1DAHA

Dethiobiotin synthetase complexed with 7,8-diamino-nonanoic acid, 5'-adenosyl-methylene-triphosphate, and manganese
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dahA00
3CF2A 5DLQC 3NBFA 2KBFA 5LD2B 4B35A 2VH5R 2EFCB 1RRFA 3H86A 5KSOA 4TSFA 5AUQA 2RCNA 2ODWA 1OH6A 3H0KA 1VPLA 4Z54A 1QHGA 4JLMA 3BB1A 5L3RA 2H16A 2CLCX 3EZ6A 3LAWA 4LV5B 4RD4A 3ADCA 2H92A 2ZJ5A 1W0KD 4GL2A 4NDZA 3BD9A 4PPFA 3ND9A 3U3KA 1KKLA 5K8LA 2JLYA 4TMXA 3RC3A 3NEJA 4JVNA 5HE9A 3SOPA 3ZZ0A 2AFHE 2VHJA 1E32A 1ZRHA 4URXR 1EGAA 1XWIA 2EFGA 1OXSC 4B44A 4JZKA 1SXJB 3EW9A 4DLWA 4LJ5A 2QG6A 3LY5A 4P4SB 3KQKA 2CLDX 1KK0A 4Q00A 4RZUA 3GLHE 4M1WA 4BFTA 2VRWA 2W6JD 1S4QA 2H1LA 1E0JA 1U2RA 2F6RA 2FGJA 2ZYVX 3GLHA 3GLHB 3K53A 4LYJA 4NL4H 2GJKA 3TW4A 1TQ4A 5HKKD 1COWD 2XITA 3W9YA 3L2OB 2ONJA 4CEHA 1ZCAA 1JEDA 4HLQB 1SKQA 3N2IA 4UQOA 2R9VA 4OJKA 5EQTA 3THYB 4A8JA 1VYTA 1LV7A 1FNNA 3K9LA 2O0HA 1P2VA 1D2NA 1KI8A 2WWFA 2QTFA 3TAHA 4WVFA 1AS2A 2PH1A 1MH1A 3RRYA 2MMGA 4EJSA 1G16A 3TVDA 3VX4A 3VAAA 5M04A 3K70B 5E7IA 5BWMA 1AKYA 2ZR0A 5EZ5A 3DMNA 1W49A 1WBDA 2FE4A 5J4KA 5LDDC 1E1RA 1M74A 3RNLA 2J7PD 4QNRA 4A8JC 3A6PC 5DISB 3DEFA 3AF0A 3IPXA 3SJAA 4BRUA 4G01B 4DVGA 4CEIB 1G3MA 2Z4SA 3H4MA 3QKRB 1KY2A 3Q7QA 1M34E 4BPBA 4AI6A 2G0TA 4EPRA 5CYPA 3UG7A 1U0LA 1OE0A 2J1LA 2KJQA 4NMMA 3LV8A 5E7MA 4PC2A 1OXTA 5J47A 3ZD6A 1XTJA 2HT6A 2IYXA 2EFDB 1G3QA 2QAGB 3OEHD 1JECA 1US8A 4PPGA 5KUTA 4I1UA 4TT3A 4BFZA 1D9ZA 3ND8A 4D0NA 1R10A 1MV5A 5DYGA 3ZDQA 3ADDA 2O8EA 2GXSA 3RAPR 4EDHA 4V02A 1T91A 4RCZA 3LO5A 4RZ3A 4A92A 2D4HA 4BASA 4PO1A 5B57C 3KQNA 3BJIC 2OBLA 2VSOA 2IXGA 2ZS8A 3PR1A 4B43A 1QVAA 1ZNWA 4Z8XA 4LGMA 1FMLA 1KZ7B 4Q47A 2IS2A 4R9UC 2C9YA 1LB1B 5A0FA 2PT5A 2W2XA 3Q8XB 2B7CA 3HPQA 1HTWA 1Z06A 2FZLA 3HU1A 2Q9BA 3IIMA 4DB2A 2OCPA 3T34A 4AKEA 1KY3A 1M1YE 3CNLA 3KKNA 2F1HA 2ZRCA 4JSTA 3SI7A 3U7FB 4V0KA 2LWIA 1Z8FA 2GVZC 3RDPA 4Q4JA 3UXMA 2OXRA 1BMFA 1LVGA 3G5UA 1G291 4ILEA 3AF2A 3THWB 4C2TA 2JEOA 1E9BA 3GJ7A 4LC1A 1Z0JA 3RC8A 2GDJA 1W36B 4LDJA 1AS0A 4QHYA 4G5SA 2ATXA 4MDFA 3QPWA 5JWRA 2ZYTX 4LOAA 1KSFX 3A36A 5DO9A 1QHNA 4UJ3A 2KI5A 2ZI9A 3TK1A 2FV8A 2GK7A 3FYHA 4JMPA 2QT0A 1S9HA 3MLEA 4CVNA 1NMZA 3L82B 4CW7A 3A1UA 4HB2A 4FXPA 3WP1B 5FPTA 1Q44A 2OT3B 2E87A 2YINC 3GQBA 3QXSA 1SKYE 2EVWX 2XOKD 4Q19A 4Q4HA 4Q4HB 5J40A 4ABYA 4DLZA 4R7ZA 1P9NA 5BN4A 3NH9A 4NCNA 1XZPA 4D4LA 3P27A 1J70A 3QOFA 1HA3A 3GJ5A 4PQFA 1UF9A 4DRZA 3DVLA 3K09C 4A6XA 1VYVA 2F1RA 3ECCA 3PV0A 4F7WA 4A0RA 4NYJR 3NC1C 2QPAA 3I3SR 2A9KA 3A8TA 3QXHA 3QY0A 4NYJQ 2BMJA 4OI1A 3TJZA 4ASUA 3I5YA 5AUNB 4DCSA 3RSLA 4DSUA 1NLYA 3TH5A 4DIDA 2HF9A 1JR3D 4Q4LA 1SQ5A 3QSYA 4XH9B 4YDHB 2ZUCA 3KUDA 1L4UA 4CDGA 2GZHA 3Q72A 4UXHA 3M1IA 1M7GA 3I62A 4O2RA 1WBBA 3OEEA 5TARA 5E3HA 1G3IA 1G8FA 2R2AA 2B8WA 4UXIA 2NZJA 2X1VA 3BH0A 2J0SA 4M53A 3QEJA 4OBEA 1G64A 3PCRB 1ZM2A 3L8YA 4AG5A 4IEIA 3RWOA 1TU4A 1PVOA 1ZVQA 2H7VA 4OHZA 4LUCA 4PQRA 2HYDA 2QGZA 1BKDR 4ON9A 2J46A 1F5NA 2IF0A 2RGNC 4HZUB 1OB5A 2FPLA 1YZTA 4MYUA 1TF2A 1Z2AA 3ZQ6A 2ASEA 4D4MA 4JL5A 1GRQA 1Z6XA 3LLUA 1DAGA 3AVWA 2JLVA 1BS1A 4DDTA 3GD7A 3P1JA 3Q7PA 2MSCB 1TX4B 1UDXA 2CLSA 4NU0A 5JSZA 1DPFA 4JIMA 2JA1A 2ZR9A 1BYIA 5EXTA 3VKHA 1EX6A 1Z29A 2PLFA 4C0SA 1TADA 2O0KA 1V5WA 3GJ4A 4B76A 1E0KA 2QTVB 3T1OA 4TMKA 4PHFA 2IX3A 4AWXA 2FJUA 3IIKA 1KDTA 2P5TB 5K8UA 2GAAA 3TUIC 5DYIA 4DJTA 1AIPA 4LX0A 2JDID 3MAAC 5HTKA 2ZVPX 1X8LA 5L3VA 4W5WA 1DO0A 3EPHA 2IS4A 1OIWA 1WCV1 2KBEA 1JPJA 4D82A 1KJYA 2D3WA 4HLDA 2WMOB 4C0HA 2FEMA 3IHLA 2Z43A 4TYPA 1GL9B 4M2LA 2OZEA 3KUCA 1IXZA 1IJFA 1KTVA 1U98A 1N6PA 2KWIA 4LBWA 4LBVA 1YZLA 1FP7A 2SHKA 2NO6A 1Q0UA 3BBPA 2WKQA 1IN6A 1TNDA 1GWNA 2BKUA 3SBEA 2P67A 1NNEA 2L0XA 1DE0A 1GG2A 1FW6A 4ACAA 2JATA 4TZ0A 3DPUA 3D3QA 2JLZA 3CR8A 4JLKA 4GMXA 4HEJA 2ZE5A 2CVHA 1IM2A 3LVRE 1HYQA 3EPLA 2XNDD 3VFDA 1GL7A 3I72A 1K5GA 1NVWQ 2WMNB 3AVQA 3L0OA 3QQ5A 3TR0A 2QE7D 3WBKA 1S1CA 3QVUA 1YZKA 1F48A 4G1UC 5IHPA 3KB2A 4DUGA 2WWXA 2D7CA 2FN4A 2ZRGA 2GXAA 2P6NA 2CL6X 4NCJA 1QHSA 4A0FA 3ZIAD 4QBHA 4FWTA 1A5TA 2YWFA 2ZJ2A 3AV0B 2J45A 5FR1A 2AK2A 4BEJA 2Z6VA 3TSZA 3FHOA 1FMJA 3PEWA 4Z1MA 2W00A 3QKSA 2QY9A 1MR3F 2BEKA 2RB4A 2G88A 2ZSDA 1I4DD 3HR8A 4P4TA 3MCAA 4FMCB 5K8IA 3CRQA 2JCSA 3IBYA 3QF4A 1NLZA 1NVVR 1TUIA 1KI1A 2D06A 1OIXA 2WSMA 2VP9A 1X8JA 1NVVQ 3EAQA 4KCGA 4CIDA 4CEJA 1VCNA 3CX7A 4O3MA 1BH2A 1W5SA 821PA 2FSFA 2IEYA 2XX3A 3NTUA 3FKSA 2OG2A 4PTLA 4IHQA 4UNPA 4HB4A 1Z6AA 3NC0C 2QQ0A 3CZPA 4KFTA 4YXWD 4ZI3A 4DLXA 2ZRPA 1ESMA 1NLFA 2UZ3A 3SJCA 5KSPA 2CMKA 2R6GA 2NTYC 4LC0A 2V9PA 5EZ6B 5CLQA 3B7GA 2QGNA 2W58A 3HR7A 4BFVA 3TVTA 3WP0A 3NIBA 4URZR 4A2PA 2PCJA 4RD3A 2QN6A 5L3SB 3B85A 3VNVA 5G3ZA 1GL6A 3EC1A 3GLFE 4HATA 2FWRA 4HDOB 3GLFB 1YZQA 1ZNXA 1XP8A 2QNRA 5IRCD 4MDEA 4I81A 1CULC 2IWHA 4TTPA 3CPEA 4HSEA 4DZZA 2DY1A 4IRUB 1KI3A 4OJQA 4QGAA 1OKKA 3P20A 5G41A 1H8EA 1E2HA 2AD1A 3I8XA 1R0XA 2XEXA 3T1VA 5AK0A 4NCIA 4QKQA 4D0GA 4DT1A 4AKIA 1MRSA 4TL7A 3WMGA 4ZDKA 4TTRA 2EWWA 2PJZA 4R98A 3TAUA 4KITB 2NPFA 3NWJA 4C0QC 5FOWA 2C77A 1KNXA 3B9PA 3BWDD 4UXJA 4XIGS 4JSYA 4IDHA 2WWWA 3CWZA 5FUXA 1R7RA 2DR3A 2JJ1A 1XU4A 3EWAA 3F0TA 3I92A 3LWNA 4RVCA 1E9DA 1XBTA 2QRNA 3T5DA 1G8YA 2C9CA 2JJ8A 3MD0A 3KQLA 5GJCA 4HYYA 4RSGA 1NJGA 2QBYA 1P73A 5C46F 4DLRA 1VCIA 3EXAA 4MYTA 4I4LA 3O8RA 1FZQA 1Z0AA 3LQRA 3OESA 2BM0A 2N46A 3K9HA 4LK2A 4WXRA 2ZETA 2BCGY 1R0WA 3TR5A 2V4ZA 3REFA 2AWNA 2PL3A 3FVQA 3T1TA 1XTIA 3NDPA 1ZNYA 1CXZA 1N0UA 4ZDJA 4BLQA 4JLOA 2ZJBA 2FU5C 1M2OB 1XTSA 1G7RA 1LFDB 4A6PA 2OILA 4OK6A 1E2EA 5EE1A 1EFCA 2X19A 3HYTA 2C95A 5DN6D 5EXSA 1OW3B 3TNFA 3B1ZA 3VQTA 5D3QA 4DLSA 1BIFA 4PPQA 1XTQA 1T4GA 1E99A 1E79A 1O3YA 1G19A 4IVQA 4M0LA 3I1FA 5DI3A 5FTKA 4DCVA 4DEXA 1IY0A 2W6ID 1G4AE 4B3BA 4JVLA 3UWOA 3PIRA 4MYHA 4HUTA 2CXXA 4U5XA 2IUUA 4TL9A 1Z0IA 2V3CC 4DKXA 3KJEA 3BFXA 1UEIA 4Q03A 5JI2E 1W7AA 1YZGA 2ZU0C 2P6UA 2VHTA 1XMJA 5K8TA 5JJKA 2PMKA 1KK1A 3ZH9B 1WA5A 1S2MA 3A1SA 1W0KA 4ARZA 3SFVA 4GFDA 2BMEA 4V0NA 3ADBA 3BH6A 2NQ2C 1AM4D 1Z0KA 5AR1A 3LDAA 1S1MA 2AKAB 2WOOA 2WSSD 1EWRA 2VSXA 4GZLA 3RRMA 4R71A 2YNMA 4TLEA 3B1VA 3UPUA 2RGEA 4V0MA 2RKOA 1UM8A 1WMSA 2CHVA 1UPTA 1KO7A 2W6JA 3T15A 3R9IA 1ZIPA 2XB4A 1HT1E 4Q18A 2YVUA 3LX8A 4LV6A 1DBSA 3AB3A 5CJPA 4JL8A 1AQYA 5HKKA 1COWA 1XXHE 1XXHB 2V7QD 1XXHA 4M1MA 1P61B 2ZU6A 3KKOA 4GNKA 3WBJA 1KDPA 1E94E 4LYHA 1KAOA 2KE5A 4WA7A 4DSTA 4Z51A 4IXNA 2RHMA 1FNMA 3PUYA 3B9QA 5FOTA 3TLXA 2GILA 1S9DA 3QG1A 2Q9AA 2Q0HA 3ZS8A 1M8PA 3FMOB 1AA9A 4XSHA 2VP5A 1DELA 1XMSA 3C5HA 4OI2A 3RYTC 3U4QB 4NP6A 5BN5A 1MRNA 4XD7D 1T3LA 3BH7A 2J87A 1NKTA 1N6OA 1HV8A 3AVPA 5G3YA 5TDHA 2ZI7A 2F55A 1R5NA 4QFMA 2GETA 3VR5A 5BN3A 2J7PA 3L43A 3AM1A 4P31A 4ERNA 3LD9A 1Z63A 2KSQA 3TRFA 4A82A 1QBKC 2V8OA 1JAIA 1IN4A 1ONBA 4LJ4A 4PAQA 4MRVA 5JMTA 4HAUA 2PJRA 1Y3AA 1IN8A 4IDOA 4QHTA 5JRZA 1G21E 1NMYA 2BOVA 1U94A 2BIFA 4KV9A 4NYMR 1F2TB 2ECKA 3P4XA 1ZNZA 1IJEA 4H1VA 4AURA 4NYMQ 3OEHA 2D7DA 2IF2A 4WOPA 1ZYUA 2A5DA 4BECA 5FL7D 2W2VA 4PQYA 3SC3A 3VR2A 2OLKA 2X2FA 3CLVA 2CNWD 5H1YA 4IOLA 1NP6A 3MWLA 3THXA 1GNPA 1OXVA 3DZ8A 5KNCA 1KO8A 4U00A 1GUAA 3K0AA 1X6VA 5B2ZA 4NYIQ 2WJGA 3HYRA 1NBME 1UJ2A 2RGBA 2WJHA 3QPVA 4PZLA 2GEUA 2V1UA 1G5PA 1OPXA 4M1KA 4ZCLA 1KO4A 2HJVA 5FBWB 3UWKA 1XDBA 1XD9A 2X2EA 3IO3A 5FPYA 3C15C 3V4RA 4Q1FA 5FI0B 2CE7A 5IDVA 4FCWA 1QZXA 1NRJB 5EJEA 2WJJA 3PXGA 4G0NA 1G8PA 4BZPA 4US1R 2VP2A 2ONKA 1Q12A 3BB3A 3CRW1 4UKDA 1Z5ZA 1X86B 1KHTA 1DTSA 2FH5B 1SVLA 2FFBA 3OE7D 3RSOA 3RS0A 5KTYA 4M1YA 2B6HA 2OESA 1G17A 5KU1A 1GILA 2ZRMA 3VU9A 4DXAA 1UFQA 1DEKA 3KKMA 3FDIA 4AD8A 3PENA 1W1WA 4MRPA 3GEHA 2BBSA 1J8YF 3OIWA 3R9XA 3AH8A 4A9AA 3LVQE 2XZLA 1ZMXA 2FX3A 2ZXUA 2ZAOA 2IWRA 1E79D 2DFTA 3AVYA 2MMCA 4E07A 4YMTA 4QBFA 4KU4A 3ZVRA 1DAFA 4DDWA 3KDSE 1N2CE 4MH0R 3QF7A 4AKGA 3NEYA 1CLUA 1SVSA 1XMIA 3MWYW 2PEZA 1M6NA 1NMXA 4G5QA 2XOKA 4FWIB 5P21A 4R2HA 4DLVA 1DS6A 4KXFB 3VR1A 1MOZA 2VBCA 2IUSA 4U02A 4QXAA 4Q9KA 2ORVA 1S3SA 2GXQA 4TQ9A 2C03A 3T1QA 4B2LA 1D6JA 1HT2E 2NOAA 4XOIA 1H65A 1JJ7A 1R5BA 4Q9IA 1N6KA 2ATVA 5E95A 4GPTA 2FDCA 4RFVA 3IHWA 4B3CA 1N0WA 4C9BA 1UKYA 2QI9C 4ZPXA 5FFMA 3RVBA 4TMTA 4B6EA 3TKLA 1JR3A 2ORIA 3BE4A 4QGGA 1FTSA 1NN0A 2GF0A 1N5JA 3KKQA 2ZM5A 3HU3A 1OYYA 3UG6A 5G53C 5KOYA 5F9FA 2JGNA 3D31A 1T3HA 1ZUIA 3GJ0A 4CEHB 3B5JA 2DFNA 4BLOA 1GSIA 2CJWB 1QHIA 2CJWA 4Q7JB 1W4BA 1C9KA 2IUTA 3DM5A 1E4VA 3OF5A 3V9PA 4A8JB 1RC8A 1U9IA 3FTQA 1P9RA 1N0VC 4XVUA 1IQPA 4HB0A 3B13B 1JI0A 4F4CA 3GEIA 4D26A 2ZRKA 1Q22A 5C2JB 3NHBA 3KB1A 4FINA 5JJIA 4EJSB 4DLTA 1EG7A 1DAEA 2AXPA 2R44A 3PQCA 4KBFA 1OHHA 1GDDA 4M21A 1M7BA 1XD2A 1H8HD 3BFKA 3DZDA 3K0FA 1YQTA 1LS6A 1U9IC 4M9ZA 1XPRA 1WF3A 2I1VB 2A5GA 4N3NA 4DWJA 2Y8EA 1Q1EA 1E1QD 2AL7A 2AHOA 2QM8A 3SU8A 3EPJA 3QXXA 4TYYA 1GZSA 4YONB 1I4TD 2BWJA 2WZQA 2HUPA 3W90A 4EJSC 1OIVA 4PFSA 2C98A 3ZQJA 2ZSAA 3A1VA 3W5IA 4HLCA 2IYSA 3SE0A 4E22A 4LPKA 2JDIA 2BBTA 4GOXA 4E09A 1W48A 1TQDA 1US8B 2DWQA 2ZE8A 3W3ZB 2A78A 2WIAA 1Q20A 3CNOA 5DHAA 5IK2D 4TZ6A 2IBMA 1P3JA 5JHGB 4NONA 1II9A 3QBTA 2F3TA 3VHXA 2O8EB 3I32A 1YR9A 3AUXA 2GCOA 4K81B 1OH7A 2YC4C 4AY2A 2ANCA 3H2YA 3BK7A 3D6TB 4DSOA 4E5UA 3HJNA 2WVJA 3DL0A 4DB4A 4D25A 2AFIE 2K5UA 4PC3A 3LH5A 5GJWC 3N2EA 4OL0A 4B2PA 3R8CA 3P4YA 5H8WA 1CJVC 1YU9A 3C5CA 5AJZA 3TW8B 3K0CA 5HPYB 2OFOA 2DWOA 3BOSA 1DO2A 3WNDA 5JS8A 3MFYA 2XNDA 3FMIA 3LNCA 3EC2A 4Q1EA 4EUNA 1KNQA 3ZVNA 4PO9A 3C4JA 4Q4JB 5JCZA 2QE7A 1G8GA 5FTJA 3RABA 5FUWA 4LWZA 3IQXA 2NMVA 2V6IA 4IOJA 1VKJA 2UVQA 2GJSA 3G82C 3ZIAA 4MRSA 3GJXC 3K0CC 1TQ2A 3TIFA 4PC7A 4B48A 1Z83A 2LCFA 1N5KA 4JL6A 4OK3A 2QL6A 4BLTA 2HXSA 4KYUA 3CRRA 4LBYA 4BLSA 4Q66C 2ZRAA 2Q3FA 1SVKA 4F4IA 3FHTA 3PJRA 1Q3TA 1KKMA 4Z8YA 3J81k 3RS3A 2IL1A 2ZS9A 4JT4A 5CK5A 4G5GA 4WBSA 2WM9B 5FPKA 3B8HA 2VLIA 5JEDA 1VECA 2ZSBA 4I1OA 4Q9LA 2PZEA 1G41A 5AWFC 1SKYB 2G3YA 4V0OA 1D8TA 1NN3A 3IUYA 3U5ZB 1NG9A 4DEYA 2ERXA 1LS1A 2GEVA 3OIYA 3VR3A 4KBGA 4B3XA 5FH9A 4YXWA 5KSZA 3CONA 4MKGA 4MUBA 4EFLA 3OFND 4BGDA 1DG1G 1MO6A 2NGRA 2YOFA 3HP1A 1B0UA 2OLJA 1KSGA 1XEXB 4JBYA 1XEXA 3L0PA 4QHSA 2ZITA 4JLJA 1G6HA 4KVGA 1OH5A 1TU3A 1KMHA 1T5LA 3SJBA 3NDBB 3KTAA 421PA 2JLQA 1AZSC 1G18A 2HLDD 1IOZA 1LW7A 1XJ0A 3X1DA 2WWGA 4OI4A 4JKYA 4LBZA 2WOJA 4JLBA 3MG9A 1NJFA 4IJMA 2J5XA 4B6FA 1Z0FA 3D7MA 3DKVA 2B21A 2E9SA 4DC9A 2MSEB 1UKEA 1PZNA 5EXPA 1JQJC 2PT7A 3Q5DA 1XD8A 4KLNA 3ASZA 4TN1A 5SZJA 4Q5IA 1I4LD 3X1ZA 1SXJD 4D4KA 3Q9LA 3RS7A 3K0EA 1XB2A 2OHFA 1ZM9A 5AJVB 5JEEA 4ZKEA 3QE0A 1XEWY 2O8BA 4WZAE 5AJYA 1FQJA 4LYAA 3QJYA 2J0UA 1T8UA 4QGHA 4URYR 1OHHD 1YE8A 1AGRA 2QUZA 3OIUA 3CNNA 3QNUA 3B1XA 1Z2CA 1Y63A 1MO4A 4LHXA 3W6OA 5AUPB 1ZUNB 1P9WA 1MO3A 2FSGA 5JSZB 2BMDA 4IDPA 3BIFA 3WNBA 4DCUA 2OCBA 4DIEA 1EFRD 3LLMA 2FSHA 3A1TA 1EESA 3DM9B 1KK3A 3GCGA 4P32A 1E9FA 3B78A 4XTCS 5DHFA 4C0AC 3FFBA 1X1SA 3K70D 1EFUA 3IEUA 3IIJA 3A4NA 5B58C 3I61A 5EP3A 1ZUHA 1N25A 1QHHA 4L15A 1LY1A 1U8ZA 3FE2A 1GITA 4I1VA 3CKLA 2ZI5A 2DYKA 5DE3A 4BFSA 2HT1A 4QJ4A 1G5TA 3QPUA 2PZFA 2BMFA 3BERA 4B32A 2WPDD 5DN6A 5CDFA 5BQ5A 2BJWA 3UATA 2JLWA 1LTQA 4A1FA 1SULA 4PO8A 2J41A 2W0MA 2IYVA 3U60B 2W6IA 4BFUA 4JYBA 3SYKA 3WYFA 3EPKA 4OI0A 2Z5FA 5JLJA 3B60A 1PLKA 2Q6TA 4BQSA 4XWOA 1A2BA 3L8ZA 1UEJA 3MMPA 1PJRA 1W4RA 2VP6A 2CL7X 4F4JA 5FTLA 1UAAA 2ZS7A 3G0HA 1VG0B 2VSFA 1WQ1R 1KI6A 1SZPA 3TGPA 3WYAA 3QIAA 1CKEA 2IYTA 2B92A 2VHCA 3ONWA 2ZE6A 3OHMA 1F2UB 1F2UA 3LW8A 5ELXA 3T12A 3BRWD 4HUQA 2VHUA 1JQLB 521PA 4UJ5A 2OO7A 2WSSA 3QI2A 4DDUA 3RRZA 1SVMA 2YWEA 3D8BA 4AKHA 1E9CA 2J0VA 3FGNA 4K46A 2HCBA 1G9XA 2FF7A 4PXAA 2P5SA 2EQBA 2HYIC 1TEVA 3W8RA 1DOAA 3KFXA 2XB2A 1Q57A 2QSZA 3KXKA 3U61B 4GBMA 2IXFA 3QKSB 2AD5A 5LPNA 4FMCF 2JJ2D 5A4JA 3CB4A 2V7QA 5E4FA 1E2GA 3QF4B 5JI3E 3EZ7A 1NIJA 1RRGA 1OFUX 1FUKA 1W36D 2XTZA 2GK6A 4Q4AA 4CEJB 1E69A 4JLDA 3SYNA 5KHOC 1B23P 2QZ4A 1F6BA 3C7KA 4YMWA 2FA9A 121PA 3O8BA 4IDNA 3K0SA 5C18A 2XSZD 1E2MA 4PANA 4XD7A 4ESHA 1SGWA 1P62B 4B47A 5BYKA 3KJHA 2GXUA 4EQ6A 1AK2A 1W0JA 3GLGE 1Q1QA 1WXQA 6Q21A 4RZ2A 4K8OA 4LHYA 1CR1A 4EKDA 3GLGA 3SQWA 2IS6A 4LYFA 1W4CA 4EPWA 3AQ4A 1QDEA 3AKDA 4FCVA 4TLAA 1KZGB 2ZEJA 4Q21A 5CJ2A 2P65A 3WY9A 1SHKA 2WKRA 2WJVA 2QQEA 2F1JA 4URUR 4BE7B 3GJ6A 4L16A 3EX7C 1G4UR 2D62A 4Q7MB 2D74A 1R0YA 3K1JA 1KK2A 3PUZA 3QEOA 4DLUA 1W46A 3BORA 4YDSA 1BYUA 4TLBA 5CITA 5D3MB 2XTMA 4HI0E 5D3MA 3UKDA 1N5IA 4JT2A 3PITA 4OHXA 2ZAMA 2JIZD 3NHAA 4G3XA 4DT1B 3GP8A 5FL7A 2CCGA 2WICA 2R6AA 2A2ZA 3IILA 4LJAA 4IFEA 4BWYA 2CNWA 1IN7A 4F93B 1W2HA 2XTNA 1TQ6A 2Z83A 3PG5A 4XTRA 4DDVA 2H5EA 4Y0VA 4RCYA 3C41J 4BZXA 4ARZB 1OLOA 1R4AA 5KO2A 5DI9A 4EIWA 5SZHB 1MABB 2C9OA 1MABA 2C5LA 2ZJZA 5DIFA 3DMDA 2QBYB 1PUJA 1E2DA 2HXYA 3IBGA 3LW7A 2BC9A 5FPHA 1XTKA 3BXZA 4EPXA 1PLJA 4A0HA 3PVSA 4H1UA 4PR0A 3KFVA 1Q1BA 1P75A 2G6BA 4EPTA 1U8YA 3M4YA 2RAPA 1JXMA 2ODNA 4J0QA 4ITRC 1TL7C 4II7A 2O52A 3OE7A 4MQBA 1U81A 2REOA 5FOVA 3PUWA 1O87A 2CL0X 1IY1A 2RH5A 2C96A 4AYWA 4N0EA 1ZC3A 1E3MA 2O8FA 1MKYA 1JNYA 2FFHA 4MKIA 1RJ9B 1YR6A 1RJ9A 4D80A 4DBLC 2GKSA 3VX3A 4ZO4A 3SNHA 1GKIA 3TBKA 4JLAA 4TLDA 1TUEA 5C4MA 2CVFA 2YWHA 2G1JA 4W9MC 2J3EA 1MO5A 5EP2A 3LA6A 1FPMA 1DVRA 4U7DA 2XZOA 1SVWA 2PBRA 3EA5A 2BVNA 2LKCA 1NIPA 3B82A 4KSBA 4KYIB 5EUMA 3TMKA 4ZCIA 5DI3B 4YMUA 5HZHA 4UNRA 3NH6A 2YZ2A 1R0ZA 2MSDB 3NVAA 4DHEA 1FP6A 1JALA 4BFWA 1HE8B 2FG5A 2QTHA 3A37A 1S8FA 4CF7A 4C3ZA 2A5YB 1ZIOA 2Q3HA 3AUYA 2YV5A 3NKVA 1Z6TA 4HAWA 1YR8A 1NG1A 2JASA 5KDLA 4BUJA 2AR7A 3KX2A 5TMPA 4BZQA 2F43A 2ZRFA 2CK3D 4WZBE 4AYXA 1VCOA 2A3RA 4QL3A 3NBZC 2FPMA 4HAZA 1R8QA 1JAHA 1QF9A 2XJ4A 2QP3A 3QVVA 4RKEA 2ZIAA 4C4PA 2PMDA 1CR2A 2HJGA 2QU8A 3ZZTA 1G6OA 2QRZA 4V0ME 2WWHA 1AKEA 4OHWA 2F3RA 2CCKA 2J59A 2KB0A 1Z22A 3CWQA 2XXAB 2XXAA 1GNRA 5TV2A 3SJZA 5JZVA 5HZKA 4Q7KA 4X8LA 4N0DA 1P4SA 2W83A 1CR4A 2OXCA 5F2EA 5GVRA 3VTKA 1E2NA 2G1KA 4EPVA 3KQUA 3OZXA 1G1MA 4EPYA 3RS4A 4US2R 1A4RA 3CM0A 2PX3A 1QG4A 1G3UA 3CPJB 1E2KA 2OM2A 3FHCB 1WDTA 4TQAA 3IQWA 2GBLA 4Q01A 3RS2A 3OAAD 4FW9A 2NG1A 4NCKA 2C04A 2YOGA 1DG3A 2YC2C 2VHQA 4LJ6A 4N1AA 1A1VA 2F7SA 5KPDA 3CX8A 2IEZA 1VIAA 1II0A 1RKBA 4NBSA 3U7EB 4C0LA 4NPHA 4OQMA 4BLRA 2BM1A 4GMDA 4FMDB 1H8HA 1W0JD 2ZYUX 5EE3A 4ACBA 4JYCA 4OQXA 1S96A 3A58B 1TMKA 4LHVA 1CTQA 2GBLC 4PPNA 2IT1A 4URVR 4M22A 3I4LA 5AJWA 4TLCA 1CIPA 4JLVA 1E1QA 4G5OA 3FMFA 2E1RA 1G5RA 2Z4RA 2IHYA 4WIAA 2PEYA 3I8SA 3ZVLA 1E2LA 1L8QA 5JWOA 1KSHA 2H17A 4ZDWA 3KXLA 1LF5A 3GLIA 4O0MA 4CRWB 4GRAA 5DSZA 2AX4A 2G83A 4H9GA 4CGZA 5IK2A 3GJ8A 1TF5A 2O8CA 4QNMA 1OB2A 2VF7A 1DAIA 1OT3A 3U3OA 1LNZA 1E9AA 5FUVA 4C0BA 3THXB 2W2TA 5SZKB 1T0HB 4NYIR 3ZVMA 5GADl 3K0AB 2GRJA 4NH0A 3SYLA 4AIIA 5GVSA 1NY5A 1CJMA 3NBXX 2FFAA 4JS0A 3M6AA 4JJKA 3W8NA 5AJXA 3ZGXA 2ZJYA 2F9LA 2GZDA 3ZLJA 3WXMA 3EZFA 5FR2A 1HQCA 2VA8A 3AF1A 3AGPA 5JBQA 2B8TA 5FOXA 4DSNA 4B3GA 1K5DA 1FFHA 3JVUA 3U3JA 5BYJA 4GDFA 3NXSA 3SEAA 1C4OA 4NTZA 3VR4A 1IHUA 4L5BA 2EW1A 2C8VA 2GESA 2ZRDA 1GIAA 4QRHA 4AYTA 4BRWA 2A30A 1E9RA 3QG5A 1VCMA 2ODEA 4A0GA 5FUYA 1OXUA 2OFXA 3VU9B 1XJQA 5J4YA 1ZM7A 4CYMA 3C16C 1X1RA 2OEPA 5BXQC 2NO9A 4UNNA 3T35A 4F91B 4LHWA 5DNYB 1D2EA 2A7QA 2BKEA 3W5JA 1L2TA 3FB4A 3QBVA 4P3YA 4UNSA 4YLGA 4MUAA 5SZIA 3WMFA 1W4AA 3BS4A 4AK9A 3GMTA 2JAQA 1XCMA 4JBXA 3EARA 1XZQA 4M1OA 2IYWA 3EASA 3OIVA 2D2EA 4TL8A 1ZCBA 2GJ9A 3PUXA 2WAYA 1VG1A 3P26A 1Z08A 3O8CA 2VO1A 1FL9A 2WWIA 3CF0A 1NVUQ 1G7SA 2IYZA 1IN5A 4US0R 1SVOA 3SN6A 1G7TA 1Z6GA 3LXXA 2GCNA 1KDRA 3WYGA 3WRYC 3ZYCA 3AVVA 1YHNA 1XX6A 4V0LA 2ZRHA 3KXIA 2I3BA 3BAFA 2GCPA 4YMSA 4KODA 3OFNA 1WB9A 1II8A 4LRWA 1FQKA 3H84A 4M9QA 4CZ2A 2CDNA 4FMBB 1JR3E 3TQCA 2AWOA 1EFTA 2XAUA 2ZSFA 2ORWA 3WRXC 1OFTA 2HLDA 3CZQA 4MRNA 4FCTA 1FX0B 1FX0A 1OF1A 2WKPA 3Q85A 2R6DA 1DARA 4QM6A 1KI2A 1P7CA 2XGJA 4OYHA 1RFLA 2CHQA 4IFBA 3JZMA 2ZE7A 3LQQA 4TMWA 2GAOA 3A1WA 3EIHA 2PX0A 1SXJE 1X3SA 2YHSA 5LD2C 4PSVA 2IYRA 4QJ5A 1SXJA 5DH9A 1ELOA 3DDCA 2GJAA 4M1TA 4P4SA 4D6PA 2BV3A 4KVAA 2GA8A 2QMHA 4B71A 2BCJQ 2DCUA 1YKSA 3FMPB 1RYHA 4P4UA 2P2LA 3DHWC 3AEZA 2V54A 2IK8A 2ZYWX 4NE2A 1VHLA 1XD2B 3ASYA 3AF3A 3K0FB 2DWPA 2BHRA 3PEUA 3LBNA 4KJZA 3THYA 1Q3HA 2DB3A 3CBQA 4WZ6A 2FOLA 3CRMA 4MA4A 1ETUA 1KAGA 4KAXA 3FWYA 4B33A 1JB1A 1SXJC 2V6JA 4C0JA 1EFRA 1G8HA 2DHRA 2R65A 2NO0A 4IKEA 3TUZC 2R6CA 4HAVA 4O2LA 2NO1A 2JLSA 3E1SA 3QUSA 1CBUA 3EWSA 1P5ZB 2EFEB 1OV4A 1NSFA 3F5FA 1PLLA 2QP4A 4O25A 1OFHA 3W6NA 4ZI2A 1GP2A 1KGDA 3CIOA 5UKDA 4MGZR 4PC6A 5BW8A 5IF9A 1E0AA 1W44A 2GJ8A 2GZAA 4FI3C 3MJRA 4CEIA 3U3RA 2GCOB 2WPDA 4A15A 3QKRA 3U7HB 3K8YA 1Q21A 1GFIA 1N6IA 2X8AA 4LSGA 1L7VC 3GJ3A 1GAJA 4PZYA 1JJVA 3RLFA 3K70C 1X8KA 5TY0A 1RVDA 5LBIA 1XNJA 5EE5B 4C30A 4RD0A 2FNAA 3L0IB 2QAGA 2TMKA 5H70A 2PLRA 3VNUA 3AVOA 4B34A 3HDTA 1NF3A 4YMVA 2IXEA 2QA5A 5J4HA 1KI4A 2WJYA 2VTKA 2ZPTX 2JLXA 3V00A 1W47A 3ICQB 4TTQA 4F38A 2ZRNA 2ZUDA 4RD1A 2CHGA 5J5CA 2ZVQX 4I1SA 3AVUA 1XFAA 3UIEA 1JXOA 2J7KA 4LZZA 2ZJ8A 4PSAA 1E2IA 2OFWA 3IGFA 2FZ4A 4RFSB 3IKJA 4RFSA 1GKUB 1HEIA 1NBMD 2GHIA 2QAGC 2C99A 1YRAA 3CUEF 1EFHA 1QVRA 2A5JA 2C78A 2QMEA 2ZI6A 1FTNA 4KHZA 1OFIA 1VIYA 5EE0A 2FMXA 4GSYA 3WMEA 1EXMA 1TEXA 4URWR 1AN0A 1RYFA 1E2PA 1P6XA 1IONA 3FPAA 1NY6A 3RRNA 4P0TA 1KMQA 5CM9C 1ZU4A 1SVIA 2JJ2A 1D2MA 2ZQ5A 3PEYA 3HU2A 1R6BX 5CM8B 4LJ8A 2QROA 3K9NA 1E96A 4FIDA 4W5JA 4CT5A 1JBKA 3KJIA 3THWA 4GT1A 2WJIA 1RZ3A 2Q21A 2GF9A 3B6EA 1R2QA 1IXSB 5F3WB 3UMSA 3IEVA 4L9WA 4LHZA 4IVRA 1K8RA 3DOEA 4C7OB 2YOHA 4C7OA 221PA 2DPXA 3PEVA 2P6RA 1OYWA 3AKYA 2XSZA 1V43A 3K09A 1HUQA 3A4LA 4BFXA 2QP9X 2OAQ1 2FSIA 3SZRA 1Q1ZA 3QXJA 2P3SA 1EX7A 2CBZA 4Q1AA 3CPHA 2ZI3A 1ESNA 3CF6R 1E9EA 2BDTA 2ZUBA 1W5TA 1KMHB 1W36C 3KTAB 4TSFD 1U90A 3TQFA 1ZP6A 2VEDA 1P72A 1WE2A 3LBHA 4RJLA 4A2QA 4NHOA 1ZW6A 1S3GA 5HE8A 4IOKA 1CJKC 1CU1A 2FFQA 4RKFA 5EP4A 1D5CA 5KSYA 3BB4A 1A2KC 3TSOA 1VHTA 5CIWA 1G20E 4D81A 4L8GA 2QEQA 2JIZA 5DGXA 4XJXA 4Q9JA 2GTPA 2I1QA 1P2SA 4A36A 4B75A 1UDWA 2C2HA 4PAOA 4WXPA 1DAHA 3FOZA 2O0JA 1QRAA 1KIMA 4RD2A 1IXRC 1A82A 1RRPA 1CS4C 4KO8A 4PHHA 2RGNA 3QXCA 4KSCA 4YC7A 2O8BB 4XWKA 1AJEA 4TYNA 2J0UB 2OCAA 3A4MA 1E6CA 4FN5A 4Q02A 3T61A 1GRNA 1GTVA 1TPZA 2GEDA 3WHLA 2H18A 2ZJAA 4LCBA 3RHFA 2IC5A 1E98A 3V4FA 1CF4A 2YYZA 2J0QA 1ZM3A 4IEEA 4TQUS 4UNQA 1JEEA 4NZYA 3JVVA 4B3DA 2V1XA 3F8TA 2V55B 3CW2A 3KZ1E 2EWVA 1UADA 1U0HC 2PZGA 1CJTC 2WIBA 2ZRJA 4HZUA 1ZM4A 4POAA 5CK4A 4OHYA 1J7KA 3AKCA 5C4GB 4TWZA 4C2UA 1F60A 4OK5A 2EYUA 2REBA 4QGFA 1U0JA 4Q1BA 5IT5A 3E2IA 3B1YA 1E1RD 1E9SA 1QHHB 2O5VA 1MT0A 4HAYA 1RPZA 4NCHA 5FPSA 1PV4A 1NI3A 2REXB 4Q1DA 4JBWA 3N5CA 5CDFE 2HDNB 1CJUC 1R8SA 4M9SA 3AF4A 1IAQA 2UKDA 5KDDA 4LI0A 3X2SA 4B74A 5JS7A 3O47A 3S1AB 1KO5A 3P32A 3S1AA 4LY6A 4AG6A 2R6FA 3F3YA 2F1IA 4JJZA 1OJLA 4JLNA 3UK6A 1N6LA 5TVKA 1XTRA 2FGKA 4JKIA 3EIQA 3UMRA 4TT3D 1GM5A 3CX6A 4Q9HA 1KOFA 4B73A 5H68A 2CE2X 4TL6A 1N6RA 1KI6B 1TF7A 2R62A 1VG9B 2CK3A 4KFUA 1Z07A 5KYKA 5F98A 1UBFA 3AKEA 2Q3MA 3W3AA 2RGCA 1NN5A 4KFSA 4BFYA 4HUQB 3AP3A 4XVRA 3RS5A 4RZXA 1UBCA 1NVXQ 4ZV4A 2EU8A 2BJVA 2OUKA 1E4YA 2H8KA 4XVQA 2ZRBA 3HWSA 4JVSB 4HB3A 1ZU5A 2NO7A 5JWHA 1YJ5A 1AS3A 1KI9A 3CRVA 3CO5A 4EFMA 3R9WA 5JJLA 5J4LA 2ZSEA 2ZJOA 1CP2A 2QMOA 1BMFD 2PCLA 1OH8A 3B1WA 3TSWA 1HY3A 5HCNA 3ETLA 2F9MA 1BOFA 2AXNA 2DFKB 3OAAA 4Q4AB 1QHXA 4IW3B 3VKGA 4QBIA 1T6NA 5F9HA 3JZAA 4LV8B 4XSGA 2LKDA 1XF9A 1KI7A 1YZNA 3CH4B 3U2QA 3VR6A 4MITA 3GFPA 1J99A 2HV8A 3M0EA 4OKSA 5FI1B 4D2IA 1T3SA 4GOJA 1YVDA 4HDQB 1N6NA 1XJCA 3FFAA 1AQUA 4EQ6B 1J8MF 3I73A 5KNBA 3GLGB 1GRRA 2ZANA 4I99A 4ZIRA 4ZIRB 4MRRA 2CCJA 2VYFA 1RRCA 4BEBA 3X1XA 2DBYA 2VF8A 3TE6A 4MGYR 1XRJA 3SS8A 4Q48A 5L8VA 4A4DA 2QORA 5FL3A 4GOKA 3U6KA 1KO1A 5LB2A 5CYOA 5FOSA 1AZTA 5TXGA 2WWYA 1UKZA 5C1BA 1T9HA 4PHGA 5CB8A 2NIPA 3NBYC 2AN9A 3MSXA 4DCTA 2Z0MA 4ASUD 3AGQA 3AVXA 4MGIR 2JLUA 2G0NA 1U99A 4G5RA 3GFTA 3GFOA 4FD2A 1HURA 1Z3IX 2IW3A 1XCPA 4X8MA 5L3SA 2D2FA 2CEAA 4AC9A 2IYYA 3SHFA 3DKPA 3KKPA 1XPOA 2QAJA 4IXMA 1F3OA 1HH4A 5A5GA 3GLFA 1NKSA 2WAXA 1GKYA 1NL3A 3OEED 4X8OA 3Q5EA 1XPUA 3SFZA 4QJ3A 3O8DA 3H1TA 4F92B 4R2IA 1P2UA 5KNDA 3E70C 4ZCMA 1DAMA 5JRJA 4YQFA 4GZMA 2VQSA 2IA5A 1UKVY 2HF8A 3X1YA 5E7JA 2HCJB 5GJVC 4V03A 3R8FA 4KI0A 1N5LA 1QG2A 1I2DA 2IYUA 3IDQA 2O8DB 2O8DA 3EA0A 2YKGA 2QT1A 3C8UA 3C14C 3GPLA 2O8FB 2BEJA 2ZTSA 1HQYE 3W34A 5FBRB 2WTUA 1WP9A 1GOTA 2EYQA 2J9RA 4LJ7A 1TAGA 3KL4A 3REGA 2HEIA 4HDCA 4LJ9A 2RGDA 5J4VA 1W2GA 2OBMA 2VP0A 2W0SA 4GP7A 1KDOA 4DCNA 5EXXA 4D0LB 5JECA 3GEEA 1UBGA 2ZROA 3LXRA 4S2EA 5FTMA 5GJBA 1ZD1A 2OAP1 3LRPA 1XEWX 4JVMA 3UMFA 3I5XA 4X8HA 2G9NA 2RGGA 3W6PA 1R5OA 5EP1A 3EIEA 1YRBA 1CRPA 4Q1CA 3PFIA 2DFLA 1OSNA 1ZBDA 2QMUA 2F43B 5CIQA 1KYIA 1NSTA 4S35A 5AUOB 4CT4B 2GWHA 3PUVA 3X1WA 4TMZA 5JFGA 3RWMB 1IY2A 1CEEA 1Z6YA 1ANKA 2OV2A 4QG7A 3DO6A 1ZD9A 3AP2A 5EUQB 2XZPA 4OHVA 2YWGA 1FUUA 1Z47A 2AK3A 5ANRB 3U7GA 4B3FX 4L9SA 2IS1A 5KDOA 1JPNA 3U6BA 4DLYA 3MWKA 1D9XA 3QENA 4MYCA 5JCPA 3BGWA 1E2QA 2ERYA 1N6HA 1ZINA 2JLRA 2ZR7A 3T5GA 1I2MA 5FTNA 1ZJ6A 4KFRA 5G40A 5FOUA 2G77B 3LBIA 1YR7A 4W7SA 4BLPA 4L4UA 3IPYA 4OQFA 4OQLA 2NPIA 4DUGD 4OQNA 2VPPA 2XNSA 3DOFA 4IOMA 2RMKA 3RANA 4E03A 4ZKDA 4PZZA 1YZUA 621PA 3ZD7A 1RW4A 3TUJC 3MUFA 2QPOA 3AP1A 2ANBA 3SQXA 2XJ9A 1GVNB 1S0UA 3AVTA 1C1YA 4MKFA 4HLUA 3LX5A 2EFHB 4Z1MD 1DADA 4C0KA 4FMDF 1CRQA 1EK0A 4QM7A 3U3MA 1T5IA 2RHDA 3KJGA 3MWJA 1P2TA 2UZIR 3NG1A 1VG8A 4TMVA 1T0JB 3L0SA 4A2WA 3U44B 3U44A 2ZRLA 4HZIA 1E0SA 4GP6A 2OBNA 1G7CA 1WRBA 2N1BA 2QM7A 2GVDC 1G3RA 3SHWA 2R8RA 3BC1A 1XCGB 1T8TA 4QBGB 2I4IA 1VTKA 5HR5A 5KPJA 4MKHA 1FOEB 1EWQA 4Y0AA 3FKSD 4RD6A 1DAKA 4HLUC 5B30A 3R7WB 3GLIE 3R7WA 4QOSA 3QKUA 3U4QA 8OHMA 3GLIB 2B7BA 1U8AA 2RGAA 3CH5A 3CR7A 4P33A 5L3QB 5L3QA 3VKWA 1AGPA 4PHTA 3ZZUA 1E2JA 2A5FA 2IYQA 1UBEA 1VYUA 4IVPA 2O8CB 3EG5A 4HAXA 2QPTA 1BO6A 5LB4A 4LJYA 1KJWA 3EZ9A 1SHZA 4ESVA 3LFUA 3MJHA 1GNQA 3E5HA 2Q9CA 4KLZA 4PX9A 2QSYA 2H57A 1KJZA 2N42A 1F2TA 2FEOA 2WHXA 4IDQA 1ZD8A 3MRSA 4TYQA 1QHYA 3SR0A 2FPKA 4D4JA 2X77A 1RE0A 1OKKD 2BBWA 4RY2A 1H8ED 1JR6A 1XEFA 2OE2A 2OSBA 1E2FA 3BFVA 2ZI4A 2ZREA 4M9XA 4M4SA 2IHBA 2WBLC 1J90A 4LPSA 2OCYC 5B64A 1M7HA 4M1SA 4QC2A 4NKRA 3THOA 3T06B 3R20A 5JHHB 3EZ2A 4EFNA 4TYWA 1XMVA 2ZRIA 5TB5A 2JJ1D 1TTTA 4B2IA 1Z0DA 4JLPA 4PSKA 1NBMA 3FKQA 4M8NE 4EAQA 3ADKA 4MGKR 4GI7A 3KQHA 1A7JA 5CB6A 2VIIA 3VHLB 2NZ8A 2BBOA 2VL7A 2QENA 1P60A 2ODBA 4ZDIA 2AKYA 2GNOA 3N70A 1KSJA 1ZC4A 1L4YA 3IO5A 4XWAA 1Z28A 5EE9A 4Q7LA 1ZAKA 2RGXA 1NN1A 1ODFA 1IBRA 5FBLB 3QKTA 1HE1C 1RIFA 5HCIA 1J2JA 1VDZA 721PA 5FBVB 2IYLD 3B2EA 3VMFA 1VMAA 3SBDA 3SDZA 4PAMA 3HPRA 3ZJYA 1K6MA 3MGCA 4PC1A 2WV9A 1OXXK 1N3BA 4W5HA 2P0EA 3WHKA 3WNCA 2VP4A 4WW0A 5CLLA 1LF0A 1II8B 4WAUA 5FBQB 3Q3JB 3UANA 3K9GA 3ICEA 1PUIA 3ZS9A 2YJTD 1CR0A
chains in the Genus database with same CATH superfamily
5EPUA 1HZZC 4RVHA 1J5PA 4B35A 1W5EA 2PL9A 3GDFA 4UHHA 1WW3A 4TSFA 4D9CA 2XGMA 5AUQA 2V5AA 4QAJA 1F8FA 2H63A 1HE5A 4R5MA 1WHSB 2H16A 1YA4A 2H1WA 3LAWA 1FUYB 1FYXA 2H92A 3QX9A 2JGAA 4QASA 1USWA 4CU5A 4UATA 5HRCA 1W0KD 4XI9A 1F8YA 3U3KA 3BHMA 4ENVA 4PF1A 2GD0A 2YVKA 4R9SA 5F7OA 4P93A 3CU5A 2ZYSA 1H4QA 1VGQA 4KUEA 1FJXA 5FLEX 2PANA 1E32A 4MS3B 3T3OA 4URXR 2O2IA 4GE3A 1ZHFA 1B26A 4U2FA 5U4QA 4B44A 3E9NA 4DLWA 1YL7A 5BT9A 5J2UA 2QG6A 3G2IA 2WSBA 1A76A 1FJ2A 1TT7A 2CLDX 1CYDA 5CTJA 4BFTA 1DC5A 4RXMA 1P5RA 3KE8A 4ILKA 2ZBGA 1E0JA 5IM5A 2F6RA 5ES3A 4JYMA 3TLZA 3TW4A 3RKUA 5KNBA 2FPGA 3IDFA 3STUA 1ONNA 4RESA 2XCIA 1F2VA 2XITA 3W9YA 1TIBA 1Z4IA 2PG3A 1W30A 3HA5A 4ZO8A 2ONJA 5AVQA 2RB5A 4C4RA 3ZJ5A 4AUKA 1EP1B 2B78A 3N2IA 3I6MA 1T9DA 4A8JA 3HM2A 1VYTA 1SK8A 2Q45A 3DEHA 1FNNA 1ILWA 2F4NA 2A57A 2X0NA 3P94A 4AMUA 2ZUUA 1HC7A 1HBJA 4U2DA 3PFWO 1P2VA 3JWJA 2PVCA 2YWBA 4BVGA 1YS6A 3BJRA 4WVFA 5EXEA 4H18A 4B45A 2PH1A 3PPXA 4RE5A 1G16A 1RAHA 3VX4A 5EFOA 4ECAA 3HYLA 4TWRA 3K70B 1E0DA 4LE2A 5E7IA 5L4LA 1AKYA 1VI6A 3DZIA 3I76A 1JA9A 2GN8A 2QTMA 4AP9A 3ELDA 1UQUA 1S89A 1T26A 3HXOA 1M74A 4B7UA 1QZZA 2J7PD 2QTZA 3LC2O 3UO8B 2IE8A 3RK1A 4D3SA 3IPCA 5IBCA 3AF0A 3KPWA 3GZNA 2AJLI 4LZOA 4XVHA 2ZBUA 2WZBA 3PC7A 4E30A 2P9TA 2Y2UA 3AEQB 2DUUA 2IZ5A 4BPBA 2BLNA 2R8PA 2WTMA 5JFTA 5AHRA 2AEMA 4F96A 2BE7A 3Q7EA 2G0TA 1A0OA 4ZVMA 2YRWA 2B0CA 1OE0A 2PXAA 2UVPA 2D8MA 2J1LA 3KZMA 3P9KA 3VSAA 2HSWA 3U0VA 1IDN1 3IAUA 4AWBA 3H99A 4RA6B 3IDSA 5FULA 2HT6A 4FMPA 3QTBA 4RGBA 5FNVB 3WLLA 4PYJA 1JECA 1S3IA 4ITVA 4PPGA 4GOND 5LDGA 4EG1A 4I1UA 1Y8CA 1N9KA 4BFZA 4JV5B 4D0NA 1R10A 3EODA 2GEJA 3K32A 3EXFA 3MJTA 3OZDA 2O2DA 3RAPR 1DKNA 2VS1A 4TKZA 4EDHA 4RCZA 4RZ3A 5B57C 1HYBA 2D4HA 2HMTA 3GAAA 5GM1A 2H3EA 1S4MA 5GAJA 1GZVA 1H6AA 4Y7CA 2MTBA 1AGNA 4JI6B 4DF3A 4COKA 2DERA 3PR1A 3KDPA 4B43A 5HCUA 5F76A 5JAHA 2JLAA 1BZYA 2FW0A 4DN6A 3AMVA 3IP6A 4GSLA 5DHUA 1KZ7B 4FCCA 4J3JA 3HRIA 1CDZA 1XG5A 1U02A 1IOVA 3AF5A 1VFNA 1QIGA 4G0MA 2CXRA 5JY1A 6ADHA 3MW8A 1NAIA 2FZLA 1BXRB 4DB2A 1TYBE 4I4TA 4M49A 3O92A 5IJ0B 4EQZA 5IJ0A 1Y6QA 2X42A 4ZODA 4Z4FA 4AKEA 1KY3A 1Y3FE 3CNLA 4WFQA 3NR2A 1PZFA 2BTEA 2ZRCA 5LQDA 1UZAA 3DF9A 4OHOA 3AHHA 5TEVA 1L1RA 2XKAA 3NHLA 3DHNA 4Q4JA 3DC7A 3UJPA 1S7GA 4DA4A 1LVGA 4UU0A 3K9FC 3AF2A 2RIPA 3EMDA 1LGYA 3IE0A 3OFSA 3THWB 2P6MA 2PSDA 4U9HS 3V1KA 3WYNA 1BXKA 2GDJA 1W36B 4PINA 2WG0A 1SB9A 3KXPA 4ALLA 3O1IC 1Y5NA 2XYRA 3K20A 1UOEA 3A1FA 1VIVA 3CKKA 2G8LA 3DA8A 4LQLA 3AI2A 3E9RA 3U3DA 2JIMA 3U40A 4MDFA 3I53A 1NW7A 2ZYTX 3JR3A 4Y6QA 1KSFX 4OAPA 4XKJA 4C4AA 4DWWA 3S70A 1JHVA 1KP9A 5A02A 4CKWA 1QRUA 5JSHA 2EBFX 4GI2A 3BMNA 3LQ2A 4ALMA 1B3BA 2GZRA 2QK4A 2GK7A 2GRAA 2QT0A 3FRHA 4JCOA 1H6DA 4C4OA 1Z2OX 4CMBA 3DOOA 4P3NA 3QVSA 5GV7A 1QE3A 3BRSA 2VBGA 2VNJA 2VSQA 5EJ8A 2Z2KA 3MXTA 3TDMA 1YT5A 4C07A 3ZN2A 4I50F 3F2VA 3F5DA 1V1RB 1XOIA 4P7KA 1BN6A 4OFWA 1Q0HA 1PQWA 4R7ZA 2H6EA 2P1ZA 5G1OA 1Z34A 3Q1KA 4HPXB 3S7TA 3ZLTA 3PC6A 1EJ6A 5CA1A 4QEZA 5I4IA 4V1CA 4D8TA 4OYLA 5HQ3A 1EESA 4A6XA 2IPAB 2VTVA 4F7WA 2IBSA 4A0RA 1UEXC 7GPBA 1V1JA 3IVAA 4C4ZA 1XDDA 3HADA 3HDJA 4BEVA 4GXRA 1T6XA 3TJZA 2JFGA 2EG5A 4OI1A 3IKTA 5K3FB 5K3FA 1NLYA 4HJXA 2A59A 1GGKA 4N0QA 1NVEA 1I3LA 4E2WA 3H1FA 1SQ5A 2AZTA 4AJIA 1RCTE 1T5TA 3ABZA 3HCRA 5FLYA 4IYRA 4IQ8A 1ZOPA 3HKDB 3JAWB 3EDYA 3QUBA 4UXHA 2RC6A 3OLYA 2HK8A 4LRUA 2I6SA 4RU1A 3HJTA 3DXYA 4BKOA 1IU9A 2AT1A 2R2AA 2B8WA 2R7LA 3SQLA 1HWYA 1KZ6A 2ABWA 3QEJA 3TLBA 4AMBA 5JQWA 2HHHB 1ZM2A 5JS2A 1UOPA 1SBCA 3DMTA 4IEIA 4AG5A 1ZIDA 3QVGB 1H2YA 3JRNA 1TU4A 3QFFA 1NW8A 4ZI7B 4ED9A 5C31A 2C54A 4FT4A 5HK9A 3E35A 1H9BA 1L7OA 2B61A 3W3AH 1BKDR 4OOFA 4HZUB 4Z2AA 4X1YB 4A27A 4CM9A 3OG9A 1LX6A 2YJTD 1ZY2A 3I0NA 4YRLA 3UK1A 2P27A 3ZQ6A 3DDOA 1FVXA 3CHYA 4KR7A 3ZGYA 2O3QA 4KE6A 4WCVA 3B5IA 4WLEA 3HZRA 4JB2A 3KD3A 1F8XA 1IEWA 2KPOA 2E89A 2MSCB 2CLSA 3O84A 2A35A 3OU6A 4NU0A 1DPFA 1P74A 2ZR9A 1CJBA 4X24A 2PUCA 3GMIA 3CLKA 4WN9B 3VKHA 4WN9A 2PLFA 4P38A 1TADA 4DA8A 2HA7A 2O0KA 2Y1XA 4G26A 3GJ4A 3SVTA 1M2WA 3R6LA 4B76A 1WSWA 1FXUA 3DR3A 3C3PA 2A9PA 1FJGB 2PJUA 3C2QA 4TMKA 4WUVA 2ZYRA 2NUAB 4PWYA 2M6KA 4DNXA 1THMA 2VWHA 2IX3A 4JJ8A 2OG1A 5K8UA 4QPNA 1NW4A 3VYRB 3TUIC 4JUBA 2BISA 1AIPA 4ZRNA 5HTKA 2R86A 2DHQA 4W5WA 2RARA 3A9TA 2UUOA 5H02A 3LRTA 1MC1A 2QV7A 3ROTA 3W6UA 1MIHA 2D3WA 4HLDA 5JS6A 4XVCA 4KO2S 2FEMA 4TYPA 3DZGA 2EKLA 5JAOA 5HBGA 4M2LA 2OZEA 3KUCA 1IZYA 1KTVA 2I4RA 3MTJA 5LA6B 4KI7A 1GT91 3EGCA 4LBWA 1ZW1A 5AW7A 3AEUB 1M1ZA 3AEUA 3BYZA 3X44A 2R1TA 4O2BF 4OGLA 5EMLA 3BBPA 1W52X 2WKQA 2PMFA 3SBEA 1SJ9A 3W06A 3OQ1A 4UEOA 4HWPA 3VH3A 4IGKA 3UMBA 2L0XA 4BL5A 4BZZA 4W99A 4EA6A 1FW6A 2D2XA 2JATA 3WQRA 3DPUA 4MJLA 1U65A 1VL8A 1BEUB 3CR8A 3ITNA 4R1TA 3VJLA 1H0SA 5LKRA 5ESDA 2IPLA 3MC1A 3QV2A 3UQYS 2XV1A 1HYQA 1V3VA 1RJFA 4OREX 5E9QA 1LBQA 4TWJA 4EYGA 2XNDD 1FFAA 3QPAA 1QK4A 3UTCA 4ZEVA 1SRRA 2XEDA 4D8XA 1A8UA 5KC8A 1JIJA 2XQIA 2CDCA 3KQYA 3QVUA 1BGXT 3S40A 3A1EA 3KB2A 4LJRA 3PB3A 5EIEA 1C4WA 2PKCA 3SZMA 1KFBB 3IVXA 3ORFA 2ZZNA 2BM8A 2FXVA 3F7NA 4NCJA 4P98A 1G38A 1GZ5A 1OA1A 3FUVA 3K2EA 3PK0A 3RKRA 4R2XA 1PBNA 2X1HA 1CE8A 2YWFA 3AV0B 3L6DA 4NVRA 4O4JF 5BSFA 2AK2A 4LMRA 4QEKA 4JI7B 3KK0A 3HCOA 5JYDA 3GJYA 1ESCA 1L4EA 1FMJA 1NSYA 1ZUD1 4Z1MA 4KXXA 1ESEA 3V9AA 2O7RA 2G88A 5K0TA 3AJEA 1KDZA 4JI2B 4KQMA 4D6XA 1R18A 1I4DD 3HR8A 4OB7A 3PQ4A 2WINI 2HGSA 4YAJA 3Q2IA 3CRQA 3QF4A 4CLXA 1M1XB 1TUIA 4G2NA 1OIXA 1C14A 2VHWA 2P6PA 3AIKA 1QTRA 2Z6UA 5IM4F 3PIDA 3SLKA 1NVVQ 2OWEA 3EAQA 3TD9A 4WV3A 4KCGA 4CIDA 4WCFC 1VJTA 1W5SA 3U4HA 3E7WA 4CQMB 1Y7TA 2Y71A 1MTZA 1B0AA 1TCBA 4HB4A 4AIRA 3GDOA 4N5NA 2QQ0A 2JL1A 3P9ZA 4UREA 4ZI3A 1NDUA 4TM8A 1NLFA 3HXPA 2HEGA 3UEOA 1RXCA 1XK6A 5KSPA 4A8HA 1WIWA 1QGAA 5FBWB 4CMEC 2ZJ7A 3CBGA 2GFHA 4LC0A 3VAYA 2XVZA 1KZHA 2WFAA 1PU2A 1T2AA 4JASB 3HJFA 3B7GA 2XMSA 5I01A 3JD3A 5I8PA 3KYCA 3B9BA 4LOLA 4URZR 1A9XA 4RD3A 2PKYX 4Y2SA 1GARA 4O1MA 1PF7E 1YRWA 1M2HA 2KQUA 2OQVA 3O3CA 5AKHA 2Q6VA 1XP8A 1ZHOA 3P97A 4FPXA 1CULC 4PLWA 3FNBA 4O4IF 4TTPA 1BEZA 1XVIA 1PFQA 2PK3A 3CPEA 3GCXA 1YDEA 2FR8C 2VYNA 4I55B 4OJQA 4QGAA 4U2EA 4JI3B 3UFBA 1OTHA 3WJ1A 5TS2A 5G41A 2IH4A 1E5LA 2AD1A 3I8XA 4H3KB 4QKQA 4DJ5X 5AK0A 5JNRA 3AZPA 1KZ9A 4ZDKA 3AY0A 5E2BA 2PJZA 4FZ3A 4L8LA 1D4OA 4TPKA 1ZVKA 4RAQA 4LYGA 3NWJA 1QS0B 3ZWYA 1QS0A 3AY6A 2Z4TA 3BWDD 3RUIA 4UXJA 4XIGS 3WGQA 4IDHA 3ZPXA 4C89A 3D3NA 5AVUA 2JJ1A 3EWAA 3E82A 4HADA 1BJTA 3MM4A 1XBTA 3EFOA 3O4FA 1ZVVA 3BIXA 4MI9A 3M4NA 3CVWA 3KQLA 4KPYA 4PLTA 1JLRA 4HYYA 4RSGA 4IG4A 1R5JA 1NJGA 2GD2A 3DCJA 1C3XA 2FSPA 2PT6A 1P73A 5K4GA 5C46F 1F4LA 1A2QA 4RA9A 4E94A 1VCIA 3EXAA 4I4LA 1PD0A 2Y1CA 4PZPA 3O8RA 1Z0AA 3LQRA 3OESA 5HIMA 5C1DA 5JAIA 1Y7IA 2FKAA 3K9HA 4QUAA 3FYUB 2WUDA 4AT1A 4XE5A 2I4TA 2ZXEA 3MWDA 2RDMA 2O2SA 3U56A 2VF5X 2H4YA 3ISTA 3TCNA 1YQDA 3U1TA 2AWNA 4BNNA 3ANXA 3GFSA 3ZNNA 2IUYA 3CINA 3D5QA 3FVQA 1XTIA 1L1FA 4RPIA 3U48A 5EHZA 2AMYA 1N0UA 2HQSA 2I2WA 4ZDJA 2FEXA 4BATA 3FMGA 3JASB 3IA7A 1G7RA 3ESXA 1LFDB 4QREA 3KVOA 4WOBA 1VE1A 2BGJA 2ZJ0A 3EIUA 1JAXA 1E2EA 3COPA 3ORYA 4I1IA 5EE1A 4E51A 2PXCA 3B38A 4P84A 1YFJA 5DN6D 3VSCA 3KJFA 3B1ZA 1PQ4A 4MGHA 4F84A 1ITZA 1OFVA 1SCUB 1J2YA 1XTQA 5FUBA 1T4GA 1E99A 5TQJA 3S2IA 3LCRA 3W8EA 3AJ8A 3ZDRA 5BUCA 2Q4OA 1KBOA 1PFKA 2JVIA 3E9CA 3I1FA 4R69A 1IY0A 1LPAB 2IYEA 2W7TA 3ONNA 3IAEA 4Z3OA 2CFOA 5DOZA 4FYIA 1ILEA 1LLFA 4KB5A 5IJZA 5IVPA 1MQSA 4YRAA 4MB6A 1EINA 2CXXA 3LLCA 2BFCB 3N2GA 1WR8A 3LIPA 5ICMA 1UEIA 3HRKA 5JI2E 1W7AA 1NQUA 2ZU0C 2C7GA 5AW4A 4FWBA 1KK1A 4EKGA 1WA5A 4F2GA 1S2MA 3A1SA 1W0KA 4YIHA 1LPPA 4OLHA 3EULA 2I2XB 4GFDA 2C5SA 4WOJA 1UXGA 5GONA 4HQ0A 4BMNA 5DBHX 5AHOA 3VPBA 2WFZA 3OQHA 1WF6A 1KH2A 4HN4B 3RLIA 2B7LA 4CM4A 1S1MA 3A3KA 2X4LA 4YQYA 2NQTA 4GZLA 3CLUD 4V0MA 3UB2A 3KOUA 5B2FA 1PWEA 1BA3A 2CHVA 2IIQA 5TQ0A 2BLLA 3OPQA 4HQ6A 3H2BA 3IUEA 3FSRA 3R9IA 4BO9A 1AKNA 2CEKA 2HSEA 2LUOA 2YVUA 1WOMA 4LV6A 4AMVA 2QUIA 4NH4A 5CJPA 3WQQA 3X1MA 4YRSA 5JMPA 4PN3A 2B0JA 1B00A 1JPVA 1R0SA 2ZU6A 3ELBA 2C7BA 3GR6A 2E48A 4GNKA 2XB9A 3WBJA 2XF8A 2BD0A 5DM70 2F00A 4E31A 4IXNA 2V6GA 2YNMC 2LR0A 5EERA 4IH4A 4GPZA 4BTEA 3JQRA 3B9QA 4IKOA 3OCXA 3Q9SA 3QG1A 2Q0HA 5KWVA 1NXVA 1M8PA 4J2HA 2I91A 3LUJA 3MTGA 2VP5A 4NABA 3WIDA 3U44A 4RL6A 1TZKA 1YE3A 4GPIB 1UMKA 3STVA 4ZZIA 1B16A 5BN5A 5KU7A 4G67A 1DRWA 1Q2XA 4YAGA 5TDHA 1NKTA 1X15A 2J87A 3M49A 5AESA 5G3YA 2F55A 4NEQA 1HFKA 4JBNA 1Y9JA 1OWNA 2PVSA 1MJHA 4HAIA 5E6RA 2J7PA 4KH0A 1XMPA 3LD9A 4MW6A 1Z63A 2KSQA 3NHSA 3SX2A 4MNTA 4IG9A 5EQJB 4IIXA 1AE1A 4IRXA 1ONBA 1YU6A 1K68A 2IP4A 3P9YA 4FHEA 4HAUA 4HEA1 4KPUB 4KPUA 4R31A 5EIOA 2RJ3A 3PICA 5EJAA 3TXYA 1ENOA 5JRZA 2RE8A 4KV9A 3ZCVA 3ZE0B 5ICCA 3BULA 1FQOA 1EUDB 2GAIA 2VXCA 2D7DA 1CZKA 3EXEB 1HT0A 3CUWA 5ETJA 1CFJA 2IF2A 1Q7EA 3DZKA 4ND8B 4YMGA 4ND8A 1K5HA 3HVJA 4BECA 3I45A 2JARA 1XHLA 1EZZA 2W2VA 4ZVTA 1XIVA 1CQWA 1T9ZA 2M6LA 3SC3A 2GOYA 2V7XA 3GFVA 1PQPA 2JGLA 2X13A 1NP6A 3C3WA 4IOLA 4JSRA 4BN5A 5LJIA 1OXVA 2Q3DA 3UHFA 1PGPA 3ACDA 3B48A 2WKSA 4E1VA 1IZ9A 1KMIY 4LTMA 3ZI4A 5F5LA 4JLWA 5DGHA 2WLSA 1QQ7A 3A05A 3D7KA 4F3CA 3Q8LA 1RAIA 4HNTA 1DMSA 4OYRA 3HV0A 3NUQA 4ID9A 4ZCLA 4FKMA 1KO4A 2OC9A 1XDBA 1XD9A 2I6QA 2X2EA 3FPFA 4KHPB 4AKIA 2Z1DA 1L4KA 1VHJA 5EL0A 3ZNPA 2FKNA 1GGVA 4Q1FA 1HE2A 4M1ZA 2WUWE 3EWIA 2AVNA 1NRJB 4A10A 1RRMA 1ENPA 3O4VA 3P0RA 1WWKA 3QUQA 2FMKA 3V55A 4BZPA 2CUZA 4C87A 3IAM1 1XZGA 3S7ZA 3CRW1 3VDNB 2Q46A 1NT2A 4TRMA 3ZWXA 2FH5B 2FWAA 3RS0A 3PXXA 4RW0A 1EP9A 5BQOA 2B6HA 1E4OA 4EW1A 1H9CA 1G17A 2EJCA 1LK7A 4QQNA 1R9MA 2ZRMA 1KH1A 1ZJJA 4O63O 3CCBA 4ZU6X 3W2FA 4QT4A 1ZH8A 2HW8A 4FFNA 2FSVC 1BROA 1HR0B 1Z2DA 2FP4A 1GZ3A 2J09A 3TZQA 6AT1A 2Z5VA 2BBSA 1RKVA 1J8YF 4H7PA 4WXHA 4DXDA 2BR5A 4Z7QB 3I2HA 5BOSB 2F8LA 3OQBA 5I9BA 1ONSA 3LVQE 1HLGA 3MIIA 3SZGA 5ED4A 4JODA 1KVQA 2ZAOA 1BW9A 1T8SA 1ZXXA 2W6QA 5D3ZA 4AKTA 2RHWA 3LC1O 1QORA 1UAYA 2WM3A 4KU4A 4BP8A 3EIXA 2FN3A 4CF6A 1N2CE 4P83A 1K98A 4MH0R 1YIOA 4JNCA 4AKGA 3OMXA 1OA0A 3JQPA 1N2CB 1N2CA 1N2IA 1SVSA 1C81A 2I65A 4EBFA 3MWYW 3V2HA 2PEZA 1PYOA 3RWBA 4ZI5A 3ZY5A 1FP2A 1NMXA 4G5QA 2H2IA 4IIVA 4R2HA 2AZDA 4DLVA 1EAMA 1PGQA 1DS6A 1OWLA 1Z68A 2C84A 2V0NA 3OD5A 4GOLD 5C5DA 4NAUA 4U02A 1XTVA 3GWZA 3PTLA 3L7DA 3HUDA 4NCAA 3A3OA 3RVJA 1NQTA 1QCDA 4A7PA 2ORVA 1M8JA 1RWBA 4D0SA 5LMCA 1L5OA 1HT2E 3OX2A 4IQ4A 4XOIA 2PV7A 2FPIA 3I39X 1V39A 1XDUA 4ZA2A 4GPTA 1Q0TA 3MHTA 3PGXA 1ZL0A 2C5FA 1ISSA 1TRHA 3PTZA 4N03A 4B3CA 3PZRA 2WF7A 3U4IA 5B6IA 1N0WA 4XGQA 5C3UA 3R7SA 5J2UF 1D1SA 2XKJE 5F7JA 2EKZA 3HABA 3TKLA 1L5QA 4DY6A 2ORIA 1RXEA 1Z37A 4D9JA 1WB5A 2V8BA 4LNHA 4Q82A 5K3CA 1FTSA 4RPGA 2QZJA 3KKQA 5CVEA 2ZM5A 1NQXA 1A8SA 2UZ1A 5KOYA 5G53C 2I9KA 4FFPA 4KZPA 2V03A 3D31A 3GJ0A 4TXMA 2PZAA 3CG0A 4CEHB 2DFNA 2I22A 1ZGCA 4BLOA 4IJ5A 2CJWB 2VJLA 2CJWA 5AM1A 1PNRA 5JS1A 3PPIA 4DR4B 1DV1A 3DM5A 1EE2A 3M4XA 2MHCA 4M9CA 3WB2A 1U9IA 3FTQA 1VE5A 3PP8A 1GUFA 4RCVA 2PLAA 2QXYA 3OQVA 4D26A 2YRFA 4UE3S 2Y1WA 2ZRKA 1Q22A 5C2JB 3V7FA 1N75A 2QGFA 2AF3C 2DJ5A 2IHZA 4D46A 2DTXA 3O2JA 5ARCA 2C8JA 3USZA 2QE6A 5KINB 5JSQA 3PQCA 1V37A 2FPPB 2FPPA 1HQDA 5KTTA 3E9ZA 1OHHA 2Q3LA 3U1VA 1Y1LA 1RWWA 3OP4A 3BFKA 1HK7A 1QWOA 4W5NA 1C50A 1ZH6A 1SXPA 1XVVA 1LS6A 3GBPA 1I2AA 4JUDX 4DAEA 1WF3A 3NHZA 4GBGA 4UBOA 2A5GA 2Y8EA 5F4BA 1Q1EA 1PNVA 2AHOA 5LOVB 3EPJA 3JY6A 3PHHA 1JHXA 1L7AA 3OHPA 1I4TD 2BWJA 1V5IA 3NP9A 1A9SA 2HK6A 3D8UA 3L5KA 4PFSA 2JFUA 4PS1A 1E6EA 2C98A 5FNVF 1V7ZA 3W5IA 3IOEA 2IYSA 1EVLA 1G5QA 4GUDA 4E22A 4IUDS 4WL0A 2NUPB 1W48A 1US8B 2NUPA 1JWBB 2WD9A 2ZE8A 3MGBA 3W3ZB 2A78A 5DHAA 2NAFA 2IBMA 1P3JA 1LC3A 3PXDA 4O4HB 3SWWA 4PXSA 3ICCA 4NONA 4MI3A 5EVJA 3VR2D 3QBTA 3URKA 2SKDA 3TMAA 5JNSA 2O8EB 1YR9A 4R1UA 3PNLA 4DREA 3LC7O 2LPMA 4MZXA 3N59A 4QUJA 2JCYA 2WQ6A 2VPZA 3CS3A 4BE9A 1Y1PA 3WSVA 1SD2A 3BK7A 4MW1A 3NHFA 4E5UA 3ANYB 2AMLA 3HJNA 4NU5A 5JD4A 1ABFA 1YZFA 4D25A 1QOZA 5HBRA 4AW9A 4B4DA 1UDAA 1FDVA 3K2BA 4GQAA 5ALMA 1U3TA 5HIIA 2QW8A 3N2EA 1F17A 1T4MA 1Y7HA 4OB6A 5TT1A 3BREA 5D51S 5L7YA 1SKMA 5CPFA 4Z0PA 4DNOA 1KRHA 4EUEA 1X9HA 1ZEMA 2OZLB 2WJ6A 3K0CA 3GVXA 1SBIA 1EFDN 1U0OC 2UYYA 3KR9A 2O54A 2ZAIA 4ZYZA 5ELMA 2G6TA 2QHXA 1XN1A 5AVKA 2OENG 1AMUA 3ZDZB 1B41A 4KREA 4AVYA 2XNDA 3LNCA 3GDGA 1MBZA 1PN3A 4KMOA 1KNQA 2VWGA 3ZVNA 4P7BA 1T36A 5JCZA 2E85A 5H82A 1G8GA 5A3VA 5KYNA 5FTJA 3U3XA 5FUWA 2NW6A 5KCZA 1KEZA 3T5BA 1OBOA 3RTEA 1VKJA 2QUBA 3HO6A 1GAWA 3MTDA 5E8RA 3WKBA 4Y7DA 4MRSA 3DXZA 3D0QA 1D6NA 1N5KA 1E8DA 1MW9X 4J03A 1N2XA 5BMVA 4KYUA 4AZTA 1X7WA 3K73O 4BLSA 4ZMRA 2TYSB 4FYKA 2Q3FA 1SQFA 2WYWA 3L9XA 2YUTA 4Z8YA 3ZC3A 3E6AA 2HPAA 5JARA 3T3NA 4JT4A 3A14A 5TQ2A 3UGJA 3S2GA 3KPYA 2EX4A 2WM9B 2QRJA 2AZXA 4V0RA 3CR3C 3GQBB 3TRHA 5K0JA 2FY8A 3QNWA 2G3YA 3USCS 4V0OA 3HJBA 4F1JA 1MQ9A 5IC5A 1D8TA 1NN3A 4DV2B 1BQ3A 3F6EX 1NG9A 5LIPA 1N9GB 1M6VB 4Y2XA 1GUBA 5KSZA 1QONA 3CC8A 3RF7A 1DZIA 3VHRA 5SYNA 2P2SA 1K7FB 3RC1A 4MUBA 4OYYA 4PG5A 4NIMA 1DG1G 2YOFA 4RTPA 1JZSA 3I9V6 4ZVKA 1PIWA 4AY6A 4JBYA 2G5PA 3E0XA 4FQ5A 4KVGA 3LFHA 2F64A 4EI9A 5I4CA 1Y6GA 1WXWA 1Q1AA 2VAMA 4NEGA 3ER9A 2YJNA 1JHUA 1XCLA 2CB9A 3SF8A 1KS9A 1G18A 3NTOA 4XM2A 3ZE7A 1LW7A 2I4MA 4H7EA 1HGXA 3M9LA 3CLRC 1UBNA 4K5QA 3X1DA 3FAKA 4RADA 1W5BA 1AHNA 1JYSA 3MG9A 4IGEA 3RU2A 3OKCA 3G9ZA 1NV9A 3DEYX 2JGFA 4F9EA 4X63A 2XWPA 1BGWA 4B6FA 1MO2A 3P9CA 3GPDG 3H65A 1HRKA 2LCQA 3VVLA 2B21A 2E9SA 4F7DA 4HOYA 4HTFB 3V1MA 1G20A 1JQJC 5F2NA 1XD8A 3E3OA 4ZI7F 5TX7A 3DMYA 3IPAA 4BNWA 1LQTA 1U1CA 5B58T 3OJFA 4RJTA 4QO8A 1I4LD 1EQAA 5IP5A 4D4KA 5IKEA 3KRTA 4BXOB 4BXOA 3RQIA 2PO5A 3K0EA 1XB2A 5KWSA 2OHFA 1UL1X 2J6HA 5CVCA 4DIBA 3TL3A 1P4JA 3INYA 4GZ3A 2P2GA 2O8BA 4WZAE 4TKMA 4W82A 2KS6A 3G02A 4RLHA 4EJMA 2I7DA 1D0IA 4WZAB 4HYTA 3UJDA 1YE8A 2QUZA 3OIUA 2K2QB 1PRYA 2VATA 3WLEA 1K7SN 3OZGA 4LHXA 1BCSA 3EQ8A 5J23A 1VHQA 3FDXA 2E4YA 3DEZA 4F0JA 3A9CA 3GJSA 4H6PA 2DPGA 3BIFA 4KQIA 4YRBA 4DCUA 1ODTC 1I5RA 5EA2A 2XUZA 2OCBA 4BPRA 3A1TA 1PV1A 3KV1A 3P19A 3DM9B 4H6XA 4KIJA 3SAJA 1D3AA 2QRQA 2GEKA 3GCGA 3GIDA 3RSHA 4QATA 2WHEA 3B78A 3LXUX 5G1PA 2JLXA 1X7ZA 4BS9A 4OXRA 4RJIA 5DHFA 3COSA 4TTIA 4NZZA 4YK7A 2EHDA 3QLUC 3IEUA 3ITEA 2ODTX 3ZHTA 5K9ZA 2QLLA 1N25A 1ICEA 5MFPA 1AB5A 4XQEA 1JWLA 2A6PA 2JF0A 3KOWA 3CKLA 4M86A 5AM5A 1KDYA 5BYKA 1B3RA 3VR6H 2R79A 4QJ4A 1EGHA 3FOAA 3QPUA 2PZFA 2W6PA 4B32A 5LA6F 1R6TA 3PGLA 1AURA 5DN6A 2VYQA 3PGKA 5CDFA 3HTXA 5C5EA 3UATA 2G7MC 4RF5A 4AJ2A 4AZVA 3F73A 2JLWA 3PI7A 3KR0A 2WR8A 3A7DA 2GAFA 3UOWA 2W0MA 4MYSA 1F7UA 4R4JA 4TN5A 1Y0BA 2MYNA 1A77A 3U7QB 1E20A 1PG5A 5EUCA 4AO6A 4AECA 4RDXA 4JR0A 3EPKA 2WIFA 4RXUA 1X1AA 1PLKA 3D2AA 2OK8A 1SEVA 2XAAA 1UEJA 3MMPA 3NUZA 3NANA 1RJGA 3OOWA 2HF7A 4XDGA 1EX1A 2Q0XA 2OXIA 4CM7A 2CW5A 2VP6A 4B7ZA 1K92A 2ZS7A 4I4NA 3G2KA 1KI6A 3SHQA 4D5EA 3WYAA 1Z39A 3NYIA 3MJDA 1CKEA 4OBXA 3UVEA 5HPYB 2C7RA 3ONWA 5ALOA 3PQ2A 2V58A 4LF6B 5FJIA 2ZUVA 3OHMA 2V5UA 1PR3A 3JZFA 4IBOA 4D3DA 3GX1A 3P2OA 5EYPA 5FBRB 521PA 5LQUA 4FM9A 3AB8A 2OO7A 1Q1NA 2VHZA 1IOWA 1NM5A 4TTSA 5SICE 1OBCA 1CB7A 5ES4B 4JXXA 3NORA 2EZ8A 4K46A 3FGNA 1LDEA 3A7EA 5CBPB 1RHMA 4CIBA 2HZBA 2FF7A 2F4VB 2HYIC 1JKFA 1I80A 1IM8A 5LU8A 3PQDA 2QRLA 4RSHA 5T3UA 4AF6A 1Q57A 3JRXA 2IY8A 1A4UA 1V7PC 2IXFA 3AW9A 5H16A 2JJ2D 1TD9A 3NV7A 5E4FA 4KR0A 3T7CA 5KNDH 2PUHA 3NPMA 1HQKA 1QANA 2DBVO 3G7NA 2P8JA 3Q10A 1SG0A 3NRJA 2CV0A 1UT6A 9MHTA 1LI4A 1DBVO 1V5GA 3MQFA 3FRIA 1R8JA 3PKIA 1TO6A 4YO7A 4D8YA 3DG9A 1NJSA 1P77A 3AL0C 3C7KA 4J0EA 2FA9A 1HT3A 2VQEB 4BWFB 3HN6A 1OGJA 4UE6A 1T5BA 3NT2A 4KMRA 4K6GA 5BQFA 3AOEC 5JPCA 2XSZD 5KTNA 1VA4A 5ALYA 4JY7A 3U81A 1A1SA 7MHTA 4JOQA 1Z7BA 1JFFB 1P62B 1X92A 3CY6A 3D6AA 3KJHA 4WY5A 5LZ8A 2GXUA 2G5GX 1AK2A 4PZUA 2JHPA 2N75A 3CSSA 4EQ6A 6Q21A 1EVKA 3GP3A 2VKTA 4K8OA 3SQWA 3VAZA 1PTKA 1OMOA 1U0NA 2OB2A 5C1PA 3T5AA 4CMKA 1M6EX 3OC0A 2ORYA 1KOJA 1U7UA 2BUCA 2QZ9A 3AQ4A 4WA8A 4TLAA 1JEQA 1T2DA 2ZEJA 1W29A 4IFTA 5CJ2A 2P65A 3WY9A 3AV3A 2WJVA 3ZGVA 4XM1A 3DPSA 2VQFB 2PRSA 3DVQX 1W9MA 3EX7C 3NNNA 2D62A 4YCCA 4P8RA 3KYDA 3K1AB 3MOSA 3K1AA 2A14A 3BORA 4YDSA 1P44A 3KALA 1I30A 4Z9AA 2PUDA 4I55F 1PJ4A 2E7ZA 2JFXA 4O08A 1NXTA 1ULZA 3DLPX 1U7ZA 4JT2A 4LDAA 4RPHA 1KR2A 2O3RA 3GLQA 1X2EA 1YGPA 2R7KA 2X6RA 4KUGA 2J32A 1Q7GA 4DT1B 3RBAA 3E7PA 4RVSA 2IS2A 1WAMA 1QR6A 2C1EA 2CCGA 2GZSA 2R6AA 4ARAA 4BWYA 2PKQO 4PCLA 3P7MA 4M3NA 2C4WA 1K3FA 2YMLA 4B09A 1JEYA 3CT6A 2XTNA 1TQ6A 1BNCA 4CTOA 1N3YA 3PG5A 3NBAA 2VPIA 3KLPX 3GCZA 4RK0A 4ARZB 2QW0X 3KKEA 1JYFA 4JC8A 2FVXA 2OHHA 5DI9A 5KTRA 1EH5A 2C9OA 3OUZA 2HQOA 3ELYA 3F5QA 4FOLA 4MVWA 4N4AA 4AUNA 3D1VA 2JFFA 4C06A 3DMDA 2QBYB 4ZAWA 4YRFA 2IH5A 2HXYA 5FPHA 1SQ0A 3TFWA 4GI3A 1FMTA 3L1VA 3QWHA 1NR1A 3PVSA 5IEBA 3INRA 4PR0A 1JQDA 1KIAA 1P75A 4HFNA 2CZCA 3G8AA 5IN5A 4II3A 2BGGA 2ODNA 3KL2A 3WLJA 4XAQA 4FGWA 3L7NA 3DE0X 1T9GS 2O52A 3FR7A 4UHDA 3UUEA 2REOA 3NGXA 3RAEC 4RZHA 5HG0A 2PUBA 4C7BA 3DV0B 1E3MA 4RHFA 3TZHA 1L5WA 3GK3A 4D80A 2HJWA 3DYBA 3C8HA 3G5AA 3OX4A 1FVFA 4N3CA 2IYAA 3DB1A 3QYJA 3SQNA 4R8KA 3V4LA 2CVFA 4J76A 4QSHA 1UBTS 1PQYA 1J33A 2I8AA 2J3EA 4J8PA 1URPA 4XYEA 1DVRA 5DKFA 1Y1QA 4B9EA 2XZOA 2PBRA 2R6HA 3IUSA 1BMQA 3IR5A 4YTEA 5TMDA 3OURA 3KVRA 1MJFA 3U49A 4EFDA 3GDHA 1CR6A 2WM8A 3GMSA 4OQYA 3ZR4B 1YJ8A 4UU8A 2Y0PA 3BD8A 4YMIA 1ZL2A 2BAGA 1HE8B 4QOJA 4CF7A 3OPMA 1E5XA 2WUFA 1M83A 3NKVA 3LGAA 3Q6MA 1YR8A 2W2PA 4E7OA 1Z45A 2VR1A 4ER5A 2AR7A 3KX2A 2ZTVA 2ZFUA 3ODGA 4BZQA 5TMPA 2HMSA 3COJA 2H0RA 5H80A 3U31A 1RWMA 2FPMA 3HUEA 4I9UA 4R1NA 1X7GA 4R2WA 5AXBA 7AT1A 3PC2A 3HBAA 2GBIA 3OZTA 5FO0A 1G2OA 2GARA 3G8BA 2P2DA 2PMDA 3T7JA 4IL5A 2HJGA 4NC9A 2H2WA 1WUKS 5E2AA 3SK0A 5MN5A 1GGFA 3OWXA 1G6OA 1KKUA 2ZT6A 4FE4A 2B3TA 4LAFA 5L6MB 1V2GA 2OCKA 2FWPA 3OU2A 4BRSA 2PFGA 1YV9A 3EOBI 2WYHA 4B2YA 5BYAA 4OHWA 4KKVA 5KJ6A 5AJTA 1I8TA 2CCKA 2VNHA 3CWQA 2XXAB 2XXAA 1NW3A 4G97A 1GNRA 3AEKB 1CY6A 1C29B 3AEKA 4FLEA 1S8OA 3SJZA 3SJUA 4A6EA 2R00A 4UEWA