1DAHA

Dethiobiotin synthetase complexed with 7,8-diamino-nonanoic acid, 5'-adenosyl-methylene-triphosphate, and manganese
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dahA00
2WWHA 2ZS9A 4LZZA 3LBNA 1EK0A 5HCIA 3QG5A 2OCPA 3FHOA 4QGFA 1E9BA 4RZ2A 3GD7A 4RY2A 5C1BA 4ZKEA 2BKEA 3BOSA 2YWFA 4D4JA 1MR3F 4I1UA 1G19A 1P72A 2CVHA 4MA4A 1E9AA 3IO5A 3V4RA 3HYTA 3REGA 4EJSC 1Z0AA 1GVNB 1CIPA 2QENA 4PQRA 3RABA 1OH7A 3THYB 2QUZA 1SKQA 3VR5A 1NLZA 3NHBA 1NVVQ 3NIBA 3DZ8A 1S9HA 4A0RA 4WAUA 1S4QA 5BN4A 4QM6A 5KPJA 5KDDA 1EFHA 4KAXA 1DAHA 3A1UA 4DLTA 2FEOA 4M0LA 2W83A 3CKLA 1OB5A 1D9ZA 1VIYA 1BH2A 3Q5EA 2CJWB 4EPYA 2RHMA 1ZIOA 2LCFA 1T9HA 4B48A 4Q19A 5D3QA 2Q9AA 3ZIAA 2J5XA 2K5UA 2FH5B 1N6KA 3WBKA 1US8B 5ANRB 4KCGA 3U7GA 4IEEA 2XOKD 1NBMA 4EFNA 1PLKA 3SC3A 1H8HD 1QHHB 2ZRNA 4XWOA 5B30A 5EP3A 3CX8A 1KZGB 1VTKA 4ZDJA 5EQTA 2VSFA 4QGAA 4YONB 2BOVA 1CKEA 1U0HC 2B8TA 2F6RA 1MO5A 2ZRGA 1U2RA 3QXSA 1N6NA 3B78A 3PFIA 1G41A 1P73A 1F3OA 5EXTA 1Z29A 2G0NA 2UVQA 4NYJQ 3T06B 3N2EA 1HURA 3MLEA 1KK3A 5CIQA 4B32A 3GLHB 4TSFA 4Q7JB 3ZZUA 1H8EA 5IK2D 2CCKA 2GTPA 1II0A 2GNOA 2OSBA 2VHCA 3PXGA 3BGWA 1T8TA 4RD0A 2XXAA 1MABB 4C7OA 4A2WA 1NN1A 1QVRA 4TQUS 3RVBA 3UWOA 5B57C 4CT5A 1UADA 2QSZA 2VQSA 2GCPA 1JJ7A 3LRPA 3TSZA 2Z6VA 2GCNA 1PJRA 5GJWC 5CK4A 5FI1B 3G82C 5C18A 4TMXA 4Q4AA 2RB4A 4RCZA 1LV7A 1TQ2A 3KDSE 2BHRA 3LFUA 2W6ID 1ZC3A 4PAOA 3W9YA 2ZREA 5K8UA 2GBLC 3RWOA 2XNDA 1RFLA 3ZLJA 1NI3A 2CK3D 4I1VA 3CONA 3NKVA 5JJKA 3H2YA 1G9XA 1YQTA 2ZSFA 1OFHA 1Q0UA 5DN6D 2QAGC 4YMUA 3ASYA 4EPXA 3SR0A 3EPJA 4US1R 1Z08A 2EFHB 5GADl 4DLWA 3GLGB 2WV9A 4QKQA 1KIMA 1NKTA 3MSXA 4EAQA 3KJGA 3AH8A 4URYR 1E9EA 4MUBA 1KAOA 3UG7A 3EWAA 2DWOA 4JL6A 4PAQA 4B35A 4KV9A 2FX3A 5LDDC 3TH5A 3T35A 3TLXA 1MO3A 5BW8A 4HLDA 1N6IA 5FBWB 4ESVA 2YINC 1P4SA 4B3XA 4Q4LA 4M1KA 5DYIA 5J5CA 1ESMA 2IYRA 5D3MB 2EFDB 1KSHA 3VKWA 3K9NA 4PPNA 4CDGA 2HEIA 1FW6A 4C30A 2A2ZA 3OE7D 2ZSAA 2CEAA 2ZRDA 5CDFA 3K1JA 4KFRA 1H65A 1QHSA 3IEUA 4KI0A 1BYUA 2AR7A 3CR8A 5KNDA 4Z1MA 4B3GA 2O8BA 3P32A 5FPSA 1UAAA 2VLIA 3SE0A 1E2HA 5H8WA 2C99A 1YHNA 5LD2C 4PANA 1Z07A 2QMOA 5EP1A 2BWJA 5M04A 5IF9A 5LD2B 4LJYA 2AK2A 2V54A 1M1YE 1BIFA 2DBYA 4KVGA 3TW4A 1HYQA 1DAMA 1NF3A 2OCYC 4JT2A 4BPBA 2GXUA 2CJWA 3TAHA 4AKGA 3OIWA 2A5GA 1E69A 3KL4A 4WXRA 2E9SA 2YC4C 1UDWA 2PMDA 4C3ZA 3WYAA 2WIAA 4MKHA 4HDCA 4JLAA 3W6PA 4N3NA 1NSFA 4G5OA 2J0VA 3GLFA 4ERNA 1JR3D 2GKSA 3KKQA 4NYIQ 2A5FA 1ZUNB 2MMCA 5JRJA 3VAAA 1G64A 3CIOA 4HDQB 1GKYA 1E0AA 1T3SA 1OT3A 4NCNA 3QBTA 4RD2A 5F2EA 1LF0A 2G1JA 4CEJB 2EFCB 5AR1A 3EARA 3L82B 3KFXA 4LHZA 3X1WA 3NDPA 4N0DA 3OIUA 3Q7PA 4G5GA 4KXFB 4B44A 3ADDA 1IY0A 2CE2X 3TBKA 2WBLC 5SZJA 3ND8A 4CVNA 3VX4A 4BLPA 3FYHA 1OE0A 1FOEB 2HCBA 2Q3FA 1ZNXA 1W4RA 2XSZD 3GJ6A 2N46A 1UDXA 1WMSA 1XD8A 2NPIA 4OYHA 4IDQA 5F3WB 2W6JA 3D6TB 2G77B 5L3SB 3K0CC 1GP2A 2CNWA 3GEIA 5G53C 3VR1A 1MRSA 3OAAD 2BEKA 2R6FA 1ZM7A 2O0JA 3PEVA 5JWHA 4U5XA 5EE5B 2QSYA 1PZNA 1FZQA 2QROA 2R6GA 1NLYA 1G20E 1XCMA 4CEJA 3AF2A 2DWPA 1JB1A 3SQWA 1JEDA 1XP8A 2PLRA 4HUQB 2IYWA 2FZLA 1Q22A 3RRZA 5JBQA 1N0UA 3QENA 3QKRB 3WNCA 4P4SB 2QP4A 3EPLA 1KDRA 4L15A 3R7WB 1F6BA 3CH4B 1P2VA 5KSZA 3CPEA 4QXAA 1ZM3A 3GLFB 3ZJYA 1G8YA 4LV5B 3DZDA 3GJ5A 1NL3A 1DARA 1E2JA 3U4QB 3EZ6A 1G4UR 2ZJYA 2GRJA 3CWQA 2JLVA 1UKYA 1MV5A 3DPUA 4KBFA 1D2NA 1JJVA 2ZI9A 3AP2A 1S1MA 5EUMA 3HPRA 4O2LA 4OI4A 1GIAA 5FFMA 4LWZA 3BD9A 3LBHA 4D0NA 3UPUA 5AJYA 2H5EA 1UEJA 1G5RA 4EQ6B 2ZM5A 4MGZR 1EFRD 1Q44A 1X86B 2DR3A 3QG1A 4JVSB 1XBTA 3SEAA 3EIHA 3T1TA 2CVFA 2VHTA 4QG7A 4ZPXA 3W8RA 3QY0A 3QKTA 4RZXA 1P5ZB 2A5YB 3OAAA 3QNUA 4D25A 2J0QA 1E1QD 1II9A 2C98A 3CRQA 1Z2CA 3NG1A 3WYGA 1GSIA 1CJTC 2H18A 1DEKA 2C8VA 2FSFA 4DLYA 4NONA 3TR5A 3U3MA 3KJIA 3KTAA 3TUZC 3U7HB 1OH6A 3AGPA 1WXQA 4LYAA 5DNYB 4WZAE 1IN7A 1AM4D 1XFAA 2GBLA 3BORA 4PHGA 3O8CA 3LWNA 4DDVA 1VYUA 3GLHA 1UBGA 1NN5A 1HE1C 3V9PA 2JLQA 1ETUA 4TMZA 2H7VA 3I73A 4L4UA 1P61B 2QAGA 4TLDA 1KZ7B 2QPTA 3K9LA 4CEIB 4U7DA 2WJIA 3BRWD 4FWIB 2HJGA 2QTVB 2WHXA 1HY3A 3BAFA 4GFDA 4XOIA 4BLOA 2IYZA 4JVLA 2FFHA 4C0KA 2QGNA 5FR2A 1JPJA 5HZHA 4LSGA 2AHOA 1IJEA 4Z8YA 4BGDA 1MH1A 2C96A 4P4UA 2PCJA 4AC9A 4MKGA 1YE8A 5J40A 4WXPA 3U3OA 3FHTA 2JJ8A 1W7AA 2HYIC 5JEEA 1BMFD 3FPAA 2R65A 1CF4A 3FOZA 4PQYA 1DG1G 3C8UA 3AKEA 1ZD9A 2X8AA 4A8JC 2PLFA 3NTUA 1OIWA 1CR0A 3QI2A 1LB1B 4A8JB 1W5SA 3E70C 2ANBA 3B1VA 3ZD7A 4LJ7A 1OSNA 221PA 5KHOC 1RJ9B 2WJHA 1KSJA 2A78A 2RH5A 4HAVA 3SDZA 1RRGA 1E2DA 3AVOA 5BN5A 3B9PA 3ADKA 1SZPA 2HUPA 3CZQA 4HAUA 4BFSA 1NNEA 3THYA 2OLJA 1VG9B 1Z6YA 2BMEA 1VCIA 3FHCB 1G6OA 2BJVA 4BRUA 2XTZA 4TZ0A 4F4JA 1VG0B 3QPWA 3THXA 4BFXA 4GMDA 2IBMA 4JVMA 4JLPA 1PUJA 1XPUA 2O0HA 2G83A 1BYIA 2GEVA 3RANA 1E79D 2QM8A 2EFEB 2H8KA 4IW3B 2YV5A 1YZUA 2HJVA 1NIJA 1M34E 1S3SA 1TQ4A 3QF7A 4IDHA 4W5WA 1KI8A 2NGRA 4Y0AA 1ZAKA 2ORWA 3OHMA 2NO0A 2VH5R 2NQ2C 4NMMA 1QBKC 4XWAA 1VCNA 2I1VB 4DJTA 3CLVA 1SHKA 4LK2A 3PR1A 3AF0A 5TY0A 2ONKA 1U8YA 1QHIA 2VTKA 4HB2A 1XEWY 3RDPA 3SS8A 4NBSA 1KAGA 4NCHA 4YC7A 4Q03A 1W36B 2D7DA 3RS5A 3U3KA 3VR3A 3MJHA 1ZIPA 4IDOA 3RRMA 4ZDIA 2WJGA 3RC8A 5TVKA 3RLFA 4D80A 1AKYA 1W0JA 2X2FA 4M9SA 3VNVA 2Z5FA 2H1LA 2QMEA 2IS4A 5G41A 2DB3A 4JLDA 4R2HA 1K5GA 1TTTA 4EPRA 1CJMA 2NO9A 1P2SA 1KI7A 1SXJE 4LX0A 4LHWA 4H1VA 4KHZA 2YWHA 4Q9IA 2D06A 2P5SA 4UNQA 1YJ5A 1GL6A 1Q1EA 2ZSDA 1CU1A 4IVPA 1AKEA 2CCGA 1VMAA 1ZJ6A 2FSGA 1ANKA 3FKSA 4NE2A 4FCWA 2WKRA 4LDJA 4QOSA 2IUUA 1WP9A 3LY5A 2PJZA 1HV8A 4ZI2A 1G8FA 3T34A 3WY9A 1KY2A 3F8TA 5A5GA 1CRQA 1T0HB 4OK3A 4U00A 3SBDA 1KO5A 1P3JA 3EPKA 3FTQA 1Z0IA 1K6MA 2LWIA 4IOKA 5F9HA 1R4AA 4KFTA 4DLXA 4FWTA 3GFOA 2IUSA 1H8HA 2YOFA 1KDTA 1OJLA 3QBVA 2O5VA 2XOKA 4G5SA 5DIFA 4S2EA 2FF7A 2EFGA 3HU1A 5BQ5A 1TEXA 3C15C 1MO4A 3U6BA 4KFSA 2F3TA 1XMJA 3WXMA 4UXIA 4RFSA 4Q7KA 1LY1A 1IQPA 3EXAA 4JLOA 3BFXA 3LAWA 4OK6A 4A2PA 3GLIB 1J99A 5E7IA 1SVLA 2QNRA 2XTNA 3CPHA 5L3VA 4OKSA 2Y8EA 1NY6A 4DDUA 1R8SA 2ZYWX 2IUTA 4FCVA 4EUNA 1RRFA 1E2MA 4HSEA 3M1IA 3SN6A 3UG6A 2EYQA 4RSGA 4DZZA 1OYYA 3SJBA 5FOSA 2GF0A 5HKKD 1E9FA 3LD9A 1VYTA 1IBRA 1EFTA 4B75A 4LJ4A 3B85A 5JLJA 1DPFA 1ZMXA 3WBJA 1M8PA 3KB2A 4QJ5A 3Q5DA 4XTCS 1EFCA 5JWOA 3CNNA 3TR0A 2GF9A 4M21A 3RC3A 1W36D 1CTQA 2O8CB 4GOXA 1AN0A 1O3YA 3D8BA 4XSHA 2Q3MA 3AUYA 2OLKA 4BECA 4TYNA 3BB1A 3GJ0A 1WF3A 4OHYA 2DFKB 2VSOA 4XTRA 1W2GA 1OHHA 3M6AA 2WTUA 4Y0VA 4DIDA 2BCJQ 2QORA 5AJVB 2R44A 4IEIA 2PT7A 2IC5A 2IXGA 3F0TA 4LV8B 1JQLB 1S96A 2AWNA 1HT2E 1Q12A 1X1RA 2V4ZA 1XX6A 3O8RA 3R8FA 1WBDA 5ELXA 4F92B 3K0SA 1RPZA 2IYYA 1HT1E 1N2CE 1QDEA 3BC1A 4IDPA 3CNOA 1W4CA 3T5DA 3QKSB 3MMPA 4LV6A 3A1VA 3AVVA 4D81A 1GWNA 5FTMA 3X1ZA 4IVQA 4B6FA 1FNMA 5A0FA 4Q47A 3NH9A 2D4HA 3FMOB 2ZI4A 1OXUA 4OQXA 3T5GA 4ZCMA 4GRAA 2WIBA 2WM9B 4AIIA 1OPXA 2QMUA 1ZD8A 2J87A 3GLIE 2ERXA 4OQLA 4JVNA 2ATVA 1HQCA 2ZIAA 4PPGA 5KNBA 2ZQ5A 6Q21A 1OLOA 4NCIA 3WYFA 3I62A 3ZVNA 2VEDA 4LC0A 3L0IB 4P4TA 5KYKA 1G17A 2CNWD 1G3UA 3LBIA 1XXHA 3SOPA 4W7SA 4HZUB 1Q1BA 2WKPA 1ELOA 2J45A 3W6NA 2FPKA 2GESA 2O8DB 3CRRA 4BFTA 4KO8A 3CRW1 4FMDF 2VYFA 3I5XA 5FBLB 1SULA 2VSXA 3OEEA 3OFND 4NH0A 3MWJA 4KVAA 5GJBA 1SQ5A 1Z63A 2F7SA 3GEEA 5DISB 2NO1A 3THWB 4XWKA 2C9OA 4GSYA 5JCZA 3AB3A 1E9RA 1FL9A 2RKOA 4DLVA 4JL5A 4HB0A 5KPDA 1P9RA 4TZ6A 3C5CA 4LGMA 1R0XA 3IDQA 5KSYA 1MT0A 2VRWA 4Z8XA 4M1WA 2GXSA 4OQNA 2GETA 4H9GA 1KO1A 1GNPA 5EUQB 2FNAA 1QHGA 1GM5A 1GRQA 3U5ZB 2JLYA 2OAP1 3ZQJA 2RGXA 1JR3A 1Z47A 3R9IA 1E4VA 2ZUDA 3I8XA 4Q9LA 1E9DA 1G21E 4TTQA 3EPHA 1G3RA 4HDOB 2X19A 2JLRA 2Z83A 5GVRA 2OO7A 1ODFA 2AFHE 4M1SA 1OIVA 3WMFA 5EXPA 1U8ZA 2YHSA 5FUYA 4DHEA 1CEEA 5FBVB 3IBGA 2VHQA 2F1IA 4H1UA 2ZS8A 4IFBA 5UKDA 4DSTA 1XU4A 3BS4A 4EFLA 4Q1EA 4OBEA 1R8QA 4KFUA 4J0QA 5L8VA 4OI1A 2XZLA 3NDBB 1U0LA 1JEEA 1E2NA 1N6PA 2J9RA 3OIVA 1IN4A 4FI3C 5HPYB 1CR2A 3H86A 3QF4B 3M0EA 3AP1A 4ABYA 4PHFA 1HEIA 4HAZA 3OE7A 4A0GA 2O8BB 1DO2A 5G3YA 3C5HA 2ODBA 4MRRA 5BN3A 5AJXA 3VTKA 5KOYA 4GOKA 4D26A 1YZGA 1NMYA 3ETLA 1CP2A 1D2MA 4CT4B 4NU0A 3GFPA 3UWKA 4Q4JB 4U02A 2Q21A 4LBZA 2WOOA 1YZLA 4BFVA 2R8RA 5BYKA 4UXJA 4W9MC 3IIJA 4ASUD 2P65A 1P9WA 4G01B 1D9XA 1JALA 2XXAB 4RKFA 4TLAA 3QEJA 3WP1B 1KMHA 2IF0A 2ZI6A 5KUTA 3K0EA 1ZNZA 2VP9A 5FPYA 1YR6A 4EPTA 1U8AA 3GJ3A 5KU1A 1RE0A 2BBSA 3HWSA 2JJ1D 4Q48A 4N0EA 5JJIA 3BH7A 3I1FA 3TE6A 4V02A 1KI1A 3KKMA 3KXIA 3OZXA 4LRWA 2ZETA 1FTNA 2O0KA 3EASA 2XSZA 3CWZA 1SVSA 3LLUA 1VG1A 1KK2A 1KDPA 2BIFA 1SKYE 2QM7A 4TTPA 5CIWA 3WP0A 4DCNA 2CCJA 1W36C 5JI3E 4B2IA 1VG8A 1ZD1A 4L16A 5HE8A 2W6IA 5JSZA 4D82A 1W49A 4AWXA 3CO5A 1XTIA 4AD8A 2FMXA 4M53A 5B2ZA 3W3ZB 1E9SA 3B7GA 1KJWA 2W58A 2BM1A 2WSSD 4W5HA 4Q01A 1KSFX 2JLSA 2ZR9A 3C4JA 1KJYA 1E2EA 4IOJA 3TJZA 3LQRA 4TMKA 2ECKA 1QHNA 1TAGA 3SYKA 2WSSA 1X8KA 4AURA 1XZQA 2WSMA 4WZBE 3Q8XB 3IEVA 2Q9CA 1E98A 1KGDA 1TQ6A 4X8MA 5TB5A 1BS1A 1GL9B 1M2OB 1GAJA 2IYUA 2BMJA 1WCV1 4E09A 2XB4A 3QKRA 4B74A 1GOTA 2GJ8A 4LBWA 1F2UA 4A36A 1Q21A 3PUWA 3WNDA 3A6PC 3NC1C 3ZYCA 3ZD6A 1AS0A 3LNCA 1DAGA 4Z51A 1WBBA 5JCPA 1Y3AA 1G7CA 4I1OA 1KI4A 1NRJB 2PMKA 5E95A 1EGAA 3BE4A 4TTRA 1DTSA 1E2IA 4JL8A 2RAPA 4M22A 1XEWX 1DELA 2ZITA 3AF1A 2RHDA 3VR6A 1ZU4A 1IXZA 5DH9A 4C0HA 3NWJA 2HDNB 4Q7MB 3SJCA 1GILA 4RJLA 1J7KA 3IIMA 2C2HA 2FDCA 3ONWA 1WRBA 1E2LA 1RJ9A 3U2QA 4A92A 2WAYA 3I32A 1KTVA 3Q9LA 3EC2A 2F1JA 3E1SA 3UMFA 1A2BA 1NVUQ 2C95A 2B7CA 5FUVA 2ZSBA 3CPJB 2NOAA 2ZU6A 3E5HA 4JZKA 4A1FA 2WICA 1B0UA 1NJFA 1NVWQ 1W4BA 1Z22A 2JEOA 3A1WA 4FMCF 1SGWA 2BMFA 2ZAMA 3LVQE 3NBFA 3OESA 1JBKA 4TT3A 1FNNA 1G3MA 4QM7A 2IYSA 2FV8A 2MSEB 4RD3A 2Z43A 5CB6A 1N5KA 2GJSA 1I2DA 5CK5A 1VYVA 2IS6A 1LS6A 2GWHA 2XNDD 1OF1A 3GJ7A 5HKKA 1AQUA 1U81A 2YVUA 3B82A 1E0SA 1W44A 1Q57A 4L5BA 2VHUA 2V7QA 2X1VA 2W0MA 3PUYA 2CXXA 2WWYA 3PQCA 4EPWA 3CX7A 1FMJA 2DFNA 1N0WA 3QVUA 2ZRCA 1UF9A 5FTJA 3RRYA 3LQQA 3FB4A 4YLGA 4JSYA 1JAIA 1KO8A 2QAGB 2GDJA 1XTQA 1FP7A 3OEHA 4WBSA 4BZXA 3LA6A 2KWIA 2BC9A 3KQNA 1YZTA 1G4AE 4IFEA 4UJ5A 521PA 3CF2A 2BCGY 3SJZA 2C03A 1F2TB 3WNBA 1EESA 3NBYC 1N25A 3BH0A 3R7WA 2AFIE 3B1WA 2CHVA 3L0PA 3QXHA 4L8GA 1Q3TA 3P27A 4Q18A 1XEXB 1US8A 1E96A 3Q3JB 3NXSA 3QOFA 1GNQA 4PZZA 4HB4A 2YYZA 4DC9A 3GJXC 1NBMD 4OHVA 4AKHA 3K0CA 2ZI3A 4MDFA 1QRAA 1PV4A 4DWJA 1O87A 2ZJ5A 3HR7A 2YOGA 2ZEJA 2J3EA 4P32A 3EZ7A 4II7A 1LS1A 2XZPA 1DG3A 4TMTA 5IDVA 3TUJC 5AUPB 3WMGA 1IXSB 2C9YA 2REXB 2AD1A 3K09A 5CJPA 3PJRA 2O8EA 5CM8B 4AKIA 1AZSC 4IHQA 2PEYA 2P5TB 4F93B 4QNRA 4I1SA 2NMVA 2CBZA 5JEDA 4DLSA 1W0KA 2N1BA 3GLFE 5FH9A 1DAKA 1HA3A 2D3WA 3N70A 3SI7A 3X2SA 1G3QA 3K8YA 1XJCA 4DBLC 1AGPA 4F4CA 3AQ4A 2KJQA 1Z0FA 2IEYA 1XZPA 5C4MA 3RS7A 2QZ4A 3B13B 4BFUA 2JJ2A 1F2TA 3GQBA 2ORIA 5AJWA 3IBYA 4D4LA 5EXSA 1I4LD 2QTFA 2HXSA 3HYRA 4D4MA 4Q1DA 2PBRA 3AF3A 4BASA 2CL0X 2NO7A 1ZUHA 2WVJA 2P67A 3BXZA 3MWLA 3KXLA 5FOWA 2IWRA 2EQBA 2QI9C 3C16C 2JAQA 2WOJA 1EWQA 2GAAA 1GKIA 1X1SA 4CEHB 3CNLA 3HR8A 5AUOB 2WWXA 2WMOB 2JCSA 1T6NA 4NYMQ 2Q3HA 3PEWA 3ND9A 4G5QA 1L8QA 1DAIA 1CRPA 5LB2A 2ZTSA 1EFUA 2ZJOA 1WE2A 1Z0JA 1TEVA 2QTHA 1QHHA 4B71A 3K9GA 4DCSA 3X1DA 2JJ2D 3W3AA 2IHBA 3E2IA 3I4LA 3HP1A 2F1RA 4PC3A 4JJZA 1R5BA 2ZJAA 2LKDA 3CF0A 3MD0A 4BQSA 2ZRMA 1F48A 3KQLA 2XEXA 3TW8B 2OZEA 3ZVRA 2IS1A 2F43B 1FMLA 1G7TA 3IKJA 4LJ8A 1FQJA 1TNDA 2R6AA 3DM9B 2QG6A 2OUKA 1OXSC 4XH9B 2CDNA 4CGZA 3HJNA 1R7RA 1RRCA 2D62A 4JBYA 1OXVA 2VP0A 4PO9A 4TWZA 3NBXX 1JR3E 2EWWA 2GVDC 3H4MA 4C4PA 3FFBA 2QAJA 3LXRA 2C77A 4A8JA 2BMDA 1G7SA 1ZNYA 3LW7A 3VR2A 4YXWD 2P0EA 2EW1A 3EA5A 4C2TA 2O8FA 1U90A 3K9HA 2QL6A 3MG9A 3H1TA 1A2KC 5BXQC 1XF9A 1DAEA 4GZMA 2P6UA 4X8LA 3U44B 2H17A 4I4LA 2QRNA 3IHWA 3UMRA 3UANA 4JLBA 1TF5A 4R98A 3AV0B 4TQ9A 2FSHA 2HCJB 2ZRAA 5H70A 4ARZA 1SHZA 5J4HA 1L4YA 2XITA 5G40A 1GKUB 2ZXUA 5HCNA 3FWYA 2F43A 5JS7A 3U61B 1Z3IX 3GMTA 2ZRPA 1X8JA 3A4MA 4Q4HA 3RNLA 2UZ3A 3VKHA 4F38A 4D0LB 1E6CA 2G1KA 2KB0A 4P31A 4G1UC 2OXRA 4QL3A 2ERYA 3KB1A 1XPRA 3C14C 3GLGA 3HU2A 1XCGB 1A82A 2B21A 5AWFC 4DEYA 5DGXA 1CXZA 1ZBDA 3VX3A 2YC2C 4C9BA 4LI0A 1I4DD 1XTRA 3AVTA 1JR6A 1TU4A 2HF9A 4NKRA 2QY9A 2YNMA 4LJAA 4RZ3A 4PR0A 1J2JA 5TMPA 4LOAA 1A4RA 1COWD 2ZANA 1FTSA 2AK3A 3BFVA 2BJWA 2UKDA 5GVSA 1W2HA 2ZUBA 1ZU5A 5DLQC 1DBSA 4E22A 3X1XA 3AM1A 1C4OA 4HUQA 3SYNA 1ZP6A 1RRPA 3QPUA 2P3SA 2V7QD 1PVOA 1N0VC 1HUQA 1TL7C 2NZ8A 4D4KA 2QBYA 4PC7A 5LB4A 2A30A 4IJMA 5JRZA 3KUDA 4MKIA 3REFA 1W4AA 1R10A 2H57A 5D3MA 1D6JA 1IN5A 2J46A 3L2OB 4MYHA 2GZHA 1N6OA 3AUXA 1DAFA 3IHLA 4A9AA 2AXPA 2ORVA 4LYHA 2VF8A 2VP6A 3O8DA 1T3HA 3PUVA 1KK1A 4IXNA 1G8PA 3FMFA 1HQYE 2EWVA 4I81A 4JLVA 3JZAA 3QEOA 4MRVA 2OBMA 1ZW6A 3TQCA 3EIQA 4AI6A 2GZDA 3SJAA 2D74A 5IRCD 4GL2A 1UJ2A 1V5WA 2F1HA 3CF6R 5JI2E 1E32A 3FKQA 2FPMA 3CR7A 4DSUA 4YDSA 2F55A 3L8ZA 1N5IA 2R62A 2ZJBA 3IGFA 2IHYA 2NPFA 4KBGA 4RD1A 2TMKA 3CW2A 5C2JB 3R9WA 1FQKA 2FJUA 4DCUA 1DOAA 3T1OA 1AA9A 1XXHB 4QGGA 4RD6A 2CLCX 1S9DA 2J7PD 4XD7A 2JDIA 3W34A 4LBYA 5JFGA 4YMVA 1ZM2A 5BYJA 3HU3A 2KSQA 2VO1A 3IUYA 2FN4A 3LLMA 4Q5IA 4RZUA 3FGNA 3L43A 3MFYA 1GDDA 2CHGA 1XMIA 4BEJA 5C4GB 2XGJA 4Q7LA 3QIAA 5L3SA 2OFOA 1YU9A 2A7QA 4Q1BA 3U44A 3LO5A 3MJRA 3Q72A 1HTWA 4X8HA 2GXQA 4GP6A 1OXTA 4PQFA 3TNFA 1COWA 1DS6A 4N1AA 1ZNWA 3BH6A 4BWYA 1OB2A 5AJZA 3QUSA 1P2TA 4FD2A 1KSGA 4JBWA 4Q4HB 3F5FA 2KI5A 2QRZA 5J47A 4CZ2A 4YQFA 3J81k 4LBVA 2IW3A 4YMTA 2ZYUX 3GCGA 4G0NA 4PFSA 1G3IA 4MYUA 3TGPA 3QF4A 2ZJZA 4ZDWA 4P4SA 3D3QA 1NY5A 2GZAA 1E3MA 3ADCA 1SXJB 4HLUA 1KDOA 4RKEA 4D0GA 1ESNA 4LHYA 1AK2A 3THXB 3NEJA 3TMKA 4NCKA 5JHGB 4IOMA 2IEZA 2NG1A 1Z0KA 5F9FA 2PL3A 5FI0B 4WW0A 4Q21A 3G0HA 5GJCA 3UMSA 2BBOA 1SKYB 1S0UA 4DEXA 1JI0A 4PPQA 1GL7A 3LV8A 4QJ3A 2DHRA 5KDLA 4LJ6A 1XNJA 4PZLA 3BK7A 3ZIAD 4P33A 4BRWA 4EPVA 3EG5A 4RVCA 4B6EA 4M2LA 3QSYA 1XD9A 1L2TA 2JJ1A 1XMSA 5J4LA 1TUEA 3U4QA 5FL7D 1UKZA 4B3DA 1E2FA 1UKEA 1E2PA 1N6LA 2GK6A 1QG4A 3DOEA 3K09C 4YXWA 2QMHA 1SVMA 1MABA 3GJ8A 1E99A 2YZ2A 3RS3A 2OM2A 5EJEA 1ZCAA 1NBME 2OCAA 1XRJA 4LY6A 5EE3A 4WZ6A 2VL7A 3DKPA 3FMIA 4EJSB 2IYXA 1QHYA 1KKLA 2C04A 4NL4H 3CRVA 5CLLA 2GJKA 1P62B 3PCRB 2ZRBA 2QN6A 4CW7A 2CLDX 5J4VA 2FA9A 1JECA 2V55B 2AKYA 5J4KA 4L9WA 4EKDA 4LJ9A 4A2QA 1K5DA 2EYUA 2R2AA 2VIIA 4R9UC 4BLSA 4OJKA 3SQXA 4OI0A 3AVYA 3ZZTA 1MRNA 1SXJD 5IT5A 5A4JA 4Q66C 4G3XA 4M4SA 1NIPA 1K8RA 1VHLA 2ZRLA 5DN6A 2QP9X 2G9NA 2RGGA 1QVAA 2OHFA 2HXYA 4D2IA 3NBZC 1IOZA 1M7GA 1KY3A 5K8IA 1CR4A 1GTVA 3W8NA 1YZKA 3TRFA 1DE0A 2V1XA 5SZHB 5TV2A 3C7KA 4BFWA 5EZ5A 4BUJA 3CUEF 4HEJA 2E87A 3VU9A 4BEBA 4B73A 1X6VA 4TQAA 5SZKB 4HB3A 5FBQB 3A4NA 3KKPA 3RWMB 3BB3A 4TL7A 2QE7D 4XSGA 3A36A 1E94E 4PC6A 3V4FA 1RKBA 1VKJA 5FL7A 2DYKA 2FGJA 1PLLA 1II8A 2CE7A 4DVGA 4MYCA 2GEUA 1FP6A 2FZ4A 2F9LA 2IT1A 2PX3A 3THOA 4C0QC 2Q9BA 3AVUA 4GMXA 4FCTA 2MSDB 4BFZA 1HH4A 4HAXA 3K70B 1FUUA 3EA0A 3FMPB 4M1OA 2FFAA 3ZZ0A 3H0KA 4TLCA 1M7BA 5KDOA 2XB2A 1IAQA 3KQKA 2BM0A 3QKUA 3K70C 1DADA 4IRUB 1JXOA 3ZGXA 2GHIA 2WWIA 4OHZA 3U60B 1XPOA 5E7MA 5E3HA 1W0KD 2W2VA 1CLUA 4ACAA 4B2PA 1Q1ZA 4QGHA 3UATA 1XB2A 3QQ5A 1BMFA 2A3RA 2VF7A 121PA 4A82A 3DKVA 4PC1A 3CM0A 3FVQA 4A0FA 4DCVA 2QBYB 3TSWA 2VP5A 3OEED 3GP8A 1IY1A 2JIZD 2VP2A 4NHOA 5HTKA 2V1UA 1G1MA 2IXFA 3AKDA 3NH6A 3RSLA 1FX0A 1BKDR 2EVWX 3U6KA 3A1TA 3BBPA 4JLJA 5G3ZA 5JECA 2GJAA 4LHXA 1OKKA 3O47A 3F3YA 1NP6A 4DSOA 4MRNA 2OG2A 2W0SA 3EWSA 2IS2A 1EG7A 2IYTA 4RFSB 2DY1A 4NTZA 4ARZB 4GT1A 5E4FA 1Y63A 4O3MA 4BZPA 3DL0A 4TLBA 2OBLA 3A8TA 4PHHA 2VHJA 1RIFA 4HATA 4FIDA 4URUR 1R2QA 2ZROA 4V0OA 2ZI7A 2QU8A 1KI6A 1LVGA 3PUZA 2B8WA 2V6IA 1JQJC 1XDBA 4NPHA 3SYLA 3AKCA 3EIEA 3SZRA 1M7HA 3TUIC 4AY2A 1T3LA 3K0AB 2ZE8A 4HI0E 4IXMA 4POAA 3NEYA 3PV0A 1UBCA 3FKSD 5TARA 1N5LA 3IPYA 4R2IA 3IPXA 3VR4A 3ZH9B 3C41J 2VP4A 4JIMA 4PC2A 2G6BA 2AL7A 4Q9HA 1QG2A 4JMPA 4KLNA 3LH5A 2CL6X 2YWEA 4OL0A 4QHYA 4YMSA 5EE9A 3VHLB 4Q02A 3ASZA 2G88A 1LNZA 1KO7A 3K0FA 3KJEA 1XD2B 2ZVPX 4US0R 2RGAA 1GFIA 4KU4A 3FE2A 4QHTA 4Q1CA 5HZKA 5SZIA 1VPLA 4DT1B 4OK5A 3RRNA 4MUAA 3VMFA 1XEXA 3THWA 1W48A 4FMDB 3KQHA 1Z8FA 1ZM9A 4GDFA 2B92A 4XIGS 4JKYA 3R20A 5FOTA 1OYWA 2GA8A 1E0JA 3PEUA 2ZJ8A 1KHTA 3SU8A 4AG6A 5J4YA 1CBUA 1YKSA 1UEIA 4PZYA 4NZYA 1ZC4A 2ZR7A 1RYHA 1GRNA 3TVTA 2ZRIA 1GRRA 3QKSA 5DO9A 4TYPA 1E2QA 1N5JA 1AGRA 1KNXA 1I2MA 2DFTA 3EX7C 4US2R 1GG2A 5AUNB 2ZPTX 4JT4A 4DXAA 2V3CC 2NO6A 2RMKA 2Z0MA 4DT1A 1PUIA 1J70A 1KK0A 4BE7B 5IHPA 2GCOA 1X8LA 5FOVA 2I3BA 2QPAA 4DKXA 1AJEA 2WJVA 2QT1A 2ZE7A 3AF4A 1P2UA 1CS4C 2OCBA 3ZS9A 4KYIB 3UXMA 3M4YA 3NC0C 2J41A 1KI3A 3W90A 3KKNA 3P4XA 1ZYUA 2MMGA 2WPDA 2WZQA 3JVVA 1NG1A 1H8ED 4DDWA 4ZV4A 4URWR 3LW8A 2Z4RA 3B1XA 4JBXA 4UKDA 2O8FB 2JLZA 5TDHA 3TKLA 4OHXA 4PO1A 1TF7A 1UKVY 3S1AB 1TF2A 3MAAC 5JMTA 4EQ6A 2NZJA 2V8OA 3GFTA 2GILA 4RFVA 3ECCA 4UNPA 3DDCA 3PENA 3W5IA 4HUTA 4ON9A 3ADBA 1P9NA 4ITRC 4M9XA 1D2EA 4LYJA 3GJ4A 1NN0A 2QP3A 2D2FA 2D7CA 3K53A 4URZR 3HPQA 3SFZA 2HT6A 1Z06A 2C78A 1D5CA 2JASA 4JLNA 3HDTA 3ZQ6A 3AGQA 5L3QB 2I1QA 2H16A 1WDTA 4FMCB 5E7JA 5HE9A 4DRZA 2FSIA 3RS0A 4ZKDA 4MDEA 5FUXA 4MGIR 2G0TA 1I4TD 1A7JA 2KBEA 3RS2A 3TSOA 2IXEA 5FBRB 1R5NA 2QE7A 1UFQA 3N2IA 3AP3A 4ZCLA 1KI2A 3B9QA 2CHQA 5KTYA 1EWRA 1TPZA 1CJKC 1N6HA 2FFQA 2JATA 2KE5A 4Q9KA 4AYWA 2WAXA 4DLRA 3P26A 4X8OA 3L0OA 2OE2A 3ZDQA 2O8EB 1VHTA 3VQTA 3WHLA 5P21A 3U3RA 1Z2AA 4PTLA 1N6RA 4B2LA 1CJUC 3IQWA 2ZI5A 3DOFA 4PHTA 2GXAA 4C0SA 2HT1A 3O8BA 3WMEA 4E5UA 3AVWA 4QJ4A 2A5DA 1TMKA 4OQMA 2J1LA 3KTAB 1XTKA 2DWQA 3RAPR 3R9XA 1RW4A 4O0MA 2IF2A 4OI2A 2W2XA 2OAQ1 1XEFA 3GLIA 2ZUCA 4O25A 4TYQA 8OHMA 1DVRA 4Q4JA 4B76A 4V0KA 2AXNA 3RHFA 2Z4SA 2J0UA 2AX4A 3RS4A 4V0ME 3G5UA 1KNQA 1FFHA 2H92A 3B1ZA 1EFRA 2CL7X 4M1MA 1KKMA 4YMWA 4ASUA 3U7FB 5B64A 3ICQB 1OHHD 4MQBA 3VU9B 4BFYA 1U0JA 2C5LA 5BWMA 2RCNA 421PA 3KKOA 1M6NA 2IYVA 2DPXA 1A5TA 4DUGD 5GJVC 2RGDA 3B6EA 2JLUA 3KZ1E 1KO4A 4JKIA 4MYTA 2RGCA 3T1QA 2MSCB 3KJHA 1A1VA 4TLEA 2ZYVX 1AS2A 1ZM4A 4M8NE 1ONBA 2LKCA 4PSVA 3GLHE 4FXPA 2E1RA 1G5PA 4JLKA 4E07A 2A5JA 2ZRJA 5DI3A 2BBWA 3I92A 4UJ3A 1JAHA 3MCAA 4C0AC 1T0JB 1M74A 1W1WA 4S35A 3GPLA 3P1JA 2X77A 1NMXA 4B34A 1R5OA 2R6CA 4HLCA 5JSZB 1YRBA 4R71A 2GCOB 1R0WA 5CYOA 4JYCA 2FOLA 3X1YA 4CF7A 1J90A 3EZFA 1PLJA 4GPTA 3A1SA 3BWDD 3SHWA 4LJ5A 5FUWA 2HV8A 2IX3A 4KODA 1IY2A 4MGKR 1W5TA 1KMQA 5K8TA 4ZI3A 2V6JA 5DYGA 1FX0B 1W46A 1UBFA 2AWOA 2YWGA 1OKKD 2BBTA 4BLQA 1KOFA 1YR7A 2GEDA 3JZMA 4GBMA 3T15A 3AKYA 2FU5C 2XJ4A 2Q6TA 1G291 2JIZA 4XVRA 4CEHA 5FL3A 1SVKA 2QEQA 2YKGA 3DMNA 1ZCBA 3R8CA 5CLQA 1NG9A 4HZIA 1C1YA 2ZRKA 4FW9A 2L0XA 5DSZA 3CB4A 1Z6AA 2PEZA 4UXHA 2AD5A 2OXCA 1NVXQ 4HLQB 4LPSA 4V03A 1QF9A 5DI3B 2D2EA 3RSOA 5LPNA 1Q20A 4MRSA 1YZNA 1FPMA 1Z0DA 1S2MA 3BB4A 1R0ZA 4DLUA 3CRMA 3BERA 2ZJ2A 4PAMA 4UNRA 1IXRC 4V0NA 1CULC 1XCPA 2DCUA 3A4LA 4PX9A 1EX7A 2XJ9A 2J7PA 4XD7D 1E1QA 1Z83A 3LXXA 2B6HA 3U3JA 1OFIA 4JLMA 2RGNC 1OFTA 3EZ2A 3A58B 3ICEA 1IJFA 3TK1A 2P6RA 3K0AA 2UZIR 5AK0A 3V00A 4TYWA 1GNRA 1SXJC 4A6PA 1LF5A 4OHWA 3K0FB 4M1YA 4KLZA 2VBCA 2FPLA 1CJVC 4Q1AA 5EXXA 4ZIRB 1G6HA 2BV3A 2GJ9A 1JNYA 5EE1A 5JHHB 1YZQA 1TU3A 3NVAA 4M1TA 5CJ2A 4P0TA 5FPKA 2ZYTX 4M9ZA 1W0JD 2XX3A 3WHKA 1P6XA 2DFLA 4F91B 5CYPA 4DIEA 1G7RA 2WWFA 2IL1A 3P20A 2FG5A 4URXR 721PA 1KI9A 1OH5A 1KMHB 3QXCA 1NKSA 2OV2A 2RGEA 3D7MA 1L7VC 1T8UA 1P75A 3K70D 4TYYA 2CMKA 2A9KA 2QT0A 4IVRA 3I5YA 4QHSA 3H84A 5JS8A 1CR1A 1IN8A 2V9PA 2ZU0C 4RD4A 2OILA 4UQOA 4FN5A 2REOA 5FPHA 1EX6A 4F7WA 4QBGB 1ZUIA 1U99A 1XMVA 1J8YF 4W5JA 3BFKA 1WQ1R 1UM8A 3AVQA 3TIFA 1E2KA 4RCYA 1MO6A 3S1AA 2HLDA 621PA 4DB4A 3PG5A 2REBA 2WJJA 1U9IA 4A0HA 2J59A 1SVOA 3LVRE 1OH8A 1JXMA 3Q7QA 3FFAA 4PSAA 3DHWC 1IHUA 3DEFA 1E4YA 3Q85A 4PPFA 5JWRA 1X3SA 4XVUA 3PUXA 1XWIA 4ZIRA 2ZR0A 1S1CA 3KQUA 3CBQA 4XVQA 1E1RD 5DI9A 2QA5A 5IK2A 1Z5ZA 2N42A 1OIXA 4TSFD 2FFBA 4NCJA 4DLZA 2CK3A 1U98A 2FE4A 2B7BA 1YR8A 2WKQA 2ZSEA 2CLSA 4A6XA 2IYQA 2J0SA 4MKFA 3QXXA 1G18A 2X2EA 4Z54A 3VKGA 3B2EA 4QFMA 1XTJA 4EJSA 4LC1A 3SHFA 2ODNA 3OF5A 5FTLA 1LW7A 1KYIA 2NTYC 3P4YA 3OFNA 1T91A 2OFWA 4URVR 3DMDA 2WWGA 4KSCA 821PA 4GOJA 1J8MF 2QGZA 2OFXA 4AYXA 1E9CA 5HR5A 1SVIA 2BDTA 4BZQA 2HF8A 4C0JA 2P6NA 5CB8A 3TVDA 1YRAA 1FUKA 4FINA 3KXKA 2O8CA 3T61A 2JGNA 3N5CA 2ZRHA 4LHVA 1S8FA 4NYMR 4F4IA 4IDNA 3MGCA 2PH1A 3AVXA 1VCMA 3MUFA 4KSBA 2O8DA 1Z6XA 5C46F 1IM2A 3L8YA 1QZXA 4ZDKA 1T5IA 1EXMA 4Q00A 1AS3A 4R7ZA 4DSNA 4QBFA 5JZVA 5TXGA 1MKYA 3B5JA 2R9VA 5CITA 1BOFA 3IQXA 4QNMA 2BKUA 5KO2A 1TX4B 4B3BA 1GUAA 1OXXK 1YR9A 4EDHA 2ZRFA 3EC1A 1BO6A 4NP6A 2FEMA 2QPOA 4E03A 2JA1A 3QJYA 1G8GA 2IK8A 2WPDD 1VIAA 2GK7A 5DHFA 4Z1MD 1UPTA 2JDID 3NHAA 1OFUX 3CX6A 4MH0R 5KSOA 4MITA 1NLFA 1NVVR 4V0MA 3LDAA 3SBEA 4Q1FA 1GITA 2SHKA 3AVPA 1RYFA 2PCLA 5B58C 2PJRA 5FTNA 3KFVA 4JSTA 1E0KA 3CH5A 3L0SA 3I8SA 1HE8B 2WMNB 4AK9A 1NSTA 2ZE6A 4IKEA 3WRXC 4DUGA 5CDFE 4MGYR 1UBEA 5JJLA 1AIPA 3QPVA 4QRHA 2HLDD 2PT5A 3W5JA 4QBHA 1B23P 1WA5A 1QHXA 2ODEA 2WWWA 4LPKA 5KNCA 4FMBB 3DM5A 4A4DA 3BIFA 1R6BX 1W47A 2EU8A 3B60A 4ACBA 1G5TA 3PIRA 4WVFA 4GZLA 2PX0A 3GLGE 3TQFA 2F9MA 1II8B 4B43A 3VNUA 1SXJA 4EIWA 1F2UB 1XD2A 3LX8A 4KYUA 2W00A 4C2UA 3ZVLA 4LUCA 4K81B 3RYTC 2RGNA 1IN6A 4KJZA 4O2RA 2XTMA 3CZPA 4AYTA 2P2LA 4NYJR 4K46A 1D8TA 1OV4A 2FWRA 3D31A 2GVZC 3JVUA 2ZE5A 2FGKA 2J0UB 1G8HA 2KBFA 1E79A 2PZGA 2YJTD 4TL6A 3UIEA 1IONA 1U9IC 2XZOA 4KITB 4L9SA 5K8LA 4CYMA 3GEHA 5FOXA 3AEZA 4JS0A 5EP4A 4BLTA 4CIDA 1ZVQA 4TL9A 4ZCIA 4B3FX 3QE0A 2GAOA 1P60A 3DVLA 4YDHB 5FR1A 1N3BA 3VFDA 1L4UA 1LTQA 1KI6B 4BLRA 4AKEA 2QQ0A 2XAUA 1T4GA 3OIYA 5FTKA 3LX5A 3BJIC 1NJGA 3I3SR 2W6JD 1LFDB 2F3RA 4DDTA 4MRPA 2PZFA 4IOLA 1RZ3A 3KUCA 1E2GA 1RVDA 4UNNA 1Z6GA 2ANCA 4LYFA 1V43A 3PVSA 4HAYA 4D6PA 3UKDA 4LCBA 4OQFA 1VECA 2VPPA 5KSPA 1TQDA 5DHAA 1R0YA 2ASEA 4CEIA 2AN9A 1DO0A 2QQEA 1XXHE 4GI7A 2C9CA 1ZINA 4C0BA 3FDIA 2W2TA 4HYYA 2I4IA 5DE3A 5F98A 2VA8A 4P3YA 5AUQA 3WRYC 3KX2A 3IILA 2ODWA 4B33A 3A37A 1YVDA 1F60A 4XJXA 2IWHA 1F5NA 3QVVA 4ILEA 1XJ0A 2R6DA 2OBNA 4V0LA 2ATXA 2XNSA 1Q1QA 4OJQA 1C9KA 1Z6TA 4TMWA 2WJYA 4M9QA 4DB2A 1OW3B 2IYLD 2OEPA 3OEHD 2ZVQX 1XTSA 4TN1A 4UNSA 1WB9A 4CRWB 2ONJA 3T12A 2G3YA 1S3GA 1MOZA 3B8HA 4C7OB 1VCOA 2J7KA 3B1YA 3DO6A 3W6OA 4TMVA 5L3QA 4GNKA 3U7EB 1AQYA 2IA5A 4AG5A 3TAUA 2HYDA 3EAQA 3PEYA 4JYBA 1JPNA 1Z28A 3SNHA 1SVWA 3EW9A 4EFMA 4QBIA 4PXAA 1NN3A 2AKAB 2ZS7A 4NDZA 4Q4AB 3UK6A 4GP7A 3VHXA 4ESHA 1E1RA 3QXJA 2BVNA 4I99A 4PSKA 3MWYW 1T5LA 4TT3D 5L3RA 4B3CA 1KJZA 1ZRHA 5H1YA 4HAWA 3PITA 3SFVA 4B47A 1RC8A 2Q0HA 4WOPA 3MRSA 4HLUC 2OESA 1GZSA 1NMZA 3MWKA 2ZAOA 5CM9C 3ZS8A 3IO3A 2NIPA 2PZEA 4ZO4A 5EP2A 4C0LA 4A15A 2OT3B 4QC2A 1U94A 1TUIA 3I72A 4Q9JA 2YOHA 2JLXA 4HZUA 5EZ6B 1TADA 4DCTA 3I61A 1Q3HA 3T1VA 5FPTA 4NYIR 5EE0A 4PO8A 4G5RA 3EZ9A 3IIKA 2JLWA 4K8OA 2RGBA 1XJQA 5FOUA 1VDZA 4WA7A 1AZTA 4WIAA 4TL8A 1P7CA 5LBIA 4JJKA 2O52A 5H68A 2BEJA 1G16A 3ZVMA
chains in the Genus database with same CATH superfamily
2WWHA 1WXEA 2WA2A 3OPYA 3ECAA 5AH0A 1J0DA 3BHJA 3LBNA 4WJZA 1J39A 1R9MA 1FFYA 3FHOA 4MI6A 1ZI8A 3RIYA 2ISSD 2BKEA 2O3TA 4RIFA 3UT5A 4DMCA 3I52A 1ARZA 3HYTA 3OH8A 1Z0AA 5KCMA 3R7AA 1X9HA 1CIPA 5GPBA 1U3DA 1SKQA 1TZJA 2C4HA 3VR5A 4EYEA 2QSJA 1NVVQ 4ZARA 2JH9A 4JC8A 3DZ8A 3GQVA 3GV0A 1M1ZA 4WAUA 4A0RA 1Y4AE 1J5EB 2AMYA 3O91A 4QM6A 4AJ9A 2DQKA 2G1AA 2G5TA 4M1EA 5KDDA 1FFDA 1OMOA 2C5EA 4U7HA 3IHTA 1RZVA 1U0FA 1QVVA 1XRQA 4XWYA 3G5LA 3IPCA 3PF9A 4BGIA 2PLAA 2CJXA 4QXQA 1XZIA 1BH2A 1A27A 3D1LA 3W9BA 4Z3DA 1T9HA 2Y0EA 4B48A 4YCSA 3WV5A 5D3QA 3T38A 3DOIA 4B8ZA 5HQ3A 4HGNA 1E3DA 3N8IA 3P9SA 4IRXA 2XUPA 4QDKA 1LLCA 4IJ6A 2VPQA 1N9GB 4N8DA 4EFNA 1H8HD 1QHHB 2ZIWB 2ZRNA 3WI7A 4EMTA 5M34A 3AR7A 4MIYA 5EVCA 1T0IA 4ZYXA 5I4CA 3H2KA 3KM0A 3QXSA 1NGSA 3B78A 5LWHA 3RK1A 4JI2B 4RH3A 2J3HA 3T06B 2IQ5A 2GFQA 4DJJA 1HURA 2NNLD 2HK9A 4PX5A 4EA6A 3OJ0A 3SKXA 3GLHB 1U04A 4XVCA 1JZQA 3AJDA 4XIJA 1EUYA 3EGCA 4Q7JB 3TZKA 5IK2D 3NOOA 4G4SP 1PO7A 1R8XA 1QSGA 3BGWA 5CR9A 3DZGA 5ICGA 1NN1A 1QVRA 3PGKA 1K89A 1JTFA 3A4IA 3UWOA 2EJBA 3ZHOA 4CT5A 1W94A 2VAMA 2V3VA 4LQDA 4RABA 3S2EA 3CUVA 4OHOA 4BQEA 1YHYA 4N0MA 3RT7A 3WQHA 3WA6A 1H0HA 3NHUA 1Y5IA 4Q4AA 2GFIA 1GU1A 1NVGA 4QT4A 1W581 3ROQA 1GGJA 3G89A 3KDSE 2B35A 2C2ZA 3OO1A 3OTOB 1TB4A 3R5TA 3FI9A 4TS1A 1Z25A 3ZCSA 3JW8A 3GR6A 2WU8A 5K8UA 1L5WA 1I13A 1NZDA 4EI7A 2XNDA 5K3BA 3FOBA 2CK3D 3NKVA 2L17A 2PKEA 3ILXA 4GPBA 5BR7A 1RXSA 3U4GA 3BD6A 2C2YA 3V8VA 1NMSA 5DN6D 1EDZA 2ACWA 4EPXA 2PSJA 4NJOA 4KQCA 3SR0A 5I5GA 5IULC 1EVLA 5KQPA 3UPTA 3UBTA 3ICOA 1DKLA 5WRFA 3IUQA 4C4RA 4RGYA 1GPKA 1WVMA 4KMMA 1KIMA 1ZRNA 1OAOA 1M0TA 2OVFA 3O83A 3KJGA 1PJQA 3HRIA 1E9EA 4MUBA 1KAOA 4EITA 3EWAA 4R68A 3U9LA 5JDIA 3WX0A 3IUBA 4JR1A 2IEBA 2ISQA 4TQGA 1D09A 4MJ7A 1N8KA 1MO3A 2CSUA 2DAPA 2QLFA 2XF2A 2B4KA 3U80A 4O59O 3UV6A 4AUMA 4F6LA 1N6IA 1PK8A 3SZGA 5BW8A 4G26A 4ESVA 3UAYA 1P4SA 2C7PA 2RC5A 4OJYA 3CSUA 1ESMA 2IYRA 2LDBA 2OZLB 4HX5A 4IUCS 4GS5A 5D3MB 5J5CA 5TNXA 2VCEA 3HXKA 1PT6A 1FW6A 1FDRA 3DV0B 1QJCA 3LQ4A 3PK0A 4INJA 4TVBA 4X5OA 2A2ZA 3AESB 4CF5A 1LLQA 4E32A 3C4VA 2QQGA 2ZSAA 1JYSA 1Y6FA 2G4CA 3M6UA 4KFRA 1QHSA 4FNOA 4J2TA 1PZXA 2O2XA 1BYUA 1FFXB 2PKYX 4KI0A 3JARA 1RWXA 4RPLA 3CR8A 3GYGA 1U7HA 3LCRA 3R6LA 3IB3A 4YT5A 4CF4A 2HIAA 3P32A 5FPSA 3WTCA 4RFLA 1PSWA 2FCRA 3AOGA 1E2HA 5LDHA 2D1RA 1EJ6A 3R0XA 1E5DA 3JWJA 1B8PA 4MXDA 5HOEA 1I6MA 2BY4A 3GMDA 2A7XA 1TCBA 5TR9A 5CLJA 5JAQA 5FLEX 1SQFA 2V54A 4XZ3A 2BGWA 2DHCA 2J3LA 3WLEA 3SMVA 2AJCA 2ZQYA 3TW4A 4AUKA 3MLBA 3TW8A 4C5CA 2VXCA 2OCYC 3GVPA 5BWOA 4F3CA 4INPA 2GXUA 2CJWA 3AZPA 3NVMB 1JG3A 4U63A 5A9SA 1VOTA 4G86A 1MU0A 5IKXA 3CZRA 3V8BA 2YC4C 1WKCA 1Y33E 5A5FA 1MMFB 2JCGA 2Q6LA 2PDAA 3NS7A 5EJFA 4I66A 5KB3A 4WUTA 4X1KA 4JLAA 4MQ6A 2PUVA 5I8ZA 5LXTF 2GKSA 1H2WA 2I9PA 3PHLA 4L07A 1P8AA 2ZJ1A 3DMFA 3FVVA 3KNZA 2IHVA 3BXHA 3HJUA 4JNCA 1K7EB 3DDZX 4JVOA 4NQRA 1WX1A 3M9WA 5BV8A 1KYQA 2CD9A 1USUA 4TV9B 5A7HA 4D99A 5G1OA 2CKMA 3AF6A 4O1MA 3BMNB 3R23A 2M6SA 4NCNA 5H4HA 3L6CA 3TLAA 5K0CA 1YRHA 5F2EA 3LVFO 3EF1A 3WWYA 2BGMA 2EIXA 4FHCA 3EARA 4Y9RA 1IHDA 1H6AA 5A2GA 2C2XA 3NDPA 3OUUA 2BFPA 4GXRA 3OIUA 4MB0A 1T9DA 4KXFB 1HFKA 3FMGA 2CE2X 1XK6A 3DP9A 1EJBA 5SZJA 4BB9A 5FB3A 2CN1A 3VX4A 2CDRA 4BLPA 5I9MA 4EFKA 5L3ZA 3BXOA 2Q3FA 2PGNA 3GDHA 4HLNA 1ZNXA 2EV9A 1FP4B 1BMTA 1WMSA 3M1LA 3P94A 2BTOA 4OYHA 5F3WB 2WAOA 1X7YB 3D6TB 2XE8A 2OQVA 3E9YA 4I4CA 5L3SB 4JY7A 5DN9A 1C50A 2YIDA 1GP2A 1OBVA 3AG6A 3GEIA 2WIFA 1TVEA 3KD2A 3RRXA 3UMVA 2Q3CA 3ZXXA 4B7UA 3KHUA 3JQPA 2AFIA 1JG1A 3AFMA 2O8CB 4OGFA 1VYHA 2V97A 4PCAA 4TWJA 2KX7A 4C3UA 1U9YA 4UUAA 4XDHA 3RIXA 1OASA 2QSYA 3LX6A 3PXBA 1FYXA 2R6GA 1XCMA 1G20E 3FLEA 1PJLA 3JZDA 3KJFA 4R8MA 2DWPA 4WTOA 3SQWA 1JEDA 3HFRA 3I12A 1UQUA 4P08A 5T5QA 3ER8A 3HWWA 1OAAA 4KDEA 2X23A 2FEXA 1Q22A 1TCUA 1KF0A 3RRZA 1N0UA 2QJFA 4FT2A 3RF6A 5I01A 2R6ZA 4EYOA 4AS1A 1FTWA 4B7ZA 3QLEA 4E88A 3OZRA 4RTMA 2F8LA 4MDHA 2XHZA 2PD6A 5JNSA 1RZRA 3VO2A 3D8RA 1K68A 2FSVA 1G8YA 3WWDA 4ARIA 2C5BA 2X0IA 4LV5B 2X9QA 4WY5A 1NL3A 2G06A 3VR5H 2CVZA 1NW4A 5L7TA 1MAVA 3MAGA 4Y9SA 3U4QB 3KLPX 4KIWA 1XNRB 4MQ5A 3CWQA 4E12A 2ATEA 1DKUA 4ZC1A 1N34B 1FUYB 2Y1LA 4I50A 2ZFUA 5FQOA 2FLWA 1JJVA 3T9AA 3AP2A 1S1MA 4ZALA 3I9FA 3HPRA 1WB5A 4LWZA 4BMPB 3FNEA 4CE6A 3QBDA 3UPUA 3I2YX 2H5EA 1UEJA 1UM9A 3R0JA 4AP6A 4J3NA 4OHFA 3H6HA 3QG1A 2W5UA 1ONOA 4EHHA 1M6VB 2CVPA 4FE4A 1LBQA 4JVSB 4ZOAA 4C05A 4C7VA 4UVGA 1PHPA 3SEAA 1E5XA 1U5AA 2X2OA 3KR9A 4ZPXA 1BC5A 3W8RA 2ROQA 3BGIA 4Y2RA 3QY0A 3QKTA 3HKDA 4HEA1 1HT0A 3CN9A 4RZXA 3S7TA 4NV0A 2PX8A 1BVYF 3I01A 3OAAA 4JR0A 1EP3B 1XQ6A 3UKOA 4AY5A 3WWOA 4TVSA 3Q40A 3QNUA 2P79A 1QC5A 3DAYA 2F00A 4HPJB 1E1QD 2QTVA 3S8MA 3L8DA 2AFHA 4K9MA 1ZH6A 1J00A 3NG1A 2DM6A 4GM0A 5D1NA 3EF3A 1GSIA 1CJTC 1N2BA 2FX5A 4DLYA 4NONA 1Q6YA 2WTEA 5DVZA 3KTAA 2RI0A 5DHSA 3EB9A 2NTVA 1J21A 2RB5A 3AHEA 3ZDEA 4KXUA 2R8YA 3TKYA 1WXQA 2P1RA 1WEKA 3AG5A 3L46A 5JQGF 1OC4A 1O9HA 2AI3A 4Q34A 4G41A 3PHGA 1XHEA 1IN7A 3BORA 2DPYA 5EGSA 3HBJA 4MVXA 4Z7NB 4NZMA 4DDVA 4AJHA 1BHSA 3HCOA 1NN5A 1HE1C 1I6WA 2B8JA 4CTMA 1EZ4A 2B83A 3C39A 3DR5A 2H7VA 3I73A 3PNQA 3PPVA 1JHQA 4TMZA 3BZWA 3G02A 1CUAA 7MHTA 5K51A 1CNMA 5ITSA 4L4UA 2QAGA 2FW7A 2NQ8A 5AK4A 1KZ7B 5DCLA 3VZRA 1RBYA 3K9LA 4FYHA 2ALJA 2XE4A 2W37A 3E2MA 3HTXA 4FWIB 1ENYA 1UCFA 2QTVB 5HR5A 4RF2A 5H82A 2WF5A 3HR4A 3GLUA 5JJ5A 4FOLA 5HZHA 2YJGA 3KJXA 1F8YA 2GBCA 1MCZA 2C96A 2PCJA 1YE8A 1UOEA 2B1GA 4WXPA 5J40A 3FHTA 1W7AA 1FDTA 5C8VA 3WA7A 3FPAA 1BAPA 4XFKA 1CF4A 3FOZA 5IVHA 3QX9A 4YRLA 2YRXA 4PQYA 3O2SB 5ALUA 3C8UA 1SU8A 4K8RB 3SMQA 2PLFA 3EWIA 4YI3A 3W6UA 3QP9A 1M6YA 5HHTA 1DQZA 4BX0A 2VYVD 4IGKA 1MOSA 2BKXA 4CIXA 2I6GA 3IMGA 4E2ZA 4AY6A 5PGMA 4RHTA 4B2YA 1FXUA 5LKRA 4LJ7A 1PWZA 3NM5A 2WJHA 5KTNA 5CCBA 2R6HA 5GONA 2H0RA 3ZOKA 4PLVA 3ADKA 1SZPA 2HUPA 2LD4A 2R11A 3LUFA 3ZDZB 1KORA 5ALEA 3RK0A 3SF8A 2CMHA 1NNEA 1ABFA 3HY4A 1HM5A 4J16C 4QD3A 1W5AA 2J09A 2LIVA 2J9FB 5B1EA 2IDKA 3DEAA 3FHCB 1G6OA 2BJVA 1EE2A 2WW8A 3PCTA 3G0GA 2XTZA 4B3IA 3VGJA 1TO2E 1ENOA 1D07A 3JV7A 1TIKA 1VG0B 2YXNA 1SA0A 1LD3A 4ZVUA 3W79A 4Y1FA 2A1TR 1EVQA 4JLPA 5CPBA 1LI7A 2NLOA 4MIEA 2VPIA 4QATA 5CT5A 1TJPB 1T43A 1RJFA 3IIEA 4IO1A 2PUBA 3FRIA 3SJ7A 3CYFA 1DV1A 3CVOA 4FX5A 3RANA 1JWAB 1NBOA 2AG8A 2H8KA 4CV0A 3SPXA 2YV5A 5DJ5A 3DXFA 3D1VA 4FONA 4QYIA 1V95A 3VTAA 3QF7A 1NJ6A 1QCYA 3EVFA 2R8XA 3VH1A 4C0WA 5IT0A 2CSXA 1KI8A 4RKQA 5JNTA 1ZAKA 2ORWA 4XWAA 3FSJX 2NQ2C 3H16A 4JEIA 3HA3A 2VJPA 4L76A 4S3MA 4A23A 4KR2A 1GRCA 1NXOA 3DD1A 1P1KA 3FUCA 3QX8A 3RAEC 4E3ZA 2WDZA 1QHIA 1CQJB 1UJ4A 4HB2A 4BNZA 1XEWY 2UYOA 5LA6A 2AEJA 1FRVA 4ZC8A 1YU6A 3RDPA 9ATCA 2PPLA 3D6VA 3CUUA 4X84A 1KAGA 2FP4A 2JPDA 3GZNA 5L7WA 1W36B 2D7DA 2XVZA 4YK7A 1UZNA 3RS5A 5HM6A 1RXWA 4JT8A 1U5BB 3P7MA 3T7CA 3RRMA 3F71A 4ZDIA 1P7PA 3AONB 4FFPA 3AR6A 4MUFA 3GFFA 2P3QA 3VNVA 5DZSA 1JJIA 1TOAA 3CV3A 2Q5EA 3G13A 2QMEA 5EJAA 2ZCJA 3LPLA 4UE2A 4PZ0A 2CXHA 4JLDA 1DTEA 4QFBA 4R1LA 4ZAVA 4MJLA 4EPRA 1TTTA 1UWVA 1BFUA 1P2SA 4QQRA 3CT4A 3HUFA 4FGWA 2POQX 3SP1A 4XDYA 4KHZA 1Y8RA 2NV2B 1HDZA 3ES9A 4RCVA 5IM5A 1NOIA 3BTUA 2XNCA 4Q9IA 4ZEOA 3DYIA 1WTCA 3KZMA 2O2GA 5LA6F 1BVUA 2CUZA 1Q1EA 3T5BA 3TMYA 4WWHA 4R2WA 1L5OA 1HT3A 1SR8A 1ZJ6A 5EHZA 3FKSA 4YWJA 4EMSA 4CQNA 1JIVA 4O1HA 4QOSA 1WP9A 3LY5A 1SUDA 5J9FA 1K2WA 1HV8A 3C7AA 4KYVA 1KY2A 4B3HA 2V7UA 4N3AA 4OK3A 4RQAA 3FYCA 5JPIA 2G6TA 2CLKB 1J2YA 2X0NA 2DF8A 3D6NB 2OLEA 2RKWA 3GNQA 3MSCA 1PQUA 2JI7A 3EPKA 1ZGHA 1IQRA 2FWBA 2J67A 3M6MD 3FTQA 4EMUA 3O26A 4WINA 5K2OA 2JARA 4B4UA 1BW9A 4MPTA 1NE7A 4FWTA 1W5FA 5CEEA 3GFOA 5G0WA 2A35A 3QPDA 5JQGB 5CXSA 2IUSA 4NCAA 2P9FA 4MAFA 4EHAA 1KDTA 2WUFA 1VLHA 3HVJA 3QBVA 2XOKA 3QTLA 4X94A 5AP9A 3HYSA 2VATA 4HWSA 4L9AA 5J43A 3C15C 5CGQB 5TPZD 1DJLA 2ARKA 3WXMA 1M6EX 4UXIA 1MB0A 1X7ZB 3HWX1 4REOA 1PS0A 4H35A 2O5RA 2NTNA 1T1SA 3BFXA 3QPBA 2Q1UA 4FYWA 4N8EA 5KHLB 3MPUA 1LQUA 2O07A 4MQEA 5LNK1 1GZDA 4OKSA 3T7AA 3RYCB 3SKYA 1WU7A 3E3LA 2IZOA 2Y1OA 1NY6A 3RTAA 4OVKA 4IAOA 2IUTA 3HFSA 1E2MA 2A9PA 2I34A 3SN6A 2FVYA 4RMJA 5DM4A 4DXDA 2WSLA 1Z4MA 2DR2A 1J6UA 1BA2A 3UFXB 2E82A 3MWFA 3R7SA 3SJBA 3VU1A 3AR9A 5FOSA 3W8DA 3PVZA 1KEPA 3UJ9A 4R16A 1RJGA 2YW2A 4C07A 1G20B 1E9FA 3HZOA 1Y7HA 4GU5A 2VYCA 4YUYA 1VYTA 1VRCA 2EBFX 4MQMA 4ZVVA 1EFTA 1MAAA 1MN6A 4OUDA 4QU0A 5K1ZA 4BQRA 4MYDA 2WQZA 3G9UA 2ZIUB 1M8PA 4IIYA 4QJ5A 2PS1A 3FBWA 5B1SA 4OKNA 1H3EA 1HDIA 5T67A 4QWMA 1TZ2A 2OQIA 3CNNA 4LXIA 3TR0A 1OT5A 3K5WA 4M21A 1FYVA 2CXNA 3LBAA 3LLSA 3WLFA 5DV9A 2ODPA 3OM9A 5JCOC 1H93A 3GP3A 5L53A 4GOXA 3WLPA 1AN0A 1O3YA 2XRYA 4C5AA 1FNCA 3D8BA 1YZFA 3E0QA 2Q46A 2O5CA 4RV9A 1ONNA 4H16A 1XQVA 2H2GA 1HDGO 4TYNA 1SG6A 2WA1A 3PDWA 1FYFA 3GN1A 1TW2A 1SO8A 1XCJA 4LOJA 5H80A 4KN8A 3USES 3WTBA 3UCFA 3VHRA 4XTRA 5KYYB 3LC1O 3VKVA 4BP1A 5C53B 3G68A 2Q99A 3QW4B 1M9NA 2QORA 2XYVA 2G8NA 4IEIA 3D6AA 5A03A 1FRQA 3WICA 1XJWA 1FLVA 4LV8B 1S96A 5FD8A 1Q12A 3P2YA 3AIMA 1QTQA 1GPBA 2PRZA 2V4ZA 5DOVA 3R8FA 5AMXA 1B14A 5ELXA 5HKOA 1RQNA 4C7KA 1BOOA 4DVJA 5LQNA 3LT4A 2YXPX 2XYRA 5BOSA 2V9ZA 4LV6A 4DIOA 4J43A 3A1VA 1ZICA 4QARA 5LMZA 5EIHA 1FNMA 3R3SA 1RWNA 4KB5A 3NH9A 1RXIA 1Z16A 3UC9A 1OXUA 4IV0A 4KJXA 2I67A 3UQYS 3DPSA 4KN6A 3JD2A 4XFDA 4YHHB 3HNPA 2QMUA 1AMNA 1EJ0A 3GLIE 3L84A 4G24A 3FXAA 4OQLA 5GP1A 4L4YA 1GZHB 1L8AA 2JIQA 4JVNA 3RWBA 4YRZA 5LUAA 1YBVA 4GVLA 2ATVA 3VM6A 3GN2A 3O8OA 5BV7A 5KNBA 2YMQA 4PSUA 3ER9A 5JCJD 3GRVA 6Q21A 1OREA 1OLOA 2FQXA 2WU0A 4P0PB 3WYFA 1E3LA 1EUDB 1VJRA 3I62A 2VEDA 3E4DA 3Q12A 3WK5A 3WRXA 4GSKA 5EWMA 1GAWA 4X6YA 4EJ6A 1MP0A 2VOJA 3OURA 4IZHA 4KE9A 3SOPA 1NU8A 4MVJD 3ZE6A 2E89A 5AK5A 4DDMA 3TIGA 2YJNA 1IPHA 4JLUA 4L7VA 2AJLI 5EZQA 2QTCA 4GBJA 1A5AB 1WXGA 2JIPA 3CRRA 5FJJA 2O2JA 3N3AC 3ZJ5A 2IU0A 3CRW1 2Z30A 3MPOA 3S4YA 4FMDF 4DW8A 1TGYA 4B3MB 3OEEA 1UP4A 2AEEA 2DGDA 4D5GA 4FR5A 2K6GA 3VKFA 1CCWA 3EVDA 3V8MA 3THWB 1J20A 3AB3A 3WRWA 4QUJA 1ZIDA 1UOQA 2RKOA 1I6LA 3AV3A 3DE3X 5FF9A 4X97A 1P9RA 3C5CA 4EF4A 3IDQA 3BHMA 3FMVA 1MT0A 2VRWA 2O4CA 3AEXA 4H4DA 2C4UA 2UYGA 4OQNA 4Z0NA 4EZBA 4EKGA 3PRHA 4Z6KA 1KO1A 5EUQB 2RBKA 2PQ2A 3LDGA 1R0LA 1GV0A 5LU8A 3WWEA 1CVIA 1MZVA 1O6ZA 2YV4A 1NATA 1CRWG 1BN7A 1CV2A 3C7TA 3GXOA 3P45A 4M98A 4F5YA 5KYWB 2R5FA 3DV0A 3NYRA 5AW2A 1EK1A 1DINA 2ZUDA 4Q9LA 4TTQA 3VNRA 5KVSA 3EPHA 1JNXX 3K1ZA 3PWTA 1V3TA 5FBZA 1Q7CA 2VP3A 1G20A 1ODFA 4L8FA 5EZYB 1U0BB 1T0PA 4H7DA 1GQSA 5A2QA 1CQXA 1N1EA 1GDHA 1YVUA 2QN8A 4MW5A 4QTUB 3HH8A 5FUYA 4DHEA 4BE9A 4M8IA 3W2EA 2K7FA 3OM8A 2ZS8A 4H1UA 3LOQA 1J8VA 4EB6B 2D6FA 5UKDA 3W8EA 3B3QA 1GGEA 2I8AA 1XU4A 4UHBA 3PUKA 5DK6A 1N2HA 2AF3C 2XVAA 2YWCA 3IDOA 5C8ZA 5F7OA 3HV0A 4AZ3A 5IC4A 4NAUA 3OCUA 1OI2A 1QGDA 1OOEA 3NDBB 2JAXA 2CNNA 4U39A 1JEEA 4GM4A 3DAOA 4INAA 1E2NA 1A88A 1QHEA 1WY7A 2MU1A 2VZLA 4L5AA 4R2LA 5DF1A 1VC2A 1NW9B 3OIVA 4KO3S 1B4DA 3G23A 2Y05A 2Z2JA 4FDTA 1CR2A 3H86A 1Y5NA 4ABYA 4OIFA 3BCHA 3VO8A 4DSAA 4NS4A 4A0GA 1NW3A 3C98A 1HYGA 4HK4A 3KJZA 5G4KB 3VKGA 2EXXA 4MRRA 3UB3A 3GFSA 5AJXA 8MHTA 1IN1A 1FY2A 1MDFA 4MULA 3EOBI 3UHPA 4EB0A 2HRZA 3TD9A 5K8VA 1UXOA 1YZGA 1M8FA 4QTYA 4E4YA 3U56A 1D2MA 4RF5A 2H7YA 4JI1B 3ROPA 4U02A 2Q21A 2WFZA 4NK4A 1TM5E 2XTJA 1GN8A 5TIIA 4FB5A 1QIDA 2P65A 4R2JA 3NDRA 3OFKA 4G01B 2F8MA 3HVRA 2FQYA 2XXAB 1JILA 4MWCA 4AZ0B 5BNWA 1I0ZA 1QG0A 1Y9AA 1WLYA 4RHFA 2GDZA 2X5JO 3QEJA 4UU1A 4JASB 2AX3A 3W2TA 3WWCA 2O6LA 4BIIA 1STOA 1XRRA 4FEGA 5D2CA 3W1WA 5FDFA 5CDHA 5LIRA 3M6XA 2OYCA 5JC1A 3DHYA 3GEMA 3P0RA 1XVAA 1EINA 1U8AA 2DQZA 1PFKA 1YR6A 3GJ3A 4U2EA 1RE0A 2BBSA 3LPNA 2JJ1D 3OIDA 5DWVA 1QFZA 3M4XA 1GZ6A 1O97D 3BH7A 3HYLA 3LWBA 3KXIA 1XLTC 3OZXA 4J49A 3HZHA 1FTNA 1JBEA 2O0KA 1KYVA 3MELA 3RO7A 2HV9A 3THRA 1AO0A 1IBSA 3TIVA 2HAEA 1YV9A 4JI8B 2BIFA 5LC1A 2I80A 1KXZA 3TPZA 4KO4S 3R09A 5JXHA 3TLGB 5HXAA 1LGYA 4P82A 2WF7A 2PR2A 1KQOA 1QUFA 4WXEA 2HK7A 2VF5X 3ANNA 3GPDG 5JXJA 1XKLA 2YJZA 3BN3A 2PHZA 4S1OA 5AXBA 4DWVA 5LQUA 4S1TA 3ESYA 5E6SA 4Z53A 1XFDA 4XVHA 3FHJA 1K3UB 5G2OA 4D8WA 3SE7A 3CISA 4WK2B 2ZR9A 3C4JA 3EGIA 1KJYA 3LQRA 5AKZA 2XOEA 3QFCA 1QHNA 3TOVA 4YMGA 4O2BF 4NFHA 4C01A 2EATA 4ROSA 5F2KA 1ZW1A 1X8KA 3SYKA 1JQ5A 4M7PA 4UMFA 2WSMA 3TW6A 4BATA 5CDTA 2JLBA 2ZTLA 3TTYA 3WDKA 2Q9CA 3JQGA 5IJ9A 1KGDA 2RHRA 2MHCA 3EQZA 1AQNA 5K3CA 1P44A 2OBXA 3WDLA 2JCXA 5AVZA 1GAJA 2DBRA 2IYUA 1NI5A 2BMJA 1A8PA 5FBKA 4E09A 3ODPA 3VA7A 4C6SA 1U3FA 2FFRA 5DGTA 5AVOA 1T26A 1WZCA 3W1VA 2XVMA 3NC1C 4HZGA 5I4BA 4NCXA 3U26A 2E5LB 1U7XA 1PJ2A 3PD0A 5BNFA 3H42B 5C8YA 1WBBA 1RMYA 5JCPA 2WFMA 3A2NA 4RPIA 1PZFA 4UAJA 1S6YA 2MYPA 2XW6A 4CMAA 1AUXA 1KI4A 2PMKA 5TVGA 4BMYA 5EHQA 1EWYA 1EGAA 5ALDA 3UMCA 4TTRA 3BZBA 5BSGA 1T2FA 1PNTA 2G28A 3DZCA 2MINB 3GGOA 3M6WA 2G40A 2V8BA 2ZITA 4NE9A 3AF1A 5EERA 2RHDA 5ARBA 2CUKA 3I9V6 1IHXA 1ZU4A 4C0HA 5ES4B 3WOHA 1NXWA 2HDNB 2GHQA 4Q7MB 1PD0A 1GILA 4EG8A 1TLFA 3CLTC 2QRJA 3ID6C 2CD7A 3V8NA 3AFHA 1O4WA 2X8WA 4TKVB 1GPYA 1M2OA 4EG4A 3KR1A 2WAYA 4BZWA 2G0AA 1W9HA 3JSXA 3HBNA 5JAPA 5JPCA 3F49S 1M1YB 3EA4A 4G5HA 4FYIA 3Q9LA 3MJCA 1E4OA 2C95A 1BGWA 1XRMA 2B7CA 2XQVA 3HA5A 2ZSBA 1UC8A 3NCTA 1HKUA 2A5LA 1YTLA 4WCFC 3OTWA 5DBGA 4M46A 2F8TA 3REQA 4OP3A 1B0UA 1F1BA 5EIBC 1N2IA 3O92A 5IXYA 3KETA 4JEMA 4CGYA 3PQFA 4EI8A 3E7XA 4BKMA 4ZRDA 3LM8A 4GX1A 3EXG1 4AJOA 4TN5A 1EMDA 2QJRA 3LP6A 4DMGA 5K20A 3KHTA 4KQ2A 5EIXA 1JBKA 4LE1A 3JQAD 4XA8A 1G3MA 4RA9B 3W04A 4D4HA 5LOVF 2FV8A 3BIOA 4F21A 1FU4A 4PZDA 3FWNA 3CH7A 3EXG2 3PWSA 1VYVA 3WZLA 1NVMB 3KXDA 1N8NA 4DA6A 4OUKX 5KNCD 2XNDD 3EODA 5CTJA 4MEJA 1AQUA 3GRZA 3VTFA 2E4VA 5CA1A 2YVUA 2JFXA 1E0SA 2X1VA 1RM3A 3DMYA 4O4IF 3PQCA 1C7EA 2PS9A 1U2SA 2DFNA 3FCXA 4TWAA 2WM3A 3FYUB 4KPGA 2EERA 2OKGA 3Q6IA 4L9RA 4IIBA 1CFZA 2BGTA 3ZIDA 1TYEB 1JAIA 4JSYA 2PRKA 4ZO7A 2FUG6 1BZYA 1PJ8A 4WBSA 3WO0A 4IV5A 3UAOA 5A6VA 4BEVA 3UN1A 2BC9A 3KQNA 2OCLA 3OC0A 2VF4X 3AC0A 1ZSVA 4QULA 4ETMA 2YRFA 4UJ5A 521PA 1T5HX 3WZ2A 4BAZA 1NW7A 4YGYA 5AJHA 3BWXA 4N5MA 3EY9A 2YUIA 3KZOA 4H3HB 4PGGA 4B5KA 5C5IA 6CHYA 2YYSA 1L5YA 1PCXA 3WNBA 5JXIA 1EESA 4K6KA 1ZFNA 5BN1A 1WSWA 1XZFA 2AN1A 2Y1FA 4HQKA 5ECWA 3PE6A 4LKOA 2BF7A 2C59A 2L42A 3AJ8A 5IH7A 1UMCB 1TTHA 2R84A 1A2OA 3O5AA 5BQPA 1OXKB 4Q18A 4TGLA 1XN4A 1L6RA 3TS1A 1FPQA 1I7SB 3NIDB 5E9AA 5H9WA 4HB4A 1U8EA 3TSCA 1NBMD 1LRJA 4YDRA 4AKHA 1N4AA 3OKAA 2P62A 3SFTA 4A27A 4DJAA 2QJTA 4DWJA 1OV6A 1WY5A 1JLHA 2QL9A 2QLLA 2ZJ5A 4H4CA 1X1CA 4IF6A 2YOGA 4W9RA 1T2VA 2J3EA 2EOAA 3WRVA 3EZ7A 5CG2A 3K0BA 3PPIA 4MSUA 3MJSA 4KLAA 5JSHA 2DJIA 2J9FA 2O20A 3T3MB 4U2GA 3WMGA 1O5TA 2C9YA 3K2BA 2GEFA 2X5OA 3KVOA 3EAFA 3AHFA 4KIFA 2X14A 1H2RS 2YZMA 3G5TA 3PJRA 2E7ZA 2ZB2A 4IZOA 1OTYA 3NALA 4TKMA 5ICEA 2O8EA 3INNA 3LUAA 5CM8B 3TF5A 4G0MA 1KBZA 1G55A 3PNOA 4QNRA 4QIHA 2EF0A 4B9EA 4COKA 1U0SY 1WVIA 2RDMA 5B3AA 2PX2A 1JPVA 1AGNA 1W0KA 4IIXA 4PVDA 3VR5D 5FH9A 1JBQA 4AMYA 1SHTX 1UOPA 2ONYA 1L5LA 4CDNA 3ZWVA 1KYTA 1HFJA 1NYLA 1XJCA 3COJA 3G8DA 4E5YA 5CURA 3T1NA 2KJQA 3Q6MA 4NATA 2IEYA 2J8ZA 1CJCA 4OHMA 2V3WA 2CYCA 4FS3A 5BWCA 4UDNA 3H5WA 1XZPA 5IM4A 1VSUA 3RS7A 3B13B 4MB6A 3GQBA 2ORIA 2P11A 5EXSA 3WYCA 2C5FA 3HYRA 1KH1A 4D41A 1HQDA 4X60A 1XIVA 3IQEA 2NO7A 3JATA 5MFZA 1GLVA 1XALA 1JA1A 3BXZA 4F3KA 2W71A 3L49A 4WDRA 2YWBA 1TO1E 4C6TB 2WOJA 3ANSA 1IMOA 1HI9A 3CNLA 1RYMA 4OJMX 1R9JA 3C3BA 5GOZA 4AT1A 2WU3A 4R9NA 3T0IA 2EJUA 1D5WA 4I6GA 1LK0A 3BL8A 3T9DA 2Q3HA 2CLIB 1TRHA 4BXOA 1WP4A 4OB8A 3COZA 4G5QA 3L07A 1Y4UA 5K9ZA 1BGVA 1YQEA 2ZTSA 1R3UA 3HYNA 5LB2A 3VZQA 4B7XA 2ZJOA 2HX1A 3S2SA 1FVOA 1KA9H 3K9GA 4QDJA 3A3NA 3IDZA 3W3AA 1X7HA 3PRYA 2A0KA 1XZLA 3E2IA 3MJDA 4NLLA 2D5CA 4BN4A 2F1RA 2PQ0A 3V42A 3PWKA 2P27A 4YAUA 3IS3A 5F3DA 1J5PA 1NF2A 1T36A 1EX9A 3KQLA 4E70A 3TW8B 2OZEA 3H8WA 3ZVRA 5BMVA 4LHEA 1HYBA 2OB1A 4XEUA 4XYEA 4U2CA 5B53A 3AUTA 1ZN9A 1AC5A 1TNDA 2PA3A 2R6AA 2SKDA 1AQ6A 1QIKA 1OXSC 2C4NA 2OUKA 4CGZA 3PX2A 1R7RA 2QRVB 3F9CA 4XX0B 1G21A 2N0SA 1MB2A 4IDEA 2IP2A 4JBYA 1OXVA 2VP0A 4C1BA 2KYRA 1HC7A 3ZHBA 4GYJA 4ZT4A 3CVXA 1X38A 2EWWA 3OA0A 4RJIA 2QAJA 4JN6B 1EGMB 1Z38A 2OGWA 3KWMA 1G7SA 1ZNYA 3LW7A 3OZTA 4ARSA 2I6XA 4UHJA 5LSAA 4C2TA 2ZW9A 4OQQA 5DXAA 3VPGA 5A7GA 3R77A 5EJGA 1G98A 2PGDA 3U40A 2IEDA 3T3IA 5CFQA 2EKBA 2PD4A 3UHOA 2FLKA 2OAGA 3KQVA 3U44B 3FDFA 1QIGA 4I4LA 1YQWA 4NZNA 2FVXA 3RBVA 4P3OA 3KK0A 5JS6A 1TF5A 4I8DA 4KMRA 2JIRA 2N1MA 3VOBA 4EM6A 1UXGA 4ARZA 2ZRAA 5H70A 5J4HA 3C8MA 1Z18A 1DLJA 3HVUA 1GKUB 1Q11A 5HCNA 5BRNA 4A7PA 3A2LA 4EGSA 2YZGA 2HPVA 3N0TA 1Z3IX 3OIFA 2GD0A 1X8JA 2W6PA 5K0ZA 3A9WA 1N7GA 3LBYA 1EQUA 4UHHA 3RNLA 3SYRA 4PG8A 5FWXB 4CKYA 2P69A 3BEDA 4Y2HA 5DLPA 3T4UA 1PJ3A 5B2EA 1X1QA 2FI1A 4G1UC 1FDOA 1ECJA 2ERYA 2OXRA 2XH8A 3KT6A 4G4IA 4ZO9A 3DG9A 1KY4A 1XCGB 2B21A 4DIKA 1TFRA 1V7ZA 1VXRA 2BH9A 3DMHA 3KP1A 1CXZA 1P33A 1IYZA 1E64A 1PQWA 3C3AA 1MIOB 3R3VA 5EY5B 2NT4A 1TD9A 2PKRA 3LFHA 3LUJA 4LI0A 4U6SA 5B4VA 1JVBA 3ACBA 1WSAA 4UARA 3AVTA 1JR6A 3O1LA 3JD1A 3KEOA 1G5IA 1TU4A 4LJAA 1UFRA 1V1MA 4RZ3A 4F9FA 1LPMA 3BDIA 3D2CA 3JRXA 4YCBA 1XTVA 2Z5VA 2BAGA 1QO9A 3SZUA 1COWD 4MPRA 1FTSA 2LVBA 3TM4A 4DQVA 3II6X 1D0VA 2UKDA 4JOCA 1W2HA 2ZUBA 4QTTB 2EKPA 5DLQC 5F4ZA 5BY2A 3R0ZA 1C4OA 3SYNA 2OCKA 1BVRA 1BX3A 3DL2A 1NVTA 4W4TA 2P3SA 2GBFA 4A91A 2ZJ7A 3FPKA 1TL7C 1YDGA 2WC1A 3V7FA 4PC7A 3E7FA 3GQBB 1OBOA 4IJMA 1CETA 4EF6A 4W8HA 1W4AA 1Y3FE 2G09A 1U2TA 3GGSA 4Z2AA 1IEWA 3PL1A 4RWEA 3U4DA 4OXNA 1IUKA 3JAKB 3Q9SA 4EGQA 4ZN6A 5BVGB 1DAFA 5CB4B 4QU8A 4A9AA 3CTMA 3CEHA 3W4IA 2VJMA 3FPGA 4OLBA 3QMMA 2VF8A 4BV9A 1T3HA 1NE2A 3K1AA 4G0OA 4HUJA 1BW9B 4JLVA 4RE5A 1NSYA 1RXUA 3C74A 4AI6A 4DY6A 5DNEA 3GCZA 3SJAA 5I3CA 1BS2A 4DILA 3WGMA 2Q5HA 3QKIA 1N1MA 3QVSA 1B00A 5AO9A 1QIIA 1RE1A 2G36A 4I9UA 1YOBA 4D4GA 2VHVA 2FPMA 3OCVA 4TROA 4RF3A 5CLGA 1NR1A 4GYKA 3GC6A 1N5IA 2R62A 4FN4A 1ST3A 3IGFA 4MKZA 2NPFA 1XP5A 3TOXA 2JZNA 3EMBA 4B46A 1TEHA 1UQRA 2DTXA 3EYWA 4UU7A 4WEOA 4EKIA 4NXNB 3TLJA 1W4LA 5EGNA 4DCUA 4ZZ1A 4FOSA 3TEMA 3EVAA