC1A 1PVOA 4A6PA 4OI4A 3ZYCA 2J59A 1GILA 4IDNA 1IXSB 5JS7A 3GLGE 3GLHB 1OXVA 2WKPA 2AK2A 1YKSA 2MSDB 2ZREA 5JRJA 3I61A 3QBVA 4GI7A 2FJUA 3AB3A 4V0LA 4GSYA 2CEAA 1D9XA 1S96A 3CX8A 3DHWC 2WAXA 4P4SB 3RABA 4OHXA 4A2WA 1XJ0A 3GJ8A 4B47A 1KSFX 3G5UA 4IXNA 1MO3A 1HQCA 1E2JA 1JXOA 3P26A 4HAYA 3OEED 5E7MA 2J45A 3IO3A 4KVAA 4UNSA 3WMGA 5JJIA 3W6NA 4YMVA 3EASA 4JKIA 221PA 1IJFA 1U81A 2VEDA 4DRZA 2GF0A 2FWRA 1R5NA 4EKDA 4OHYA 6Q21A 2BWJA 1XTIA 2PEYA 4IJMA 4IOLA 4LBYA 4ILEA 1EG7A 4JS0A 1K8RA 1N5IA 1XMVA 1E2PA 4C9BA 5B58C 5FH9A 821PA 1NSFA 2QAJA 3GQBA 3X1DA 3BC1A 2QPOA 2G6BA 1UKYA 5B30A 2QUZA 3QVVA 4D0LB 3T35A 1W47A 3VMFA 3HU2A 2GEDA 3LLUA 1OIXA 3ONWA 1W0KA 4V0KA 3GEHA 3KXKA 1JI0A 1G5PA 1OW3B 4BE7B 2V1XA 1GKIA 4M4SA 4C30A 3N70A 1Z0JA 4C0SA 2WZQA 2H8KA 4UNNA 1ETUA 3OEEA 4AY2A 3K09C 3EZ6A 1UBEA 2JJ8A 2ZJ8A 3CNLA 2V8OA 3GJ0A 4WZAE 4MYUA 4QM7A 1T8TA 1MABA 3U6BA 5DGXA 3SI7A 4TQUS 5JBQA 1OFHA 1MR3F 4LPKA 2JJ1A 2IS2A 2F43B 1VG1A 4JLMA 4NCKA 3THWB 1XTRA 2WTUA 3PXGA 2YVUA 4QBGB 3ZQ6A 1R6BX 3AVQA 1HT2E 5M04A 4PHTA 2GF9A 1UF9A 4EIWA 1ZYUA 1NIJA 2Q0HA 3OZXA 1RVDA 1W2GA 2PT7A 1G18A 1YU9A 4XD7A 5AR1A 3GLIB 4P0TA 5TARA 1QBKC 2BJVA 1IN6A 5AUNB 3SBDA 3VR2A 4LPSA 4CF7A 2EYUA 5JJLA 4AK9A 3U7GA 5AUOB 1OYYA 1X1RA 4LGMA 5LB4A 1E1QD 3H0KA 3VX3A 4A36A 2R8RA 2OBLA 4V02A 2WJHA 4ESVA 1HURA 5AJXA 1GL9B 1G3IA 2Z83A 3L0IB 4JLKA 3LX8A 4OK3A 4PPQA 1JJ7A 2W58A 3TQFA 3CW2A 4XVUA 2A5DA 2RGAA 3AKYA 4RJLA 1UM8A 5CM9C 3WMFA 1SXJC 2ZS9A 4B71A 4F4CA 3RLFA 5AUQA 1X6VA 2ZJBA 1HYQA 1AKYA 1RE0A 4PPFA 1SKQA 2ZRIA 4OK5A 4JSTA 1G3QA 2VP2A 5KNCA 1XMJA 4RCYA 1NNEA 3PG5A 1VKJA 3B1YA 3C16C 1CJTC 3QF4B 3AVOA 4PQRA 4X8LA 2YC2C 2QT0A 5JHHB 1Z6AA 4IEEA 1SULA 2X8AA 3V9PA 5A5GA 1KI7A 4M1TA 1YR7A 3TUJC 1VTKA 1H8ED 4A6XA 5CJPA 2R6AA 1EK0A 1W2HA 2WWIA 3DMDA 5FTNA 4TZ6A 5L3QB 3CZQA 3EPLA 2GXAA 2IYSA 2H5EA 4JLJA 2D2FA 3AVVA 2B7CA 1AS0A 3CRVA 1L2TA 4M9QA 4A0GA 5CITA 1TNDA 1JJVA 2CLSA 1G17A 5IK2D 4Q9LA 4DIEA 2F6RA 3G0HA 1QHHB 3ASYA 1ZMXA 1VYVA 2P6NA 3P20A 4CEHB 2EFDB 4JL6A 5HPYB 3NHAA 4TMZA 1SKYB 5J4LA 1A2KC 1NVVR 3HPRA 2R6GA 4KVGA 2NOAA 1GFIA 2WJIA 3KJEA 4JKYA 4FWIB 2ZEJA 5LD2C 2I4IA 1M34E 3LX5A 4D4LA 2GZHA 3K70B 3RS7A 1G7TA 1VG0B 5HCNA 2Z6VA 4TYNA 4NDZA 4IDOA 3R9WA 4EPRA 3R20A 4I1UA 1MRNA 4Q19A 2FX3A 4IFBA 1AA9A 5HKKD 2YWHA 4XD7D 4HAUA 3QY0A 2ZM5A 3BWDD 4BFWA 4CEJA 4LYFA 1UJ2A 2F3RA 2J0SA 2GVDC 2XEXA 3TW8B 2CCJA 4MKHA 4MDFA 4UNPA 5DISB 5BN4A 1FP7A 3M4YA 4NCHA 2VA8A 5EP3A 3W6PA 1QRAA 4A15A 2QMEA 2BEJA 4WXPA 3E1SA 3T5DA 3MJHA 2GETA 3AKCA 4PFSA 3EC2A 1Q0UA 3KKOA 3I5YA 5KSPA 1TEVA 2XJ4A 4URZR 3REGA 621PA 3WYAA 3BD9A 3GLGB 2F9MA 5KSZA 3L43A 1US8A 3HYRA 3CWQA 3GPLA 1OIVA 4ZV4A 1BMFD 1X8KA 4MGYR 3ND8A 1FFHA 2QSZA 4QGAA 2QM8A 4MUBA 1LS1A 1ZUIA 1HH4A 2G9NA 5C1BA 2IS1A 2Q9AA 5EUQB 1OLOA 3A58B 4MDEA 4XOIA 4A9AA 3NXSA 3D8BA 5HKKA 3U4QA 2OAP1 4TSFA 1XEFA 2ZPTX 4NKRA 2RGGA 4US2R 2A30A 1KDRA 2J9RA 3N2IA 4BQSA 3NBFA 2VSOA 1GNQA 2IW3A 1LTQA 2ZYVX 1NLZA 1NMZA 3C7KA 5J4HA 5GJWC 2ZROA 2AFHE 1W7AA 4JIMA 1W0JA 4OJKA 3AVPA 1AQYA 1BKDR 2Q3MA 1NI3A 2ANCA 2B21A 2CK3D 1TU3A 1IJEA 3CRMA 1RYFA 2LKCA 1KDPA 1DADA 2VP4A 5DLQC 1JB1A 3A4NA 4H1UA 3RWMB 1JECA 1N3BA 1NY6A 1AIPA 1Z07A 3IEVA 3TE6A 4Q7MB 1QHXA 5FBRB 3AM1A 1LF5A 1M7GA 3KJIA 2HXSA 3AVYA 4HAWA 4AKGA 3CZPA 3BH6A 4D0GA 1EX6A 4TT3D 3WP1B 4DLZA 1HA3A 4HZIA 3FYHA 4ZO4A 1R5BA 3F8TA 2NO6A 3SNHA 2HEIA 4FI3C 1FPMA 1J70A 4JT2A 1E2FA 3DZ8A 4TLAA 1W36D 5DIFA 1NRJB 4B3FX 2XSZD 4MKIA 1G3MA 4Q1BA 4R7ZA 5EP2A 3UKDA 1VCNA 1SHKA 4PAQA 3SEAA 2PX0A 2ZI5A 3ZS8A 5JCPA 1R0YA 1Z22A 1IHUA 4M53A 3EW9A 3NC0C 3TIFA 1ZM3A 3DOFA 3UATA 5JEEA 1ZD8A 1ZNWA 4QJ4A 2AD1A 3FWYA 1DEKA 1XPOA 4IXMA 2DCUA 2O0HA 4OQXA 1RFLA 2ODBA 2PZGA 1JEDA 3TVTA 2DYKA 2OM2A 2FG5A 3SYNA 1U8AA 1Z0FA 4HSEA 3UWOA 1WQ1R 1Q12A 5AJWA 1ZBDA 1N6IA 2E9SA 5FBVB 4GOJA 4OYHA 4AYXA 1S4QA 3KTAA 1FTNA 1IM2A 1YZGA 5FPHA 4B32A 4AKIA 4TWZA 2EW1A 4OHZA 4QL3A 4IKEA 4ZDJA 4CEJB 1WBBA 1U0HC 5IHPA 4Q1DA 4ZKDA 4V0NA 4B73A 1RJ9B 5BN5A 1YRBA 2ZRJA 4LX0A 5JI2E 1BIFA 3A1UA 2C5LA 4QJ3A 3PR1A 3SHFA 2FV8A 3THYB 2BMFA 4F4IA 4EFLA 4HLUA 4HDCA 1W4BA 1GRRA 1CJMA 2ODNA 1E2IA 1E9RA 4DCNA 2J0UB 1QHHA 1KI2A 1XMSA 3THWA 3FMOB 1IN8A 1JXMA 4Z8YA 4TL6A 2QP3A 4S35A 1P5ZB 3FB4A 2E87A 3TSOA 3BAFA 1NVVQ 2OCAA 2QMOA 2J1LA 1N6KA 4MRNA 4XTRA 3NKVA 4R2HA 3X2SA 2UZIR 1CRPA 3K1JA 3W8NA 4WA7A 2YOFA 4Q9HA 2YOGA 3EPHA 4Q9IA 3QXHA 1LF0A 1E69A 2IYWA 2H1LA 4C7OB 1SXJA 3WP0A 4ARZA 1CLUA 4C2TA 1KSHA 1F5NA 2FEOA 1T91A 2CL0X 1U0JA 3PCRB 2QZ4A 4XH9B 5TB5A 2XB4A 2FFAA 2AL7A 1OB5A 1OH5A 1E2MA 4GOXA 2C96A 1NBME 4QBHA 1Z06A 3C5CA 2OUKA 4Q66C 1OV4A 4MUAA 3LA6A 3QENA 3OIYA 3WNCA 1W49A 2LKDA 3FHOA 3FOZA 4Q21A 1SVOA 2N1BA 4Q1EA 1SVLA 1KNXA 3EZ9A 1FQJA 1M8PA 4TLBA 5H68A 4DJTA 2QP4A 4Q02A 1Z63A 1ZM2A 3NBXX 1W48A 1UKZA 1DE0A 3CRW1 1ZC4A 1YZNA 3ICEA 4F38A 4D6PA 4NZYA 1II8B 3RDPA 2IK8A 3NBYC 4AD8A 4TTPA 1Z6GA 1N6OA 1DBSA 2G83A 2GCOB 2FZLA 1TQ6A 1Z28A 2G3YA 1FOEB 2LCFA 1SVSA 1XCGB 4RFVA 3SU8A 1NVWQ 1XRJA 4V0MA 5LDDC 1R7RA 4D81A 4IFEA 1SVMA 4DCUA 2P3SA 1DOAA 2MSCB 3WBJA 3KKNA 3N2EA 4LDJA 2GRJA 2W0SA 1OPXA 3KQNA 2R6CA 2XTMA 3I3SR 3N5CA 4QGHA 4B6FA 3K70D 5TVKA 2QP9X 1PZNA 2W2TA 1CBUA 4MQBA 5FL7D 2GAAA 1ZM4A 1WCV1 2QTHA 1KI6A 5G40A 2O8DB 2IHBA 4JLAA 3R9XA 2QRZA 1P73A 2FSFA 3FTQA 5FTKA 3W5IA 1XP8A 3CF6R 3H2YA 4DB4A 2Q6TA 2DWOA 4NYMR 4O25A 3V4RA 1E2LA 1E0KA 4ON9A 1EX7A 1DG1G 2VP0A 1T0JB 5KOYA 3CPJB 2ZRFA 3EG5A 4EFNA 2WPDA 4NH0A 1YRAA 3AF1A 3C8UA 4CEIA 2CDNA 4CZ2A 2CCKA 1N6NA 2BMEA 3QXXA 1E0JA 3NC1C 2GEUA 1UFQA 3EZ2A 3ZVRA 4M9ZA 4B35A 3OEHA 3SYKA 3O8CA 4DSTA 2G0NA 4BFVA 3AP2A 1ZNYA 2E1RA 3B1ZA 3M0EA 1I2DA 2OCYC 4KITB 4L4UA 4B33A 4HZUB 2QL6A 4CEIB 2BM1A 4JVSB 1G7CA 3DL0A 5E95A 1DAHA 2PBRA 1Z6YA 3SFZA 5K8UA 4EPXA 3HU3A 5J4YA 2WV9A 1Z3IX 3U6KA 3K0SA 2XX3A 3AQ4A 1EWRA 4OBEA 4Q5IA 3ZZ0A 3PUWA 2ZR7A 1N0VC 2MMGA 4LHYA 1SVKA 2WM9B 2XXAA 1MH1A 2QORA 4MA4A 1WXQA 3RWOA 2GJ9A 4D80A 2PLFA 3TMKA 1KY3A 3BB4A 4B43A 3KQLA 4FCTA 2ZETA 4XVQA 2ZU0C 3GLIE 2J7PD 2W2XA 2O0JA 2DR3A 4EJSA 4PQYA 4Z1MD 3H86A 4XSHA 3MD0A 2LWIA 2FMXA 4P33A 5EP1A 2X2EA 1U98A 2VHJA 4F93B 4ARZB 5FUWA 1GRNA 2IXFA 1JEEA 3EXAA 2IS4A 1KK2A 1T3LA 1AGRA 1Z0KA 4E09A 1OXXK 1TAGA 2HCJB 1PLLA 3PUXA 5CYOA 5IT5A 1OXTA 4B2PA 1LVGA 1J8MF 3H84A 4F91B 1E2KA 3EIEA 4TMKA 2A7QA 2V54A 4HEJA 1KKLA 4FWTA 3IPYA 4PO1A 4XVRA 2C2HA 1A1VA 1T5IA 3WHLA 2QM7A 5FR1A 1IN5A 5SZKB 2VP6A 2YJTD 1ZP6A 3VTKA 4YMTA 1N25A 2EVWX 1P75A 5GJBA 5H1YA 4V0OA 3LW8A 4ZDWA 1XEWY 3MLEA 3JZMA 3U61B 1SXJE 3GLHE 4NYIQ 3LXXA 5D3MA 4A8JA 4B3BA 4E03A 3PEUA 1KK3A 2JA1A 2FFHA 3AP1A 4F92B 2O5VA 4QBIA 3O8RA 5JJKA 4WZBE 4JL8A 1II9A 3OE7D 1GNRA 1OFUX 2J46A 3B1XA 4Q4AB 3FKQA 2F43A 3FGNA 3EZ7A 1X3SA 4QGFA 5E4FA 2FPKA 2JASA 4Q7JB 4KFRA 4B3CA 5FOVA 2JLZA 1OSNA 3GJ7A 4KXFB 4PR0A 1Q1ZA 1XX6A 5JSZB 4MGIR 3SS8A 3J81k 1UEIA 2FSGA 4BFTA 1VYTA 4P4TA 3IIJA 1GG2A 1IXZA 3SJZA 2ZTSA 3C4JA 4DUGA 3W90A 2D2EA 1E1QA 2WJGA 3BXZA 1Q22A 1CP2A 1WE2A 3BOSA 4QHYA 1XXHB 2IT1A 4MGKR 1D6JA 2I3BA 1OIWA 1Z2CA 2C9YA 4NP6A 1F2UA 1RRGA 4QNMA 5DN6A 1S2MA 3U3RA 1E9EA 4B3XA 4PSAA 1A7JA 1YZLA 3EIQA 4ZCIA 2VP9A 3P4XA 4Q9KA 4DLVA 4JBYA 4AIIA 4IVQA 5B57C 2QTFA 4O2LA 1MOZA 3I8XA 2IF0A 3LV8A 1RC8A 2GXQA 2PX3A 2OLJA 4M21A 2WOJA 2JLUA 2OZEA 1JR3D 1GSIA 1OE0A 2GZDA 4PO8A 5DI3B 2AN9A 1XD9A 4CW7A 3BK7A 2GJ8A 1WP9A 2QROA 2AXNA 4AI6A 2V6JA 1KO1A 5CDFA 4NCIA 3MJRA 2BM0A 2W6JD 4I81A 2BKUA 5CB6A 3NG1A 3RYTC 1H8HA 2W0MA 1E79D 2EWWA 3K70C 2QQ0A 1WMSA 4TL7A 4ACAA 1K5DA 3E2IA 1KSGA 3A6PC 1CXZA 2XNDD 3AF4A 1TMKA 3A37A 2ANBA 3EAQA 2ZXUA 4I1VA 3QOFA 3ADKA 3AF3A 1TQ2A 3VQTA 1VHTA 2P2LA 4TMTA 2VHQA 1NLYA 2ZSAA 1P72A 1YVDA 5LD2B 3KDSE 3EPKA 1T0HB 3BIFA 1E9FA 1JR3E 4HAVA 2WBLC 2GXSA 1M7HA 4R98A 5HZHA 5F9FA 1ZM7A 4HLQB 4EPYA 1A82A 1RIFA 1DAFA 2PLRA 2IYZA 3FE2A 4KFSA 5HCIA 5BYJA 4IDHA 4C3ZA 3AVXA 3T1QA 4AKEA 1KNQA 2QBYA 2F1JA 4LJYA 4M2LA 2QU8A 2ZR0A 1WBDA 2IYXA 1U2RA 4Q18A 1ZNXA 3B2EA 1E94E 1WA5A 5TY0A 3WXMA 2C9CA 1IBRA 3LVRE 1FUUA 2BIFA 3D6TB 4URWR 4QHTA 1YZTA 3CR8A 1YQTA 1E0SA 4ZCLA 1ZIPA 121PA 3GFPA 4A2QA 4LJ8A 3ADDA 1G7SA 2QBYB 1VCOA 4DSOA 1Q1EA 5J5CA 4K81B 3LNCA 1DAIA 3UG7A 1FMJA 3FMPB 2P65A 5GJCA 2QGNA 3DKVA 2GA8A 3GMTA 3L82B 4BFXA 3ADCA 2ZUDA 2W83A 4YXWA 1R4AA 3QKUA 1R0ZA 3ZVNA 2O8EB 3SQWA 1XD8A 1BYIA 2J87A 3I72A 4TTRA 2Y8EA 3U44A 1GNPA 1YR9A 3TH5A 2RH5A 1ZINA 2YWFA 3U7EB 2XOKA 4GT1A 5IK2A 2HJGA 2JGNA 3AGQA 1QHSA 2OCBA 5EQTA 1ZRHA 2JLRA 1XBTA 5EE0A 3VU9B 2XSZA 3DEFA 1I4LD 5JSZA 3CB4A 1CF4A 1QF9A 5CLQA 5FUVA 2VSFA 3K9NA 3BORA 2G77B 1FP6A 1JQJC 4LYAA 2EWVA 3CPHA 2G1KA 2HCBA 2DFKB 3WRXC 3QVUA 1P9NA 2CL7X 2CVHA 2WJJA 5EXXA 3GEIA 2PL3A 4A2PA 3KB1A 2GESA 4W7SA 3W5JA 1ZIOA 4JYBA 4X8OA 1TL7C 1WRBA 2J5XA 2XZLA 1ZC3A 2IHYA 3U5ZB 3OFND 1XDBA 1G7RA 1CKEA 1OXSC 3HP1A 2RB4A 3DM9B 4K8OA 2HT1A 4RD2A 4URYR 1KYIA 5KDOA 2DPXA 1MABB 2XXAB 2JATA 4JVMA 2FEMA 3FMIA 4TL9A 1KI6B 1VMAA 2O8DA 4DWJA 5LPNA 1G64A 3LFUA 4I1SA 3SJAA 2QAGA 3VX4A 3LRPA 3GJ5A 4DCTA 1N6RA 4BLSA 1Y63A 2RGEA 1NF3A 1KO5A 1W46A 2KE5A 2OESA 2D4HA 2R2AA 3NWJA 4I1OA 5GJVC 4HZUA 2H18A 4DLUA 4DBLC 3A4MA 3WNBA 1E4VA 3T34A 3U44B 1XWIA 2H7VA 4UXHA 5DH9A 4RKEA 2BBTA 3DVLA 4Z1MA 3TSWA 2V4ZA 1WB9A 4EQ6A 2ZJAA 4OQLA 4LBVA 4EPVA 4TMXA 4WOPA 2FOLA 3DKPA 4GPTA 5IRCD 3QXJA 3THXB 1P60A 5IF9A 4TQAA 5FOTA 2ORVA 5DHFA 1EFCA 4ESHA 3B1WA 3TVDA 3TSZA 1P4SA 4IVRA 4NHOA 4KSCA 1XZQA 1F2TB 4C0JA 3QXSA 2W6JA 3Q5DA 2WSSA 3BJIC 4RZUA 4EPWA 4M9XA 2VL7A 1G1MA 3G82C 4MYTA 4CRWB 4JYCA 2CHVA 2AKYA 1Y3AA 4PAOA 4LSGA 3MAAC 4U5XA 4L9WA 5JWHA 2DB3A 3HR8A 5BQ5A 2QE7A 1Z6TA 4MKGA 3P32A 1JR3A 4MRSA 4YMSA 3VFDA 4AWXA 4XJXA 2X19A 1KOFA 2YHSA 2ZAMA 2ZJOA 4KBFA 4OQFA 3WBKA 4CIDA 1PLKA 2B6HA 2WIBA 2ZYUX 2ZJ5A 3UIEA 4TLCA 2D06A 4MRRA 3IQWA 1M74A 2RCNA 5H8WA 2PT5A 2AX4A 4AYTA 1DTSA 1L8QA 1WDTA 2Q3FA 1KK0A 1G6OA 2ZRHA 5SZHB 3WNDA 3EWSA 721PA 2VHCA 5CM8B 2HT6A 2VBCA 2VIIA 3QEJA 1GAJA 2PCJA 3CX6A 2L0XA 1P2TA 3Q7PA 3X1YA 4PC1A 1IXRC 3VR1A 4BZPA 5L3QA 2XNSA 1X8LA 2CLDX 1TTTA 3OIVA 4PSVA 1KI8A 4RFSA 1TF2A 3VNUA 2OE2A 2D74A 2WJYA 4LI0A 3L0OA 1W5SA 4DDUA 2C04A 4HYYA 3RS3A 1R8SA 4DLWA 1G3RA 1ZU5A 5HE9A 3VR4A 5HR5A 5FBWB 4ACBA 1KI9A 2W6ID 1W5TA 3ECCA 4K46A 1OT3A 2FA9A 5DI3A 3NVAA 4PC7A 4AURA 1B0UA 2KJQA 3L0SA 2DFTA 1VPLA 2A5GA 3IKJA 1XPRA 2J3EA 3CR7A 1RJ9A 4ZKEA 1XEWX 4QGGA 1XMIA 3WY9A 5JCZA 1DAMA 3KB2A 5L3SA 5KPJA 2WWXA 4FN5A 4BFUA 3KKPA 3ZLJA 5CLLA 2NG1A 2F9LA 3NEJA 1IOZA 1GUAA 1A4RA 1FTSA 1U90A 2IXGA 2YC4C 3D3QA 3NH9A 4M22A 3UANA 4Q4HA 3PQCA 2Z0MA 5JI3E 1L4UA 1UEJA 5DHAA 1U9IA 3K0EA 3GFTA 2ORWA 4KJZA 4WIAA 2ZR9A 4DVGA 1CJUC 3FVQA 4PX9A 4CGZA 2GCPA 1AGPA 5H70A 4LJ6A 1C1YA 2CNWA 2RMKA 1D5CA 2D7CA 2ZYTX 3D7MA 3RRMA 2QEQA 3LBNA 4FD2A 4KO8A 8OHMA 5P21A 4G3XA 5SZJA 1NMYA 2BCGY 1QZXA 2CK3A 3QNUA 5SZIA 1EGAA 1RYHA 3QKRB 1F2UB 4RKFA 3MWYW 5DI9A 5L3RA 2JDIA 3BH7A 4NE2A 1IY2A 5GVRA 2IL1A 2ZRPA 2BDTA 2ZI9A 3GLIA 4BFZA 2JCSA 4U02A 2JLVA 4FMDB 5BWMA 3RRNA 2IUUA 1C9KA 4Q4JA 4XTCS 2GTPA 3BFXA 4ASUA 2GDJA 1KKMA 2P67A 3VKWA 4C0AC 3P1JA 3KUCA 1P2SA 4HAZA 3FKSD 4G01B 1C4OA 4NBSA 3LH5A 4FINA 2I1QA 1SXJD 2HLDD 4GFDA 5FPKA 4D26A 2BC9A 2FFQA 1VECA 1I2MA 1JNYA 4G5SA 5E7JA 2QNRA 2VLIA 1ZU4A 4O2RA 3KJGA 4KLNA 4L16A 4LY6A 2ECKA 3OHMA 3ZGXA 1GP2A 2NO7A 1P9WA 1H8HD 2GEVA 3JVVA 5TXGA 2WJVA 3AVTA 3PITA 4M1OA 2FU5C 4RVCA 2JJ2A 4MH0R 3U7HB 2N42A 3PV0A 3Q8XB 4BLTA 4PXAA 4GZLA 2ZAOA 3SE0A 2NIPA 4ABYA 4ZPXA 3E70C 3L2OB 3OIUA 4BECA 5HZKA 2IWHA 2VSXA 3TJZA 2IF2A 4C0LA 1LNZA 1BH2A 1TQ4A 1Z47A 1YZUA 2R6FA 4A1FA 4NTZA 3PENA 2JLWA 4MRVA 1XXHA 2OEPA 3GJXC 4BFSA 3AUYA 2OG2A 1NY5A 1E9CA 1KSJA 1XTKA 4TL8A 1NLFA 2GILA 2XITA 1CULC 1CIPA 2CBZA 4RZXA 1UBGA 3LBIA 5FUYA 4G5RA 5KTYA 2RGNC 1G41A 1NBMD 5JS8A 4GOKA 5JHGB 4IOKA 4V03A 1G20E 2X1VA 2RKOA 3K8YA 4GP6A 2CVFA 2Q9BA 4R9UC 4WVFA 5L3SB 4ZCMA 3ZQJA 5CK5A 1CS4C 3LAWA 4LRWA 1Z8FA 1MRSA 2JJ2D 3Q5EA 2IEZA 4E07A 1Q57A 2D3WA 1QHNA 1FX0B 2F1RA 1VG9B 2ZE6A 1I4DD 4PC3A 4TLDA 4ZI3A 2GJSA 2ZRBA 2G88A 4FMCF 4QM6A 5DN6D 2FSHA 3FPAA 1S8FA 1M6NA 4RSGA 1RPZA 4P31A 3LW7A 1OKKA 3KXLA 4O0MA 2C99A 3BFVA 2GBLA 2ZE7A 3T61A 3IPXA 1E2EA 2IYUA 2P5SA 4FMCB 4H9GA 3QKSB 3K9HA 4OL0A 3LQRA 4MYCA 1Z0IA 1MO4A 1KZ7B 1VCMA 4Q1FA 1ESNA 1TPZA 1E96A 4B3DA 3UMSA 5L8VA 1ZM9A 5GADl 3LQQA 4LYJA 1VCIA 2A5FA 4XWOA 2REXB 3MUFA 3WRYC 1W36C 1N6PA 2V7QD 1X8JA 1Z2AA 3REFA 1QVAA 1E0AA 3Q9LA 5LB2A 1LB1B 5EP4A 2YYZA 1R8QA 5DO9A 5EE9A 4DT1A 4JLDA 1AQUA 3NTUA 4DCVA 2B8TA 2KBFA 4DLSA 4DLRA 4E5UA 5EZ5A 2EFEB 1NVXQ 3KL4A 1L4YA 2ZRKA 4DCSA 2ERXA 3ZZTA 1KDTA 2G0TA 4IDQA 4B74A 3Q72A 5EUMA 2VH5R 2CXXA 2GJAA 1XJCA 521PA 1XD2A 2IYLD 5CK4A 4DC9A 2ZI6A 4QBFA 2XZOA 3NDPA 2IA5A 4F7WA 2B92A 3IIMA 2ZQ5A 4ZI2A 2WOOA 5C4MA 4NL4H 1II0A 5FBLB 5FOSA 2ZVQX 1SXJB 1ANKA 3HJNA 4JJKA 1RW4A 4G0NA 3QEOA 1LY1A 1FNMA 1NN0A 3B85A 1NJFA 1P7CA 5E7IA 4NYJR 1DAKA 3GLGA 3CBQA 3K0AB 1Q21A 2C98A 5FPTA 2V55B 2QRNA 1E6CA 1BS1A 1ZW6A 1BMFA 3NIBA 4US0R 3I1FA 1N0WA 4RCZA 2WWWA 2A3RA 1TU4A 1DG3A 4HLCA 2MMCA 4OHVA 2D62A 3VKHA 2J0UA 3HYTA 4TMWA 2NQ2C 5FI1B 2O8FA 4QJ5A 3IDQA 2IXEA 3LBHA 3HU1A 1T6NA 4C0KA 3BERA 2F1IA 1G16A 3KKMA 1HE8B 3LDAA 3VAAA 1Q3TA 2JDID 2W00A 5C2JB 3TUZC 4CT5A 1HY3A 4LJ9A 5F98A 3EA0A 1R5OA 4AG5A 2JLXA 4JLBA 2B8WA 2FZ4A 2F3TA 2IYVA 3GLHA 2OV2A 1GOTA 3LO5A 1G8HA 2R9VA 4RD3A 5A0FA 3IUYA 1AM4D 4LC1A 4URUR 4NYIR 1J90A 421PA 3M1IA 1CU1A 1LS6A 1YJ5A 4DLXA 4FMBB 3OF5A 2AKAB 1B23P 3OEHD 1QHYA 4D4MA 1N5KA 4G1UC 3ZS9A 3EARA 4DUGD 4JMPA 1T5LA 3ZD7A 4FIDA 1J99A 2HDNB 1UPTA 4JVLA 4RZ2A 3MWLA 4ITRC 2BEKA 2DFLA 4Q00A 1KDOA 4G5OA 4LV5B 3CWZA 5ANRB 1TX4B 2VYFA 2V1UA 2GWHA 5JWOA 3IBYA 4O3MA 3R8FA 4D4JA 1QG4A 1JPNA 2IYYA 4KFUA 1YZQA 1N6HA 4MGZR 1F6BA 5EE5B 1GIAA 2UKDA 3A1SA 4QHSA 3UK6A 1XB2A 3GLFE 2F1HA 2GHIA 5FBQB 4D82A 4LJ5A 1D2EA 1G6HA 3FFBA 1J8YF 1KMQA 1S9HA 4Q1AA 4LC0A 4A92A 3AUXA 3A1WA 5FL3A 3KX2A 4DSUA 4LJ7A 3CPEA 1Q1QA 4AG6A 4LWZA 4B3GA 3CKLA 1OH7A 1OKKD 3TW4A 1UADA 3ZIAD 1E2HA 4RD4A 3VKGA 3K09A 3K0AA 5JEDA 2WWFA 3BH0A 4HB3A 5AJYA 1OJLA 2DY1A 2VF7A 4BLQA 4Y0AA 1UBFA 1L7VC 4OKSA 3S1AA 3VHLB 4LOAA 4BZXA 4KCGA 4QNRA 4N1AA 1N2CE 1CJVC 1DS6A 2OXRA 4KI0A 1G4AE 2C78A 3X1WA 4NMMA 3V00A 1E1RA 1G3UA 3THOA 4ASUD 1XZPA 4FXPA 1ZAKA 3GJ4A 4IVPA 2XGJA 2HF8A 2ZRAA 1BYUA 1IY0A 3U2QA 3TGPA 1MT0A 4PZLA 4X8HA 4A4DA 2CJWA 4YLGA 2WWYA 4PPGA 4BPBA 2O8CA 3ZZUA 1OH8A 1Z83A 1MO5A 3U7FB 1FQKA 2UZ3A 1NG1A 1ONBA 3MRSA 1E4YA 2ZJ2A 4DXAA 4OJQA 4DSNA 2OT3B 2NO0A 1ESMA 3R7WB 1KI1A 1DAEA 3RSLA 2ERYA 4JLNA 5JWRA 4FW9A 1SVIA 3L8YA 4JZKA 1V43A 4DLYA 1NN1A 2FF7A 2IC5A 1GM5A 3KXIA 4W9MC 2GKSA 3BBPA 2GCOA 1SGWA 1N0UA 2VRWA 3O47A 3PUZA 3U60B 4YMWA 5L3VA 5K8TA 3DDCA 4DDWA 1II8A 1ZVQA 2ZS7A 2O8FB 2YKGA 4ZIRA 3DZDA 3DOEA 3PUYA 4M8NE 3PFIA 3NDBB 1G8GA 1NG9A 2VHTA 1G8PA 1CR1A 3CNOA 2QGZA 2BMDA 2KSQA 2XNDA 4GP7A 4KBGA 4LHWA 1OHHD 3BB3A 4Q1CA 2BCJQ 3B13B 1AS2A 3O8DA 4GMDA 2IYQA 4JLVA 4IRUB 2SHKA 2OHFA 4A8JC 3RS2A 3F3YA 2W6IA 3TQCA 2OFWA 2ZSFA 2VO1A 5K8IA 2F55A 2ZSEA 1CTQA 4POAA 2RHDA 3CH5A 5DNYB 2ZSDA 4ZIRB 4PO9A 5F3WB 3AH8A 4TZ0A 2CHGA 1H8EA 3X1XA 3SN6A 1SHZA 3I62A 3LVQE 1VG8A 3GJ6A 4BRUA 2OXCA 2TMKA 1KJYA 2REBA 4GNKA 1HUQA 2RGXA 3CLVA 3I4LA 2JJ1D 2IS6A 3T1VA 1NL3A 3OESA 1AN0A 3B1VA 4HATA 1GTVA 2A2ZA 1NJGA 4P3YA 4Q4LA 4UXJA 3ZH9B 4YMUA 3LY5A 3RS0A 1GWNA 1Q3HA 1N5JA 1F60A 1J7KA 2CHQA 4OI0A 1TEXA 3CF0A 1IN7A 1KGDA 2YWGA 2DFNA 4F4JA 2VHUA 5J47A 1VHLA 2ZRNA 4LK2A 1NIPA 3IGFA 2C8VA 2CE7A 1E2GA 1UDXA 2JIZD 2QPAA 3CX7A 4DDVA 1E2DA 1E9SA 2WKRA 4KHZA 3FFAA 1E79A 1SZPA 1MV5A 1R0WA 2BBSA 3QBTA 4A0FA 3C14C 3ETLA 3A1TA 4NU0A 3B9QA 4FMDF 4M1YA 2QN6A 3EWAA 2FGKA 3SBEA 3DPUA 4L8GA 4NPHA 2PH1A 1CR4A 1AKEA 2H17A 1KAOA 3TRFA 1W1WA 4OQMA 5FTLA 1TADA 4LBZA 3SR0A 5KSYA 1S9DA 2PZEA 5CIWA 2ASEA 2CCGA 2P6UA 1E2QA 2ZIAA 3VR3A 4PPNA 2OFOA 2KWIA 4PHGA 1G8FA 3DM5A 4Q4JB 4DZZA 3IILA 3KQHA 4OQNA 1SKYE 2GXUA 1KIMA 1TUIA 2XZPA 4BLRA 5FUXA 4Q03A 1RKBA 3VR6A 1OXUA 1R2QA 1CR2A 1P3JA 3FKSA 3KFXA 1FL9A 4UKDA 4D4KA 4DDTA 2HYDA 2XB2A 4U7DA 2QT1A 4NONA 4N0DA 2IX3A 3PEVA 3TKLA 3QF4A 4DKXA 3IEUA 3BS4A 3R8CA 3K0CC 1DO0A 2OSBA 4PQFA 5FTMA 1E2NA 3TR0A 1XTJA 2WSSD 3AF2A 3LWNA 1MO6A 2NO9A 4HB0A 4LV8B 4LCBA 4C0HA 4KAXA 3BFKA 1AZSC 3CF2A 1ZJ6A 4TYYA 2GK7A 1COWA 1ODFA 4PHHA 2GZAA 1U99A 3QSYA 3K9GA 4BZQA 1KHTA 5GVSA 5B2ZA 5ELXA 1SQ5A 1XPUA 3K0CA 3QG5A 3SHWA 4URVR 4Y0VA 1JAHA 2FFBA 3AKDA 1ZD9A 1S0UA 1XEXA 1J2JA 3UXMA 5CB8A 2RHMA 1DPFA 4BASA 1TUEA 4KLZA 4KU4A 4UJ3A 4IOJA 1JAIA 3B78A 3JZAA 4EJSC 1X86B 1HT1E 3BE4A 1E98A 1TF5A 2G1JA 1KJZA 3Q7QA 3CIOA 2Q21A 2AFIE 2EYQA 2O0KA 4Q7LA 3B82A 3MWKA 3KQKA 2JLYA 2OO7A 2GAOA 3THYA 1G291 3RSOA 3KUDA 1CJKC 2Z43A 1AK2A 2CE2X 4B76A 1FZQA 3BRWD 2FN4A 3QG1A 1P2VA 3GLFA 4H1VA 3KQUA 2BOVA 4JLOA 2QG6A 5CIQA 5AK0A 2UVQA 3P27A 1ZCAA 5TV2A 2PEZA 3H1TA 3T15A 3A36A 2Q9CA 2HUPA 4EAQA 4TYWA 1KAGA 1Z0DA 1E3MA 1XU4A 1DAGA 2ZJYA 3IQXA 3U3JA 3I32A 1N5LA 2QE7D 1GKUB 4EDHA 1YR8A 2RGBA 4RD1A 1D2MA 3RANA 1Q44A 1HV8A 5FOUA 4XWKA 2V9PA 5E3HA 1W44A 5FTJA 1JR6A 2QENA 4HB2A 4NYJQ 1T9HA 3ZDQA 4CYMA 2J0VA 1F48A 1UDWA 1S3GA 1YHNA 3W8RA 1OFIA 4JBWA 3IHWA 3ZJYA 1XEXB 3OAAA 1HTWA 3SZRA 2XJ9A 2FDCA 1G8YA 5KUTA 4LJAA 2O8BB 2IYRA 5FL7A 3CONA 3HDTA 4B75A 4M1SA 2ZI4A 3RNLA 1XXHE 3NHBA 2YNMA 2WHXA 2EFGA 3SFVA 2QMUA 4I4LA 4Q4HB 4B34A 3PJRA 4WAUA 1AS3A 3QPVA 1ZUHA 2HV8A 4TYQA 3AV0B 1RRPA 3TAUA 4V0ME 4DEXA 1Z6XA 2ZI3A 2AWOA 1KO8A 1YR6A 5HTKA 4JJZA 3I92A 4AC9A 2P6RA 4A8JB 2JEOA 4LHXA 4Q7KA 1EESA 1TQDA 2J7KA 4B6EA 4ZDIA 3K0FB 4PZYA 2O8CB 3IBGA 5G3ZA 2BBOA 1V5WA 1XCPA 1U8YA 3NBZC 5BXQC 1O87A 1P61B 1DO2A 1G4UR 1W0JD 3EIHA 5FPYA 4W5WA 1GZSA 1LV7A 4M1KA 1GVNB 1T3SA 1RZ3A 2ZUCA 3MGCA 4RD6A 3U3MA 2R62A 1PJRA 1XNJA 3RRZA 2N46A 4UQOA 5K8LA 3TLXA 1JQLB 3IHLA 4PTLA 1XTQA 1OYWA 2J41A 1BOFA 1BO6A 3IIKA 1OB2A 1P2UA 4B2LA 4KYUA 4IEIA 1HQYE 2WWGA 3EX7C 2IUTA 3WYFA 3L8ZA 2HJVA 2K5UA 1ZD1A 5G41A 4EJSB 2REOA 2C9OA 1W4CA 2VPPA 3TNFA 1XFAA 3GD7A 3PVSA 4URXR 3C15C 1W0KD 2NZJA 1EFUA 2YINC 2ZE5A 4HDQB 1W36B 4EPTA 5CJ2A 4XSGA 1IONA 4D0NA 3CH4B 3U3OA 1PUIA 3GFOA 3HR7A 3AVWA 4CVNA 4B2IA 4TN1A 2AXPA 1PLJA 1S3SA 3T1OA 3VU9A 3TAHA 1E1RD 5EE3A 2EFCB 5B64A 3CRRA 4HLUC 4A82A 3KTAB 3MCAA 2A5JA 3NEYA 3D31A 5F2EA 3DO6A 1SVWA 2QAGB 2FPMA 2WIAA 3B7GA 3KJHA 2EQBA 4OI2A 3RRYA 2ZRMA 1G21E 4WBSA 2O8BA 1EFRD 3F0TA 4BEBA 4GL2A 3ND9A 2HF9A 5KYKA 1Z29A 2VF8A 1US8B 2ZRLA 4EUNA 4HB4A 3MFYA 2A5YB 3L0PA 2AR7A 1OF1A 3KFVA 3RVBA 4YC7A 1XTSA 5JMTA 2R6DA 3QJYA 2BJWA 4BEJA 4EFMA 4P4UA 1MKYA 2BV3A 2FNAA 3B5JA 1O3YA 2WAYA 2WMNB 1U94A 2PMKA 2OILA 2NPIA 2XTNA 4HUTA 2H92A 2CJWB 4HUQB 4YDSA 4BWYA 1VIYA 2V7QA 5DSZA 1AJEA 4UNRA 2ZRCA 4UJ5A 1R0XA 2DBYA 3RHFA 4NCNA 3TBKA 3FHTA 1VIAA 3CM0A 3UWKA 5FOXA 3VNVA 1KJWA 4YQFA 2V3CC 3PUVA 4L5BA 2Z5FA 1HE1C 1XD2B 4GDFA 1G5TA 2YWEA 2BHRA 3GLFB 1ZNZA 2WICA 2JAQA 2X77A 5C4GB 1P6XA 4X8MA 4CT4B 3GJ3A 1GDDA 1M7BA 4LUCA 1CEEA 1EFRA 3WHKA 4TTQA 5A4JA 3TUIC 5C46F 3ZIAA 2R65A 1ELOA 1E9BA 4XIGS 3K9LA 4YXWD 1ZUNB 2QMHA 1NKSA 1VYUA 2AD5A 4QRHA 3V4FA 2O52A 3HWSA 4RZ3A 1UBCA 5JRZA 2ZITA 3I5XA 4Z51A 4QG7A 3DMNA 3FMFA 2GJKA 2OAQ1 3MG9A 4TSFD 1K6MA 3SYLA 1E9DA 3PEYA 2XOKD 4ZDKA 3AEZA 2AWNA 2OCPA 3OE7A 4N0EA 5C18A 4MYHA 5LBIA 1U9IC 4W5JA 4GMXA 1FW6A 2P5TB 3FDIA 4JBXA 3B6EA 2BMJA 5FFMA 3ICQB 1A2BA 2OFXA 3QUSA 3OAAD 3AF0A 1NVUQ 4YDHB 1KO4A 1TF7A 2GNOA 3QIAA 5HE8A 4PC2A 4UNQA 3VHXA 3R9IA 4PC6A 5G3YA 4OK6A 5UKDA 1GL6A 4AYWA 2F7SA 2QTVB 2QA5A 1FMLA 2ZRGA 2AHOA 2NO1A 4L15A 4GBMA 4LHZA 5J40A 3U3KA 4D25A 2V6IA 3Q3JB 4RD0A 3THXA 2FH5B 4JL5A 4U00A 2ODWA 2EU8A 2BBWA 3OIWA 1PV4A 1NBMA 1QHIA 1JPJA 3ZVLA 2WVJA 2AK3A 4FCWA 2DHRA 3QQ5A 5TDHA 3I8SA 4Q48A 1E99A 4ERNA 2NGRA 5FOWA 2ZJZA 5KDDA 5FPSA 1T8UA 4IOMA 4KV9A 1R10A 2OBNA 4WW0A 2CNWD 4S2EA 3RC3A 4A0HA 1KZGB 1Q20A 4P4SA 2P0EA 3TR5A 1I4TD 2Q3HA 3UG6A 4LYHA 4WZ6A 1OHHA 2H16A 5BW8A 4C7OA 3KZ1E 4CEHA 2PMDA 4M1MA 1NN5A 5KU1A 1IAQA 2D7DA 1KY2A 1T4GA 4A0RA 4QOSA 5IDVA 3ASZA 1S1MA 3MSXA 4JLPA 3T5GA 1G9XA 2KBEA 1COWD 3JVUA 3M6AA 1H65A 4TLEA 5EJEA 1DELA 1LW7A 2R44A 3F5FA 3W34A 3C5HA 5BYKA 5AWFC 3ZD6A 4DB2A 2ZANA 1U0LA 1UKVY 3EA5A 4NCJA 5EXPA 5J4KA 3CNNA 3QI2A 3I73A 4US1R 1NN3A 1EXMA 2HXYA 3K53A 5KO2A 3MMPA 3KKQA 4HAXA 4KFTA 4DT1B 3PEWA 2I1VB 4TT3A 3T12A 2ZVPX 3EPJA 1XCMA 3ADBA 2QI9C 3QPUA 2RGNA 4HLDA 1KI3A 4L9SA 2HLDA 2O8EA 3QE0A 4Z8XA 1CRQA 1KMHA 1YZKA 3W9YA 2C77A 3FHCB 4BFYA 2PCLA 2ZI7A 4QC2A 4IW3B 2NPFA 5KHOC 2QAGC 3QXCA 2HYIC 2BVNA 5EZ6B 2RGDA 3UPUA 2Z4SA 4GRAA 4KSBA 4DEYA 2X2FA 3SJBA 4JSYA 2JLQA 2YV5A 3IO5A 4N3NA 2ZYWX 4JT4A 4J0QA 1QVRA 2JLSA 2PZFA 3SQXA 2WKQA 2PJRA 3K0FA 3QPWA 1FUKA 5KNBA 1LFDB 2QPTA 3BGWA 4PANA 2EFHB 3SJCA 3QKTA 3X1ZA 3T06B 2GK6A 3QKRA 1VDZA 2QQEA 2QY9A 2W2VA 4BLOA 1G5RA 4P32A 3OFNA 1NP6A 1YE8A 1QDEA 3B60A 4Z54A 1KK1A 3W6OA 1E9AA 4BUJA 3B8HA 2CL6X 2VQSA 2Z4RA 5AJZA 5TMPA 2IEYA 3SDZA 1ZCBA 2ATXA 1NSTA 2NZ8A 3MWJA 2ZUBA 5DYGA 1WF3A 1P9RA 3WYGA 4DLTA 4Q9JA 4M0LA 5KSOA 4C0QC 4W5HA 1KI4A 4LHVA 3ZVMA 5G53C 1XJQA 4HI0E 2DWPA 1AZTA 3RAPR 3AVUA 1RRFA 1X1SA 4LZZA 2ODEA 4GZMA 1T3HA 3R7WA 3VR5A 2J0QA 4M9SA 1JALA 1KMHB 2C95A 4QXAA
chains in the Genus database with same CATH superfamily
2GUGA 2H57A 4A5OA 3TM4A 1E5LA 2GAFA 5BN3A 2K7ZA 4DNOA 1F3OA 1MA3A 5KNDA 4HNRA 1YUNA 3KYDA 3BT7A 3R2JA 3FIUA 1FNNA 1MAAA 4ZAZA 1Z68A 3H65A 2NTYC 4H77A 2AZMA 3H9GA 3VO1A 2J7PA 5F5LA 1Y42X 1PTJA 4MGHA 1NI4A 5F7JA 1GKYA 5HRAA 2IU0A 1V7ZA 4HDKB 4U8GA 3VXKA 1D8TA 5A5VA 2FDXA 3A1NA 3UMRA 2FPLA 2R8YA 5ILQA 1V9SA 4D7AA 4M9CA 5J58A 1GL7A 4OI1A 2VTKA 4CWAA 5DHPA 4BNDB 4FZ5A 2YQ4A 4UREA 1U8CB 4QFMA 3QLVA 2C7PA 3YASA 5DTQA 1CQXA 3DBLA 4MWBA 4DMHA 4F21A 1QFMA 5LMZA 2V7GA 2XTZA 3W3AA 2DHDA 3MS4A 3Q85A 4RA9A 5IDXA 2ZU6A 1MP0A 3A1VA 4TQ9A 3TK1A 3ZE1B 1E32A 1N2OA 2QZ9A 5SY4A 3NOXA 5INTA 2YJ6A 1XJ5A 2Y0DA 5FAXA 5DZSA 2BTQB 4DHEA 4WINA 3IAS1 2CMKA 1XZDA 1XEAA 2C2ZA 3ZKAA 4I99A 4KH0A 3H18A 4TROA 1QGUA 2R11A 4DR3B 5EI5A 3LMKA 1PU2A 4OP3A 3NRBA 4JJ7A 5BT8A 2JLBA 3BRQA 3NTVA 4WCFA 1ND6A 3FGPA 3WO1A 1OFTA 2AN5A 1HEIA 2WE8A 3K73O 1BDIA 1DJMA 2ZUSA 2IDJA 1GRQA 5KPDA 3HPQA 3LC1O 3GJZA 5MF6A 4LDZA 2QTVA 2DSNA 4O4IA 3PFWO 3F9IA 3K6JA 5CT8A 5ALKA 1QQAA 1PL0A 1Q84A 2WPDD 2GR9A 4HVLA 3EZGA 4TTAA 3TLBA 2BUAA 2R1ZA 2B4QA 3N0TA 4R3WA 2WSMA 4XWAA 5AJVB 4ZOEA 3W2FA 2DWQA 3ZOKA 2E6UX 3EOBI 1J2TA 5BN4B 2QUKA 4X45A 4X9XA 4MRPA 5DYIA 3QLUA 1M1YE 4G5GA 4KPGA 1A5AB 2QM0A 3WGMA 4I8DA 3WMEA 3QVMA 4UPEA 3WWEA 3TF5A 1W4RA 3D7KA 2XXAB 2C1XA 2OO5A 4MUKA 4RFSB 2FE4A 1DCMA 1QUFA 3UB4A 1E3EA 3VPFA 1CY7A 3O1LA 1ABFA 2WFLA 1ZFNA 3O03A 1KPHA 1D2NA 4L07A 5LKAA 1A9XB 1F8YA 2N3ZA 2JIZA 1EFHA 1OV6A 4FBMA 4Q01A 2PBFA 5AQ1A 5IT0A 2NTVA 1RRCA 2QN9A 2O2GA 5A06A 5DE3A 5A5EA 3I6QA 5DSTA 1QHGA 3T7AA 1UDBA 1H3EA 3T54A 2R79A 3Q0TA 4LOKA 3ANYB 1BX1A 1O1YA 1YL5A 1AUOA 1UK6A 4IHQA 3OJCA 3EISA 2UYHA 2NU9B 1U8ZA 2BW0A 4PLTA 1OWLA 3QTBA 4H7JA 4FCCA 3S6JA 3D0OA 1T6BY 1RAHA 5GGYA 4YRNA 3MC1A 4G23A 4HNHA 4B44A 1P62B 1PQPA 3DBVO 4D9GA 2CJPA 2RHGB 3RRXA 2LE0A 1UFVA 5F9HA 3ILHA 3PDIB 3CTPA 1ZAYA 3ZDXB 2WP0A 2BE7A 2OAGA 4PLCA 1IMJA 4WXRA 4ZVVA 3SOPA 2IUSA 2YZ2A 1WZUA 3UHPA 1FU7A 1MVNA 2C82A 2B7BA 2P1RA 2R60A 2QN1A 1GZ7A 3QF7A 2WWHA 4HDRA 5ITZB 2Q4BA 4HNVA 1N78A 1RI5A 3EB9A 3IV9A 3LWZA 4RMIA 5K3DA 3RIMA 4OXNA 4EA9A 2AV6A 4WUVA 4QRDA 4CIBA 5F2NA 1NJ2A 4YJ3B 2G28A 3GFQA 5K1ZA 1C30B 4QECA 1I5RA 2H1IA 4MR8A 1RDFA 3GLGE 2JBWA 2WKPA 2HWWA 5DULA 1DU4A 2ZREA 1Y9AA 3FAKA 3VZPA 5JZMA 1LBEA 2BZ0A 2OQRA 4UBIA 1Q11A 1RYYA 4HN2A 4TRJA 2ODPA 2OHHA 3ROGA 7MHTA 4L6AA 2O2DA 2CEAA 4JYZA 1S96A 1LEHA 2HIHA 3JRNA 1FFXB 1WUKS 4OHXA 1Q0TA 3GJ8A 1AQNA 4UTOA 3GRUA 4IXNA 2R85A 3HK2A 3QYFA 1C2YA 1E2JA 2XMGA 3DAYA 3QITA 3CW9A 2A1UA 2XRMA 3CKYA 3NIDB 4MQFA 1BW9A 1YBFA 3ZNNA 2B4RO 4ZEVA 3IO3A 3EFOB 4KVAA 2ZDHA 3KQMA 3LYLA 5DT2A 4JI7B 4MUGA 1ADJA 1H2ZA 3VKHA 4FOLA 2ILTA 5LQRA 3EASA 1JP7A 3QP9A 3GF4A 1YB1A 1NBOA 5JNWA 1EGMB 1EFKA 1VI6A 4NY1A 4UHBA 2VEDA 1NJ5A 3IAM6 3ETEA 3LBYA 1O94D 5DLEA 1SHTX 4OHYA 1BWRA 4XOUA 1DG9A 2G8LA 4M1ZA 3X1KA 1XTIA 4GPBA 2PEYA 3B3GA 5DM2A 3QOWA 1L5FA 4LBYA 4WEOA 1T29A 1Y4AE 3KTOA 1EG7A 3QELB 3FLEA 1PX0A 4Z0PA 5FH9A 3C3DA 1YZ3A 1XZAA 2QPOA 3KE9A 1E3JA 3HVKA 1B6GA 3LSTA 3T35A 1W47A 4X41A 2IZZA 1HKUA 3BPSA 2GEBA 2BF4A 4G89A 3I52A 4OBBA 3O84A 1W0KA 4V0KA 3R76A 5JFOA 3VR2D 1JI0A 1G5PA 1JQ5A 2VRCA 4N3GA 4M4SA 3PWSA 4MEJA 3N70A 4X66B 3RADC 5JPCA 2WZQA 2H8KA 3HN6A 4UNNA 3RG8A 4QT4A 3OEEA 1P6QA 3EZ6A 5FCDA 3W1VA 1ZH2A 4B6QA 3U0BA 4ZJPA 4YY3B 2QL9A 1MABA 3ORQA 2VC2B 3D81A 2IW1A 4J0CA 3S5UA 5DGXA 3U6BA 1LRLA 3SI7A 5KOHA 4YVFA 1UMKA 1X2EA 2AFIA 1OFHA 4LPKA 2ODAA 3QYJA 3V48A 5JYEA 4YI5A 2Q5EA 3A7DA 4G2TA 1IIRA 4GZ5A 4JLMA 4MRMA 4NCKA 2C3PA 4QVIA 1LK0A 4L4XA 3SQLA 3STTA 1WSBA 1R6BX 3BJMA 4GOOD 3R3ZA 5K7SA 4HMPA 3PRYA 4PHTA 4B8WA 3IUSA 1CUYA 1CY4A 5CNIA 1P29A 4JBIA 4CBVA 1G2QA 1JG4A 2BONA 1YGYA 1DQNA 1VZ3A 1QFJA 2XUKA 2Q07A 2Q0HA 1U2TA 1W2GA 5JD5A 4MCHA 2XQFA 1NLUA 1L4LA 3WLOA 4Z7NB 1XT6A 3HYLA 3NYQA 4UUQA 3SBDA 1AXGA 4LPSA 2EYUA 2FWBA 3GA5A 4QQRA 2VTBA 4RLQA 3KVRA 5EC8A 4B4UA 4LOJA 3GOHA 3ELYA 3QELA 4A91A 1MZVA 1Q2XA 3H0KA 4BRSA 2PVPA 1GQRA 2P6PA 2HZ7A 1XTUA 3MWFA 4ESVA 4GECA 2PMWB 3C3BA 4PGHA 4DNQA 1S4MA 1SQSA 1BTOA 1G3IA 3KP1A 2Z83A 5HNKA 3LX8A 2VKQA 3MERA 4PPQA 1T2AA 2O5EA 5ALMA 3DZIA 3ZYZA 1JJ7A 3O8QB 2WMDA 2VNSA 1DRVA 4I50F 2A5DA 3VMMA 3GHHA 2L18A 5CM9C 1UM8A 3WMFA 4F4CA 4EB8A 4GYYA 7AT1A 1X6VA 1AKYA 1JSZA 1USVA 1KJ8A 3ORHA 4PPFA 3AR2A 3OU2A 4B7UA 2I9PA 5DRTA 1EUCB 1IOWA 3FYCA 3TOSA 4P08A 1NNEA 1KYQA 1JFLA 5CIYA 3QQPA 4R83A 3A0UA 3V32A 4CHGA 1GAEO 2GHQA 3QF4B 1L5VA 4PQRA 2OXIA 4F71A 3TJMA 1BAPA 3ZW7A 3L8FA 3H42B 1C0EA 2Y1LA 3ZKWB 4WOJA 3HADA 3ZU4A 2W4IA 1KQOA 1ISHA 3CU5A 4DV7B 1K9VF 1Y6RA 2NPOA 3I9MA 3N39C 5AMXA 1DC3A 4BNJA 4BXOB 5FTNA 3DMDA 3G5AA 4KPFC 4B4VA 1Q0LA 2FW8A 2FN7A 4KQFA 1MX9A 5L3QB 3AVYA 4EHNA 2D2FA 1Z0UA 2B7CA 2E48A 2Q29A 4WFJA 5DGTA 1TJNA 4A0GA 3UMMA 1TNDA 3NIGB 1UZAA 5GM2A 3L40A 3A6KA 4IDFA 5IK2D 2DWUA 3AB7A 1HEUA 1XYYA 4FYKA 1OBVA 2NVBA 3OHPA 4DR5B 1VYVA 3EFHA 1A2OA 3RFFA 3NHAA 4M1QA 5FPQA 4P34A 4CLXA 4U7FA 1A2KC 1NVVR 2VF4X 3HPRA 4AKSA 5EJ4A 1GZ5A 1K2WA 3C87A 4GPD1 4XLTA 2IV3A 3E7FA 2Y4NA 3IBFA 1TIBA 3HACA 3B5IA 1G20B 1M34E 2BUCA 3U7RA 1NOJA 1N32B 4HEA6 1XZJA 1G7TA 1VG0B 5HCNA 4BYMA 5LOVB 4MHOA 1YIDA 4IX1A 4LK3A 4PZUA 1ZG3A 4EPRA 3MQFA 4HGQA 4COOA 1Y0BA 1YZYA 2YWHA 4XD7D 5TC4A 3W79A 3B6IA 3LM8A 4ECAA 3NFRA 3BWDD 4C3UA 4CEJA 2AXQA 1WSWA 1ULUA 4J4BA 2I55A 1JLRA 4OU4A 3GXBA 1IK6A 4YS6A 2XDQB 4UNPA 1HGXA 4ILKA 5BN4A 2QL7A 4BY9E 3E5MA 2PUDA 2IQIA 3OJWA 2VA8A 1BJKA 3W6PA 3B1FA 3BD8A 1BXZA 3AR8A 3G9ZA 3N74A 4DYHA 4NS1A 2FPXA 1FXWF 3MJHA 3G23A 1NI5A 3RVPA 3H1GA 4XUDA 2ZPAA 3MJDA 3GGDA 2PGIA 4YRAA 2OC4A 3OSUA 1TEVA 2QJRA 4IICA 2FSPA 3O2NA 3WYAA 3UBTA 4C29A 2NUPA 3KKLA 4H0NA 1GR0A 2OPBA 5CVJA 3OFJA 2P68A 4G5HA 4U39A 3QZUA 5AM0A 3GPLA 3UV3A 4C5CA 1ZISA 1FFHA 1SO8A 3K5HA 3PX3A 3GPCA 3JTEA 1HYHA 3IP7A 4LF9B 2C8KA 2X6TA 4MUBA 3CYFA 2EBHX 2Q9AA 2D1QA 2QXTA 5EUQB 3UAVA 5TQ2A 4XOIA 4J0EA 3NXSA 3MMNA 4YWJA 1WB5A 2A1TS 4TSFA 5IW8A 1XEFA 2ZPTX 1U3GA 1KVQA 4US2R 2BM9A 3T4UA 1ZH4A 4MPTA 1QF6A 1IATA 2G5PA 3WLMA 1PYGA 2J9RA 1P7YA 2C3UA 3R75A 1TLLA 3N2IA 3QU2A 5EIXA 1IZYA 1U8XX 1GNQA 1ADCA 1TYAE 2Z57A 3D8HA 4HWKA 4ZRDA 1GUBA 2Z3ZA 1PJLA 2RBEA 3M4JA 4ZZ2A 1QC5B 3UJ3X 5KNCH 4OLJA 2CJXA 1MB4A 3L1UA 2ZROA 1X87A 3U26A 4MQLA 1EVYA 1VIVA 5BYAA 1V8FA 2ONZA 1T2VA 3KYBA 4OJKA 3PR2B 4NZMA 1PNOA 3AVPA 2HF7A 4JR0A 3UOAB 3LUDA 2WWTA 3R6DA 3TW6A 4DOMA 3OQOA 4DR6B 1TU3A 1K8YB 4J6FA 1HLPA 4O2BA 4OXIA 1UCFA 1KDPA 3UHOA 5C8ZA 1DADA 2OL4A 4RAQA 4RK1A 2ZG6A 1FJGB 2QB5A 4KE7A 1NY6A 3AHDA 1Z07A 3IEVA 2QLTA 3TE6A 4RHFA 1JYFA 3O74A 2I4OA 1C1DB 1PEYA 2MTBA 3KJIA 5DNDA 5TX7A 3HB9A 4DLBA 5CXSA 3CZPA 5ENVA 1E3IA 2PR2A 3HA5A 1OXBB 2P2SA 4TT3D 3DEHA 3FYHA 5C53B 3DPSA 3F8TA 2HM7A 1K6JA 1MD9A 1UDRA 3MLAA 4HN9A 1L5RA 3DMYA 1H0KA 4LRTB 3SNHA 4FI3C 2OK7A 2YWBA 1JA9A 4K6GA 1W36D 3L46A 4IH4A 3OY2A 5DIFA 3G17A 4B40A 1NRJB 5E9JA 4BB5A 1G3MA 4N18A 3UC5A 1PKEA 4BNYA 4NV0A 2HA4A 1AG9A 4XB1A 2OXTA 4AY6A 1SHKA 4PAQA 2RBGA 3OURA 2R7MA 3SEAA 5JFTA 2CYAA 3ZS8A 1Z22A 2W2LD 5JCPA 1IHUA 1Y6QA 1HMPA 3EW9A 4GGMX 3WKDA 4RPIA 2VQ6A 4FYWA 3DOFA 2D2XA 4QQFA 4B3IA 4WQMA 1PVVA 3PIDA 3ZI0A 2D54A 1ZD8A 3AEUB 3MQ4A 5DFAA 3VR4D 1C3XA 1ZNWA 3GJRA 4QJ4A 2AD1A 2WDZA 4DARA 1W29A 3PFFA 3IA2A 2O0HA 2PZGA 1C29B 2B20A 1CVLA 2ECPA 4UUAA 1Z0FA 4O4LA 5AK4A 3BQMB 3UWOA 3WGUA 5JSFA 1B8NA 3NBAA 2JGFA 1DX4A 4MVJF 1Q12A 4TM7A 5HF9A 3EMVA 2AG1A 1XZFA 4HDAA 4OYHA 4AYXA 3VZSA 1EE9A 1YR1A 5D7BA 5ECYA 7MDHA 3F7MA 3DLBA 3KRTA 3EZNA 5DEIA 2QNIA 1TJPB 4TWZA 3GZTB 2EW1A 3DWFA 2DTEA 5LZ7A 3S2GA 1UDAA 5BV1A 2JBAB 4OHZA 5A5FA 5JASA 3FMGA 2IU3A 5E2IA 3WJ2A 1WBBA 1L7BA 5FWXB 3HJUA 1T2FA 2HTFA 1R00A 4V0NA 4MPRA 1YRBA 4GYKA 4JEMA 5CB4A 3ONDA 5K3CA 1BIFA 3RVOA 4KIWA 2GNPA 4OMDA 4QLOA 4QJ3A 4MV0A 4UVDA 3SHFA 1MJGA 3ZDFA 3THYB 4Z0NA 1EFVA 2I3DA 4YCJA 4HLUA 4HDCA 1WULS 1SUPA 2BFAA 2XCLA 5BSTA 3UWPA 1HM5A 5L53A 3RUPA 5F7XA 1E7MA 1WUYA 1T1RA 2VQEB 1CRZA 1LC3A 1E9RA 1WVGA 4GDMA 4F3CA 5EWMA 4N6GA 2FE1A 2DHEA 2VHZA 2Q1UA 4XUEA 4B1FA 2AJCA 3GLIB 1USUA 3FMOB 4DNXA 2QVBA 1K0FA 4HFJA 1JXMA 4ZI5A 2M6KA 2ARKA 2QP3A 2WTAA 3ZHBA 2X8JA 2ZIUB 3AJ8A 5EGSA 1M5TA 2ACKA 1OGYA 2ZSHA 2NV0A 4RTOA 3AW9A 4MRNA 1N6KA 1QQTA 2BELA 1XALA 3NKVA 3PNBA 4L0QA 4R2HA 4V38A 3HYCA 4GM1A 5ALLA 5CLFA 2CZCA 3ZHSA 1OAOC 4Q9IA 3L41A 2O3SA 4EZIA 1E69A 1VBKA 2IYWA 2H1LA 3GN2A 4HXYA 4LISA 2HNAA 2Z3VA 5AXCA 1KSHA 1F5NA 2XUIA 3GVPA 5AKYA 2PYZA 3BTOA 4DN6A 4UDYX 1QFYA 1T91A 2CL0X 4Z6KA 2VNIA 1VFPA 2X1HA 4XH9B 2XD9A 1Z7EA 5H4GA 9MHTA 4K3VA 1D07A 5CJJA 4OGGA 4F3KA 1FDTA 2BLNA 3C5CA 1QOQB 3D7LA 4MAMA 2JNWA 2EL9A 3CA8A 3OIYA 2I7TA 3AETB 1KBOA 3WDMA 3UJ9A 4UOEA 1YCFA 3IVRA 3L7IA 1YS9A 2J6HA 4HMOA 5E7QA 1WCIB 2WHRA 3H8JA 1ENPA 4J0HA 3R0IA 1WZNA 2GK4A 4TLBA 1IB0A 4LE0A 2GD2A 2XDYA 4QYSA 3NBXX 8ATCA 4WX2B 3UMBA 2VVTA 3WB9A 1Y82A 4AY4A 3NVMB 4F38A 3E7DA 1EDEA 2YDYA 4J0FA 2QG4A 5LDGA 1II8B 4DMRA 3NBYC 5FQNA 4TTPA 5CFRA 1Z6GA 1P80A 4XYGA 4P3OA 5A05A 3HM9A 1F06A 1NC1A 1SA0A 4IV0A 1B2RA 1ECGA 1UP4A 2AFHB 5G1OA 1Z28A 4MUXA 2RK4A 1P4JA 2LCFA 2J09A 3LDHA 1SVSA 3QHPA 4XFJA 1WV1A 3SEFA 4ARAA 4D96A 4YR7A 1N7HA 2XMZA 4LDQA 3WIEA 4AG3A 4YUWA 3JQPA 3VRHA 1F38A 4FSHA 4KQHA 1X7ZB 4V0MA 4D81A 5TMEA 1TQ8A 1FFBA 1T2EA 2ZUFA 1MOPA 3EVGA 1Q5PA 2JFBA 3K30A 4INPA 4J76A 2V03A 3V1KA 1DZ3A 2YVQA 4LDAA 1DOAA 4FM9A 3ZIUA 3M6MD 3D6MA 4WLOA 5KYGA 2GRJA 5BT9A 3FUWA 3KQNA 2CV1A 1W59A 2R6CA 1YSCA 1M1ZA 3I3SR 4EHFA 2QP9X 2ZJ7A 4TYMA 1PZNA 3GUVA 4WFIA 2GAAA 2XXBA 2YXNA 3C70A 2DF8A 5ES4B 3TTYA 4DUPA 1BRMA 3PZBA 4YRLA 3F78A 4TUYB 3ZX4A 3DWEX 4G0YA 4JLAA 3GDHA 5EHIA 1O6ZA 3W5IA 1RWBA 2C4UA 2SNIE 2FP3A 4DB4A 3Q8MA 3P9QA 3DR5A 1QMPA 3PE6A 3ZBQA 5LJIA 1Q0ZA 4DA9A 1PJ3A 5JNVA 5K0TA 4U7PB 3V4RA 4EGSA 1DG1G 1Y3BE 3IAS6 2X86A 1LSJA 2PGJA 3W7BA 4LGVA 1SEPA 2ZRFA 3CW8X 2O5RA 4JCCA 1CQJA 5DDIP 5HXAA 1YRAA 4PWYA 4LF4B 3C8UA 3L1IA 1J09A 3IOEA 1F8GA 2I76A 4TT8A 4ZOLB 2CDNA 4DADA 3V6LA 2BMEA 1FNCA 1E0JA 1RPTA 2IVZA 5EJ6A 1UKCA 4IR7A 5L51A 4XTRA 1RCTE 2DBVO 1ZR4A 4TRRA 5JD3A 4A6DA 4B35A 4EA7A 4NXNB 2NUAB 2Y1FA 5E6UA 2G0NA 5CFOA 3FCXA 3AP2A 4TKLA 2V0GA 4IV8A 3B1ZA 1YT5A 4RDIA 1SUBA 1EDZA 2ZWMA 1JJAA 5DYTA 5KYYB 2IOFK 2PRSA 2WFMA 3RVMA 1G55A 3HI6A 5TNXA 1UXHA 1T1SA 4DYVA 2VAVA 3DL0A 4NPCA 3ENQA 4HWOA 1TT7A 4WNAA 2PBRA 4E88A 3V8NA 2ZQYA 4RVNA 1O5IA 3V1TC 1RM3A 2J4DA 2WV9A 3K20A 1JA1A 5KYUA 4OBEA 2FR8C 5HF8A 1OLXB 5M34A 4LHYA 2ET6A 4OOEA 3G7NA 1JKFA 4Q24A 1L7MA 1NAHA 3P8ZA 3PQ7A 5DXJA 5IT4A 2BSQA 1C9DB 2G63A 1O95A 3H5LA 3DC7A 1DT5A 3ANMA 1L1FA 5I9BA 2JAXA 2GM3A 4RTRA 2W2XA 2H4ZA 2O0JA 3B5EA 4FXOA 1WXEA 1XU7A 2PJDA 4HTFB 2DR3A 5CH8A 4EJSA 4YASA 2DX7A 5E3JA 4FZJA 5GMOA 4ZHQB 4BO4A 4CQMA 3EXIB 2ZZMA 2HFKA 3IPLA 4NE7A 5FWNA 4IILA 5KHAA 1J06A 4NJMA 5EP1A 3SBOA 4GKJB 3UCEA 1UXGA 2OKCA 1F9AA 3EXAA 2VT7A 2C8JA 1YQGA 4R8LA 3ULKA 4CM7A 1P44A 2PUAA 1FZTA 3KUXA 3W4JA 1E6UA 1TAGA 4BZZA 1FDVA 1PLLA 5CYOA 5ALEA 3WV4A 1J33A 4K9LA 3BWMA 1O2DA 4K9OA 4AROA 4OQQA 4V1CA 1E2KA 1JUDA 3EIEA 1GSHA 2EJVA 2XGGA 3F71A 1EA5A 1WLSA 4HTAA 4RMNA 5G1PA 5B1DA 4CKCB 4PO1A 3ER8A 2MT9A 4GBJA 4L5JA 3N8HA 2O05A 5LQAA 4CDMA 5EMJA 1A69A 1A1VA 1EK5A 1FFDA 2OHGA 4L6CA 3W5DA 2C7OA 1E58A 2HDOA 5SZKB 4X61A 1ZP6A 3P9NA 3IMGA 5BQOA 2A0YA 2A92A 1JYEA 1MAWA 4GU5A 4DTIA 4EHJA 3LW8A 2V74B 4KB5A 2R97A 3S8MA 3JZMA 3NV9A 1KP9A 4L8VA 3U61B 2AT1A 4G65A 1GZ6A 2AGVA 3HDGA 2BFNA 4JL8A 3T7DA 3HBAA 3OE7D 1TIKA 1JU3A 4DR7B 2J5BA 4DMGA 3FGNA 1WHTB 1N33B 3OLQA 4QGFA 1BVYF 4Q7JB 3SY8A 4G0QA 1IIBA 2E37A 2VDLB 3AESB 4KK4A 4ZARA 3L1JA 4KXFB 2W6CX 5BSRA 4S1WA 4E2ZA 4YXFA 1XX6A 5JSKA 5JSZB 5ULLA 1T3GA 4XEHA 3J81k 3SMVA 1QUEA 2FSGA 3ZWVA 5BP7A 3OA2A 4K9RA 3CLRD 1WIWA 2WJ4A 1OT5A 1V3VA 4QPNA 5EZYA 1ORVA 3K9FC 1LVUA 2XQGA 1EGHA 1QK4A 2JJQA 1NYTA 1AA6A 1VJTA 2ZTSA 1L7XA 3B70A 3BXZA 1O58A 3H7AA 4FFBA 4LZAA 4WBXC 4ZODA 3SBXA 3S29A 1WE2A 4QHYA 2FUEA 1OIWA 4R05A 4L5IA 3WX0A 5CXUA 4QNMA 4CG1A 1VQ1A 1XL0A 3DJYA 1BXKA 2FYTA 2HU8A 1A7JA 2A86A 2QRKA 3PK0A 1EVQA 1YOBA 4MW2A 4PGGA 2VP9A 3DMFA 5FBKA 5I9LA 1UMDA 2WD8A 2PX6A 2CW5A 2O2YA 3IXLA 3LV8A 4IVQA 5B57C 1RC8A 2GXQA 4TV9F 1QG6A 1U0BB 4L22A 3DB2A 2OZEA 1JR3D 1OE0A 2GZDA 5BOSA 1D8AA 3IVXA 1CDEA 4MULA 1U0RA 3HXMA 3R5SA 4YWHA 2GPNA 3TEJA 1VLLA 4TZ0A 1R9GA 3VZBA 4P9NA 1NUTA 1U04A 2QROA 4X7RA 3FZGA 4W5TA 4AI6A 4CUKA 3SIWA 5CDFA 3MJRA 3AT1A 4N7MA 4KN5A 3UQZA 3PXUA 2P2YA 3KG2A 5EMLA 2W0MA 3EGIA 1J0BA 1RR6A 2HJHA 2ILVA 2X42A 1WMSA 4TL7A 3P2JA 1S7GA 3G6WA 2XWPA 4PLPA 4PICA 4H7FA 1D2GA 1TMKA 1TQHA 1YZFA 3E15A 4GWKA 3VSDA 4EENA 4EX6A 3WLLA 1W9HA 1B0PA 4FZVA 3WKAA 2ID9A 3IT0A 3PKZA 1FPQA 1DX6A 4B7CA 4DJAA 1YFJA 1NVFA 1PFVA 1ZUNA 1JQEA 4MVXA 4AMVA 1P72A 3FWKA 4OFWA 3TMAA 3OF3A 1BX0A 3BIFA 4LF6B 4O2AF 3RSQA 3TTWA 2WBLC 3CLRC 2CFIA 3OM1A 5HZHA 1B8VA 1VHDA 5F9FA 1D03A 2AEFA 4HLQB 1R74A 3AEQB 1A82A 1RIFA 3OUTA 1QCDA 5KVVA 4C3ZA 3EIOA 5BYJA 1QC5A 3BEOA 3T1QA 1YQEA 2H3EA 2VUIB 3LT4A 4AKEA 2VRNA 1M6WA 5J2TA 1F2VA 4AS1A 4BCDA 4KO1S 3RU7A 1ZNXA 2YNMD 1E94E 3ND5A 1WA5A 4HADA 2WJ6A 1U8TA 2EGHA 5I9IA 3LVRE 5HQJA 4OLFA 2H1OA 3GVHA 3D6TB 4URWR 1Z18A 5JJ5A 4R2JA 4DG9A 3SVTA 5A4KA 1RXUA 1LDMA 1IRXA 4NZZA 4NJEB 2VSQA 4ZCLA 4EKYA 1FB5A 1ZIPA 2NNWB 1OI4A 3AEXA 1X1BA 1AF4A 4JFRA 4RAOA 5IJWA 1Q1EA 1SIBE 3DE4X 3I05A 4LQDA 3TNJA 5IYZA 1MENA 4PYKA 4E5NA 3IELA 1Q7EA 3QMPA 1Y9EA 4PS0A 1T4BA 4X7MA 1U28C 4MTLA 3RIHA 3LUPA 1U2ZA 1VSQA 3KPUA 3ADCA 6CHYA 2ODTX 3FM9A 3OCCA 4BMOB 5IBQA 2W83A 1XYGA 5B7NA 1R0ZA 2D59A 5CFNA 2ATIA 1Q1AA 1SRQA 3I72A 5MN6A 3U7IA 2BD0A 3WDSA 3IE1A 1TEHA 3HB5X 4ER6A 2GN6A 5C8DA 4GT1A 2YUIA 3OH8A 3I9V1 5EXDA 3NKLA 4ZC1A 3MGGA 2AMLA 3AB8A 3OLCX 1G9TA 4HQKA 2B99A 2OCBA 1ZRHA 1KAMA 2JLRA 3BD6A 5CM2Z 3EIFA 1V71A 5EE0A 2XSZA 3T99A 4QLBA 4WBNA 2RBKA 4W8OA 5JSZA 2R1UA 4ZVPA 1P81A 5FUVA 3ZX5A 2Q4OA 1P0CA 2VSFA 4ENSA 4JOQA 3K9NA 3BORA 1FP6A 4EKIA 5KTKA 4Y6GB 2G17A 4D9CA 2DFKB 2IY7A 2F64A 3NFYA 4CF6A 1PI3A 1L5YA 3FZEA 4WJLA 5KQGA 1Y9ZA 1NM5C 2WVGA 2Y05A 5EZQA 4UBNA 1E61A 2PL3A 4K3UA 2TRSB 3U39A 1RPNA 3N3AC 2GESA 3E0XA 4OU5A 1GYPA 4W7SA 4JUFA 3L0CA 1P4AA 3HXKA 1JR4A 4KIFA 2XZLA 2BP7A 3KVOA 2C57A 2IHYA 1FDUA 2JCBA 1V5FA 2HMUA 1U3UA 4BMZA 1Y33E 4O6VA 5I4KA 3HP1A 2RB4A 3OE5A 1TJ5A 5HIMA 3T5TA 5JAIA 2HT1A 1PIWA 2PLAA 1M2GA 1JQ3A 3OFKA 4OFZA 4F8JA 3PGKA 2DKOA 1DQYA 4JVMA 2UZ1A 2PNFA 1NP3A 4TL9A 3JWGA 3WLHA 3T38A 5LPNA 1G64A 1OH6A 2X8WA 2EJTA 2QAGA 4WLUA 1X7YA 5HIIA 5LYYA 2AS0A 4ZD6A 1AMNA 1N6RA 1UBLS 4BLSA 1EEXB 2Y99A 4WNAB 2RGEA 4ND8A 3SG0A 1NF3A 1W46A 2KE5A 2DJ5A 2FG6C 2VK4A 3JQAA 1DI0A 4I1OA 2HDWA 4XR9A 2EBFX 3INTA 3PICA 2H18A 4QUAA 2A0KA 2KMLA 2ZWIA 3LHFA 4JJ8A 4YP6A 3W2TA 2FQ1A 3WNBA 1U5CA 2A9OA 2FETA 2H7VA 2ZB2A 1T2CA 3KR9A 4J7UA 2W6PA 2VF5X 4PBSA 4XM1A 3UMCA 5BSWA 5JR3A 4P6VF 5AKZA 2MYNA 2BBTA 4IQ0A 4XX1A 3KLPX 5AM4A 3TDKA 1WB9A 4BO8A 1R4MA 5LP6C 1EUCA 2UZ0A 3KJXA 2FOLA 4GPTA 3CCCA 4MQUA 3QXJA 4WLFA 4XUGB 5E1DA 3UJCA 1SXIA 3THXB 3D43A 5DHFA 1ONOA 2FRVA 2CV0A 1NGSA 4PCUA 1KP2A 4BGEA 3TSZA 2CLLB 4NHOA 4C0JA 1GG9A 4MKZA 5G1NA 1I3MA 3C6MA 5K45A 3DH0A 3Q5DA 2WSSA 4M9XA 1PR4A 4CRWB 4JYCA 2DB3A 3GIWA 4L9WA 5F4BA 1XMPA 3HR8A 3EBLA 4R2KA 5BMVA 3KBBA 1D4ZA 3C8MA 1JR3A 1X0XA 3F74A 5L9AA 4EGCB 5KU7A 2NQTA 1V0JA 4XJXA 4YP0A 4CR7A 1YV9A 3E8XA 1NXXA 2X19A 2I4NA 3FWHA 3HMQA 3RJZA 1CLEA 3PVZA 3UENA 3F6YA 4R0VA 4LXUA 4CIDA 2PGLA 1PLKA 5BURA 2FZKA 3R5XA 2B6HA 2ZYUX 3DBHB 4MUIA 3QVXA 4NZPA 1MOQA 5ECGC 1SURA 5FD8A 3RE1A 4MTCA 3L92A 2D06A 4WDRA 3UIEA 4LYEA 4IH1A 1N0HA 1EPUA 1CUJA 4LCJA 1GA4A 3D4OA 3BAZA 2WJPA 1SU7A 1EVLA 4PRZA 3W78A 3W8FA 3WK4A 2WIKA 4CQMB 2QW8A 3NHZA 1U80A 3WNDA 2NZVG 2ATEA 3LCRA 1UMCA 2VHCA 4U9IS 4J1SA 3WWYA 4IYJA 2VRBA 1XV5A 1GAJA 3DFUA 1P2TA 1JL3A 1XCOA 3Q7PA 1NMSA 2VDUE 3NASA 4G8CA 4R1TA 5JDIC 4CMIA 4MIYA 3VR1A 5C5DA 4GVXA 4N03A 3K1YA 3UK1A 4X64B 4ECEA 3IAHA 4YUXA 1UZLA 4GLLA 2B30A 3AJ9A 1EYZA 1MLDA 1P2BA 4Z3OA 2HWXA 3NM4A 4U2DA 3OF2A 3IOMA 2D74A 2FKNA 5AKIA 2Z8YA 2OD9A 2HIMA 2C04A 4HYYA 5DCYA 4YN3A 1R8SA 1CB7A 1YI8A 3D4IA 4ZWNA 3RS3A 3U56A 5FBWB 2ROQA 3WA6A 3IDAA 1QKKA 1SY7A 4FK8A 4K46A 5DI3A 3A6GA 3GRFA 4P7BA 4PC7A 4AURA 4IG9A 4JIGA 4AJHA 2V9ZA 3UH1A 1HYEA 2BPOA 3HVHA 3WYDA 3UV6A 2YXEA 3ROXA 4OSEA 1PQ4A 4KTTE 4JODA 2J3EA 3CVVA 1ULBA 4B6EA 1U7TA 3X0DA 2WEKA 3CR7A 1RC1A 1R4NB 1RJ9A 1XCBA 4ZKEA 5A4FS 1XEWX 4YLEA 3DV0A 2VSNA 1A9SA 1VJGA 3IP8A 3G0OA 1HEYA 4WZAA 3NOVA 3KKPA 3LOUA 1OXKB 1Z7YA 3DTNA 3SZMA 1QP7A 3NH9A 1GUAA 5KVCA 2P11A 1U90A 3AVTA 4FGUA 3UANA 5D84A 1H2HA 3L06A 2Z0MA 1X74A 2KPOA 3PD7A 4G8BA 1C9EA 1L4UA 2GB4A 1UEJA 2P4EA 3LZCA 4K6HA 1U9IA 2HRRA 1MJGM 4WIAA 4CGZA 2MHCA 3LC7O 1JQBA 3LHIA 4JOBA 3JASA 2CNWA 2OCLA 5K6RA 1D5CA 2AFIB 2D7CA 3FCOA 3HRKA 3GFSA 4FOOA 1WU7A 3ZU3A 4B6OA 5KQMA 3RYFB 4TKVB 3TL3A 2PX4A 1NMYA 2GK3A 1JLLA 1QZXA 2CK3A 5J9FA 4IGKA 1KHHA 3QBJA 3TD9A 3MWYW 4BO1A 4NE2A 3BH7A 4W99A 3D1JA 5FV4A 3ZN2A 1NOIA 2P9QA 2IL1A 3RF7A 5IMSA 2GN1A 1PDWA 1ND5A 3B3QA 1CZNA 5JH7F 2JLVA 4FMDB 4IDEA 1C3LA 3URMA 2IUUA 2HPZA 2WUDA 4NFYA 4TZKA 2NT4A 1ZJYA 2GTPA 1KEUA 1G38A 3RUCA 3LHKA 3ZLBA 4KFCA 3BFXA 1PEAA 3F4KA 3BFJA 4ASUA 3MPUA 4AZ3A 2GDJA 4R40A 1X8XA 3VKWA 1M3SA 4HPJB 4HCJA 3P1JA 1RQXA 3S1SA 3KUCA 5F1KA 5THXA 4CIXA 1L7EA 2QN2A 1T5SA 3GUCA 4G01B 4DMCA 2VG8A 2COEA 5K6AC 2AJLI 2EIHA 1E1YA 4G9BA 5HDBB 4ALMA 2VDWA 1VP3A 5E7JA 1ZU4A 1LLUA 5J5AA 2H48A 4KLNA 2NU6A 1RC0A 4BAZA 2ECKA 3OHMA 4YAKA 3L7JA 1L4MA 2DFDA 3G49A 2ZGVA 5TXGA 1CUCA 1PFKA 1I7NA 4FHEA 3PITA 1DIGA 4FMPA 1Z2EA 2JJ2A 3ZDEA 3Q8XB 4R7GA 5HVNA 4WECA 1QO0A 5KC8A 4PXAA 4GZLA 4HBZA 2WT9A 3DFMA 2A9VA 4ZPXA 1TMYA 3C6QA 3E70C 1KJJA 1UT8A 4H7EA 4DIKA 1VL2A 1R6XA 1NBEA 1MC5A 2B5OA 3F67A 4BECA 3A1EA 2IF2A 4C0LA 2R6FA 1PW5A 4AU1A 4ENQA 3RTDA 2R8PA 1TUGA 3PENA 3O4IA 4MRVA 1KH2A 5CHEA 3CEHA 5AJTA 4YRKA 3LZ6A 3L6OO 1KYVA 4RMJA 1KSJA 1XTKA 3PWTA 4QQ8A 1J8VA 5EQJB 3NHMA 2GILA 3E7WA 4AMUA 4MS4B 4N3AA 1CIPA 1GGHA 4ZREA 2H52A 2BMVA 1GN9A 1VI5A 1KJNA 4H7PA 3GROA 3OT1A 5CRIA 3A2MA 1SUAA 1CT9A 4EY6A 5JS8A 2WU4A 3KYIB 1VSVA 2X1VA 3EY4A 3K8YA 2PSSA 4BJ1A