1DBBH

Three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
source organism Mus musculus
publication title Three-dimensional structure of an anti-steroid Fab' and progesterone-Fab' complex.
pubmed doi rcsb
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1992-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH02
1GHFL 4JQXC 2HJLB 1DBJH 2VAJA 3MRCA 4NC2B 4ZUUB 3UTTE 2NQCA 1A2YB 1QD0A 2P45B 5D7SL 5J4MA 3GSNH 5IW1B 3VFSA 1S5IL 1RZ8B 4FP8L 3KNBB 4DKFL 3MV8A 5F70A 3HG1D 2R9HD 4WO4B 2VSCA 4XNXH 4PJHB 3TN0D 4L3CB 4ODSH 1YMMB 2BVOA 1CE6A 1CBVL 2VZ3A 1KTLB 4JGUA 3KS0H 1LK2B 4RISL 3ARGA 5IKCB 1GGCH 5GISH 3OPZH 3MCKA 3PGDA 2AJVH 1MQKH 3MRKB 1WSST 4IBLT 2A6KA 1KB5L 1A6PA 2IFFL 3D85A 4FOMA 3WKMH 4Y5VB 7FABL 2F19L 2QHLA 4G7VH 4MHHG 3E0GA 3GSWA 4JRYB 1F02I 1IKFL 3TO2A 5MI0B 3NPSC 3VG0L 1KJ2A 3G6AB 2X4UA 4JFXA 1IAII 3D9AH 2R2HB 3TJHC 5J11C 3PGFL 3MJGX 4JREC 1KC5H 2F5AH 4JANB 3SE9L 2V7HA 4EXPX 3I3BA 3RP1A 1LO4L 4OZIA 5KW9L 3L1OH 2YHGA 4XPBH 4CJ0A 3WFDL 4LEXH 3GZKA 4P49A 4WI2A 4XVJH 2DBLL 3HE7D 4IRSD 5EUKB 1U91B 3MGTB 1KNOA 1T2JA 4D94A 4ZQKA 1PW3A 4P5TB 4NKIL 1R3JA 3HRZB 3S37L 2BC4A 5L2KE 1EAPB 4OZHE 2C3VB 4JG0H 3A6OA 4UTBL 1JGEB 2JB5L 3ARFC 4OTXH 5E2WL 5C0FB 4L8DB 3WFEH 4MA7H 3AY4C 4S0SD 2AEPH 1S7XA 2CXKA 5CBEA 2IFGA 1NLDL 5HHXL 3GMPB 3KPRD 2Y7QB 3BO8A 4RMUA 4WO4A 3MACH 4XCYA 2BNRD 4OM1H 2R1YB 2OL3L 1LO0L 2B8OT 3NIDE 3L7EA 1N5AA 3CFCH 4WEBL 5D7SH 3BRGC 4X98B 4PJFB 3UTZA 5DRZA 4Z7WB 3GBNH 5CEZL 5F7DB 5I30L 1SEBB 1ES0B 2DLHA 2XXMB 1GIGL 4G5ZL 1QYGH 3KXFA 5GJTL 2RB8A 1EFXD 4JHBA 1CGTA 1BVKB 4M7LT 1MY5A 3WD5L 2CKBA 3T1FB 4AEFA 1I3VA 3RKDC 3VFVB 2XWJB 3G04A 3OXSB 2XA8H 4NFBA 2BVQA 3W39B 3P0VL 5KSBB 3WD5H 2P5WE 4JO1L 1VENA 3ZKMD 4LU5L 4HGWB 4MWFA 1QR1B 1JPTH 4LHUG 4KUCD 2GJZA 4KHXH 2OSLB 3KPNA 3VFRA 5IEKB 1YYLL 3WNPA 4UBDC 3MA7B 2JK5B 4EDWL 1IZKA 3DMMC 1M05A 3DX8B 5B3NA 5E8EA 3VRLF 3GRWL 5F7MC 2FEDC 2VLRA 2WUBL 4S10A 4QYOA 1AD0A 4LPTA 1IC5L 4OLXH 3UMTA 3S8WA 2OQJB 3VXTB 4FG6C 4KZEL 4WI9A 3ARBA 3VA2C 1YQ2A 2F53D 3TYFB 3ES6B 1D9KD 1HIMH 3DECA 4FQ2L 4OB5L 3I3DA 5BW7A 3MSPA 5MERA 1XF1A 5C0AE 4YEEA 3TEUA 2OJEB 4LFHG 1L7IL 5E1AA 1FGNH 1FO0H 1MCKA 2LTQC 4L8CA 2XWTB 8FABB 1P4BH 1JL8A 5FHAH 3MUGA 5IOPA 1JGUH 1BZ9B 2VDMH 1HZHH 2J1KA 1L0XA 1CK0H 2WQ8A 4PRPD 3MR9B 3VG9C 3U82B 3V9FA 2CRZA 4K2UH 4WWKD 5JDSA 1DBAL 3QZWA 1KENH 4Y2DB 1TPXB 1IMHC 2IALB 1BQLL 1INEH 4YH6A 2WZPD 4GW5B 5EUOE 3U7WL 3QQ3A 4JY4A 2DIJA 3FO1B 5EWIL 5GRJL 3N1FC 4MB4A 1IGTA 4PJHE 1E4WH 3MV8D 3IGAA 1S9XB 5T1KB 1KJ3L 4PTUB 2ZSWB 4BK4A 5I73C 4P3CH 3VGAB 4NO0B 1K4CB 2GT9A 3C5ZB 1A1OB 4HK0B 5E03A 5B39B 2APTA 4WW2C 3VGEA 3QNYA 3QIBB 1K6QH 1EA9C 1G7HA 1KPRB 2K1MA 1UG9A 2X9YA 5HI5D 1JGDB 4I0CC 2NTSP 2JLLA 4KTDL 3CX5J 3KYKL 3SDCC 3W5MA 1EK3A 2P5ED 4ZFOB 5EBMB 4ZO8A 4NQVB 1OTSD 3RZCA 4XC1L 1MCSA 3OGOE 5TH2B 5AD0B 3AXLB 5EO9A 5GS1C 3P4LA 1YEDB 5J6HB 5A2IH 2BSSB 3NZHH 2AABL 2AXGB 4PRDB 2HJKA 5EC2A 5DFTA 2VDLL 2X4QA 2YD4A 5JUEL 4JY6B 3ALXA 4U6YA 1H5BB 1TJHH 4PG9A 4JFDD 2PUQT 3TN0B 4YZFF 2VERN 2QHRL 3S97C 1FYTD 2FL5A 2Q76B 5DUBA 1FAKT 4X83A 5SWZB 4BFGA 4GW1A 1KOAA 1MVUB 5B39A 3ULVL 1FIGL 1ITCA 3MCLL 4NQCB 3TV3L 4LCUA 3OJMB 4LIQL 4XNMA 3MRFB 1FFQA 1F6AA 3DX6A 4FQCH 3VXRE 4PP2B 2FR4A 4HUUB 1NAMH 5TE7H 3WFCH 2BSTA 4QRSB 1Y18A 4NQXA 1K3IA 5ESVA 2YKLL 3MA9H 1F4YH 4RMVA 2VDNH 1QFWI 3C60A 1YYLH 5F7NC 3MLXL 4DZ8A 4AT6A 3QT2A 1DVFC 1YYML 2A6JB 3P11L 1S3KL 2VZUA 1A9BA 3FO9B 4YXHL 1HXMA 1QSEB 5ERWB 3QDME 1LNUA 5DUPL 5IB1B 4UB0H 8CGTA 2EDWA 4ZOEA 4ODBD 4JFEE 3FFCB 3TGXA 3CX2A 2R4RH 4WNQB 5IR1B 3B9EA 1U8MA 2FJFB 4BSVB 4KTDH 3RJQB 2IH3A 1RZKL 3T3PE 3OKYA 2B5IB 4HH8A 3M17B 2XZAL 5MERB 1VFOA 5L8LB 1MAMH 4OKVB 4OBSA 2R0LL 1MCPH 3CLEH 4XNZB 3T4YA 5H94A 3OKEA 4W6XB 3QUKB 3PNWB 4ODVL 3FN0L 4FQJH 1C5CL 2VR4A 1NEZA 2J7LA 2UY6A 4IS6A 3ZKNC 2RJMA 1WWBX 1A4JB 3M8OL 2WP3T 1IAIH 2VXQH 2AJXH 3ZKXC 4NPYB 5C0BB 4NJAL 2J6EH 1NSNL 5DJ0A 1YEJL 1ZHBB 4L8SB 1OCWL 2X4SB 3J7HA 5JQ6H 2XTJD 4JO4H 2NY5L 3ROLB 4HC1H 1IAIL 2VXQL 3A0OA 1AXTH 2GJZB 3VFNB 1FP5A 2G2RA 2P5WB 1PKQE 3O2DA 3N9GL 3KWWA 4HLZG 1JWMA 4H1LG 4HGWA 4PGBB 1G9MH 3CVIL 2E7MA 1M7IB 3VGAC 3KR3H 1ACYL 3FB6A 5E6ID 3QG7H 4X6CF 4X7EC 5HDBF 2P8PB 2CIIA 3R06A 1G9ML 3OKKB 2PXYC 2QBWA 4O4YL 4D8PB 2AXHA 3GIZH 3VFMA 4G8GB 2WANA 1EERB 3IDMB 3RWFB 3VGBA 1KXTB 4CVXA 1AXIB 1MCOL 1M71B 4TVPL 5F7DA 2XQBH 2YPKB 2ICWA 1I4FB 1UH3A 5EBWB 2XIDA 1EO5A 2Y5TA 5I9QB 1V7MH 3UPAA 5E8DH 1YMHA 1A7RL 5K59F 3HZYA 4OLVH 4DK3A 4GAJL 4QWWC 3QWRD 2R2BA 2ZNWA 1P7HL 2BZDA 4RAVA 5C08D 4MD4A 4KQ3L 3O2WH 1CFQB 5TF1L 3VXPB 4FMKA 3I2CH 5F96L 3WDJA 1QFUH 3LN9A 3EJJX 4WI3A 1CD1B 1GZQB 2Q7YB 3QDGD 5JOFA 3PP4L 4KI5E 4NZRL 4WI4A 4XHQA 4P2QD 3E8UH 1JNLH 2J8OA 4J3TA 1RZ7L 3ETBF 1IAKB 4X5WB 2FX8H 1BOGA 5GGTL 1MCJA 1TQCC 3PE9A 3FONB 3WEXB 4K3EH 5K9QG 2FH8A 3GJEA 1UJ3A 2ADGA 2AJZA 4XP6H 5ALBH 1QFWM 3BP5A 3O2DL 1XF3B 3WFHB 2X4UB 4TSCH 5DC0A 1FL3B 5D5ME 3B83A 4UDUA 1KEGL 1KIUA 4NHCH 3VRLE 1LWRA 4B7IA 2OMBA 12E8L 1T89A 5CZXD 4Y19B 3IU4L 3NCJL 4XXDB 3OQ3B 1HSAB 1KCRL 3PJSB 1CDHA 1HN1A 1ODAA 2HN7A 4NN5B 5HPOA 3KJ4C 1P7QD 3DVNB 4PJ9C 1I3UA 4MNQA 1J12A 3NIGE 5IJVA 2CO6B 3H9ZA 4MLSA 2ENSA 2BSRB 4L3EB 3CFIC 4LBEA 3I3EA 1UYWH 5FYLL 3KVQA 4U2YA 15C8L 4Z77B 3ESVF 2H6PB 3ARGB 3ARXA 5FEBA 5L2KD 4I18B 4HIXH 4QHNA 5TQ0H 1HHIB 4ZOAA 5T1DL 3WXVH 4HKXB 3V5DA 5EN2A 4XNYL 5BJTB 3H0TB 3ZDZF 1NCBH 2P5EB 1FFOB 5A2LH 3WNLA 1FE8H 4XVTH 3OBAA 4J3WA 1QRNA 4OCMC 1ZA3A 3QUMB 3SDCA 1OD9A 5HTSA 3F7VB 2C26A 1HNFA 3D39A 3O8XA 4KKBC 5I1EL 1WBXB 4W70A 4CN1A 5DJCB 5IM7B 5IB5A 4GS7B 2HFFB 5BVJB 2W59A 2E3VA 4GRWF 3HNVH 4HBQA 3JV6A 2NXYD 5KVEH 1QTYT 1EZVY 4WHYG 2HRLA 4IRJD 4O2CB 2APWA 3W9DA 4DKEH 2CXGA 3QEUB 4BH8B 1EDQA 2BY1A 3MRHB 5J6GA 4KJWC 4PGJA 3NOIA 1MI5D 4QRRB 5D1XB 5TDOB 5TDOA 4YUEH 4ZS6C 3KJ4B 5IMOA 2NR6D 5D2NC 1CE1L 1L4IA 1XCTA 5EO1B 2NXZB 3MRHA 2Z92B 1WC7A 3V0VB 3TWCL 2C3WA 1CGSH 4E5XB 3LPFA 4R2GB 1B2WL 4X7FC 1FVCB 5D7JB 2X4NA 2DM2A 2A9MH 4HPOH 4YE4L 4YHZL 2R69L 4PJ5D 4CMMB 3U4BL 3GSUA 1M7XA 3G5XB 1KYOK 1WBXA 4YXHH 3OJDB 5F9JA 3D39B 3O8XB 5GGRB 5DK2A 1M7DB 1RZJH 1BFTA 1I8KA 4I18C 4HS8H 3ARGC 5ICYB 4OFIA 3OSKA 3MROB 3L95B 5FGCE 2X6MA 5DQ9B 3EOAA 4N5ED 3S9DB 3X12B 4Z0XA 1LO3H 1DQDH 4PLJD 2R0WH 3NCYS 4NN5C 5E8PA 1EVUA 4PJHF 1WTLA 1NFIA 1KIQB 5C0BE 3DI2B 4OKDA 5I2IA 3O6FD 4NKIH 4OF5A 4MZ2A 1CU4H 3QIWB 1Q0XH 4JN2B 2WINA 1FLRL 2FX9L 3TM6A 1XR8A 2QSVA 2VDRH 1UM5H 2DQGH 5IT2L 2DQIL 2DL9A 1S7VB 3JWDH 5JLZB 4H8WL 3C08H 1CYGA 4F7TA 3U4AA 4NSKB 2QQNH 1IZJA 4FXGA 2VIRB 4G6KL 2UV3A 2UZIL 3TBTA 3VXSA 1I1AD 2X4PB 5EZJA 1TZHB 3WO3B 2VL4A 1T1ZB 3TO4D 4ZTOH 3O45A 3VXMA 4PUBH 1BQHA 3FQRB 2FO4B 2FZ3B 2FB4L 5D2LF 2WWMD 4NC1E 5IQ9A 4HUVA 5E8OB 3HFMH 2ESVD 2JIXA 3WDHA 2F58H 3WLBB 2A1WL 2EEDA 5IVZB 1EH9A 1U8QA 2PCPA 1FVDA 2F74B 3IDJA 1WIUA 4L3EE 1CFVL 2V9QA 3MRIB 3U1SH 3UTSE 5LQBL 4MAUL 3FOLA 4EVNB 4L1DA 2PW1B 1HH6A 1PX4A 3HMXH 3IKCB 3RGVA 5C9JA 3JV4B 5KVDH 4XCNB 2VQ1B 5EWIH 3RPIA 5L9DL 4G43B 3QG6B 4DZBA 4N0CC 2W91A 4KJQD 1J8HE 1BGXL 1ETZA 3ARQA 4KAQL 4NM4H 2Z91B 2X1PA 3O6MH 3TBWB 2Z31B 1UKTA 3PHQA 3RNKB 3TNNA 5L9DH 1Y6KR 4PR5A 3M8OH 1QLFB 3PWLB 2VJXA 2AEWA 5DQJA 4WO4D 1NLDH 4OQTH 4XPGH 4Y1AD 1KB9J 2Y36H 2ICWB 4EBQH 1FPTH 2Q6WB 1D9KC 3DRTA 2D31B 5DEFB 4KTEH 1FFRA 1RJZA 1AO7D 1XGTA 4NO5B 5L2KA 4YFDB 3BPOC 3REWB 1VEPA 2MCPL 3L3JA 1A9EA 3FN9A 1YEEL 1TZIA 5CIPH 3BUYB 4OZHA 3BP4A 4AH2A 5C0CD 1Q9LB 5E2JA 4N8VB 3CVHL 4P4RA 3AREC 1UB6A 1YEEH 4YDJA 4DGIL 2R0ZH 2GSIA 1VADB 5DJAB 2PTTB 3QI9B 3RTQA 1NPUA 1W0YT 4Z0BH 4RQQB 5A43C 5DJYA 1AGDA 4KRNA 4ISVB 2ZCKL 1TVHB 2BRRH 1DQLH 4BQ6A 5FYLD 2MWCA 1AXSA 4HWUA 4KK9C 4C56D 3HE7B 5IQ7L 3HE7A 2R0WL 4HIJA 4OF6A 4PJFF 5HHOA 3O6ML 5FB8A 1MUJA 4CGTA 3W0WE 4RZCB 1TITA 5FYLE 4FQHB 3X17A 4I2XA 5DJYB 5TQ0L 3MYJB 3UXFA 4CNIB 1N59B 2A73A 3D9AL 1E4KC 2CK0L 4HEME 3IFLH 5IVXA 2C9AA 3N1GC 4D0CA 3MRLA 1NCUA 2V2XB 4IJ3B 4NRXB 4JFPA 2VZVA 3BD5A 2OTWA 4P4KC 1A22B 3LMJH 2BNRB 3MXWH 2O5XL 3T8XB 4YHLH 1P4BL 3BKYL 4EI5C 5C9KA 1PJ9A 3EJYC 3UPCA 4WENB 4WU7B 3FO9A 3RZCC 4JFQB 4P9HL 2ZG1A 3GKZA 3LRHA 3VRJB 5ILTH 1SEQL 5DO2C 4Q6YA 2ZCHH 4HUKB 5D7KE 4L9LC 1F4AA 4MJIE 4P2CG 2EKSB 4DFHA 1W0WA 4MNHB 3GGWB 2PO6D 1T0PB 1BM3H 4R0LA 3CFEA 1HKFA 1R0AL 2B4CC 3QQ9C 3KJ6L 4R4NC 2A6IA 2NY1C 1DBBH 5DQJB 3TN0C 1EHLH 1MFBH 4PP2A 4R2GD 3WFCL 3BPCA 4Y2DC 2UUDH 1QKZL 3KPSA 5I16B 1MJ7H 4PJ7F 3O3EB 1OD7A 1RD6A 4JGJA 1TJIH 2QL1A 3AREB 4CN4A 4PJXB 3HC0B 1NGXA 2X9WA 1RUML 3V6BR 4GW1B 4J6RH 1X5XA 1JI2A 1KEML 3VXOB 1DBJL 4H26B 4C57C 1CL7H 3SGEI 4XGZB 3JV4A 2VDOH 4UV4L 3UTQB 4QXWA 4M00A 4UT7H 4Y4HA 4LPCA 3GUTA 3V6ZA 1G7PB 3KLAA 5IUSA 4Y16B 3C2AH 3BISA 1AGFB 3VFGL 2BCKB 1WFNA 4XBEH 2XQYG 5HJ3A 5CP3H 1FORL 3QR2A 5E95B 2EDKA 4MNQE 3DYPA 3P0VH 2HP4A 4RAUB 2SEBB 3O9WA 4IRSC 3SE8L 5J12B 3PGFH 3CJJA 4YFLF 5E2TL 3UBXI 4UT9L 1G6RL 3FQWA 2FO4A 3E6HB 1WZKA 5GSRB 3SE8H 5L7XH 1AKJB 4XCEA 1NDGB 3BVNB 4Y5XA 5AEAA 4PTUA 4UT6H 4RAUA 2VIRA 1CVRA 1LHZA 3CMOL 5T1MA 1BEYH 4L29B 1ZT7B 4PGEB 1RZFH 2VAAB 4KJQC 2BOCA 1XR8B 2APFA 2JKXA 4YUEL 5DD3H 5ACZA 2X42A 5DZNA 3UPRB 5FGCB 1A47A 4GRWH 4X6CA 4Z7WE 2CDFA 3LH2L 4Z7UA 4S1SL 4NJAH 3MODH 1KIQA 2V5MA 1MIEL 5HYSB 2J2ZA 3WLWC 4ODSL 2ZUQC 4QRPB 2WWKO 2R29L 3U0WL 4F7MB 1S7TB 3T3PF 5B8CC 2VH5L 2DQEH 4K3EL 1T2QL 4X9IA 4LLQB 4JKPH 1I1CA 4Q0XH 4LVNB 4OCYL 1C16A 3EOTH 2H8PB 2ZNXA 4JKWA 3S34H 4R0LB 2IJ0C 1IM9D 3GSNL 3GMMA 2EDBA 2IQAA 1T4KB 3BJLA 1E6JL 5IB3B 2FATH 5DD6B 1AI1H 2H32H 5EORL 4GH7B 1BWMA 5HGBB 4YBLC 4Z7OF 3HZKB 1OOAA 3X14B 4UINH 4R4ND 5DI8A 3FKUS 1OWWA 5F6IC 5J7CC 1FVCA 4JFYB 1YNLH 2AJ3A 3NFPA 4IHOB 3UTSB 1MJ8H 1PG7W 3VWKD 3P0YH 3PWPA 1JHKH 3MLTB 4F37K 4Y1AB 1A4KA 4PJAF 1I9IL 4GUPB 4YC2C 3H3PL 1U8NB 1UZ8A 4P3DA 5KSBF 2YWYA 4L4VE 3NIGF 1INDL 1ZA6B 1H3UA 4FQIL 5D1XA 2ITCA 1MVFA 4XPAH 3RPKA 5J6GB 1C5DB 4Z18A 2DL2A 4E0RA 3JTSA 1N7MH 4G8EB 4JDVB 4LEOA 2C3GA 2D2OA 3VFPA 2O5ZL 3W9DB 4WRLA 3SKJH 5JPMA 4LSUH 4WUUA 4PBVC 3DI3B 3VFVA 5GHWL 2VITB 5LAXB 3VCLA 5BVJA 5EFIB 3NCYP 1H3GA 3CFDB 3D87B 1BFVH 3BDYL 3EOBB 4GG8B 3JTTA 4XCCL 1RULL 4Y5VC 4KTYA 2DIBA 2QHRH 3H42H 4X6EA 3ARFB 2PYEB 1U42A 4WHDA 4A2LA 4ODWA 3V4VL 4ZUVB 4ZUTA 4G80B 3U9UA 1NJ9B 4ZDHA 1EV2E 3D18A 1S7RA 3ALWA 3CVHH 5MHSD 2E7LA 4ERSL 5FO8B 4JM2B 3RY6C 5EZOH 1IC5H 3M45A 4OLXL 4PY8I 3BKCH 1MIEH 4GRLD 1F4WH 1LQSR 2IH1B 3KPMA 3G5VA 4MCYB 3FRPG 2P8MB 2NY3C 3GMOB 4R97B 1BGXH 2GHWB 4FABH 4RDQF 2H6PA 2ERJB 5BZDA 3WLWD 1CFSB 4MXQC 2YPVL 3EO9L 1RJZB 2GK0B 1Q72L 4L3EA 4LLAA 4NO5A 3SDYL 4KKLD 1N6QH 3V2AR 1KNOB 5JXEA 1PQZB 4LKCB 3BP7B 3IAPA 1RAMA 1U91A 3L3IB 4XPGL 2E7CA 3Q0HA 4NQDE 2NY2B 1G7LB 4RNRB 2ZWLT 4XWOD 3LRSB 4HHAA 3LKOB 3A67L 4OZFB 2AJSH 2V7HB 4NHUA 1PY4A 1T21A 2R4RL 5IHUL 1ZEAL 3O6FC 2UVEA 2Z31A 2VN7A 3AGVA 5D71H 3EDKA 2AJZB 3N0PB 2YA2A 1ZXQA 5ALBL 1GOGA 2VDPH 1FN4A 5EOTB 2VR9A 3BKYH 3WIFA 4OZ4B 2DQCL 4P3WA 3T0EE 1OVZA 1NEUA 2BMKA 5FIEA 5B38B 2EDTA 2AV7A 4NN7B 3MRKA 3BJ91 2XA3A 1TVDA 4KJYA 1L6XA 2VISA 1I7UA 1KJ2H 4X8XA 2YPLE 1DQLL 1PZ5A 5F9WB 5SWQA 4KQ3H 2R2BB 3FQRA 5JZ7C 4L3CA 1IFHH 1MFBL 3HPLA 2OP4L 5JW5A 3LKNA 1YEHH 5F1OB 1R0AH 4U6VH 2ID5A 5CIPB 1NDMA 4I3SL 3KNBA 2D03L 5HHPB 3QPXL 1A6VL 1OSZB 3SDAA 1NUNB 1WAAA 2XN9E 3WN5C 1BZ7A 1W0VB 3AC0A 5DD0H 3NZ8B 3VH8G 2JJTA 1IGCL 1JBJA 5DK0A 3ZHLA 1XGPA 4Z7OE 3MC0A 4HS6B 5DJDB 1ZEAH 3U2SB 4BZ1L 1NCWH 2P8PA 1AKJD 2LU3A 5AYQA 3FB6B 4B53A 5HHVL 2Q3ZA 4AIXA 3LZFL 2AP2A 2FWOB 4Z7VE 3TESA 2E7HA 5JW3H 1U6AL 3L9RB 4QTHA 3ROOA 4M6ML 4HPYH 3MROA 5KN5A 2V2WA 1DEEB 5LGHH 1K2DA 4WU5B 4R4FL 3ZKXB 3SQOH 3I2CL 4FZ8L 5F96H 4R3SB 2B4CL 5DJ0B 5CJBA 1UWGL 4X9BA 3CPLA 4ZTPL 3CH1A 4BZ2H 1DDHA 4R4FH 5INDA 5I1KL 2AJXL 4G8IA 2RBLA 4TTDC 1BLNB 4WW1B 1V3KA 1OPGL 4MNGA 4MSWB 5CILH 1FIGH 1KGCE 4HUXA 1MHEA 5C7XL 3GSQA 3UJIH 3IB4A 1JGLL 1UWXH 4FQ1L 4NZUH 2Z92A 3V0VA 1W8OA 3IXAB 4U2ZA 1D6EB 1XCTB 5FUCC 4UU9A 1I1RA 1I9JH 4OZIF 3MNWA 1Q38A 1AJ7H 4WTZA 1OARL 4ELMA 1SYSB 4AK1A 5L2JA 5MEQA 3RWJB 1KJ2L 4ELME 5I76A 1UENA 2H3NB 4AM0B 4BH8A 5D72H 2HTLC 4EN3A 1KXVC 3HRPA 2A1WH 3NACH 2QSCH 5I15H 5CJ8A 1LNUB 1N2RB 5MENE 1Q9WB 3PWUB 4Y4FA 1G1YA 2XY2A 1P2CB 4XVSH 1B88A 1YMMD 2KQNA 1N5YL 5DGRA 4JRWA 3QO1A 3T4AA 4UI2A 4M9OA 1I8LA 4S1QH 4IRZL 1HYSD 4OLWL 4ALAL 2L7JA 2I9TB 4KGJA 4NRZB 5CINH 4K8RL 3EJZC 2AKRA 1Y18B 3F5WB 5HI4C 1I8MB 4X7SL 1YNLL 4H8WH 5JHDD 4HUUA 4ZSOE 4HX1B 2C4FU 4U1LA 4HG4J 5J12C 4LCUB 2BY2A 1MWAL 2DTMH 2EYSA 3LKRB 4JRYD 3QCTH 4NFDA 3X13A 2HG5A 4O9HL 1WZ1H 3IVKB 2DRUA 1IEHA 1P1ZA 1DVFB 3I6KB 2BSRA 5EO0A 2X4QB 2ARJB 4BELD 3T77B 4KI5F 2VZSA 3CLFH 4G8GE 4XBPB 3DBXB 3QIWC 3DHMA 3OAUH 3O41A 2W9EL 4Y0GA 1SJVA 1A6TB 3S35L 1N8ZB 2YPLB 5TF0A 4O2EB 1MCHA 1BD2A 3BIAX 4Z5RA 3B9DA 4GKSB 3QXAB 3FT4B 1NCAL 1FYTE 1A1OA 3BWAB 1PKQB 2JELH 1KCSL 2NY7L 1HK6A 2OR9L 3WS3A 5KTEL 1OGAA 1YEKH 2I25N 3FRUB 4UAOC 5T1KA 5T5NG 5KVFH 3O8XC 5GSVA 5A40E 4MGXA 3PHOA 3G6DL 5IHZA 4J3OC 1OAUH 4D0BB 3WNNA 5GS1B 1A6UL 2OS7A 5I0DA 3U4EA 4LVOB 5CJXA 3WNOA 4HWBL 4V1DA 4EDWH 1K8DB 1PGRB 5EOQL 1KTDB 3IDNB 4PJCE 1CFTA 3HMWH 4PBXA 3KYMA 3IRZA 4NM8L 4Z7QE 3DUHA 1AP2A 2FYYA 1BOYA 3I6LD 2JJSC 4YHNA 2IQ9L 1T7ZA 2W1NA 2DD8L 3FTGB 4QO1A 5DJZB 1PSKL 4HUNB 1I1AB 1U8HB 2HWZL 4NM8H 3RVXC 4HH9A 3KHQA 1DE4B 1MEXH 3DRQA 4XCCH 2R1WB 3HTLX 2ADIA 3V4PH 4YXKL 4PJGA 4CUCA 3VMNA 1U92B 3BE1H 4NUJB 3UJJH 4P0DA 3QXDB 3RWCA 2JCCE 4LRIC 4JM2F 4U6TA 1UEYA 1BQSA 5TE6H 3RWEB 3GI9L 3ZDZE 4YHIB 4UQ2B 4FZEH 1FZJB 3SCMB 3TYGH 4YHML 1X5LA 1NCBL 3PQYB 1AD0B 5JR1L 2X4RB 3RWDB 1FSKC 4N0RA 4U1MA 2P49B 3BKMH 4YDVB 4J23A 4X4YB 4LCWB 2OR9H 4IOIA 1OGAB 4PGBA 5BRZB 4X5XB 4NP4H 2Z4QB 3L5WA 3V6OA 2LTQB 4OZGB 4KDTA 1KEMH 5CLTA 2JB5H 3KYNA 4QF1A 3KLHD 2LU4A 1RY7B 3SE4A 4F9LC 2X4SA 1AR1C 3PDOB 4NP4L 1EFXA 3EKCA 2WWMC 2GJ6A 1BP3B 2Y6SC 2JJTC 4N0UE 3MLPA 4D2NA 1VERA 1N0XL 2DKMA 3PQYA 3VXME 3X3GH 3BEWB 4ODXA 4L4VB 1XAUA 3T1FA 4CDHA 1KPVA 3B3IB 1FG2A 4Q9QL 4R9HA 3TBVA 5IBLD 4J8RA 3VD7A 1P53A 1HINL 5AZ2L 3VGFA 1SBSL 1A0QH 3QFJA 1TTFA 1PFCA 1O7SA 5E8NB 3O6FA 3DMMB 1RZKH 2R1WA 1LEKB 1KBGL 1FCGA 4QHLB 5D1QB 3V4PL 5DVMA 2VMFA 5EBGA 2R1YA 1LD9B 1A6WL 2ICCA 3V7AG 4YO0B 4P9ML 4O51B 4Z76B 1NCNA 5T1DH 5DUPH 1NANI 4I4WB 4NRZA 4F2MA 3QI9D 3T2NH 1INDH 1TQBB 3QDJB 5HHNA 1N7ML 3BH8A 2A6JA 4LDOB 1EUUA 3L7FB 3BESR 1K8DA 5DMYA 3RY4A 4Y8AA 2PTVA 4G6JL 4P5TA 1CXEA 3QRFM 1BIHA 3I6GA 3H6JA 4U7MA 2BNUA 1MHHB 5C09A 5FECB 4WJ5A 1C7SA 1CF8H 3QCVH 1MFAH 2BSTB 3O81A 3K3QA 4HIEB 4EN3B 4JPIA 1CG9B 3UBXA 1TVBB 4FQ2H 5I8EB 4FQQA 3OKOB 1IM3B 2YUWA 2VOTA 5L2JB 1I8IA 3OHXA 4DWHA 1V7NH 5SX5H 2MHAB 1KJ2B 2NMSA 1KIPB 4BZ1H 3FQXB 5C6TH 1AI1L 4GLRI 1ZT4B 5GQBA 1D5ZB 5EU5A 3FO2A 4OCSH 3AROA 4UIKL 1Z3GL 3KPPA 1P6FA 3BAEL 4PG9B 3MOAL 3IS1X 1E6OL 3O6KH 4AIZA 1T7VA 3I84A 4WW1A 1V3MA 2I07B 2VE6A 2UZIH 1S5HB 4DOHB 2CO7B 5IMLB 1BQLH 1T66D 3GI8H 2HLFC 5FYKU 2DKUA 3QIBA 3X13B 1TTGA 3SDYH 3UTOA 1P6AB 2QEJA 5K9KB 2E9JA 2H1PL 1ZHKB 1DVFD 4MD0B 3QEHA 5IHLB 5HYJB 3GK8L 4FQPA 2V9TA 2K7QA 2FWOA 3FB8A 4WWID 3JBG7 4F9LA 3UZEA 5FYKD 4HGMA 3TA3A 3ARED 5GRXG 1GGBH 3ZLQC 4EI5D 3NH7L 5ITBL 4XP4H 3SPVB 3EYOB 2CGRH 3QH3A 5GGQH 2FATL 2DWDB 3KPOB 5L8KB 1MCIA 3NZ8A 1AIFB 1P2CA 2NXZC 5F1IB 3FB7A 3IU3B 3SE3A 4LSPL 4GXVL 1I9RH 4HKJB 3CLFL 5B3JE 2XFXA 4Y2DD 3SDXE 4FQXA 4OLUH 4NKDA 4KXZI 4F33A 2Y07H 2BX5A 3CCHA 1A3QA 1P4IH 2CUHA 3U9PH 4WTWA 5E6YA 2DQHL 4Y89A 2AVGA 1LEGB 1BPVA 1J8HB 4U31A 5E1AB 4CN6A 5JHLH 3Q5OA 1ITBB 2VXSL 5H35A 2QQLL 5SWQB 1UH2A 3H9SA 4HIHB 4PJXE 4PV9B 1KT2A 4GRWB 2YPVH 1QQDB 1P5UA 3QUZD 3OKDB 3PXHA 3TP4A 5FYLH 5GIRA 3U0TB 4HF5L 3F58L 2Q87A 5FDWA 4JHAH 2OCFD 3MPCA 4MNGB 1F5WA 3QIBD 4P23C 1WBZB 2BNQA 1F00I 2BMKB 2VLRB 1QSEE 2YUXA 2R23B 3BW9A 4GW4B 3N1MC 3MV7B 1U95B 4JO3H 5E8EB 3SDDB 3PWVB 4C56E 1IKFH 3WKNA 2JJVA 3ARSA 1UWEL 5LXGL 43CAB 1T5WA 3KYKH 4JO2L 1YJDL 4RCAA 4HQQL 1KG0A 2NY0C 1WEJH 1FNLA 1DP0A 5GRUL 1EO8H 3TCLA 2I26N 3KGRA 4CVWA 1UACH 1DANU 2V2WB 1U8JA 2FCBA 3MFGB 2EECA 4PRBB 3LKOA 1FNEB 5I75B 3PQYD 5GS0H 4NQCD 3W39A 4OAWA 2X2YA 4OCWL 3L3IA 4CU7A 4DVBB 3C5ZD 3OKNA 1IBGL 1IEBB 5LGJB 3MRRA 4NUGL 2MKLC 4LAQL 5HYFA 2B1AH 3QCUL 2XWBB 3JWOC 1IE5A 3HZVA 1W0VA 1SEBA 4OZGE 1T83A 3EFFA 5CILL 4BA8A 1SBBA 3HNSH 4GG6F 3SDAB 4LHUD 3QWRA 3GIVB 1HHKB 3GO1H 1BMGA 4CL7A 1OAKL 3W2DH 3L7EB 4K3JH 3HG1B 4J4PC 3PWJA 4LLDA 4I9WE 1EXUA 3KYAA 5KSUB 4DTGH 3FQNB 5SWSB 3NGBB 4L8DA 3BZ4B 5KG9B 4UV7H 4ODWB 4TSAH 2PYEA 1OSPH 2R1XB 4WFGE 1AY1H 5B8CB 1T04B 1OLLA 1I7UB 1IC1A 4M5ZL 3FO0H 3T04D 1U8IB 3K8MA 2F8OA 5D96C 4XVTL 3DROA 1GGIL 4LARL 1G0YR 1CLOH 1KV3A 2ZKHH 4F7CA 4TTDD 4XI5C 2HVJB 2Q8AL 4LQFH 4RWHA 5I1HL 4MX7A 3VXSD 5FKAB 4RBPH 3D69A 4HIIA 2R2HA 1P69B 4M4RA 2R2EA 4XPTL 5D6CB 1FG9C 3RL2B 1MF2L 3T0EC 3G6AA 1DN0A 1JMZA 1UZ8B 1F4XL 4XBGA 4J1UB 2DOCA 4OF7A 4JRXB 4NNPL 1MFDL 1G7MB 2PR4L 3MRPA 5FYJL 5T1LA 1A6WH 2IWGA 2ESVA 3L3DA 5LG1A 4LPWA 4P2QE 4DN3H 2HJFA 2AJ3B 3LN4B 2DQGL 4PJCB 5IT2H 2WUCL 5EIQA 4JFZL 3B6SB 4QOKE 1FZMB 1DUZB 4ODVH 4NN6C 5FGRA 1CFSA 1Z9SA 2HKHL 2A83B 1F3JA 4OIIL 3VFUB 3VXQA 2D7MA 3AB0C 5IB3A 4X6FB 4OCRL 2EXYC 2P8MA 1SY6H 3S35H 1QPPA 4PJDF 4F3FB 1DLFL 5BVPL 1E4KA 1SEQH 1N0XH 4K9EC 1JNLL 5IESL 3RIAF 5D72L 3CK0L 5CMAA 5I1IL 1S7RB 5INCB 3V6OE 2GUOA 1EHXA 2R2CA 2BVTA 2WK2A 4KK8D 3MJ9L 2LV4A 4WV1C 3TPUA 4MA1B 4KKCC 2H9GB 4ESKA 1U58A 2HLAB 4Z7UB 1KJMB 1KPUB 4I8DA 2DLFH 4GT7A 3SO5A 4PRIE 4JG0L 3VCLB 1ZTXH 1ZOXA 1VGEH 2DM7A 2YKLH 4PGEA 3MLRH 4OUUA 5E2UH 3RBSA 4WDIA 1A3LH 4FFWD 3G6DH 3W11D 1MFNA 3VFPB 1E4WL 4QRQB 1N6UA 3JTSB 1RK0B 1WUNT 2YEZA 2ZUTA 2DMCA 4M7LL 4QHKJ 2B1AL 4EI5B 2NY4B 3NTCH 1KUMA 4PV8A 3UC0L 3EHBC 3SGKC 2NY2C 4IJ3C 5FYJU 1D5MA 4P23D 2EDOA 2HWZH 2XOTA 3F8UB 2FSEB 3I9GL 2ZG2A 3D39E 3WFDH 3MLTA 5BV7C 2A74A 3JWOL 2EIZA 3NA9H 4PJ8D 1HEZB 3CVIH 1F58H 5FHAL 5I73B 2B0SL 4CAGA 5CJ5A 3HN3A 1ED3B 5DQDH 4YWGL 3V6ZB 4HS3B 1K5NA 4HCRH 4LVHC 3KG5A 5D5MB 1OGTA 3K74B 4LSQH 4U1SA 4HMEA 5DVOA 1OP5K 1I1YB 1QLRB 3U83A 2VZOA 3HC0A 3FB5B 3DOSA 4IMLA 5D7IB 2O5ZH 1C16B 1BECA 2AEPL 5HI3C 1EFQA 4NBZB 5I1DB 4WEBH 4WCYH 5IW6A 1S7TA 4KMTH 1KIRA 4K94C 3ULUC 3BEVA 3FOMA 5C08A 5TE7L 3FB5A 4JKKA 3RZWA 1W72H 1WWWX 4Q97A 4PRAB 1QSFE 3B4NA 1CE1H 2YC1B 3GSRB 1LE9A 3UPRA 4QCIB 4FN0A 1SMOA 2P7TA 4JPWL 1XR9B 4A6YH 1R24B 5MEPB 4U1JB 1Z9OA 3VXMD 2JJUA 5T5FL 4ZNCD 4FFVD 4UB0L 4I77L 1WVZA 2FSEA 3NACL 3MUZ1 4JG1H 3FFDA 3I9GH 1WEJL 2V2XA 3V7AE 1HINH 5AZ2H 3V6FB 5GGSY 3HNVL 4EDXA 2HFEB 5CEZE 1CDBA 4PB9L 3QXVA 1XF4A 1CD9B 1SVCP 1CLZL 2YD2A 3W0WD 2Z31C 3HUJF 4QRQA 3THMH 3WHE1 1DQJA 1JNHB 3OJVC 5FB8B 3RUGF 3IFNH 5DWUL 4WDIB 3FZUC 3MLVH 1BJ1H 4OD2B 5D9SA 4KY1L 4PIRF 2Z35B 1CDCA 3MODL 3C8HA 3PWNB 1IT9H 3DURA 2V6HA 4MLIA 5I6XB 3QO0B 1M1SA 5D70H 1U93B 3WUWG 4F58H 1KLUB 1ND0B 3WFEL 2Z8WC 4XGZA 3LB6D 2E8YA 3QQ4A 3VXOA 2AV1A 3VD9A 4K71C 2FBJL 1ZVYA 3VXSE 1NC2D 3BQUA 4F58L 4Q9CA 4NO3B 5A1AA 4N9GA 2VWEE 3SDXA 2VLME 1ZHLA 2EEBA 5DLML 1WZLA 4JFDA 4YIQB 3FQTA 1ZE3C 2AEIT 1GC1L 3BP4B 5ESAA 3SDDC 4AH2B 4F3FA 1S7UA 3CVHB 4K8RC 4PREA 3PGCB 2VB5A 1Q1JH 5JXEC 2ITDB 1J0KA 4DN4H 3U36A 4GRWE 3G6JB 3GSVA 1VKXA 1SY6A 4ZD3L 3EO0A 1NCAH 3IDYB 2ITDA 3G5ZB 4DK6A 2Q6WA 5EU4A 4PJ7A 3HUJB 3DUUB 5ESAB 3LN4A 3FQTB 5CSZA 2I9LA 4C56B 1ACZA 4KJWD 5T1LB 3L3OA 5DTFB 2ESVE 2J8UB 4X7SH 3IXTA 3L3GB 4JPWH 4XBGB 2K7PA 4NM4L 1D5XA 1NFDB 1F4XH 5D6CA 3RL2A 5CP7A 1NGYA 1A6UH 5BXFA 5FFLA 4XPTH 3LD8C 1N59A 1IM9A 2D4FA 3G5YB 1RZFL 3RAJH 3SY0B 4HDIB 1YJDC 1CVSC 1QHOA 4N0FB 1A6AA 3WHE0 4FA8A 4K71B 3NPSB 3ILPA 1QP1A 5T3XE 3BPNC 2IBZX 1QZ1A 2MNUA 5I6XC 3RVTD 3UTTA 3T0AA 1ZKAA 2CLVA 1MNUL 3FQUB 3GIZL 4LSPH 1F13A 4LSRL 4Y4FD 4JFFE 4QHUA 1R6VA 3UJTL 1F42A 2PTTA 3QI9A 3C6SB 4P23A 4XP6L 5C6TL 1ULVA 4LIQE 4AENA 1Q94A 1TCRB 4TRPL 3FFDB 5J1AB 3SCMC 1CZ8L 3HG1A 4LLDB 3MRDA 4P4RB 4DCQA 2E27L 2VLJE 1I7TB 4WTXA 2VZTA 4G9FB 3T2PA 2XZCH 3DX9B 3EZ8A 1ZLSH 1B4JL 2W92A 4I5BA 4XXCA 3MUY1 5IEHB 3HZVB 2OR7A 4JPVL 4MMZC 1SJXA 1QRKA 2XWBA 4NZTL 1F4YL 3F6LA 3S36L 3A6CL 3K8KA 5BQ7B 3Q5YA 1DQQB 3O2WL 1N64H 3TT3H 3A67H 5F8RC 4LSSH 1GCFA 4ACPA 3GSXA 5MHSE 1XCQA 4H25A 4Y16D 5DVKA 5HD8C 3LQAL 2R56H 4Z0XB 1GRWA 1XGYL 1Q9KA 4M4PA 4PRBA 5F72S 4B0MM 3REVA 5D7IA 3HAEA 5C0CB 1UACL 1R3IL 1X4XA 3UAJD 3CAFA 4PPTA 3CU7A 5C0GB 2FDBP 5FA4A 4G43A 1RUKH 2JB6A 2ZUXA 2R0LH 3NPZB 4NQTA 3RGVB 1HH9A 1CL7I 3SGEH 4GW4A 3GSUB 2RAMA 1YECH 5I1JL 2XKNA 3BDYH 2NLJA 2B20A 4YR6B 3FOLB 3O9WC 4IRSA 4P2QB 4JB9L 4X7TA 4RAHA 2PO6A 1FVDB 1K4DB 2EE3A 1ZGLA 1CDGA 1MH5A 2WNGA 3RVVC 2A74B 4XWGL 1N4XL 4JM4L 2IEPA 2EH8H 1JZ5A 1TDQA 1H3VA 2VXTL 3DMMD 5F6IB 5JQ6L 2DJUA 5SV4A 1IAIM 2E7BA 4EI5A 3MBEA 2ZJSH 4ORGB 3KDMB 3MA9L 3TBSA 4GMTH 4NC1C 5FO7A 1LP9B 3EYFB 5IW3A 1IGML 3SO3B 4KMTL 3NMEA 2ARJQ 3WHXA 3GEWB 4XC3H 5EOCH 4EEEA 4LCIL 1RZGB 4R0LC 4Z78B 4UIMB 4H1LB 2ZSVB 5ID1A 3DXAE 4C55A 3CDGA 4TVPH 5EIIA 4TSCL 1PSKH 5KSAB 2DYPB 4LSUL 4XBEL 1GGTA 2NX5A 1MEXL 4L5FH 1D6VL 4FS0A 2AJYH 3EOAB 4MD0A 4OLUL 3VWKB 4KH2A 32C2A 5GGUA 1GOHA 4PB9H 3CMGA 4P4KA 3QFJE 4HKZB 4RGNE 2FECL 1EEZB 3GB7A 3LOWA 3Q5TA 2ZSVA 2JTDA 4LCCB 4LBEB 2ADFH 2CMRL 3EZJB 4PJ5E 5JW4N 4F80A 3C08L 4MXQD 1NSNH 3B6SA 4DN3L 5DD3L 1K9TA 1P9MC 5L8JB 4KUZL 3W2DL 1P84J 4HLZH 5DD1L 1U8PA 5FO7B 2ORBL 5HVWA 2F53A 4ORGA 4GLRH 1FZOA 4JQIL 4L9DA 4NQEE 3AMKA 4QRRD 5KVFL 1AGBB 3FQXA 3EO9H 2BVEA 5FF6A 1XZ0B 1HZHL 1UJ3B 2ADGB 3B5TA 3N50A 5I8EA 4OM0L 4RX4D 4X99B 5BS0B 1UVQB 2XT1B 5F9AC 3CK0H 5I1IH 1MCRA 4HIEA 4JKPL 2WBJA 3WS6A 2FJGA 2AK4A 2BNUB 3O6KL 1A7PH 3MACL 4P5KB 2KUTA 1CQKA 1BJ1J 1GSMA 1IEAA 5CD5C 4JQVA 1HH9B 2X9XA 4ZUSB 3UYRL 5HGHA 2J4WH 3AAZB 2OK0H 1TCMA 1L9MA 2ZCLH 3C5JA 4HWBA 1WICA 2QV2A 5IHBA 1T2XA 1FORH 1OAXL 4MA8L 5F88A 1QRNB 1T1WA 2A2QT 3CDCA 4MXWH 1MRFH 2BHZA 3PIQB 1G7IB 5CS7A 4YO0A 3JWNC 5FYJH 3P0YL 2VZ1A 3PWJB 5C09D 2IMMA 1YA5A 3H0TA 2Q3AA 3I02A 2BVYA 1MRFL 3GSXB 4LSDA 1QA9B 3RAJL 3O6FB 4KRMB 1FNHA 4CDGC 3QFJB 2PNDA 3BWUC 4XPAL 4ZO9A 1F90L 3PL6C 5DJ2B 5LGHL 2VDKH 4G8GA 1KPVB 3B3IA 5CLWA 3VMOA 5C0IA 2IAMC 4XVJL 5LGJA 1D9KA 1FJ1A 1NBYB 4MNQB 4OFDA 1S8DB 4M43L 4PTTB 3HE6B 4DVBA 5JNYA 2NY6D 4ZAKA 1WIOA 2WBWB 4N68A 1KXQE 2QLVB 3H42L 4OM0H 2NY3B 1XH3A 4UDUB 2UWEB 4CVZA 4XH2A 1X7QB 4S2SA 1OP3H 3BAEH 2XTJE 1KG0B 4QTIH 4U3XA 3GSOA 5F93C 4M3KB 2X09A 5J89A 3P4MA 5FGBA 1JGLH 1AQDB 3QHZH 4ZNEE 4WWKA 4X4YA 2WLZA 5M7QA 2AJUH 3PXJA 5D2LA 2X4RA 3K2UH 2L7UA 2VDQL 4OFVA 3CMOH 3ILPB 2MKWA 3B8YA 4LASL 35C8H 2UZYB 1N64L 4XP5H 3VXUA 3A6CH 4MD4B 1VPOH 4JFEA 4RAVB 2Z31D 3BH9A 5E99L 4YK4C 2W60A 1HHGB 5EBLB 4LHUA 4PJBF 1U8LA 2CDEB 1H8OA 2FJFA 3DJ9A 5CCKH 4NQED 3WDIA 4NZDA 1AP2B 5FYKH 4OCWH 1FO0B 5LQBH 3RWIB 5SWSD 3JWOH 4FQXD 4YBQC 1U8KA 4X6BA 2W9DH 1I4FA 2FIKB 1JPGB 3IU3A 1A9BB 2EDEA 3EO0B 1L7IH 1NCDH 4DZ8B 4GRLB 1ZANH 1ROWA 3G6JA 3GSVB 4JZOA 1L9NA 3U36B 3BGMA 4LP5A 5TQ2H 2F9BT 5TDPB 5L6YH 1JF1B 1UEMA 3PDGA 3HB3C 1DFBL 4WY7H 2QQNL 1F11A 1U41A 4MCZB 5JIHA 5ABDE 1XF5B 4WI5A 4W6WB 5J13B 1M7IA 2Y4SA 4N9GB 2O93L 1AGEB 4MA7L 2NY2D 5EZLB 2FBJH 1BVLA 3F58H 1ZVSA 3TT3L 3BPLC 4MB5A 3KXFE 5M94B 1MLCA 3OX8A 4CADB 3LQAC 4EN3C 35C8L 3CDFA 1NFKA 5FOBA 1U93A 1XGQA 1A6TA 4ODHH 2EC9U 3ELAT 2DYPD 3L3KA 4FTVB 5D7LA 2VE6B 2L0DA 3EDJA 3H9HA 1FAIH 1X5JA 2N7BA 4ZPVB 3U9PL 1BHGA 4X7DC 5FCUL 4UIKH 4YHYC 1IGIL 3O3BA 4NO2A 5DRXB 2BDNL 5HVHB 1TQBC 2XA8L 1D5ZA 4YDLC 4MDJB 1YY9D 1MJJB 4F8QA 4HAGA 5JA9A 4KK5D 43C9A 4E42A 5JW3L 3PP3K 3GJFK 4PLJC 1QSFB 4OFPA 3WJJC 5IR1A 5GJSH 1S9XA 5IVXF 3WSQL 5CBAB 4YHYB 5ERWA 3P9WB 5T33L 3BQUC 4LLVA 3I6GB 1G0DA 3RVXD 4EXKA 1PLGL 2OP4H 3I75B 1H8SA 3GJFB 4CW1A 3QO1B 4LDEB 3BT2H 4JKMA 5DHVH 4NOBA 5I17A 2O5YL 3QUYC 4Q9BA 1BREA 5JMRA 4MHHI 1KIRB 1XF2A 3QULA 1ZAGA 1JUFA 4JVUA 2G5RA 4YK4B 3D3VB 2DQTL 1LVEA 1TZGL 1BD2D 2NY6C 4OCSL 2NNAA 2ZUWA 3OB0H 4LLUA 3RWHA 3IFPB 3TV3H 1QLRA 3AS3A 2IANB 1V8HA 2FL5B 2R8SH 3NCFB 3QUXA 5D5MA 2XZQL 1K5NB 4WEMB 5HHMB 4EI6A 2YD6A 3QA3A 4Z7VB 4PRDA 5EC2B 1OP9A 4EUPA 1Q0YH 2MTPA 4YFEA 2UWEE 3QRGH 5FUOH 4G8IB 3HCVB 3L3HB 4OGXH 5HVGB 5D93C 3WXVL 1J0IA 2VLJD 4KJPC 4UTAH 4H5SA 5D6DA 5BOPA 1ZS8A 1UA6H 5DRNA 1EFXB 5EU6E 3QDGA 4H88L 1S7QB 1VESA 2Z0BA 4DAGL 3QNYB 1FNGB 4M6NL 1A7NH 5T1KD 1ZVSB 3H3PH 3HR5A 5JQHC 4YDKL 2MPAL 3EYQC 5AWNH 1DEEA 5DVNA 4FQIH 4JO1H 5K59E 3RHWF 1X5YA 5K33A 2PW2A 5FO9A 1R3LB 4C59B 5C6WH 2FECI 4A6YB 4IDJL 3DYMA 1XMWA 2X40A 4OLYH 4OSUL 1FFNB 5E2VH 3QJFA 1J87A 5ADPL 3MBXL 3SDCD 4XMKH 2NY4C 3DSFH 1A64A 3VXUD 3BGMB 1NMBH 5DK0B 5DMKB 1WF5A 1RK1B 4Y7MA 1GL4B 4OV5A 4DN4L 3ZE2E 5GGRY 3RJDA 5HYEA 2X1XR 1NUDA 4X6CE 1JPGA 4Z7WA 3QQ9D 3STLA 3RWIA 4R6UA 4N5EC 4X98A 2PXYA 3OAUL 3IDIA 1HYSC 5IK3B 5INCA 2XWTA 2G75B 1JTTA 3FO0L 4KKBD 4PRNA 3QUMH 4XVUC 1PVHA 4HF5H 3HS0B 5CZVL 5I8OH 4PJ9B 1YQVH 3U0PA 5AYUH 2ARWA 4WWKC 5TFSL 2ZJSL 1JGEA 5C0AA 3ES6A 2DM3A 3W82A 3QSKB 3G9AB 1BF2A 3GBML 2J8UF 3ARBB 1KJ3H 1WITA 1JVKA 3TZVB 5DD0L 3TZVC 3ARZA 5T3XH 1M6OA 5DS8B 2VN4A 3T0BA 4NQEB 4PRPB 2V5YA 4U3HA 1OM3L 2LU7A 3ET9F 1PKOA 1QBML 4WWKB 3C60C 4KZDH 1HHJA 4L4VD 2MQ3A 1JWUB 1G6RH 4RX4A 5HI5C 3CSBA 5DUML 4Z0BL 3BXNA 1DN0B 1DLHA 4D9QE 4JFXB 1LE5B 2EKJA 1BBJA 5L7XL 1KFAL 2CDGB 3TO4C 3K1KC 2ENYA 4MX7B 3NZHL 3NH7H 4QRRE 2GTZA 2E5EA 4I3RH 3RU8H 3V4UL 1PAMA 4GMSL 2F54A 2YPLA 1R5WA 3O3DA 3Q3GA 4JB9H 1REIA 3U46B 2DI9A 4LAJH 5DJ8A 1RHFA 3WNMA 5IIEB 4XBPA 4U1HA 3VFTB 1PQZA 1BF8A 2HTLD 4ZFZB 5TGBB 3I6KA 3ZYOA 3AFLA 3O4LA 1XIWA 3KXFB 4ZTOL 1BQUA 3RVWD 1ZK9A 4QRPE 4QRUA 4B50A 1H3PH 1SVZA 4OLZH 4EIZC 1A3RL 4KVCH 4XMLH 2ICWJ 1CE6B 3D2UB 3UJIL 3ZDYF 1CD0A 1A7BA 1A1NB 1AHWC 3DVGB 4HK3N 3LAFA 2ICWI 3B8SA 5D96B 3U6RB 1XFPA 2EIEA 3LDBB 4TSBL 3IYLW 5E4EC 3IDGB 3MJ8A 4NN6B 4XCYB 1GXEA 1ZT1A 2CH8A 1C1EL 2P5WD 4ZUVA 3GMNA 1NGZA 1KCSH 2RFXB 4ZNEA 3B9AA 1IQDB 1I3RA 4RDQG 1MREH 1A6ZA 5EU7C 3MRCB 4ZUSA 5J56B 1RULH 3HMXL 5FUZH 4P5KA 3ZKQD 1H8NA 2QQLH 4RFNC 4KROB 5F9OL 1Q9WA 3S4SB 2FJGB 3VXNA 1FNEA 1BFSA 4MQSB 4POUB 1MCOH 4E0RB 3VWKC 3ZYIA 3UJJL 4GMSH 5DJXB 3OXRB 5DJ6B 1VA9A 2WIIA 4M7JL 4MNGE 2NY1B 2NW3A 1T3FA 6FABL 1AGBA 2NYYD 4KPHH 3UYOD 3HAEG 4W81A 1JWUA 5C3TA 4KROC 4Y4KA 4JHWH 3SKMB 3SDDA 2WUBH 3PWPB 4LKXB 3DIFB 1YPZB 2R23A 5D7IF 3GRWH 2A6KB 1F6LL 4G9FD 4AMKL 2PTUA 4M48L 5DR5H 3TIDA 1T83C 2R4SH 3D3VD 4HJ0C 4K3GA 4UMGA 5DI8B 3WFBL 1VHPA 3GMRA 3HZKA 1IC4L 3CH1B 1ZGLM 1JCKA 4J3SA 5JIPA 4CJ1A 4EKXA 1PLGH 4HD9A 3MV11 4Y4KB 3QB7C 5KJRL 4NNXB 3GBMH 4PV9A 5JZ7D 4KQ4H 3IDXH 5MEOA 5J3HD 2APVA 2H45A 4DGIH 4WU5A 2IBBA 1AHWB 4NZJA 3BMWA 3S98A 1HOCA 3MJ9H 32C2B 2ZCHL 5GPRA 2XN9D 5CGTA 4K7FB 4EOWL 4PRHB 3UTPE 5DFVD 2EXYD 4P57A 3LS4H 4NKDB 2I60L 2OZ4A 4Y88A 2HRPL 5IW1A 2P1YA 2YXMA 5F1IA 4Q9RL 3HMXA 4L4TD 5SX4I 1RK1A 2WBJC 3ZT7A 3RGVD 2W9LA 4FNLL 4UIMA 3FHQA 3WIIH 3GM0A 1XIWC 5ICXB 5I0ZA 1O0VA 1BBDH 2E9IA 1B9ZA 4I3SH 1XGYH 2GSGB 4GAYB 2BXYA 3QI9C 1S3KH 3WN5B 4PY7A 5HYJA 3O11A 3WNKA 5DF0A 1ZHKA 3HPLB 2D7TL 3QCUH 1A1NA 1AHWA 3QCTL 1T80A 3LHPL 4FFZH 2VKXA 1JYNA 3D2UA 3ORJA 1FZKA 1FNGA 5CJQL 4LLMB 3V52L 1HKLL 3H9YA 4MDIA 4XP1L 2BNQD 4HMDA 5L0QC 4NOFA 5DRNB 3EDFA 1DQDL 3ARBC 5F9WC 4R7DB 1ZGLB 3DHJA 5KW9H 4L4JA 4R96A 5J06A 2VLRE 1D6VH 4LGSB 4NNPH 3K4DA 5JXAL 2OTPA 2NLJB 3GKWH 2FNBA 1AGCA 1PYWB 5CEXA 1EEYA 3MJ7B 2GTZB 2IBGA 4PJ9D 1VFBB 1MSPA 5DVLA 5C0GA 1T3FB 4PJXA 1DLHB 5EU3B 2F5BH 5LVEA 3C5SA 3HAEB 1TETL 4ONGH 5D1XD 1LO0H 4RGOH 3I6LE 5HDOA 3LRSA 4WI7A 2IADA 3NVQA 3RZCD 1HILA 5GRYA 1DLFH 1KTRL 3WCYA 3X11A 4WFED 1OB1A 5ENWA 5I17B 3O6LH 3TZVA 2WW8A 1RJCA 1WK0A 5AWNL 1A02N 1PX3A 2Z93B 1OAZH 1FLTX 5BZDB 4XP9L 2YMXL 5IEHA 5C0AB 3O6LL 3EAKA 3SGDI 2FD6L 2Q8BH 5CFHA 4GKOA 2QSQA 4HXAH 3P40A 3VH8B 5DK3A 5FO8A 2ZG3A 5IVOA 4OGAD 3IDGA 2GFBA 3QIUB 3WIIL 1QVOA 1JV5A 3DVGA 3SQOL 1MFCH 1X6NA 1NANH 3ARFA 2VABA 2GEEA 5E8NA 3D48R 4OFYD 2DMKA 3FQUA 4TPRH 5TE4H 3D25A 4YWGH 4FQLL 4UUJB 4FQHA 5E5MA 3GMQA 2CLVB 3VFWA 1BFOA 4MQ7B 5JHDA 3FMGL 5GZND 3NBNA 4RA3A 4LPXA 4ZPVA 3RNQB 5ID0B 1UXWB 5D2NE 5JPMB 3L3KB 4M6OL 1R5WB 3MXWL 1WIPA 2BRQA 3G9VA 3OKLB 4LEOB 4AQOA 1HQ4B 5C2BH 2HKFL 5EZIL 3SY0A 2ZCKH 5LJYH 2BERA 2J6EL 4Q6IB 3TA3D 1I9EA 5IBTH 4QXTA 1P5VA 5DMJB 1GAFL 2YR3A 2VC2H 5JOPE 1QBBA 4UILL 2HKFH 4I3GA 1HHJB 4X0KA 1YPZE 4Y1AA 4LCWA 3L3OB 1IQWL 2ZUQB 2J8HA 4BFEA 4NQEA 2R39A 4JFYA 4OCNC 4OZHB 3ILQD 4PJFE 4ODTL 2YBRB 1DBBL 4YHIA 3DNKA 4KGLA 2H2PD 1E0OB 4JZOB 1SBSH 3KHOA 4TVPD 2O61A 1MHPH 2DAVA 5B4MD 4WW2F 3N1QC 1MRCH 1NCDL 1U92A 2NY7H 4GXUM 2P48B 3DUSB 4ODUB 2FEEI 2XTLA 3LKSB 5ESQB 2ZUUA 3GMMB 1J5OH 3PWPD 2K9UA 4PJ5B 2QR0B 5AUMA 2G75A 1J1PL 5DJZA 4V2CB 3F12A 1X3DA 3PWPE 5IK3A 1JNNH 4U0RB 2NY3D 4LHUB 2B5IC 4PJGE 1KB5H 3OTTA 2H1PH 3PABB 1EO8L 3STLB 3RQ3A 3QNZB 2KH2B 4MJ5A 1MCFA 1CFTB 4JO4L 2KZWA 2EZ0D 2VQ1A 3MLZH 3CC5B 3HKFA 5DMKA 3VRIB 3GJFA 3U4EB 1T22A 2NCMA 4WI8A 3QO0A 3J8F7 1HH6B 5DHYA 5ALCH 3IF1A 2A9NL 1B0RA 4PJ8A 1DJSA 5ETUA 5I1GL 1QKZH 2JCCA 4NJ9H 3T65B 3PHOB 5KSBE 1IL1A 3K8LA 4KKAC 4YNYA 3ABZA 1S5IH 4P5MA 5T1MB 1UM6H 1ZSDA 4D9RD 3GM8A 2MJWA 5BRZD 2A9NH 5I1LB 3LKQA 4KV5F 3FRUA 5JPNA 4G42A 4JFFA 3ZE0E 4F37F 3P3YA 2C4FT 4LVOC 2CIKB 4PJXF 4XZUB 5EB9A 4XCEB 4HUVB 1MJUL 1QFPA 1FSKB 2JELL 5TJWK 1FYHB 3BE1L 5F7WC 3HR5B 2ATKA 3M1BB 4MDJA 1BQHB 1RI8A 1ZWIA 4P9HC 4JO2H 1V7NL 4CVZB 3QXAA 1G6RA 3DXAA 1YY8B 2SEBA 3TBTB 3VXSB 3BKJH 4TOYL 5C07E 1L0QA 4G8FA 3HCVA 3L3HA 3LS4L 4M8QA 3HE6A 4JRXD 3P4NB 5FUCE 1S8DA 4FTVA 1YEHL 2ARJA 4Z7VA 1JGVH 4UV4H 3RUGE 4OCXH 3C2SA 3GSRA 1I9JL 1LE9B 2P5EE 4X6DF 4QEGA 5C0JA 1IILE 3Q48A 1WAAF 4XC3L 5D1QD 5EOCL 3WE6B 5D2LE 4X9FA 1OM3H 3RVWC 5EZLA 3BEVB 1RZIA 3FOMB 2B1HH 4HZLB 1N26A 1AE6L 3QHFL 4M6OH 5FYJE 4WW2B 1JHLL 4TUOB 5KVGL 3VFOB 1AFVH 4OJFL 4BZ2L 2NTFB 5BRZE 3DGGA 4XWOC 1WCBB 3ARRA 5I1GH 2I5YL 3LEXA 3INUL 4TUJA 2J88H 2QADD 1MAML 1ZANL 2CK2A 1VEOA 3C8KB 4E41D 4GRLA 4M5YL 2EDQA 4JCMA 1TJHL 2KDGA 4PJEE 2FLRT 3DO3A 2YOCA 3F65A 4Z6AT 3FRPA 3GKWL 12E8H 4NUGH 1N2RA 4JN1H 1XGRA 2HRPH 2Q86B 3OAYH 4AG4L 4APQC 1GGIH 1I9RL 1Y0LA 2WBJB 2X1WL 2GCYA 3BHBA 4ZOBA 3O3AA 3F7RA 4UNTA 4X99A 1JTOA 2PKDA 4JVWA 4HBCL 2MOVA 3CXHJ 1KB5B 3ZSSA 1U8LB 2CDEA 5GS0C 4ZD3H 1MHPL 5DMGD 4U3CA 1OCWH 2W60B 1HE7A 1YNKL 3VJ6B 3MNWB 4PY8J 5I9QC 5GJTH 1X5ZA 1AXTL 1HI6B 2YEZB 1CDJA 4FFYH 3LN5B 1HQRA 2HFGL 4OCYH 4XRCB 4NWUL 2Z8SA 3ILQC 4KI5D 3GSQB 3HC3L 4NZRH 1U8PB 1MUJB 2NY4D 4J7RA 4K07A 4ELMF 4JLRA 5EA0L 4HFWB 4RFOL 3HC3H 4ZXBA 2GYSA 4MXWL 5FOBB 1KN4L 4ISVA 3R1GH 5IB5B 1Z5LA 3NFNA 1U58B 4RQQA 5C70A 3P30H 3TLRA 2H41A 2XNAA 4LU5H 2CGRL 5GGQL 1ZA3B 1BVLB 3QUMA 4J4PA 5D7LE 5DJAA 1JGVL 1FH5H 2W0KA 4AEHL 2YUVA 1XH3B 2B0SH 1KF9B 5HYQB 4RGMB 3W0WA 3QZWG 4I9WD 2NX5B 1CGVA 2LAGB 5BJTA 1J8KA 4MCZA 3MJ6A 4HKXA 3V5DB 4ZAKB 4ZAKC 2BOBA 3CZFA 5KS9B 3ZSTA 5I66A 2IAND 4HS6A 5DJDA 4R4BB 1GPOH 3DETC 4YGVB 2N1KA 1B6UA 4LF3A 5FCSH 3TNMB 1OF2B 1DUZA 5IJVB 3TF7C 3KLSA 4JQIH 5CWSB 1YEJH 3ARYA 4UNVA 4P46B 1Y6NR 4RIRB 1IC4H 2HJFB 5E24E 5DR5L 3MYZA 3I02B 1FO0A 3ZDXF 5HHPA 5DYOB 4K23H 3KYOA 2MMXA 1NDMB 4Q6IC 1NL0L 1OAKH 5CIPA 3RX8A 1ZLUH 1MCWW 2ZUVA 3H2WA 2EZ0C 1M4KA 4O2FB 2HMID 2EEAA 4GAFB 1YN7A 2AJVL 1HHGA 3NIFF 5GRWA 3ARWA 2VSDA 4PGZA 1U8OA 1S9WA 1WT5A 3C5JB 2NXYC 1UQSA 3LDBC 2CKBH 1CK0L 3AAZA 3WEXA 3FONA 2BXZA 4F7CB 4ZPTB 5AZEH 5SX5K 5IGXL 2FHFA 3QRGL 1E28A 3TH4T 3TT1L 3T1WA 2VLRD 5GS0L 2KBGA 1GZQA 3E3QC 4LARH 5F9OH 2HFGH 2V2TB 2DQJH 1OTTD 3STBA 4K7PH 5BV7H 3CIQA 3JV5A 3TBYB 4I0PA 4URTB 5EOTA 1AQDA 3GSOB 5A16A 1JN6B 4HWZB 1FVEB 3ALPA 4P2OC 1OWRM 2UWEA 5KSUA 4M1CC 3HZYB 4M1GH 5E6ZA 4F15B 4KRPB 3GK8H 5H8DA 3ARUA 4AMKH 5F21B 4BFBD 1XEDA 5F44A 3TYGL 4LKCA 4CVXB 5DXWA 2AXJA 4LRNH 1TXKA 3D6GA 5C0IB 2GK0A 2LAAA 2ATPA 5E7BA 3THML 1I3GL 2CLRA 5KJRH 3MLZL 1EMTL 1IGYA 4YGVA 5J13C 3CD4A 2E6JA 5E00A 1EEZA 4HWEL 2FEEL 4YXKH 4LRNL 3ULVE 2IH1A 1JMXA 3CXDL 1QLEL 1HYRC 1FNAA 1NGWB 3WIHH 3QEGH 3ARFD 1G9MC 5CGYC 3KWWB 3U9UB 3TCLB 1P84K 2XV6B 3C6SA 5BMFL 2CUIA 4QHUB 5EU6B 3PG2A 5AYUL 2GJJA 1EJOL 2BJML 1ZLUK 2BDNH 3K4ZA 7FABH 1JF6A 1W72L 4ENED 3BRFA 4LMQE 5D7JA 3MRMA 1CTOA 3Q6GH 3MNZB 1X4ZA 5BS0E 3U30B 4X4XA 4U4BA 1A21A 5BS0A 3FZUD 4HDIA 4LSSL 3CGTA 1T0NB 4YQXL 2IPKA 3B2UC 5ICZA 5ICZB 2YD8A 4O00A 4S1SH 4E41B 2MQ0A 4PJ7E 1MCEA 1BAFH 3S3SA 1LO3L 2Y1VA 4PB0H 3O3AB 2D7NA 4U1GC 4C56A 5C09E 4ZFGL 1XT5A 2XFXB 1BJMA 1T6VN 5KVEL 3DUUA 2C1PB 4IIQC 7CGTA 3MRMB 1LDSA 4ZFFA 5E8DL 3JV6B 3EIFA 4W4NA 4X9HA 2F54D 4M6NH 4HCRL 3GB7B 2E6QA 3QHTC 4K7PY 3DV6B 3LEXB 3BUTA 2GW5A 4X9GA 5GGUB 3HPJB 4YPJA 1FIEA 4DVRL 3C6LB 5IB4B 4Y2OA 1ZHLB 2VTFA 1FL5B 1NC4A 5HYQA 3QEHB 1FFOA 4TQEL 4DQOH 2VRAA 3CSYB 2W0FA 2XZQH 4HW6A 1XCQB 1IFHL 3SDXF 2Z9TA 4QRPA 25C8H 2NY1D 3E2HC 4Y5YA 5I1AA 3UTTD 1IGJB 4M6AA 2EIDA 1IGYB 2AGJL 5BQ7A 5IMLA 1WV7T 4JY6A 4U1NA 2FH6A 4Z78A 1LMKA 3VWJA 2XZCL 3GFUA 4N90D 5FHBH 5T3XD 4FHBD 3OAYK 1KLFA 4G9FA 5AD0A 4L29A 3V8CA 3EYFA 4RFOH 1HSAA 2XRAL 4Y19A 5EBMA 2NX5D 1K8IA 1N3NA 2K3TA 3KPPB 5HHOE 3CU1A 3KDMA 3EOYG 4MA1C 2V5RA 1G7HB 2UY7A 3MO1B 5C07B 4ETYA 4LP4A 1MFEH 1BFVL 1QACA 4UT9H 3DARA 3K80A 2DI8A 4LSRH 5TE4L 1QRNE 5IV2A 1JIBA 2BFVH 2FEDD 4Y4FC 5IHUH 1OW0A 3ARDB 2AJYL 3RA7H 4NBYB 5DDHB 2YS4A 1Q9OB 3MV01 1FBIH 3PP4H 5LKNA 4XNYH 1K4DA 4HKBA 4ONHA 4YAQB 2ZPKL 2DQUL 1MHHA 5C09B 3BZEB 3RIFK 4Y16A 1FE8L 2YD9A 3UP1A 3IF1B 1CD1A 4NRYB 4L4TB 1W2KT 1A6AB 3F62A 3LH2H 3QWOA 1CGYA 1T5XB 5JDSB 3UTQA 1EEQA 5A2KH 5GISL 3OWEA 5BXFB 1NGXB 1BQHG 3PABA 1OTUD 4RWYH 2UYLA 5C3LD 5I16A 3F12B 3LS5L 1NCTA 2A6IB 5DTFA 3CFEB 4P59H 4HV8A 4X8JA 4QHLA 5JMOC 4RIRA 2OJEA 4HWNA 2F15A 2EIBA 2ZOKB 5H2BB 3U7WH 1LK3L 4U1SB 1GGYA 2FX7H 4HS3A 4TPRL 1O5DT 4R7NB 4D8PA 1U6AH 1YQVL 1MLBB 1SYVA 5I66B 3P4NA 2NW2A 3ECBA 4XPBL 5I1HH 4LCIH 2BNRE 1I7TA 4QLRA 4YX2L 3S96B 3QUYD 3MRDB 3S7GA 2BNRA 4R90H 5EULV 4L9LB 1XGUB 1B0GB 1LDPL 3DXAB 4I3RL 1D5MB 3P11H 1VB9A 4NQCE 4EJ1C 2G2RB 5FM4A 4M02A 1RURH 1RVFH 3HR6A 1VFUA 4LQ1A 5HGGS 3ROLA 4XP1H 4PS4L 1X9QA 4J3UA 3TIEA 5IBTL 1GGBL 3MYJA 5CJQH 3V52H 4QHMB 4TNVF 1KCUL 5C0BA 1HQ4A 3SDAC 2OI9C 5I1LA 5T3ZD 3VWJD 5B21A 1JHLH 3IAGC 4TQEH 4DQOL 4JJHA 3VGDA 1X6LA 3MLYL 1VSCA 5ADOH 2VR5A 1QSED 4PP1C 5BS0D 2EDDA 1BFOB 3JZ7A 4MVBD 1GZPA 1UH4A 4MQXC 3PV7A 1ZLVK 5I1KH 2N56A 4QHMA 4NUJA 5H94B 1T89C 1V5JA 5DRWA 4OKVA 1NFDE 4I13B 4LPYA 4JKLA 3QG7L 1TTUA 1NFDA 1I85A 3TT1H 1JV5B 1B0GA 2NZ9C 5HHVH 5BO1H 4KKCD 3QIUD 1B2WH 2VLKB 5CBEB 1J1PH 2I9LB 4K3DH 3ZT5A 1Q8MA 5FK9B 1GVIA 5AG8A 3LKSA 2NW2B 3ECBB 1HXMB 3CSGA 5GRZA 4QTIL 3L3JB 3IDNA 1CLCA 1NCCL 1G1CA 2YMXH 4LOUC 4D0BA 2ILLA 1VEMA 4M61B 1KN2L 4PJCA 3LQAH 1HILB 3SKJL 2OZ4H 4HV8B 5JIKA 4JFDB 4YIQA 4XCFH 1G7MA 1QLFA 4AYFA 3BDXA 3NA4A 5F7EH 4HZLA 2UYLB 3BT2L 4JZJC 5AAWA 4OGAC 4KDWA 1C5CH 3WE6A 3FT4A 3TO2B 4DZBB 1W8NA 3QQ4B 4FNLH 3W5NA 1OGTB 4HG4K 3WFBH 4OLVL 4N1EA 3ZKSD 5DQDL 1BEYL 2VNCA 1CU4L 2XZAH 3VXRB 3TJHD 1ED3A 3PWNA 4B41A 3KLDA 2BSSA 1UXWA 3T77A 5TH2A 4HZAA 1HEZA 5JOEA 1Q9OA 4KHTL 1NUGA 4JHWL 5DDHA 1X5GA 1ZLWH 3U7YH 1UM4L 1DQML 1HHHA 4WHCA 1UKSA 4K7PX 1CDYA 3LPWA 2X70A 4I0KA 4F9PA 2FX7L 1J18A 2VABB 4RMQA 1ZWIB 4J6RL 5E9DB 1OSPL 3BZ4A 2EYTA 3K81A 4N9OB 1T1ZA 2CRMA 1IAOA 4LGRB 2EDYA 1EXUB 1MREL 1FHGA 2Y9RT 3BGFC 4LNRA 5J9PA 3EDEA 4K94H 2ZSWA 5C0ND 5BOZG 4N0UA 5K9JH 3ULUH 1IGMH 4U6VL 3IGAB 3MV8E 1I8MA 3BZFA 3NAAH 4EQ3A 5I71B 5ICXA 4YNYB 4U1JA 2JCCB 3LSOA 1A2YA 4Z7WF 5JORB 3KS0J 1Z3GH 2Z93A 2CUMA 2F8VA 4P2OD 3L5XH 4YJZL 5ENWB 1FFPB 3ZT6A 4AL8H 2DLIA 4Y5YB 5I2IB 3QNZA 5F71A 5F8QC 3L6FA 1JZ8A 2IADB 2X05A 3KPQB 4P2RA 4P57B 3MUGB 5IOPB 5FCUH 4YDLB 1F4WL 1J88A 1J11A 1G9NC 3QBTB 5CJOL 3L95A 3OZ9L 5IB4A 4V1DE 3PL6D 2BY0A 4C4KO 1FL6B 1SYSA 5K9OA 1NAKL 1DCLA 5L6YL 5DK2B 1UZ6F 3WS6C 4ZYKB 4XVUD 2AEQH 3SBWC 1KULA 1YNTA 5CEYB 5LXGH 1B3JA 1NMAH 1U95A 3G5XA 3TJEL 5CP3A 4CMMA 1MIMH 4QOKA 2W9DL 1CGWA 2YBRA 1JRHH 5DD5H 5DD1H 1AE6H 3MGAA 1BX2A 3U0WH 1S78D 3RU8L 3V4UH 1BZQK 1IRAY 3VU2A 5F6HI 3OKDA 1MPAL 5DD5L 4MDIB 1KT2B 4J1UA 4EN3D 1IGFL 4HWBH 2J88L 4XP5L 5H35B 2NW3B 3U48A 1IKNA 1CFNA 1CLZH 4ZUWB 3S4SG 5F7FA 2IPKB 1DQMH 3ROOB 3C6LC 1E6JH 1YUHA 3BKCL 3QDAA 3WN5A 2DQHH 5J3HC 2GSGA 4GAYA 3IFOA 3VXNB 1B4RA 1IJ9A 1KEGH 1F45A 4DFIA 4ONGL 2XWJA 4M1DL 1NBZB 3DXAD 2DWDA 3VFWB 1U9KA 1YEIH 3GMQB 5ITFA 3ZE0F 4M1CD 4TSAL 5I19L 3HZMB 3F7VA 5C86A 2E7LC 1CGXA 4YHOH 3BIBX 1MCNA 2AJSL 2OR8A 4DGVH 3DV4B 1OPGH 2GFBB 3QIUA 3QPXH 5CD3B 3B43A 5ISZB 1P7KB 3EFDH 1JJUA 3GMPA 5EA0H 3VGHA 3F6IA 4KKNA 2CKNA 5D2NA 2VYRE 5C0FA 3D0VB 5MEOB 3C60D 4QRUB 1VFAB 4HT1L 3ZTNH 3BMVA 2AQ2A 1R3JB 3HRZA 1H15A 4LSQL 4Y19D 3VI4F 1G7QA 1UC6A 3EHBD 1IEBA 1FZMA 2XXCB 4OSUH 3R4DA 1VACB 4PRPE 3LZFH 4AIZB 1SHMA 3PJSA 4ZOCA 2E9WA 1QBAA 2WLYA 5DJ8B 1U3HA 3L3DB 1JNNL 1YPZA 4Y1AE 5HHMD 5FXCH 4JRXE 4OZ4A 4RMSA 3GHBH 3SKMA 1MIML 4LVHB 5F3BA 1FNFA 4APQD 2F58L 5FA3A 5IF0A 4JRXA 4ZS6D 3CFJB 2OLDA 2D9CA 3WO4C 3MLUL 2C4XA 2B2XL 5I1CH 1JN6A 5C2UB 5DJ6A 2QKIB 4JREB 1T5WB 4KI5C 1J8HD 3ZMRA 1UXSA 3U7AA 3D2UD 3MQIA 3VXUE 1EEYB 5F3BB 3FAWA 3UBXB 4IRJC 3TBYA 1A6VH 2HVJA 4X5WA 1U3HB 2DKSA 2WM0A 3S4SA 5L0QB 3CFCL 5CJOH 2COQA 2R29H 4YBLB 3BP7A 4UILH 5ANMB 4JZNA 3SKNA 2NPLX 1CIUA 3QYCA 1U8IA 1H15B 1OAQH 5GIRB 3C87A 4JRYE 3BPNB 5TPWL 5CHNB 4LLMA 2M26A 1QRND 1Z0NA 3D0VA 4PJ9A 4UQ3B 5GGSA 5L88L 2Y36L 3VXRD 2EH7L 4S1DC 4LL9A 1NUFA 3MJ8B 4G7YH 1NJ9A 2DICA 3RGHA 3DV4A 2F5AL 3IDIB 5DWUH 4WHTA 2PETA 4HS8L 1Q0XL 1RUAL 1MCPL 2B4CH 4KHXL 1AIFA 2NXZD 3O2DH 4NQDB 3AS2A 4LCYB 3IDMA 3RWFA 2HJLA 1P4LB 3EJZD 2APBA 1GPOL 4LF3B 2OMNA 5E9DD 1FV1A 4EBQL 4GRMB 3BEWA 2BOBB 3CZFB 5KS9A 3O2VL 4GAGH 3QUZC 5IIEA 2GITB 1C12A 1MCLA 5GS0D 3NA9L 5FO9B 2MCPH 2DMBA 2CJUH 4K7FA 1MHCA 1DEDA 1JE6A 3MLXH 3BDBA 5HDQH 1H0DB 4OUOA 5CEZH 1NAMB 5I30H 1ZA6A 3BFOA 1VPOL 5MENB 5EOCJ 1EMTH 3S5LA 4HPOL 4P2OB 4DJMA 2HYMA 2IPTH 4NPYA 1S78C 1F97A 5F7HA 2XN9B 1CXHA 3NFPB 4IHOA 1JGUL 3UTSA 3ZZ1A 1ORSB 4MA3B 4ODHL 3T0EB 3WXWH 1NEZB 4RRPG 4U7KA 5FHBL 2DWEA 3QP3A 1JF5A 2GI7A 4QOKB 2B1HL 3A6BL 4NQUA 5E08H 3QUXB 3FO2B 1HI6A 4TTGA 2IANA 1T4KA 2ADIB 3VJ6A 1DE4A 4DEPC 3MNVA 2Q8AH 5JW4M 5LWYL 1MFEL 4UOJA 1J8HA 2EC8A 1IM3A 3KXFD 1I1FB 1FPTL 4N5UA 4XHJD 4TNVK 3SDDD 3TO4B 4PYHA 4YHNB 4LFHD 4UOW0 3QDMB 3QPQC 2PXYB 4FQXB 1Y0LB 4OF8A 4PYGA 2HT2C 4MJ6B 2NZ9D 3L6FB 4HKJA 4X4MA 3F7QA 3RWGB 4QGTA 3V5HB 2DDQL 2CDFB 3MRQB 2C7UA 4V1DB 1JPFA 4P46C 5TF1H 4CW1B 2XZZA 4TULH 1Z9LA 2AW2A 5ACZB 3L5HA 2I5YH 3LSOB 5IJKC 5ESVB 1NC2A 1TJIL 2VLKE 4QWWD 1HNGA 5HDQL 1JRHL 1RHHA 3DGGB 5MP6H 2OBGA 4RGNB 3STZB 2UZXB 1RFDH 5I74B 3CXHK 3S37X 5T3XL 2A38A 1ZT1B 1MCQA 2FGWL 5SWSE 1UM5L 1NDGA 2M1KA 1AKJA 3ZHDA 3IJSB 3ULVH 3SQBA 3DYOA 5C0RH 4FFWC 2EYTB 1PKQA 3TCXA 5GZNC 4UAOB 3QXTA 3E6FB 5KBNC 2DI7A 1S7QA 9CGTA 3O9WB 2GTWB 4DGYL 3DX7A 1XIWB 4J8RB 1FRGH 1N8ZA 3C09C 3BP6A 5KVDL 3P9MA 4Q9RH 2BK8A 2I07A 5E9DE 3RZCB 3RKDD 1CDIA 3P9MB 4WUUD 3U46A 5LWYH 3B2VL 1ADQL 4M93C 2D03H 1DVFA 1YYMH 1OTSC 2GJ6B 2F54B 3JSSA 4Y4HD 5AAMA 1JGDA 1MOEA 3OX8B 4CADA 1I85C 3GMLA 3E6FA 1FLRH 2FX9H 3P73A 2MHAA 3WJJA 2CKBL 3C5ZA 3IFPA 4PFEA 2EYSB 3LKRA 3AREA 4ZMAT 3D85D 2AGJH 3V6OC 2J6EA 1H3TA 4M48H 4X5XA 3AU1A 4BQ8A 4FQQB 2CIKA 4U1LB 1CICC 4XZUA 4IOIB 4QY8A 1CG9A 5AZEL 5IGXH 3LKQB 3QISA 4JPIB 4XAWL 2IGFL 4BQCA 3NCEB 3VD3A 3L1OL 3S88L 4D9LL 3W9EA 3MRBB 3DTXA 4HXBL 3ZYZA 3ZTJG 4WI6A 1B0RB 4PJ8B 4FXLA 3RWEA 4APQB 4PRHE 2VC2L 5BCAA 1OL0A 2C5DC 2C7UB 5J57B 1JWSB 2N7AA 4TVSa 3T0WA 4PJGB 5FK9A 5CBAA 4MJ6A 3MFFB 2YRPA 4ONFL 4P48A 2D7QA 2KL6A 3WSQH 2H3NA 2OTWB 3QUYA 2QR0A 3BKJL 5AUMB 3S5LG 5F6HJ 4E42B 1KACB 4D0CB 5TDNB 1MI5E 3SOBH 4LOUD 4JDZA 2VDNL 4JFEB 2CSPA 5FM5O 3TYFA 1MJUH 3SKOB 4NFCA 1OAUL 3ARDD 2DWEB 1KN4H 5KZCB 3QCVL 3MUJA 1BIIA 3V8OA 3TVMB 5D2LB 1WAAE 2ERJC 2XN9A 3VD5A 4A6YA 2VWEC 2OZ4L 2G9HA 4M1GL 4EIGB 1UB5A 2DM4A 3TIEB 4ZSOA 4HJ0D 4FABL 5C6PB 4TULL 1EHNA 3NFSH 1H0DA 1ADQH 1T7YA 4N1CA 2Z4QA 3BN9C 4GKSA 3UYRH 4Z5RB 4GAJH 1F3DJ 3X3FL 2D0GA 3GNMH 4L9LA 4LCCC 5JHDE 5F7LB 1UB6B 1VDGA 1HXYB 2DQUH 1F11B 2FHBA 3DBXA 3ZL4H 2YZ8A 1BIIB 4OZGF 4GG6E 3CDYA 5ID0A 1SYVB 3RL1B 1FV1B 5TDPA 1X5AA 2B2XH 2YD7A 3QA3B 4OQ1A 1BVKA 4H1LH 1JYVA 5DJ2A 2QQQA 1J7VR 4KV5E 3DRTB 4HEPG 5MEND 1BZ7B 1PDKA 5JXED 3GHEH 3EOTL 4WFFE 3UTZB 3SJVD 5C0EA 1LEIA 1OGAE 3R8QA 4HH9B 3QUYB 4K3JL 1OP5H 5JO5B 3BPLB 5IROC 5JW5B 1XF2B 4R26L 5KS9F 3RNKA 3TNNB 1NGQH 3NGBC 3MFFA 1JPSH 3V7MA 2Z91A 1KELH 3JVGA 2C3VA 1EAPA 2VISB 3QWOB 5M95B 3I75A 1A0QL 1KGCD 1JYXA 4NRYA 2PW1A 3FL7A 3Q6FB 3DTXB 1K3ZA 2AK4B 3LY6A 4WFHD 3RTQC 5IFHL 2IGFH 4JR9L 1U8QB 1CXFA 5I18H 1YEFH 5F7YC 5IVZA 4YX2H 1C7TA 5I19H 1QSFA 1UXSB 5IQ9B 3OAZH 4O58L 5T1LD 5IV2B 5MEQB 3FCTA 5J1TC 3C5SB 3VD4A 1YECL 1YZZA 4XPHL 5EU3A 5I1JH 4Z95L 3O4LD 4NWTH 3O45B 3VXMB 2DQDH 4K9EH 3GMLB 3CFJA 4H0IA 1FZOB 3IXAA 5IROA 4JG1L 4OZFH 4O2EA 4PG2C 1N6VA 2AS5M 4JFZH 5J11B 3O41B 2EYRA 3H9HB 4GS7C 4JQVC 5CD5D 5E2VL 1U2CA 3LRGA 3FT2A 2IAMA 3NAAL 1QEWB 4OTXL 4R7DA 5EO0B 4DUXA 1TNNA 4ORZC 5T3ZL 1YJDH 4RWYL 4FFYL 4U05A 3IDXL 1LK2A 3U30C 1KTLA 1FZKB 3GMOA 5D2NB 4OFYA 1KELL 2LE9A 3IJSA 1AGEA 4QNPF 3X12A 3MRNB 4QXUH 1P7KA 2G60L 3D18B 5ISZA 5CD3A 5J0BA 5LBSL 2X4OA 4FQCL 2AJUL 2WBJD 2EXWC