1DBBH

Three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Three-dimensional structure of an anti-steroid Fab' and progesterone-Fab' complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1992-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH02
4I0PD 1TQCB 4LPCA 2NXYB 4J3UA 1LEKA 1ZVYA 3HB3C 5GPRA 2B1HH 4GOSA 4PLKC 1B2WL 4BFIB 1L0QA 3RWGB 1RU9L 4JJ5A 5K33A 2FR4A 1RI8A 3SKOA 4P5TA 3BRFA 3DO3A 3PUCA 2R39A 3SY0A 1U3HC 4Y16C 4X5LA 1YEEL 1Q0XL 4D0CB 3SPVB 4Z7QE 3DHJA 4U3CA 2NY6D 1MH5B 2X89A 1XGPA 3P11L 1MI5E 2I26N 2MPAH 1QPXA 2IBBA 4ZDHB 3V4PL 3IDJA 1H8OA 3PJSB 4JREC 2B2XH 2D3VA 1J05B 3MBEB 5I1DA 4R2GD 3DUSA 4OQTA 4ZFGH 4MYWB 4XBGB 3TIDA 4PTUB 3JWDH 4OLYL 1J0HA 3KPLB 1QLFB 4NKOB 4OFVA 3GSNH 2XQBL 4OLUH 2IAMC 4FTVD 5BRZA 1KJMA 1NBVH 4F80A 2UZYB 2BHZA 5EOTB 4ZQKA 5GRYA 2WP3O 2FRGP 4AL8H 5B8CB 3OHXB 3K3QA 4NQUA 5CLTA 1SM3H 4K07A 4IS6A 1EVUA 3MRJB 1QFWL 3BKJL 1XAUA 3GBMH 3GMMA 3QQNA 1EJ6A 4GW1B 3VDCA 4M48L 4ODSH 5CGYC 2DIAA 3K4DA 3O41B 1GCFA 4CADA 1TZIA 4OZFH 1KCKA 1JHTA 1CWVA 2NY1C 3I3BA 1QR4A 3D0LB 4NSKA 4GBXC 2YN5A 3G6AA 4LCIH 1F4XH 1C12A 1OGAA 3W2DL 3ULSA 3V6FA 4CW1B 3H42H 2HLAB 4X9BA 4NCC1 5B38A 3KPPB 4YDIH 1NAKL 1ZS8B 1KCSH 2X4QA 3ULVH 2P46B 1MCQA 1GAFL 1OSZB 3MNWB 2Z31A 1BM3L 2E7CA 1FZKB 1NAMH 4QXUH 3HS0B 3VFNA 3TJHD 1Y18A 1OP3K 1T0MB 3MLXL 3TPKA 4Y16B 3V6OE 5CILL 2NY5L 3L3GA 4JN2B 3QIBD 3KS0H 4LNRB 5IQ7H 3ARTA 1CE1L 3JV4B 4HC1L 4NZJA 1T83A 4U7KA 5I1GL 2DMKA 3ALPA 5F7FA 5ID1A 5F9WC 3U83A 3BDYH 2ZOLB 5CP3H 3LHPH 3Q5YA 5E6YA 4NJ9L 2VXTL 3D2UD 3W9DB 3CD4A 3JXAA 4IRJC 1MHPL 2CLRA 3QIUD 5B4MD 2AXFB 3O9WD 5F6HJ 5D8JH 1OTSD 5SV3A 3UTPE 1XF2B 4NM4L 1U58A 5EU7E 2HT4C 3UBXI 1DQML 2IAMB 1P7QA 2J7LA 4KK5C 4O4YH 1MHEB 4L9LC 4M7LL 4DOHB 4PRBA 3EYUL 2VOTA 1MHCB 4J1UB 3UJIL 5FAAA 2VH5L 5JOFA 1A7OL 3QNXB 3DECA 2JE8A 2FATH 1KJ3H 3VFPA 2XI9A 5DD0L 3TH3T 1EHLH 5I1JL 2JELH 2E7LC 1QACA 3O4LD 4JO3L 4K7PL 3QXDB 4M6NH 2FNBA 3FFDA 1MRFH 3RWHB 3G04B 4B0MM 2NY1B 1FLRL 1DDHB 3GSOB 4GBXB 1I1CA 1I8LC 1C1EH 1WVZA 4GAJH 1V3LA 2H3NB 3BEWB 3CC5B 3ZKND 2EYRB 3KS0J 4BSWA 2A6KA 4PJAA 2XWBA 1AY1L 2VLRE 3D9AL 1QRNB 1KN2L 4NQCA 3H7BB 1OD7A 3KPSE 4OFKA 4ZOEA 3GJFK 5BXFA 3P2TA 3R1GH 4N0UA 4IRSD 2EDWA 4PB0H 4Y5VA 2R1XB 3VG0H 3AMLA 1MY5A 4HPOH 4HWNA 2C7UB 4GG6A 1MCWW 5D93C 4PRNB 4PD4J 1F2QA 5L9DL 4UT7L 4I13B 4HUVB 2ADGB 5DMYA 1IQWH 4S10A 3DV6B 4ETYA 5BS0E 1U8JB 3BSZH 4OGZA 1RHHA 3JV6A 3S34L 5GZOC 3BISA 4LLQA 5DQJA 2C3WA 1LE5B 4G42B 3VGHA 3WN5C 1SBSL 4ONGH 1I1AD 1L7TL 1X4ZA 2M8XA 2GAZA 2H9GB 4J3VA 3TESA 2VAAA 5D2NB 3CVHA 3QQ3B 4JFFE 3FT4A 4U6HB 4QXGL 5DMGD 7FABH 1NCCH 3M17B 1INEH 2G5BB 1LNUB 2IEPA 4IRZH 5E9DB 2ZCLH 1T7ZA 1J5OL 3WEXA 1JJUA 3KG5A 2X10A 4L9LB 4HSQA 5C0BB 1NBYB 1JPTH 5D6DC 3HMXL 3RDTB 5I16B 1UWEL 4XXCC 5KS9E 3GJFB 4UI2A 4JDZB 2OJZL 1SYSA 1FORL 4LCCB 3QA3A 4OD1L 4M5ZL 4G9FE 1ZHBA 4ODTH 2D7OA 4NT6B 3ZO0A 3U6RB 3FB5B 2MSPA 4PJ9C 4PGZA 4XGZA 2BXYA 1F3DH 3F7PC 4ORGB 3KYNA 2GCYA 2Q76A 5K9KB 5D1QA 1FH5L 4CRPA 3FQTB 3PV6A 3ARGA 4MQTB 3FN0L 2KQMA 2X70B 1DVFA 1RUMH 5EU6E 2BHUA 2Q6WB 3DV4B 1H3WM 3QDMB 4U6YA 1CBVH 3H9HB 5DWUH 4X7SL 4LEOA 3QDGE 3REVA 2BRRH 1X5IA 1BLNA 5DJ6B 4J3SA 4K7PY 4XI5D 1IQDB 4NWUL 1VGKA 4OLXH 1AFVH 5K9JH 4O02H 4P46A 4JRXE 4P5KB 5F1KC 4UT6L 1L0YA 4P2RE 1IM9D 1IC1A 5JDSA 3NFSL 3GIVA 5A2KH 5F8QC 2GW5A 2DL2A 4JM2D 3THMH 4DZBB 3NPZB 2AEWA 1NLDH 5GGTA 1JI1A 3ROLB 5D7IE 3LEXB 3ZHKA 3NVQA 2YBRA 2Q8BH 1IAOB 3WN5B 5HHXH 3O8XB 3IFNL 4JY6A 3CMOH 3MRIB 5KSBE 5C9JB 1J1XL 1W0WB 2CDEB 4HIIB 3ZDXF 4MXQD 3MV7A 5A2LH 4HS6A 2NNAA 1P84K 2F5BH 1U36A 4UIKH 2XNAA 3MLTB 4W6XB 5FO9B 5KSUB 1UVQA 2R9HD 5E2VL 1OWWA 1F3DJ 4U1NB 1CE6B 2YXFA 3B43A 3QUYB 2ZCKL 3BXNA 2YZ8A 1KB9J 1U9KA 3M07A 2MQ0A 4L8BB 1FLTX 3I85A 4P2YA 4UAOB 3BO8A 1S7WB 3EJYD 4GMTH 1FIEA 1HXMB 3OR7B 3RQ3A 2DDQH 3MLVH 2ADJB 3QUMB 3IGAA 3LV3A 1UM5H 3RWIA 4Y2DA 3VRLE 1G7HA 1LE9B 1DCLA 4JGJA 2RHEA 3DRQB 3BZ4A 1BQHB 1GHFL 1R6VA 3VFGH 4X8JA 4LQ1A 5F3BA 1SEBB 2DQHH 1RHFA 2VLJB 2AK4E 3KPQB 4JRYA 3TZVA 5I9QB 3PP4H 2ESVA 1GYAA 3HR6A 2B1AH 1MPAL 1IFHL 4JPIB 1NGQL 4PJCF 5F88B 4NKIH 3SJVD 2X1WL 4LSDA 5FIEA 3UYPA 4MJ6B 4LSPL 3G5YA 2BK8A 3BGMA 2YKLL 5JIPA 4NP4H 1I9EA 2BSTB 4I4WB 1TVBB 3RA7L 4QXWA 4GUPB 1PSKH 1AGEA 1F4YH 3VFMA 4NQDA 3B5GA 3HI5H 5J12C 2MNUA 1R3LA 2R2BA 1LO2L 1Z9MA 1LEIB 3CLEH 4L5FL 1MNUH 3S4SA 4MLIA 2WIMA 4ZNCD 4DK3A 3QO1B 4DN4H 4RA0C 1QYGL 3GSXA 4PJ8A 4N8VA 4JJ5B 5FKPA 2FR4B 3SKOB 4I0KA 4P5TB 4PP2A 1OWRM 3SY0B 1CGSH 3HKFA 4PRPA 1X4YA 1QSFE 3QI9B 2VXUH 3QWQB 2XN9E 4LLDA 3FMGL 4FFYL 4UT9H 4PGJA 1XGPB 2AABH 5JPNB 2EDFA 2Y5TA 3KAAA 3WD5H 5IP4A 2DLFL 1SJXA 4WUKH 1YZZA 2MFNA 3IDJB 1T83C 4PJ5D 4YFDB 4QRRE 4ZAKA 4MNQE 3C60A 4BQCA 2NYYC 4X5WA 2VL5A 5I1DB 1MCIA 3DUSB 4TUKH 2AJZA 4GH7B 3TIDB 4A6YB 3T8XA 2VLLA 5TE6H 3T2OA 2HRPH 5JW4Q 1OP3H 3B9EA 1IAMA 3UC0H 4M7LT 5C0DA 1ZLVK 4LKCB 2D4DA 5BRZB 1QVOB 3TBSB 1FL3A 1RZKL 4ZS6C 4HWEH 4ZQKB 3VXUD 1FIGH 5CEYA 2R29H 1QKZL 1CXHA 5HGAA 1PG7H 3SCMA 4FFZL 4AQOA 3AY4A 3HE6B 1QPPA 2VERN 4IRZL 4KDTA 5B21A 3V0VB 3GMMB 4ZFFA 1JF1A 4ZOAA 3LZFH 4M7ZC 3P40A 4XNYH 5BZWA 1DN0A 4MAUL 3Q48A 2VDOH 5AG9A 2LE9A 3EBAA 4CADB 1TZIB 3QAZC 5ECJE 3B9KA 4LPTA 4V1DE 5TE7H 1JHTB 5I1AA 3UO1H 4Y2OA 5FM8A 1JGVH 1FGVL 5DMIL 5DI8A 3D18A 2APWA 2WK2A 3G6AB 1C12B 1OGAB 1FL6B 3K0WA 1CICD 4ODUA 3ULSB 3V6FB 1UQSA 1I3UA 4X7CC 5F3HA 2DD8H 3W5NA 3F6IA 3EIFA 1H5BA 1A9EA 1NANH 2X4QB 5EULV 2QKIA 2Q7NA 2VXQH 3GK8H 3X11A 4NCDA 5C7XL 2Z31B 4XVJL 4U0QB 4HEME 4Y5VC 1IL1A 1Q1JL 3IFLH 4TSCL 5IBTL 4NWTL 3VFNB 4U4BA 4X8XA 3CX5K 3RVVC 1NC4A 4YHNB 1Y18B 4GAFB 2FSEA 4LSQH 3EHBC 4POZC 2WWMC 3TH2T 4FQCL 4JM4L 4OFYD 4O5LH 4YNYA 4AT6B 1JMZA 3L3GB 1GRWA 1D9KD 3OGCA 4M00A 2FD6H 1SQ2N 2YD5A 5I1KL 4DZ8A 4I2XA 4XT1C 3KXFD 5ID1B 5IW1B 1R3KA 2GK0A 1HWGB 4JZJA 4J4PD 4ZO9A 4ODHL 3V7AG 4MJID 12E8H 1A4KA 4PGBA 2C3XA 3PGCA 3GJFH 5F6HI 4P99A 1T4KA 1YEJH 3T77A 3D25A 3EOYG 4XPAH 2CLRB 4QHMA 2ID5A 4FTVE 1EMTH 3K8MA 3QDJD 4QWWD 2BY2A 1NMBH 2EDDA 3K1KC 1DFBH 5A2JH 4QRPD 3FB6A 5KN5A 4Z7WE 5JMOC 4JGUA 3FO9A 1P7QB 4DEPC 1ZLSH 1MIEL 2AVGA 2GITA 25C8H 2ZSVB 4PRBB 1UKSA 2AAVA 4HUNB 2IMMA 1XF1A 1DEEA 4QGYA 3TN0A 5JOFB 1Z5LB 4W4OA 4RX4D 2PYEB 4ONOA 5HYSA 4H25A 4H8WH 4F9PA 3CDGA 5IF0B 1ONQB 2JCCB 3FFDB 2QSCL 4HMDA 5EWIH 2Y9RT 3MOQA 3MREA 4GAYA 1QFHA 3DTXA 5DRZA 2ZUQC 4Q0XL 1BX2A 5D1QC 3WIFB 4APQA 5HJ3A 2DAVA 2NY7L 3OJDB 2APXA 4MSWB 1M4KA 4NN7B 4RFEB 3ARGC 4W6WB 4BSWB 2A6KB 1DVFC 4PJAB 2XWBB 1ED3A 1KN4L 2R0KH 3MRLB 3ZTJG 4NQCB 3SGDH 4L8DA 1IAIL 4E5XA 5BXFB 4N0UB 2UWEF 1FP5A 1BJ1H 1HZHH 3LKQB 4LPWA 4Y5VB 2QR0A 3MODL 1CDCA 3QCTL 4KHTL 3SDDC 1BZ9A 5KSAD 1U8QA 4GG6B 3BN3B 4GRWB 3WJJA 3VI3F 3DWTA 1N0XH 5T3XL 3BZFA 4U6XB 1FGNL 2XT1B 2DJUA 5T33L 4LU5L 3K8KA 5IVXB 1RHHB 1A6UH 3JV6B 4J3OC 2BNRD 2PXYD 4K55A 4XMPL 1JNJA 3BYTA 3MV8D 5JIHA 1I1YA 2VSDA 4GKZB 2YD7A 1MIML 1MFAH 4JVUA 4YE4L 5DUPH 5AYUH 3BP5B 4OZ4A 2VAAB 2VSCA 4JAMA 3CVHB 2CR6A 4P5MB 2FEDD 3LOWA 3MC0A 5F44A 5FDWB 5TFSH 3LQAL 1HI6A 3F5WA 5LCVL 3WEXB 3QUMH 2WM0A 3P77A 1Z9SA 4M61A 1JGLH 2FB4H 1A5FH 1CXIA 3BN9D 4PJFF 1JZ8A 5D5MF 4XNMA 2YA2A 3CXDH 5AWNH 2B4CC 5C0AD 2CJUH 3O4LE 4UV7L 3WHXA 2QSVA 5IV2A 2X41A 3SKMA 1SYSB 5BV7C 3OF6A 4P23B 3BPLC 3GIZH 3C08H 1AKJA 1ZHBB 3VI4E 4RMVA 4UT9L 1FV1A 4EI5D 5F89B 3HCVA 1MCDA 1CXFA 1URLA 3QFDA 4N8CH 4XGZB 3VWKC 4Y2DC 2EIBA 5KVEL 2XZCH 3HPLA 3KYNB 2AQ1A 2GCYB 2Q76B 2ZUQB 4U2ZA 4WCYL 1RAMA 1HYSC 5IM7A 3N1QC 3RVWD 3V95A 3NFNB 3MLRH 3L3OA 2R2EB 3QG7L 1DVFB 4JKPH 4U6YB 3TZVC 5E2UH 1LD9A 5GS0L 2ADIB 5IFAH 5E8OA 1BLNB 1AE6H 5L7XH 1IGIL 2FEEL 1VGKB 4N90D 4P46B 4X9GA 1NCWH 5TQ0L 3MOAL 5FHBH 1NCAL 2VKWA 3P0GB 5JDSB 3GIVB 2MOVA 4PGDB 1NQBA 4WJ5A 3ZDYF 2BNQE 5T1KD 1NGXA 4BZ1H 2H2SC 1WSST 4UQ3A 3C6LA 2YBRB 2CRZA 4MB4A 3W39B 1MWAA 4MA1C 4JY6B 2YPKB 5L88L 3WS6A 3FAWA 3QNZA 4HT1H 1DP0A 4KGLA 2J8UE 1FNFA 4Y5YA 3WLWC 4PJ8C 4S1RH 2DKUA 5IROC 3LN4A 2NNAB 2GSGB 2YS4A 4OQTH 2XNAB 4A6YH 3U0PA 2DIJA 4JHAH 4QY8B 1UVQB 1T2QL 4E0RA 3TO4D 1LP9E 5IMMA 4KI5F 4PLJD 4JY5H 4XNQB 5DJ0A 5CIPB 3QXAA 1G1YA 4PJEE 4HEPG 4ZAKC 5C9KA 2Y36H 4CJ1A 5C2BL 1X5KA 3O6ML 3BPLB 3C60C 3BO8B 3T1FB 3B9AA 1A6ZB 1JHKH 2PN5A 4LF3A 1QSED 5ETUA 1RSFA 1QBLL 3BMVA 3K74B 3KR3H 4HPYH 2ENYA 2EXWC 3IGAB 5HYJB 3LV3B 2NY2D 3RWIB 1G7HB 3U0WL 1KCUL 3P73A 2VNCA 4F58H 4X83A 2HLFC 4CBPA 5LQBL 4X8JB 5F3BB 1MAML 1VGEH 3HPJA 3U7WH 3DVNB 4JRYB 3TZVB 3SCMC 5DEFA 4DW2L 3O45A 4JN1L 1U8HA 3HC3L 4KDTC 4JB9H 3FQRA 5FUCE 4OGYL 4NQED 3IU3B 1A6PA 1EEZA 3G5YB 3BGMB 3I50L 3H3PH 1KC5H 3B9KC 4E9LA 1MI5A 5F1OB 4RMRA 1U8PA 4NOBA 4Z77A 4Q9QL 1ULVA 2JKXA 1OAYL 2YPVH 5I8OH 1AGEB 4LSUH 4Z7UE 1VPOH 4NQDB 3V0AC 4YX2H 4HKXA 4MA1B 1R3LB 2R2BB 2A9ML 3RNKA 1H5BC 1R3JA 1MRDH 1DL7H 1KIUA 1OB1A 3K81A 5HI5C 3S4SB 3ME0A 4L4VA 2OMBA 5HI4C 2GEEA 5IHBA 4DJMA 2BY1A 3BPOC 4PP2B 5E4EC 3S88H 1BEYH 3QQ9D 3RL2A 4PRPB 4GW4A 3WSQL 1OAZH 2EDYA 4WI4A 3LKOA 1CI5A 4K9EL 4M6OL 2Y5TB 4PJDF 1FNHA 1BIIA 1C7TA 4K94L 5F6IC 4NUJB 3T2NH 2IBGA 4KRMB 2OBGA 4PREA 4U1KA 4JZJC 4M6ML 1OPGL 1YEGL 1YYLH 4RMSA 3ZMRA 3C60B 4JR9H 2Q86A 2FH6A 1G7MB 2VL5B 3LMJH 2E6QA 4FNLL 3MLUH 1ZSDB 2AJZB 2WUBH 3T8XB 2VLLB 3WFEL 5EA0L 1MCKA 5FCUL 4ZD3H 1YQVH 4NFBA 4QF1B 3AS0A 3PGDA 4HK0A 3RVTD 3ZKQD 4FG6D 4XVTL 4PRHD 3NAAL 2ZCHH 1IGFH 1NKRA 1FL3B 5B39B 5CEYB 1BFOA 3SJVE 3INUL 5HGAB 4K3DL 3SCMB 1EO8H 3TN0C 3H8NA 4W4OC 3FFCD 3CFCL 4H5SB 3HZYA 1AHWA 1UYWH 3AREC 4Z6AT 1IGYA 4ZFFB 1JF1B 4GFTB 5J1SC 1DN0B 4F9PC 4M4PA 8CGTA 3X3FL 1YMHB 1YEKL 2HAZA 4M8VA 2P8LB 5ERWA 5I1HH 3B9KB 5MERA 4IJ3C 1B90A 5I1AB 3BPNB 5ICYA 3D3VA 5DI8B 4GRWH 2OP4L 3B5HA 5JHLH 4APQC 3NH7L 4ODUB 3QEHB 1UQSB 5F3HB 3H9ZA 4G8EA 4C4KT 3LSOA 3OAUL 4HH9A 5L2KD 4LLYB 1H5BB 3DGCR 1A9EB 1QZ1A 4ONFL 4PBXA 3G6DL 2NW2B 2ICES 5T1DH 4GSDH 5ALCL 3PQYA 4DGYH 1MCOL 3DARA 3EO0B 1FAIH 1IL1B 4IMKA 5JIKA 3DSFL 4OCWH 4I3SL 1NC4B 1NGPL 4HJGA 5E4EB 2FSEB 4EUPB 3WJJC 1N59A 3CVHH 2GFBB 3VDAA 4MXWL 4PJ5E 2X2YA 5D1XD 3OGCB 1ZWIA 4WWKD 3UMTA 3GO1H 4UNUA 2PO6D 2XKUA 2J88L 5F6IB 1R3KB 2GK0B 1S3KL 2XIDA 1U6AL 5E5MB 4PGBB 4P4KA 5J6HA 4NZUH 3PGCB 3D6GA 3ZT7A 1IEAA 3V4UH 2EE6A 3T77B 1TZGL 2XZAL 3D25B 4ZO8A 4QXTA 2BJMH 3QZWB 5I76A 3VXUE 5JR1L 2WLYA 4NQVB 3U9PH 4F37K 1NEUA 5I1IH 3FB6B 4HFUH 3FO9B 2UZIL 3TBTA 4I3GA 2GITB 1O7SA 3KPSA 2R4RH 5FOJA 3QHFL 3LKRA 4XP6H 1C5CL 5T5NG 5KJRL 4X98A 1DEEB 1OHQA 3TN0B 3PWPB 3O2WH 1YEFL 2ZWLT 5DGQA 2JIXD 3B2UC 5FHAH 5HYSB 4H25B 3L1OL 4FQ1H 4LQFH 2R4SL 4LL9A 2R56H 4UU9B 3CDGB 4EVNA 5C09A 4D9LL 1PD6A 4AIXA 4NO5A 1KEMH 5BS0A 4MAYA 5EC2A 4GAYB 3VXOA 1JCKA 1AO7A 1BX2B 1N5YH 1HOCB 2Y07L 2SEBB 4IDJH 4EEEA 4FQIL 3BWAA 3IFPA 3KHQA 1T5XA 4E5XB 3MUGA 1GPOL 2XQYG 3PDOB 4RGMC 4Y19D 4JDTL 2QR0B 3N1GC 3RIAK 3L5XH 3D85A 1BZ9B 2O5YL 3QSKB 1EGJL 2AXHA 3O6LH 1UJTA 1RJZB 5TDOA 1YUHB 1FYTA 3U79A 5K9QI 5MEQB 3KXFE 4JRWA 4KQ3H 5KS9A 1WICA 3S98A 5ALBH 2F54B 5I1CL 1UWGH 3MFGB 4MJIE 3NIFE 4TOYH 3ABZA 2VQTA 5HGBA 4F7EB 5FGSA 2R23A 1CL7I 1RFDH 1X6NA 1I1YB 5FYLH 3GUTA 1P2CA 5T3XD 1FFNA 2YSSA 3C6LC 3DVIA 4P57A 4FXGB 3QDJE 1WITA 5CIPH 43CAA 4OZ4B 1MRCH 4QRPE 1WZKA 4BYHA 3WS6C 5L2JA 4JAMB 5DDHA 1JE6A 5EBLA 3O6FD 4Y5YC 7CGTA 3LEYH 2D03L 4LSUL 5HHNA 1A4JB 4AG4H 3TFKD 1HI6B 3F5WB 1JWUA 3TT1H 3VXRD 4M61B 5ITBL 2CPCA 3QDGA 4Z76A 3DX8A 2NXZC 4XNMB 1O0VA 3RAJL 3UZQA 3CFKA 5CEZH 1IGMH 3SGDI 3OQ3B 1YEDA 3WHXB 4YHML 5IV2B 4JRXA 3SKMB 4KI1A 5C08D 2C1PA 3AROA 2OK0H 4P2RA 5DHVA 1AKJB 3JWOH 5IMOA 5CAYB 1FV1B 4HXAL 3FO0H 3RKDD 4ACPA 3HCVB 4WEBL 4TTDC 4KKAC 4EDWH 2X42A 3HPLB 5D7IA 3SQBA 1HIMH 4G6FB 3IVKA 3GMOB 4GXUM 1K5NB 2OQJA 3EDEA 5C8JA 5KSBA 2JK5B 2XWTA 1A1OA 1G6RL 3L3OB 1IE5A 3NZ8A 4NRXA 3LB6C 1QP1A 4PJHF 2IG2L 3ZDXE 3GRWA 2IQAA 1B6UA 2R0WL 4HLZG 4QOKD 4PJBF 3N9GH 4LEXL 5ID0A 2C4FT 4HF5L 2EDTA 5CBAA 2BNRE 5F1SA 5IMKA 3MV8E 5I15H 4XAWH 1FAKT 5FYKL 1K8IB 4WJ5B 4MCZA 2GJ6D 5F71A 3C6LB 1MWAB 4RISH 3WDIA 3PDDA 2ORBL 2X4SA 3NIGF 1IBGL 4CVZB 4PP1D 2ZJSH 3RTQD 5E6ZA 4O58H 5IB3B 2Z93A 3C09C 4AQ1B 2XG5A 4X0KB 3QIWA 1SY6L 5EUKA 1Q0YL 5CD5C 1GJIA 3MRRB 3U0PB 5C0AE 3OXRA 5H35A 4YXLH 4E0RB 4IOFD 5DJ0B 2NXZB 1U3JA 3QXAB 4PJCE 4HUXB 3V0WH 4FQJH 1U8MB 1KCVL 3WIIL 4HWBL 1WAAA 4F7CA 4IOIA 3QFJD 4G6AC 4DGVH 4EXKA 4LF3B 5ETUB 2CD0A 2VXVH 1G9EA 4PTTA 4Z8FH 3CPLA 1KEGH 4JG0L 2EE2A 4G8IA 4RAVA 3P73B 1ZLWK 1G7LA 3N1MC 3ALXA 4UB0L 3HPJB 5DS8A 1NCNA 3HNSH 1RIUH 1RV6X 2P8MB 4N90E 2RAMA 3CDFA 4HJ0D 1CT8B 1KELH 4K8RH 5DEFB 3TBWA 1AHWC 3FQRB 2CRMA 1QBBA 4G6KH 4FXKA 5DQDL 2PKDA 5E94A 2Y6SC 1EEZB 3ARFD 2BOCA 2XN9A 2VZUA 3QXUA 1MI5B 4RGNC 4U1HA 1AH1A 2VLMD 1BVKA 1EAJA 1U8PB 4QRRA 1SJEA 5CCKH 4EUPH 3QCUH 4Z77B 4Y4HD 4PJ7A 1XGRA 4MNQA 2QJDA 3DO7B 1OD9A 4OV5B 3CSYA 2DQGH 3LRSA 3RNKB 4AYFA 2UY6A 1R3JB 1OB1B 1EBAA 3BZDA 3CAFA 2YK1H 4PB9L 3I9GL 4XTRD 3VCLB 1IAKA 4IMKC 1IGTB 3BWUC 4IDJL 1N2RB 5DJ8A 1CK0L 1GC1L 5HI3D 1K8DA 2NY3C 5C6TL 1P4LA 4HKBB 1CR9H 2HMIC 3UYOD 1OAUL 1F5WA 4G7VH 4LHUG 4FZEH 4GW4B 5IT2L 2CIKB 3ZDZF 2R0LH 4Y5XA 5IW6A 3P4MA 1BIIB 1WTGT 1YEHL 1QSEE 2XPGA 4K3GA 5F7YC 3PHOB 5E6IA 4U1KB 4C56D 4XP9L 1UACH 1H9VA 4K2UH 2DTMH 3MACL 4P4KC 5AAMA 2Q86B 3MJ9L 1OARL 1EZVX 1YQ2A 2X4UB 1IM3A 1C5DA 4PUBH 5DD1H 3TBVA 3GMLA 4U7MA 1ZE3C 3CH1A 2EKSB 3PGDB 4AEIL 4M7JL 3A6BH 3I75A 4HK3J 3IXTA 1CFTA 2YPLA 1XCTA 4OCSL 3L9RA 3BKYH 1BFOB 3U4AA 2F58L 1PYWA 3C8HA 1C08A 2Z35A 5JQHC 1WQVT 2XTJD 1JZ5A 3HZYB 1AHWB 1K4DA 4GQ9L 4D0BA 1AXTL 5GS2D 5I8EA 4K3HA 1FO0A 5DMKA 8FABA 1BREA 2EZ0C 5MERB 3QRGL 1KPRB 4RGNB 5JDJA 5ICYB 5IHLB 1SHMA 3D3VB 4MNHB 3ARSA 2QADC 1KLFA 1JF5A 3VGFA 2WBWB 4KRPD 4M5YL 5GGRY 4XXDA 4QHNA 1JNLH 3MNZB 4G8EB 4HH9B 3QPQC 3FO0L 1IKNA 4FTVA 2B0SL 4NO0A 5I71C 1U3ZA 3H3BC 1F42A 1MJJB 3PQYB 2AERT 4N0YL 4Z7WA 3Q1SH 4Z5RB 3HTLX 5DR5L 4HJGB 2NY3B 5C0JA 1J87A 4P9MH 1N59B 3HHRB 2QSTA 1KIPA 1ZWIB 3GSQA 4W68A 4Z7VF 2WLZA 2W0LA 3F6LA 2VLKA 3CCHB 3NCEB 3OPZL 3BW9A 1R5WA 2IBZX 4CGTA 5DT1H 1RVFL 4KVNH 1RZ7L 3BD5A 4RZCA 2DMCA 5J6HB 4R7NB 2WUCL 4YHZH 1IEAB 2C3GA 5F96H 3AGVA 5C0RL 3I3DA 3MRPA 1FC1A 1WIPA 4PRHE 1NUNB 2ADFH 4JFXA 4QXTB 3ZE0F 4I18B 4HK3N 2P5WA 3BP7A 5I76B 2YXMA 5KVFL 5EC1B 3PL6D 1HQ4A 3JSSA 2E9IA 4OIAA 2WWKT 3TBTB 2UVFA 4U1IA 4W6YB 3KPNB 3FFCE 1D7FA 1KSRA 4G6JH 1BIHA 3KPSB 1A7RH 2WIIB 4DVRH 3U4BL 3BQUB 2UWEE 3MRMA 1KENH 1D6VL 2M2DA 5FOBA 1E4XH 5A43C 1DQDH 3PNWA 3I2CL 2CLVA 5F7EL 2EO9A 4JCMA 3VI3E 1RURH 2E6JA 5C09B 5TJWK 1YECH 3JBG7 4DKEH 5BS0B 4MAYB 5HYQA 3V7MA 3I3EA 1I9JH 3WYRA 1BF2A 3FO1B 1G6VK 1ZTXH 2XY1A 3HNTL 3VXOB 3P30L 4I77L 1AO7B 2EKJA 2QADB 4MA8L 3UPAA 3QIUA 3QEGH 5L2KE 1UG9A 4HCRL 4UILL 2EDKA 4PLNC 5ACZA 1IT9H 2XICA 3VW3H 3BWAB 1G9NL 4OFPA 4PYHA 1ZGLP 1T5XB 1YYMH 4ZFOL 5LBSL 3MUGB 3NN8A 1MWAH 3W11C 2CUMA 4KV5F 3D85B 4FRWA 1C7SA 5JA9A 2DBLH 5TDOB 3E3QE 5GGVL 3FZUD 3CVIL 5KS9B 4OZFG 2XACC 1NL0H 5D5ME 1CDYA 2PW1A 2A6IA 4M4RA 3RX7A 1EPFA 5HGBB 3BUYA 4HBCH 2R23B 6CGTA 4LFHD 3GUTB 3HZVA 2YSSB 4KZDL 1S9YA 4MDIA 1T22A 3CXHJ 1RZGB 1T80A 1P53A 3PG2A 43CAB 3TNMA 1YNKH 5BVPH 4XAKD 4OQ1A 5DDHB 4HW6A 5EBLB 4FQQA 2AJVL 5DRXA 1FPTL 5HHNB 2H1PL 2VUYA 1QO3A 4IRSA 1F3JA 5JUEL 5FGRA 1JWUB 5J11C 5I19L 3AMKA 3QDGB 4GG8A 2UV3A 4Z76B 2L0DA 3DX8B 4XCFH 3CFKB 2CMRL 3MCKB 2CLZB 4UDTB 3I6GA 1YEDB 3K4AA 2MKWA 1WCQA 2V2XA 1G9MC 2DQIH 3IJYB 4JRXB 2C1PB 2FLBT 4YXHH 4P2RB 2DBJA 1IGCL 3VXMD 4PJIE 3DX7A 1AC6A 4HXBL 2BNQA 3VGEA 5EFIA 1RZ8A 4WW1A 5D7IB 3O3UN 2YD2A 5ITFA 2O26U 3EYQC 3I84A 1MJUH 3QXVA 3IVKB 1X44A 2IALA 3IU4H 4YR6A 2OQJB 1J88A 5C8JB 1MJ7L 1WIUA 1IC4H 2I5YH 2VDKH 2XWTB 1A1OB 4Y19E 5KSBB 3ULVF 3NZ8B 2KUTA 3MXWH 4NRXB 2V7NB 3V52L 5I30L 4XCEA 2BXZA 4U1JA 1VEMA 4X6BA 3E0GA 2IQAB 2BVPA 1S7TA 2DB8A 2FO1A 4CNIA 4XPGH 1B4JH 1RUQH 2OJEA 5DVOA 5ID0B 1PGRB 1LP9A 2HP4A 3D39D 1A47A 1J0IA 4OF0A 3GMNB 5C3TA 5IMKB 4ALAH 5T3XE 4PJEA 1ZLWH 3UJTL 2DJ4A 4MCZB 4WO4D 3VGBA 5FYJL 3WKMH 2HT3C 1NFDA 4MB5A 4HKJA 5DA0B 3VD5A 3DUHA 3MOBL 4NRZA 4OKDA 1FCGA 1P4IH 2YWZA 5FYKD 2X4SB 1F90H 3HE7A 1E4WL 2BOBA 5CJOL 5D7JA 5HDBF 4QO1A 3VXRE 5GGVY 4OV6F 3QIWB 5E99L 5KW9H 3G6JF 4YO0A 2AK4B 2Y7QA 3CNKA 2NY0C 3OXRB 4LK4A 4RGOH 2WW8A 4ELMF 1IGJA 2A9NL 4M1GH 4Y5XC 3NCBB 1S78C 5C08E 4KTYA 4FQLH 5J06A 5EUOA 5EG6C 1DLHA 5E6IC 4JM2A 4O9HH 4EOWL 1MFCL 2D0HA 4XPHL 4G6ML 4IOIB 4KUCF 3TH4T 1HXYA 4PTTB 1S8DA 2JJSA 4Q7DA 4POUB 5E00A 4G8IB 4Z7UA 3MRDA 1G7LB 1I7TA 4DGIL 4NBZB 3TNNB 4HH8A 3MV9A 4JFHD 4DQOH 4UOW0 1JFQL 5DK0B 1AR1C 1XF3A 1PG7X 4HQQH 5DS8B 2CRYA 4L4TD 1WWCA 4QCIA 4QOKE 4CN4A 1P6FA 5DFTA 2VXSL 4GQPH 3LPWA 2IGFH 5DUMH 4L3ED 1DBBL 4FXKB 1RIHH 5C0CD 2JJWA 4Z7NE 5E94B 3VA6A 1VEOA 4AIZA 1QSFB 2BOCB 2IPTH 2BVEA 2XN9B 2YMXL 4RWYL 3K4ZA 2GJ6E 1WJ3A 1M7XA 3VRJA 4YDKH 4PJDE 4U1HB 1A2YA 2VZTA 5JQ6L 4QRRB 2VZSA 3LN5A 3GSRB 5I66A 2PYFA 2AKRA 2YD3A 2FIRT 1XGRB 4MNQB 4PG2C 3S35X 3FQUA 2I60H 5F9OL 3CSYB 4XWOC 3LRSB 4HV8A 1IKNC 1ZV5A 2A74B 4PJGF 4DWHA 2W0PA 1FFQA 5BOPA 3ORJA 5EZOL 1N6QH 1IAKB 5IR1A 1H15B 1NMAH 1YDPA 4D3CH 3P9WB 4YWGH 1N8ZA 1HINL 1K8DB 2EEDA 4L1HA 5EOCJ 1P4LB 3S37X 3Q2CA 2GJZA 4KJQD 4KKBC 3SJVA 1U93A 1HWHB 5FM5O 1E0OB 4HUMB 2R8SL 3UAJC 5DGRA 4BH8B 5IW6B 3QFJE 3P4MB 4P2QA 2XPGB 4MMXC 3H9SA 1P5UA 5CZVH 1GGUA 5E6IB 5GZNC 1MF2L 2CGRL 1YJDL 3ARBC 3RVUD 1A7NL 4QHUA 3ZYIA 4I0PB 2YRZA 3MZTA 3EJZC 5J3HC 1C5DB 1V7NL 3TBVB 3GMLB 4EDXA 2NZ9D 4OM1H 3P0YH 3QG6A 3ARQA 3I75B 1Q9KA 1OL0A 1CFTB 4I5BB 4KPHH 4MD0A 2DQFA 1XCTB 4DCQB 4U1MA 4WTZA 2BNUA 3TC9A 2IQ9H 2HJLA 1C08B 1T20A 5D2LE 1TLKA 4XZUB 1WFTA 3T0EE 4D0BB 1FNGA 4MQ7A 2P42B 1QHPA 4MS8D 1CFVL 2VLME 4PJ5A 4XPTH 1FO0B 8FABB 4X7EC 1RZIA 2ATPB 3JUZA 4KJPD 3HUJE 4G3YH 4KK9C 4R2GB 4HAGA 4YBLC 5IK3A 4DTGL 1A6TA 2QQLH 3QIUC 5B4MC 4R4BA 2XFXA 1OTSC 3TYFA 3QDHA 4KAQH 4XXDB 4QHNB 3MJ7A 1WUNT 2X6MA 3QUXD 4OM0H 1CXKA 4FTVB 1JN6A 4ZSOA 5DO2D 5FXCH 1RZFH 4KJWC 4JPWH 4JVWA 1C16B 3K2UL 5JHDE 4Z7WB 3QUZD 2YC1A 5EOQL 4JFYB 1Z3GL 1OQOA 3F7YA 3O11A 4KGJA 1FFPA 5C0JB 3MCLH 1F58H 3CSBA 3WFDH 1RK0A 4Q58C 4KKLD 4C56E 1KTKE 3GDBA 2WSKA 3PWVB 4CUCA 3BW9B 3FOLA 3E2HB 4D9QE 1JRHH 2PCPA 4NYLA 4KWUA 2CR3A 2P5ED 1CU4H 1I7UA 3UEZA 1EXUB 3IDGA 3ZKNC 1QSVA 4W4NA 3MRPB 4U49A 3P0VL 3EFDL 5I74B 4JPVH 4YDLC 2P5WB 3BP7B 1TJGL 3S35L 1IRAY 1RULH 1UKTA 1IKFH 3IKCA 4F8QA 4NJAH 4U1IB 1A7QL 1QFUH 2XTJE 2KBGA 2IADA 3PXJA 1G0YR 4OUOA 1D9KA 3DNKA 5LWYL 5IG7A 4YXKH 4CN6A 3PNWB 3S37L 1S7VA 1OY3B 2CLVB 2COQA 2VC2H 1I7ZA 2GY5A 2P48B 4IIQB 3NGBB 3BRDA 3BZEA 3GRWH 2VB5A 4LGPB 5HYQB 4GT7A 3D2UB 4U3XA 1FRGL 2VDPH 3QIUB 4RMQA 4KMQA 3QDJA 1K2DA 4LHUA 2LVCA 2EH7H 2LTQC 1AXSB 4OF6A 3MLWH 2VKXA 4ZUWB 4OFIA 2ZSWA 4OJFL 5LGJA 1YC7A 3MX0A 2DQCH 4FQXA 3A6OA 1BQSA 3CDYA 2JF1A 1FZJA 4Z7OF 5FF6A 2NX5A 5IWLA 4AZ8A 1CL7L 4X6EA 4QNPE 1JHLH 3O3AA 1JV5A 2AEQH 2A6DB 4KUZH 2K7PA 1NMCB 2A6IB 5BVJA 2HG5B 5EZIL 4HGKC 3BUYB 5F9JA 3NTCL 5JW3L 4Z9KB 3EOBA 3HZVB 1CDBA 5HGGS 1CGVA 2DWDA 1JP5A 1T22B 1H3VA 2W9DH 3DX9B 4NC1E 2FHFA 2ZP0T 3TNMB 3HE7C 4P2OD 3RP1A 1MLCA 2DQUL 2QBWA 1MCLA 2HN7A 5D7JC 2YEZA 4KUCD 4FQQB 4YDLB 4OLZL 1GOHA 1NDMA 4X6DA 4IRSB 1F3JB 3F58L 1A1NB 1JGDA 1TFHA 4XMKL 5J1AA 1PX3A 4NRYB 4WFED 5KSAA 3WIHA 3O2VH 4DFIA 1BD2D 4GG8B 3RFZC 1LK3H 1N7ML 1IZKA 1KT2A 3MRBB 1XEDA 2RFXB 5FUCC 3L7FB 4ODVL 5FUOH 2AV1A 2V2XB 4JM2C 1ACZA 5C07D 1GIGH 1LO0H 3QEQD 4PJBE 2HKHL 4EIGB 1N6VA 3MV8A 5FB8A 3SE4A 2VQUA 2PTTA 4Q9CA 4FS0A 3ZE2F 1X5HA 3DX7B 3FT2A 2BNQB 5EFIB 3I02A 5IVZA 1I1AB 1RZ8B 5GGSY 1G7QA 3MA9L 1WLHA 3SE9L 1T2JA 3HN3A 3PABA 2IALB 4MXQC 4YR6B 2LTQB 2RGSA 4LBEA 5HHOD 2YD6A 3TO2A 4R4FL 5ESQA 1TJHL 3QUKB 4JO2L 5BQ7B 4RMWA 4XMLL 4XCEB 1MFBL 2J8UB 2E5EA 4X6BB 4N5UA 1MFEH 2W0KA 1A3RH 1MQKL 3GSVA 5JOPD 1S7TB 5IB4B 1YPZE 4CNIB 5BO1H 5IJVA 5C0AA 3WXVH 2OJEB 5E8NA 2DRUA 2P24A 3CZJA 1LP9B 3MGTA 3T4AB 2XQYK 3PV7A 3EJYC 3HMXA 3V5DB 2GI7A 4XCCH 5IESH 4XPBH 4PJEB 5TE4H 3WO4C 3TA3D 2D0GA 2EDXA 3R06A 4EI5A 1N26A 5GISH 4PBVC 3L7EA 4KH2A 3B6SA 4XAKE 4HKJB 4PJXE 4IHOB 4F3FA 3C5ZD 4HWUA 4X4ZA 4GAGH 2BOBB 5D7JB 2XRAH 5FYJD 4FABH 4KMTL 1INDH 1UJ3A 3WNMA 2QSQA 2Y7QB 3MXVL 4UMGA 3O81A 4MZ2A 1IGJB 4JFPA 4YQXH 4IEFB 1CLYL 5BW7C 5DFVD 1DR9A 2IH1A 1IM9B 5E08H 4YPGA 5EUOB 3VXME 3ZE1E 3IDXH 2IFFL 5C0FA 2WV3A 4JM2B 1NH6A 4OFDA 3IAPA 2W0FB 5D1ZC 4MXVF 2NXYD 4HFWA 1HXYB 2X40A 2OL3L 3C6SA 1F6AB 4NN5C 1S8DB 4JHWH 3WXWL 5E5RB 2Q7YA 5E00B 4DK6A 4WHDA 3WNPA 4Z7UB 4HMEA 2H2PD 3S5LG 1ZMYA 3DXAD 5EN2A 4NGHH 1FO0H 2MKLC 3U1SH 4F57H 4FFVD 3TJEL 4LSTH 3MV9B 5CJXA 4UDUB 1QBAA 3MQIA 4MA3B 5ELIA 5GRZA 3BHBA 3MA7A 3QJHB 3U7YH 3TWCL 4QCIB 4NHUB 4R4NC 3TEUA 1DSFH 3TO4A 4LOUD 3D39E 4P3CH 5GHWL 3OXSB 3VWJD 5FA3B 1JYNA 4RFNB 4X80L 1FDLH 4K3JH 3MLSH 2G60L 5IEHA 1X9QA 3SO3C 3VRJB 4L3AA 4ZMAT 2OZ4L 1ES0A 5T3ZL 3LN5B 5ACLA 5FYKE 5D72L 5I66B 2PYFB 2AKRB 1DUYA 1RMFL 3EYVA 4J7RA 5LJYH 3FQUB 4NZTH 4OB5H 1LK2A 4XX1E 1I8IB 4HV8B 1ZT1A 1W8OA 3MLZH 4OLWH 4G9DB 1L9NA 3VXSD 5IR1B 4Q9RH 4OTXL 1XGTA 4A2LA 3ARRA 3BP4A 2AEPH 3ARDA 4GRLA 2EYSA 4LVNC 5I1LA 3NA9H 2GJZB 3SJVB 1U93B 3OKEA 4JJHA 1QNZH 3V6ZA 1AJ7H 2DF3A 5E95B 1AI1L 2Q3ZA 3N85L 4P2QB 5DJDA 2EDRA 2ZG2A 5JXAH 1WBYA 3H9SB 3WFCH 2WAHA 3G6JA 4LIQL 4L8CB 4RAHA 2FX9L 5LAXA 1UH3A 2ZOKB 3HB3D 1E4JA 2D7MA 4QHUB 1U42A 4LLUB 4BSVB 2R69L 4JFHE 4JHBA 4S1QL 3GNMH 1CDIA 1T1YA 4EDXB 5L8JB 1MLBA 5AZ2L 5E2TL 1DBAL 3QG6B 2BSSA 4L4TE 4DUVA 1U3HD 2CO7B 1TVHA 4Y16D 4MD0B 5H2BB 3HC4H 1CIUA 1NCDH 2ZKHH 5EDXA 4R90H 4U1MB 4L3EE 1B9ZA 2BNUB 5C0CE 5C92A 1SJVA 4LRIA 2HJLB 2HJKA 1NSNL 4KRNA 1D9KC 2B8OT 2XXMB 1A6WL 3OR6A 5HGDA 4JFDD 3P9LA 5IJKA 4M3KB 1XGYL 4JO4H 4PJ5B 2EH8L 3SE3A 1D5XB 1H0DA 1IC5H 5FO8B 1RZIB 4OT1L 1J10A 2N7AA 3SO3B 3MLYL 1OGTB 2BFVH 5CZXC 5TF1H 5IK3B 1EH9A 3KGRA 4LLMA 1F00I 2FJFA 1EEYB 2XFXB 3GSWA 3O6KL 4R4BB 2IAMD 4QWWC 3TYFB 1KTRL 5FEBA 3MJ7B 3WFBL 4PRHA 1H8SA 3ARUA 1A0QH 2CQVA 5LGKA 3ZE0E 5TPWL 3VXUB 3UPRA 2JB5L 3LS5H 4FQXC 1UFUA 4ZFZA 2BRQA 2YC1B 2A2QT 5T1MA 5CGYD 5IWLC 1AR2A 3UTSD 3IKKA 4JFEA 3O11B 1FFPB 3FFCA 3RVXC 4OLVL 2BDNH 1N64H 5LGHH 2AJUH 1A6VH 3LH2H 4WHTA 1RK0B 2NCMA 4R96B 2BVOA 4GBXD 2GK2A 4O2FA 3FOLB 1HEZB 4GW5A 1T03H 3WHE0 1N3NB 1OTTC 3GHEH 3KJ4B 2QHRL 1QRND 3IDGB 1WCBA 4HX1B 1KLGB 2VQ1B 4KRLB 1JYWA 4ZTOH 4I0CC 3OL2A 2AJXL 2V2WA 3SKJH 4S11A 4CMMA 1L7IL 5I8CA 5D7KD 2F53D 5TF0A 4N9OB 3TCXA 6FABH 1UA6L 2ED7A 5DZNA 5KSAC 3NFPA 3IFOB 1TQBC 1MJ8L 1WK0A 4BFEA 1CZ8H 1P5VA 5IHUH 3MJGX 1D9KB 1D6EA 4P9HL 5IG7B 1CLZH 4XWGH 5DJZB 2D9CA 1JTTA 1S7VB 2PO6A 4B50A 1G0XA 1DQLH 1GGIL 1I7ZB 1ZANH 1PZUB 3KXFB 3SE4C 3BZEB 1YNLL 5DC9B 4IRJD 1QLRA 2FZ3B 4M9PA 3KPRD 1AIFA 4YFLI 1MVFA 5A1AA 3H9YA 5KVDL 4TSAH 1BBJA 2HT4D 3QDJB 4KK5D 1K2DB 3VRIA 4JQVA 5E8DL 3FN3A 4QRPB 5C0BD 5GXBB 1JRHI 1OW0A 3ZT5A 5LGJB 1NPUA 2YUVA 1FHGA 1TZHA 4TRPH 3SPVA 1FZJB 2NX5B 4X6EB 2K9UA 2UUDK 3TT3H 1LVEA 3O3AB 2W9EL 3O2DL 5I18H 4UINH 4J6RH 5K93A 1AQDA 2FDBP 3MBEA 2P5EE 1CFSB 2BY3A 3L3KA 4EI5C 2V5YA 5FECB 4XBGA 5I73C 3EOBB 4PTUA 3MBXH 4F7TB 2NY4C 4PJIA 3RPKA 4R97C 4NKOA 3FB7B 3QDMD 3R0NA 2HN7B 1OAKH 1RUAH 4PRID 1KJ2L 5HHVH 43C9A 5EOTA 4NZRL 2N1KA 1NDMB 5SWZA 5T5FL 5B8CA 1UJ3C 4Y19A 5GGTL 1MCPL 1JGDB 3MRJA 1NFIA 5J1AB 5KSAB 3V5KB 1LDPL 3W81A 1TQBB 1CF8H 3JWDC 4I3RH 4LAQH 1KT2B 2HKFL 4QTHA 1T0PB 3R8QA 3JVGA 4PJAF 5GZOD 4ZS7H 4F15C 2AV1B 2B5IC 5CJ8A 2H8PA 3LKNA 2PXYB 3MV8B 5FB8B 1AJ7L 2A6JB 5CS7A 2F19H 2DLEA 2X9YA 4GG6F 3FT2B 4YUEH 2IJ0C 4GRWF 3B3IA 5IVZB 2EC9U 1KCLA 1G7QB 4D2NA 1ZS8A 2B4CL 3UTQA 3PABB 4JQIH 2VDNH 5CJXC 5EU3B 4LBEB 3TO2B 5BV7L 4JO1H 1FZKA 5GS1C 3HS0A 3RI5F 1OQXA 3ULUL 1T2XA 3B9VA 1T0MA 1WZ1L 3JTSA 5HDBE 4ERSL 5SX4I 1AQKH 1ORSA 2DYPA 4JN2A 1GGTA 1RIVH 2OM5A 5IJVB 5C0AB 4JZNB 1MREH 5E8NB 2P24B 4XBEH 5DD6A 3ULVC 2ZUYA 4ELME 1R0AH 3MYJB 5C08A 1U92B 4PJ9D 3VXTB 3GMPA 4PJCB 3E1F1 4P59L 3FL7A 3R06B 4DAGL 4EI5B 3L7EB 3SBWA 3B6SB 5I73B 1JK8A 5C2UB 2V17H 4DUXA 4WY7L 2R0ZH 1XF2A 5TQ2H 2J1KA 2L7JA 4F3FB 4NNPH 5FGCE 2BMKA 4BFBD 4ZUUB 1E6JL 4H1LA 4YGVA 4WFEE 4MJ5A 1BD2E 1KG0A 3ARDC 4GRLC 1YY9C 4PBWD 4POYA 2P7TA 3A6CH 1KYOK 1TJIL 1F2XK 2EIDA 3UROR 3U0TA 5D70H 4HLZH 5C07E 2QQKH 3QEQE 4JFPB 1C5BL 3ZT6A 2BCKA 2IH1B 3PWLA 4YPGB 5FUZL 3RWHA 3KHOA 3G04A 4TULL 1GGBL 5T1KB 2HT2C 1B2WH 3GSOA 4NFCA 4HFWB 4OZHE 1RU9H 3C6SB 1EX0A 1Z9OA 5HHOE 1EJOL 2Q7YB 5C71A 3HR5B 1YEEH 4LPYA 3BIAX 3SDAC 4JKMA 4U6VL 1S5IL 1Q0XH 2WQRA 3QP3A 5L8LB 3IAGC 2QV2A 4KC3B 1CDJA 3P11H 5JOPE 3V4PH 3E8UL 2RIKA 2P1YA 2C7UA 4LRIC 1MCJA 4PRNA 5JW4R 1D5IL 1DN2A 3BIKA 3TO4B 4JPKL 2RJMA 1ORQB 2ADGA 1W0VA 4G5ZL 1CDUA 5E8PA 5IJKC 3QPXL 4HBQA 4LSRL 4P2CG 4J12A 3SE3C 5IEHB 4HS8L 4OLYH 4H88L 1J7VR 5E2JA 2XQBH 2VWEE 1QSEB 1ES0B 5KG9B 1GOGA 1I9IL 4TYUA 4B7IA 5CJBA 1A9BA 5FFLA 1DUYB 2NY2B 5BRZD 4ESKA 2YUWA 5D2NA 4NN6B 3QQ3A 5FYJE 4PGEA 1LK2B 1I1FB 4XNZC 4U3HA 2ICEA 1QFWH 2VR9A 5T3ZD 3BKJH 4WTWA 3KLHC 1TTUA 1ZT1B 1NUGA 1ODAA 1MCCA 4M48H 2Q1EA 3BX7C 3OJVC 1FNLA 3X12B 1ERNA 1NBYA 3BP4B 4WHCA 3ARDB 4R8WL 4GRLB 1ZLUK 3RDTA 5I1LB 4PV8A 5F7DB 3GJFA 2ZG1A 4JDZA 3OKEB 3V6ZB 5D2LA 3ARFA 3W2DH 4LCCA 4U33A 4HG4J 5JORA 4JG1H 3T0EA 1ND0A 1OGAD 2AEIT 1JZ3A 1NAKH 1WBYB 2RBLA 3NABL 4N0FA 4NT6A 4JFQB 2LQRA 1GAFH 3FT3B 5LAXB 3HUJA 4ORGA 1BM3H 3DXAE 3UPCA 1EFXA 3FQXA 3PHSA 3MLXH 2DLTA 1U91B 1B4RA 1BAFL 2OR7A 3BH8B 2BSSB 5CILH 3H9HA 2NY5H 1TVHB 3A67L 3T65A 3ILPA 3MJ8B 3PP3K 1WWWX 1CE1H 3OMZA 2X4PA 1IQDA 2HH0L 4IM8A 4HC1H 1DANU 3VXQB 5I1GH 3V5HA 5JHDA 2FECI 4NQSA 2GY7B 1KUMA 5DC4B 3BMWA 3UYRL 3X14A 5B39G 3OR6B 5IFHL 4NJ9H 3WUWG 3P9LB 3LPFA 5H94A 2VXTH 2QHLA 1MHPH 2NYYD 1H0DB 1FL5B 4C56A 4NM4H 1ETZA 3HMWL 3CLFL 2Q8AL 4MHHG 1DQMH 2WWKO 4UV4L 5HPMB 4LLMB 2RCSL 5FKAB 2FJFB 1NBZA 3K8LA 4M7LH 2Q87A 2VN7A 1DUZA 1PKOA 3EYUH 4JQVC 4ZS6D 3BT2L 1CN4A 5B22A 3VXSE 2PTUA 3MRQA 1OW0C 4PRHB 2H41A 2VH5H 3UJIH 1A7OH 1A02N 1BFTA 2E27L 1VESA 1UC6A 3UPRB 4KHXL 4Q6YA 4ZFZB 2VITA 5DD0H 1IEBB 5I1JH 4JO3H 2WP3T 4K7PH 1H3GA 4JFEB 2ED9A 3FFCB 3QUYA 2DICA 1FLRH 5JNYA 2UWEB 3BDBA 4L8BA 4WHTB 3PDGA 2MCG1 5JZ7C 3C8DA 3MBEC 3S5LA 1SYVA 3QNYA 3BH9A 4O2FB 4EUPG 2K3TA 2OCFD 5DTFB 1HXMA 5EU5B 2G5RA 4NO2A 4F2MA 1AY1H 3D9AH 5CD3B 1KN2H 1T6WA 3STZB 4WNQA 4J2XA 5F97E 4WI2A 5KTEL 1I75A 1WCBB 2IPUG 2XKSA 4HKZB 4BK5A 2APBA 1A8JH 1OTUC 3HZKA 2A77L 1OVZA 2AXGA 3IDIA 3RVVD 2UUDH 4CMMB 4UT7H 5B8CC 5I8CB 5L9DH 3DIFA 1Q9WB 3EHBD 1R5IA 4POZD 2WWMD 3SDCA 3NFPB 5F88A 3QZWG 4J8RA 3S34H 1YNTA 4JFDE 5MI0B 1P69B 3JVGC 1MAJA 5D1XB 3K2MC 4Z7OE 3D1MC 4I1NB 1SBSH 4WWKB 1I3GL 1L7TH 2PO6B 4LASL 4K23L 2VDRL 2X44D 4DN3L 1F4WL 4BFGA 4WW2A 4GUPA 3CIQA 4QXGH 5KANG 5C0GA 1QLRB 5HYSG 1AIFB 4WTXA 1J5OH 2IMNA 1X5AA 4LAJH 2X7LB 1LEIA 1BBJB 1LEGB 4GKNA 4CU6A 4OI8A 1T89A 1F13A 3VRIB 3HMXH 3QO1A 4LPXA 5KBNC 1UWEH 3PL6A 2OJZH 3TFKC 1I8MB 3UTSE 4WI7A 5F7NC 1FORH 3JV5A 3SKUD 1TZHB 3KYAA 4OD1H 4M5ZH 3QI9A 4LVHB 4DKFL 2DQEL 4HDIA 5JPNA 2VN4A 4PV9A 4KKCC 5LXGL 3O0RL 3UTTA 4NUGL 2EE9A 1ZGLA 1PEZA 5JLZA 1A1MB 3ZKMC 1FH5H 4H0HB 1VERA 3ZL4L 1AQDB 5KVGL 4RFOL 2AGJL 1TETL 3L3KB 5D1QD 1QRNE 3FN0H 2J6EL 2PTVA 3BKCL 1VA9A 4A6YA 5IBLC 3ARGD 1A22B 1S7QA 4X7SH 4PJIB 1BVLA 4L29A 4YBHA 4M7KL 4XP4L 4LKCA 4N0RA 5D7KE 1SJHA 1MEXL 4NWUH 1QVOA 2F53E 3TBSA 3FCTA 2FX8L 43C9B 4RRPG 3SDDD 4X9FA 3WCYA 1UM6L 5SWZB 4CMHB 1ZA6B 4S1SL 4UT6H 4Y19B 2PNDA 2EEAA 3HE6A 3NFSH 1NFIB 2OR9L 1MFDL 3V0VA 3HI6L 4KK6C 3P3YA 5GJSL 5GS0C 4QTHB 1U95A 5EO1A 1AGDA 1YPZA 3GB7B 3RWFA 3IFNH 3BVNA 3MSPA 3NCMA 4P49A 2H8PB 5I2IA 3LKNB 2AK1L 1J1XH 3KPRE 4QRSB 1J9CT 3G9AB 5CKGA 1FL6A 4FZ8L 4X5XB 1U8KA 4OF5A 4TSBL 4JG1L 1X7QA 4G7YL 3BGFC 4JQXA 3B3IB 1KBGL 4KVCL 1J1OL 5C0BE 3MV7D 5J56B 2LAGB 4KZEL 5J4MA 5E2VH 3UTQB 3O6FB 4PJXA 5AD0A 5IQ9A 1E27B 1OAXL 2Y23A 2ZCKH 3CK0L 4YHNA 3IJSA 4QTIL 3JTSB 3VXRB 5E7FA 1ORSB 4AT6A 2DYPB 2NTFA 1V3MA 5CWSA 4RMTA 4B53A 3ULUD 5DD6B 1X5ZA 1KGCD 5C08B 5IW1A 1FE8L 3GMPB 3WKNA 3VWKD 4Y2DD 5IMLA 2LU7A 1GHFH 2KDGA 2I9LA 3QDME 1U2CA 4YHYB 5CEZD 5D2NC 1JK8B 3BAEL 3W0WA 4PRIE 2Z8VC 3RZCA 3MZGB 3OZ9L 1MPAH 3TZVD 1IFHH 1DQJA 1NGQH 2ESVD 3V4VL 2BMKB 3DX6B 3OKLA 5CMAA 3CU1A 4H1LB 3H3KA 4LSPH 4YGVB 5C0ND 4MJ5B 2YKLH 2ZSVA 4KQ4L 1KG0B 3RDTC 5AG8A 3SQOL 4M3JA 4N5EC 2Z8WC 2BX5A 3VFRA 3MRNB 3S3JA 3J8F7 2P7TB 4KTEL 3EDFA 1Z5LA 1G6RA 2BVYA 4BUGA 2PYEA 3ELAT 3RA7H 3U0TB 2VMFA 1FNSL 4LCCC 2F15A 4S1DC 4UTAL 3D39A 5SWQA 1KYOJ 3T0EC 3MUJA 2BCKB 5IF0A 4AEHL 1A21A 1ONQA 3LIZL 3PWLB 1XMWA 2H2SD 2JCCA 1LO2H 4BQ6A 5MENA 3ES6A 4LNVA 4L5FH 4QRQA 4WO4A 5GRUL 1TMCB 4PJDB 3WIFA 1QYGH 2OTUA 5MEOA 3OJDA 4MSWA 5DHXB 1LO3L 4RFEA 3BGFB 4XPFL 3WLWD 4PJ8D 1ZLUH 4OZGE 3MRLA 4H8WC 3IJHA 3T0WA 2LABA 4QHLA 4PRPD 5D7SL 3FMGH 3BIBX 4FFYH 3LKQA 1B0GA 3OKMA 2DLFH 3QHZL 3HG1D 1FSKB 1HK6A 2CXGA 3BIKB 4ZAKD 1SY6A 4U6XA 5CLWA 1W0VB 3FAXA 5E8PB 5JTWA 3CUPB 3C60D 1FJ1B 2DL9A 5IVXA 2CRIA 3SEPA 5K59E 2VDLL 3FJTA 1CFQB 4BQBA 1BOGA 3ZKXC 4GKZA 2EXWD 3QFJB 4K9EC 5AZEL 3CH8A 2CDFB 3O8XC 3MRCB 1RJYA 3BP5A 4EI6B 1RZKH 4K94C 1A9BB 1B0RB 4ZNEA 5EOCL 2VAJA 3NACL 3Q3GA 4JKWA 1QKZH 2HLFD 3PP3H 1T7VA 1LO4L 4HWBA 4PGEB 4P5MA 4FFZH 4MQSB 2ICEB 1A6AA 4OCXL 3SCMD 1UT9A 4PPTA 5FDWA 4MAUH 5INCB 4BM7A 3GEWB 3Q5TA 3QUYC 3T04D 3CX2A 4PV8B 3LN9A 1IVLA 2C4FU 1FGVH 3B9KD 5DMIH 5C0CA 1BZQK 5HXMA 5D2LB 3ARFB 2PR4L 5FGBA 3A0OA 4OI9A 1BBDL 2KH2B 4P23A 5GGRA 4UAOC 4YLQT 5JORB 2O5ZL 4LLAA 4LRNL 3T0EB 1ND0B 1F6FB 1D3CA 5IFJB 4N0FB 5F89A 2C4XA 3TGXA 1CD9B 3O3BB 2G2RA 5C7XH 3DROA 4Y4HB 3DVGA 4XVJH 3HUJB 4PS4L 4KRPC 2QTEA 5HI5D 3FOMA 1Q1JH 4X6CA 4TSCH 5IBTH 4NWTH 1EFXB 4Z7QF 5HI4D 3FQXB 3NFNA 4JFOA 4A2MA 2R2EA 1YMMD 3VDBA 1NC4D 2XA8L 2DKMA 4FQCH 4JM4H 5I9QC 5IHZA 1KCRL 2ADIA 1VDGA 5GQBA 4GXVL 3T65B 3FTGA 4H20L 3ILPB 3SDCC 1Q8MA 3BE1L 3AM8A 1B0WA 4M43L 3GMQA 5I1KH 5CFHA 2CXKA 2P4AB 2X4PB 2X1OA 3HNVL 3V5HB 4M93C 5JHDB 4NQSB 2EDQA 4CL7A 1QFWI 2QQNL 2HYMA 3X14B 2VZOA 4ODHH 4NFDA 5DD3L 1DTUA 5H94B 3DUUB 3KNBB 3HZMB 1ACYL 5IW3A 2OX5A 4WVRA 4PGDA 3STBA 4WW2C 4C56B 5I1EL 1JPSL 1ETZB 1CXLA 3ZKXB 5BRZE 3KYKL 1W72L 3STLB 3W39A 4NNXB 2YPKA 5T3ZE 1MIEH 1NBZB 1T89C 3FQWA 1DUZB 1RUPL 1X5LA 4UBDC 3MRQB 3LS4L 3MJ9A 2IH3B 4P5TC 1CD1B 2GSGA 5A16A 5DXWA 3TN0D 2QLVB 4QY8A 3ARED 2VITB 1ZKAA 1FG9C 2YD8A 3QI9C 3QEUB 4X99B 2QSCH 4XNQA 2XTJB 2DQJL 4ONHB 5CIPA 1OGAE 4XC1L 5J6GA 5E56A 5JNYB 4PFEA 4WI6A 4Q0XH 2NY7H 2JJTA 3T1FA 1E6OL 3S5LB 1SYVB 2X4TA 3QNYB 3BH9B 1A6ZA 4APQD 1KTDA 5A3IC 3EO9L 1S9XA 4NO2B 4F2MB 1KN4H 1QFPA 5HYJA 3KPMA 3WFHB 1IAIH 4YHLL 1VFOA 4WNQB 4LIQE 4KRPB 3MODH 4OSUL 3QCTH 4KHTH 3MYZA 1HH6B 1CG9A 3QUXA 2DS4A 5LG1A 3HZKB 1T7WA 3NA4A 2AXGB 3IDIB 4DVBB 4ENEC 3DVNA 4W81A 1U2HA 3DIFB 5T3XH 1FGNH 2D2OA 1R5IB 3QUZA 2VABA 3HE6C 5T33H 4LU5H 2WMPA 3DVFA 3SDCB 3L3DA 4J8RB 4LSSL 4Y1AD 4OZIE 1YNTB 3IU3A 4XMPH 1KLUB 4R26L 3WL9A 4M93B 2YD9A 1MIMH 4YE4H 1ZEAL 2A1WL 4WGWB 1AGCB 3RWCA 4UIMA 4BZ2L 1W0YT 4OF3A 2P44B 4K71B 4WW2B 1R3IL 2D7TL 2EDEA 2OS7A 3VGGA 4GLRH 5C0GB 1AD9A 2FGWL 2P5EA 4JQXC 4XP1L 2EO1A 1UCTA 3LKPA 3LQAH 3S7GA 5I8KL 5LCVH 1U0QA 3PF2A 4GKNB 5F72S 1XGUB 4X9IA 2Z31C 5DJAA 5CUSL 3PL6B 3F62A 1VHPA 4H0IA 3TLRA 2A0LC 4OD3L 4UV7H 5CP7A 3BPCA 2BERA 3B2UD 2O93L 5SWSE 2ZPKL 4KROC 4MZ3A 2CKBL 3GI9L 3OF6D 4MQXC 4LGRB 5BMFL 4CU8A 4HDIB 4K7FB 4PV9B 5J89A 3UTTB 1KACB 3V8OA 5TH2B 1ZGLB 1I3VA 5JLZB 4C83B 5KVEH 4H1LH 4NUJA 1FBIL 1KJVA 4WCYH 3IXAB 3T0AA 1G7MA 5ICXA 5D6CB 3QG7H 3Q6GL 2Y72A 4R6UA 1ZSDA 1WGOA 1HHHA 1S7QB 3RZCC 1CTOA 4QF1A 5GS0H 1BVLB 4L29B 3RJDA 1D5BA 3PWNA 1IGIH 5ADOL 4FQPA 1SJHB 3FCTB 4Q74A 3REWB 5B39A 3VE0A 1OM3L 3WUWA 2QEJA 3SO5A 4KXZH 3MOAH 5TQ0H 3G5VB 1VFMA 4HCRA 4O2EA 1J0KA 1RPQA 1NCAH 32C2A 1J0ZA 1EA9C 4YC2C 3ESUF 3G5XA 2KL6A 4XP5L 4H5SA 5JO5A 3B8SA 2FBJL 3QH3B 4GRMB 2I27N 3B4NA 3SDXA 5EO1B 1SBBA 1U95B 4FFWD 1AC0A 1MCNA 1T21B 1AGDB 1YMHA 1YPZB 1IILE 2FHBA 5DD5L 2P8LA 3RWFB 2HTKD 3BVNB 1HKLL 3C6LD 4CJ0A 5I2IB 5L88H 4WO4C 3SHSA 4YHOL 3QEHA 1U8KB 4NN7C 1X7QB 5M7QA 4PLOB 3WS3B 2GUOB 4P2OA 4WFGD 3RRQA 4IDLA 3AUVA 3TYGL 4LLYA 1O7VA 5KS9F 1DBML 4FQ2L 1T2QH 2NW2A 4PJXB 1Q72L 5AD0B 1G9ML 5IQ9B 3EO0A 3O3EA 2O5XL 5C0IA 2P45B 3IJSB 5ILTL 2NXZD 4EUPA 5C2BH 1BWMA 1BD2A 1MY7A 4P3DA 3O6MH 2GFBA 4JGMA 2NTFB 4KROB 3U46A 5CWSB 3KJ6L 4HJJL 1QBLH 4ZXBA 4YFLF 3DETC 3RUGA 1RZJL 3QEQA 4WIQA 3U9UA 1KCUH 3U0WH 2MJWA 4TTDD 1HYRC 4KKAD 3DYPA 2WQ8A 5IMLB 5E5MA 3VXMB 1XR8B 5ENWA 1DBJL 5LQBH 1AGFA 2I9LB 4N0CD 1MAMH 4G43A 4L1DA 5C3LD 4NC2B 3KLSA 1NLBL 2EC9T 2FJHB 3W0WB 1OP9A 3QZWA 4OZHA 4MA7L 3RZCB 3LB6D 3CSPA 4DW2H 4NQVA 1ZHLA 4JN1H 4GMSL 3HC3H 3EOAA 1DQJB 1WT5A 4OGYH 5EB9A 5ADPL 3OKLB 5CMAB 5C0EA 3I50H 1VSCA 3RHWF 3VFRB 4YC2B 5FYKU 5D7IF 3PWPA 3CGTA 1G6RB 4NZDA 5TGBB 4N1HB 1PZ5A 3JV0A 4V2CB 5FGBC 4Q9QH 4UTBL 1OAYH 4KDVA 4P23C 3D39B 3ROOA 4UU9A 5SWQB 1E4KA 5KSBF 2FX7L 4R9HA 2WBKA 3EYSL 1R5VA 2A9MH 5MENB 3ES6B 2V9RA 4QRQB 4WO4B 2APFA 3MV7E 4NBYB 3X3GL 2OTUB 5MEOB 1HOCA 4L4VD 2SEBA 2EXYC 2FO4B 3IJHB 5CD5D 3P4OA 3WSQH 4QHLB 1M7DA 1PY4A 3PDOA 4K9EH 3F7RA 4M6OH 4ODXB 1C8PA 1B0GB 3OKMB 2Y25A 4K94H 2P8PB 1F3RB 4P46C 1V8HA 3ULUE 1RJZA 1XGQB 4M6MH 1OPGH 1YEGH 1YUHA 5DUBA 5C86A 5MEQA 1KGCE 1JPST 3VRLF 4FNLH 2F54A 4S2SA 4NKQB 4G6AD 1I3RB 1TCRA 2WBJA 3WFEH 4F7EA 5EA0H 3AFLA 1HHGB 5FCUH 1BOGB 5CEZE 2UZXB 4XVTH 3DI2B 1XIWA 4RRPA 5IOPA 4FXGA 3NAAH 1RJYB 1X5FA 2PUQT 1T7YA 2ZZUT 2ESVE 1GXEA 3Q3GB 2CO6B 1HHKA 3INUH 3DXAA 4K3DH 2BSRA 1S7SA 1A4JA 3CFCH 1S9WA 1A6AB 2AV7A 1WAAF 5D71L 4L4TB 2VRAA 3X3FH 5J8OA 1WZLA 1YEKH 2Y6SD 1OCWL 4XNXL 5C0CB 2M1KA 3UZVB 5HHMD 2OP4H 3DGGB 1J0JA 2VDML 4RGND 3NH7H 1HN1A 4I8DA 3NCCB 5GGRB 3RIFF 2JJTC 2J5LB 3D3VD 3NMEA 2A38A 4O2CA 1BJ1J 3OAUH 2R1YA 4ONFH 3G6DH 1DQTA 2G2RB 4U31A 3DROB 3DVGB 5ALCH 1MCOH 3FOMB 4X6CB 3DSFH 3GMOA 1JZ4A 1K5NA 4I3SH 3PQYD 3QUXC 1NGPH 1PBYA 4JFOB 2JK5A 3EYOB 5CJ5A 2NY3D 4MXWH 3HG1E 5IHZB 1PEWA 1PG7W 3JWOC 3LEVL 3FTGB 4LSVL 4PJ7F 3G9VA 3GMQB 1B3JA 2HWZL 2J88H 2W07A 1S3KH 3SDYL 1U6AH 4R3SA 4JKKA 4JFZL 1Z6JT 3VXNB 4Y4KD 3CFDA 4P4KD 1TZGH 2DLIA 2XZAH 1K8IA 2X4OA 2PW2A 3BOVA 2OI9C 1UKQA 3PWUA 3K7UA 2MQCA 5JR1H 3LD8B 5JA8B 1CLOH 1TDQA 4G80A 5DLML 4TUJA 4KJYA 1A3LL 5GGUA 2UZIH 4CVZA 5ESVB 4LLVB 5ISZD 5IB3A 3T3MF 3FQWB 1II4E 4M62L 3QHFH 3FB8B 1C5CH 2F5AL 1NKOA 4X0KA 5KJRH 1I9RL 1YEFH 3NIDF 5A16B 3L1OH 1HCFX 3MRRA 3GSUA 2R4SH 3GHBL 2DN7A 1K6QL 1P84J 1DANT 4TQEL 3KDMA 1LMKA 4JEGB 4RAUA 4D9LH 2BZDA 2H45A 5C09D 1SEQL 5J6GB 2EZ0D 4HUXA 1BZ7A 5E03A 2D0FA 1U8MA 2XZQL 3L3HA 2Y07H 2X4TB 3ILQC 1AO7D 3WLBA 2QADD 1KTDB 4FQIH 4HWZB 2ZG3A 4X4XB 1K4CA 1S9XB 3QCVL 1T3FB 3MO1A 3KPMB 4ZUVB 4KTDL 3QPQD 1YMME 1GPOH 1G7PA 3NZHL 4E41D 4JDTH 2O5YH 2Z91B 1EGJH 5HY9A 2LU3A 1CG9B 3QUXB 2OTPA 4WFHD 3ZTNL 4C58B 3TF7C 4HIXL 2P8MA 2AI0L 1CT8A 3QUZB 2VABB 4I2XE 1FYTD 3AY4C 5I1CH 4ZOCA 1MCHA 3UTSA 3L3DB 3CFJA 1QQDB 1EEUA 1CGYA 3RWJA 3WL9B 2DLGA 4L8SA 1MCBA 4ZO7A 3S36X 1WWBX 3RWCB 4UIMB 4NHCL 3BPNC 4EBQL 1ZLVH 4TPRL 4Z7WF 2NLJA 2VO5A 2OI9B 3WNLA 4K8RC 5L0QB 2D03H 3DO7A 1AD9B 3RZWA 2P5EB 4OV5A 3LKPB 4H0GA 2VDQL 4NM8H 4P2OC 3FHQA 1Z2KA 2HFTA 3DOSA 1UADC 4PD4K 3PIQA 1KF9B 5ITBH 1VFAB 5DJAB 4KY1L 1N4XL 3VCLA 1IGTA 3RAJH 5EIIA 1N2RA 4YHMH 1IAII 4Z95L 3VFSA 4HKBA 5CP7B 3BPCB 4AENA 1KNOB 2HFEA 2JLLA 2IPKA 1GZQA 2HFGL 2CIKA 4XC3L 3CZFA 3ARZA 5IVOA 1LILA 4HXAH 5EU4B 4ZXBC 2J4WL 5GGSA 4WEBH 1RQ5A 3PHOA 4HUUB 2GKIA 1KJVB 4TVPL 1NCBL 3GI8L 4RIRA 2NMSA 1XT5A 5ICXB 1G6RH 2X4UA 1CVSC 35C8L 3KPRA 1HHHB 2EDOA 2I07B 4M1DL 1UXWB 4J3TA 3GM0A 2IG2H 1U8OA 3RGVA 3RNQB 2EKSA 3N06B 3MV01 5H37H 1D5BB 1WT5C 1ITBB 2R0WH 3PWNB 3HC0B 2FH8A 3VE0B 5HVWA 4LEXH 5IBUG 1P4BL 3W11D 3WUWB 4K3EL 4HF5H 3F7VA 4Y1AE 1TNNA 4O2EB 5MP6L 5EORL 32C2B 1DBKL 1HNFA 1IC7H 4LARL 3G5XB 1XF4B 2IPUK 5B3NA 5FYKH 9CGTA 5JO5B 3ZYZA 3C2AL 1HE7A 3PGFL 3V6OA 4QEGA 4ZFOB 1E4KC 3SDXB 1PLGL 1BFVL 2ORBH 1KPRA 1IBGH 4ELKA 4F7PB 3U2SB 2BC4A 4ELMB 3T2PA 4FMKA 1L9MA 2BSED 4IBLT 4MNHA 3UCRA 4EQ3A 3VFOA 1LQSR 1SY6H 4WI8A 5DFWH 4OF8A 1Q0YH 2HTLC 2UYLB 3MNZA 4P2OB 3UJJL 1G7JB 1HILA 3CSGA 3MNVA 1MJJA 3MUY1 5KOMC 3O3EB 5FGCB 1ADQL 3MTRA 4WENB 5C0IB 4Z5RA 4XNUL 3C5JA 3C87A 1BD2B 1KCVH 2C5DC 2W65A 4P3DB 3MFFA 3WIIH 4HWBH 4CKVX 2D31A 3CX5J 1B6DA 2FEEI 1V7ML 3U46B 1OLZA 4KXZI 4ZXBB 2WBJC 5I75B 4JG0H 3CCHA 5JMRA 3RUGB 4HUWA 3QEQB 4WI5A 3U9UB 5HDQL 4LP4A 4N1EA 1XIWC 4Z0BL 3LQZA 5ENWB 5INDA 4R7NA 3S36L 3EYQD 1AGFB 4G43B 1Q94A 4UB0H 4GJTB 1AP2A 4I18A 1JNNL 4OZHB 5AAWA 1T66C 4BKLA 1NC2D 1JWSB 3D69A 3VFUA 1ZHLB 1BQLL 1XH3A 1CLOL 1WBXA 1VEPA 4NKDA 3EOAB 5EC1A 1UENA 1KB9K 5DQDH 4HGWA 2VLRA 4OZGA 3KPNA 4MX7A 5C0EB 2WIIA 3BQUA 5E2WL 5DRWA 5L6YL 5CKAA 1NANI 2YA0A 1PZ5B 3PHQB 5FYJU 4OGAC 4KU1A 1OT2A 3ROOB 1FFOB 4AMKL 4PJ9A 1T1WA 2HT3D 3KPOA 1UWXK 4UNTA 1R5VB 3BESR 4FP8L 4PB9H 3FO1A 3I9GH 4WFGE 5IB1A 1A14L 3BYYA 1P7KB 3VG9B 1CK0H 1GC1H 1LP9F 5C6TH 1OAUH 4JDVB 4JFFA 3P4OB 3DBXB 2DOCA 5IT2H 4PJEF 1M7DB 2NY0D 2Y06L 4ZO6A 3ZHDA 5CJQL 4Y4FA 1NFDF 1YEHH 1S78D 3B2VL 5GGQL 1OF2A 4XP9H 5DUBB 4N9GA 1KFAL 3MACH 5E6ID 2BHYA 5T5NF 3UXFA 1MCWM 3MJ9H 1OARH 5GJTL 1NCUA 4S2SB 1UM4L 15C8L 4BK4A 1TCRB 2WBJB 2V7HB 4F9LA 2F74A 3TV3L 4KI5D 5DVNA 1VACA 1FZMB 4AEIH 4M7JH 3ALWA 4G9FA 4HIHA 1XIWB 5IOPB 1RZGA 1YN6A 4OCSH 2YPLD 1HHKB 1YJDC 1AR1D 2F58H 2H6PA 1AGBA 3DXAB 4WEMB 3T09A 5EUOF 2BSRB 1S7SB 4JM2F 1S9WB 4RDQG 2AV7B 2OL3A 4GQ9H 1AXTH 4NM8L 5EU6A 5IB5B 4K7PX 3IDMB 1RK1B 1ZK9A 1CCZA 1CD8A 4LMQE 1DQQB 2F9BT 3QRGH 3MCKA 3GKWL 2CLZA 4UDTA 4Z7UF 3LQMA 1DLFL 3VWJB 1L6XA 3E6FA 1S5HB 1OP5K 5ICZA 1QEWB 3IJYA 4U0RB 4M5YH 5T1LA 1H3PL 1CYGA 4O2CB 1WF5A 2R1YB 4P3WA 4L4VE 3LPGA 2MCPL 2B0SH 1XR9B 1RY7B 1QR1A 4XWOD 4NO0D 4N0YH 5KOVC 4FHBD 3SOBL 2O61B 2XZZA 5DR5H 2OZ4A 5JOEA 4NNYA 2E6PA 2DLHA 2V7NA 1N0LA 3QHTC 2DQTL 3VXSB 5EBMA 3MV11 1FVEB 4KKBD 4RDQF 2IAND 1BGXL 1QBML 5L8KB 3UAJD 2HRLA 3OPZH 2WNGA 2VLKD 4L8SC 3NCJL 1RVFH 5CSZA 5I6XB 1RZ7H 4R3SB 3GMNA 5GZND 2WUCH 3HFML 3UZEA 1IC7L 5C0RH 3CFDB 4WTZG 4LDLB 1OSPL 2X4OB 1RUKL 3ARBD 2PW2B 4TNVF 1HHIA 4Z0XB 4BH7B 3HAEB 5F1IA 3M8OL 3PWUB 5KVFH 3EJZD 5J3HD 2FBOJ 4OCRL 1F11B 4G80B 2P5WD 4TUJB 4KJYB 1AD0B 5GGUB 1F8TL 5HGHB 3UDWA 1QLEL 3QYCA 3U4BH 4XHJC 3OKDA 4M8QB 4AEFA 3BKML 1U3HB 4AIOA 1D6VH 4D8PA 3I2CH 4MD4A 2AK4A 3GSUB 1J1PH 4XVSL 5F7EH 5DURD 4YAQB 2BVQB 5HHME 4RGNE 3KDMB 4EN3A 4RAUB 5DK3A 3D3VE 2JJVA 4OZIA 4JREB 4JFDB 1GGCL 1VFBA 4BJLA 4OLEA 3HNTH 3AS1A 1BZ7B 3P30H 4I77H 4AH2A 4KK9D 4MA8H 4HCRH 1NBQA 4UILH 3L3HB 3WLBB 1A7PL 4ZTPL 4GO6B 3VH8G 1K4CB 1G9NH 4QYOB 4X7DC 1NGYA 3MO1B 3PQYE 3RGVC 2LVEA 5LBSH 1G7PB 2X1QA 3TNNA 2OXHA 4KJWD 5HY9B 1EO5A 2QQQA 3CFEA 4X4ME 5DK0A 1KB5L 1IJ9A 2AJYL 4JANA 2CK0L 1KIQB 5GGVH 4XVUC 4Y88A 3CVIH 5CINL 4OIIL 1N5AA 1JI2A 3UTSB 5EBWA 1HSBB 5EO9B 3CFJB 3V6OC 1ITCA 3EFFA 3RWJB 3Q6FB 5SWSA 1QSFA 4MGXA 5EIQA 4L8SB 3OKKA 4KZDH 3I6LD 3EOTL 5DJXA 2ED8A 1T04A 1X4XA 3DMMA 2NLJB 3GSRA 2AJVH 3T08A 1FPTH 5ISZE 4N1CA 3WIHL 2H1PH 5JUEH 5JXEA 2GYSA 4JY4A 2A74A 1UGNA 2DQDL 3TBYA 4IOSD 5I19H 3PIQB 4Q9BA 3LRGA 4FOMA 5DVLA 2AJSL 5EU7C 2E9WA 1H15A 5EIIB 2CMRH 2F53B 3GBNL 3WNNA 3VGDA 1BVZA 3EJJX 3VFSB 2KPNA 1X5GA 4AENB 5C09E 3RU8L 4YHKL 1NEZB 2HFEB 3U36B 2IPKB 1GZQB 4OGXL 3CZFB 1IGCH 4HXBH 2N7BA 4BH8A 5GGSB 5F9WB 1AO7E 4XB7A 1FFRA 2BNQD 3Q0HA 3SE8L 3BGAA 4IRJB 4RIRB 4V1DA 3MCG1 3S9DB 1MJ7H 4E41E 4I0PA 3KPRB 3V52H 1QUNA 5GRJL 5I30H 3SN6N 4I18C 4WFHE 2FYYA 3EO1A 1U8OB 3RGVB 4TVPD 1GZPA 1LWRA 2B1HL 1SVZA 4I5BA 2I24N 1FYTE 1D5ZA 1JUFB 2EDHA 4DCQA 1R3HA 3F7VB 3NIFF 4NQEE 3BQUC 1MVUA 4ZYKA 1SMOA 4XZUA 5GSVA 1U41A 3UJTH 1MELA 4G8GD 1XZ0A 3FQNA 4QT5B 3T0VA 3QJFB 5FYJH 3BRGC 2MPAL 3EW3B 3WDJA 3MOBH 2ATPA 4NIKB 4MAYC 3X13A 4ELKB 2ARJQ 1TITA 2B2XL 1E4WH 2BC4B 5CJOH 1EHAA 2OMNA 1T5WB 5CEXA 3VFOB 3O2DA 3HE7D 3R8BB 1TENA 5D7JD 5E99H 4ZFGL 3JWDL 3HI1B 2E7HA 4EQ2A 5F7WC 4PRIB 3GSNL 1M7IB 4OLUL 1HILB 2A9NH 3SDDA 3MNVB 5CGMA 1NBVL 1C16A 3ETBF 2J2ZA 5D93B 4Y4FC 5GS3A 4JFYA 4AL8L 2H26A 1SM3L 3C5JB 4EOWH 4YHPA 1VCAA 1UWXH 1KJ2A 1MFCH 2W65B 4XPHH 3MFFB 4G6MH 2D31B 4YK4C 3GBML 4CDGC 2X4RB 4ODSL 2D9QB 2ZUWA 3CDCA 3PWVA 4F9LC 4X6DF 4HZAA 4HUWB 3QB7C 2ZUVA 3MUHL 1JMXA 1EHNA 3H0TB 4XCYA 4DGIH 5HD8C 4YBQC 3LQZB 5INDB 1EXUA 1JFQH 2H32A 4LCIL 1F4XL 1Q94B 3MV9D 1AP2B 4L9DA 4KK8C 2C3VA 1L4IA 3H42L 4BKLB 4YDIL 5J13C 4PRDA 3D69B 4R0LA 4XB8A 3VFUB 3V7AE 1XH3B 1WBXB 2VXSH 4NKDB 1KCSL 1X5YA 3ULVL 1DBBH 3OWEA 4HGWB 2VLRB 4OZGB 4MX7B 5A2IH 4ZODA 3KVQA 1NAML 1T1ZA 4QXUL 2YMXH 4RWYH 5F7MC 2ICCA 5DRWB 4WRLA 3VA2C 3QIBA 5JQ6H 1KXQE 4Y89A 1J1PL 5IQ7L 4IIQA 4CVXA 3C9NA 4ZUSB 1LDSA 5F9OH 4PJ9B 1T1WB 3KPOB 3VWKA 3BDYL 4YPJA 3LHPL 3D2UA 2CDGB 4WU5B 5EZOH 5IB1B 5HVGB 2F8XC 3KYOB 3O9WA 1HINH 1V05A 3M1BA 1AXSA 5D8JL 4ZUWA 3HAEH 4JFFB 3FHAA 4YJZL 5HPOA 2R8SH 2X05A 3GFUA 1OP5H 4O4YL 1MUJA 4Y4FB 3RX8A 1JZ6A 1WAAE 5GRVK 4P2QD 1RJLA 1MF2H 2CGRH 1OF2B 2VR5A 1YJDH 3H9SD 4N9GB 4PJFE 4JLRA 4D9RD 4YK4B 4NO3A 5E8EA 2A6DA 2FATL 1A7NH 1KJ3L 4ISVB 5D1ZD 2HG5A 3O4LA 4OAWA 2CUIA 2OR8A 1EHLL 3FRUA 1V7NH 2KZWA 2JELL 4Y8DC 4M6NL 4M1CC 2F74B 1MRFL 1VACB 1LEKB 4G9FB 4HIHB 2OTWA 3DX9A 1NGZA 1YN6B 3KWWA 3UDWC 1C1EL 1FZOA 4GAJL