1DBBH

Three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of an anti-steroid Fab' and progesterone-Fab' complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1992-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH02
2D0HA 2OTWB 3RVXC 3QI9B 5IMOA 1HN1A 4CVXA 2IWGA 4NSKB 1SJXA 3LPGA 1KCKA 4ZFZB 2BVPA 5BO1H 3CFDB 5J9PB 2BJML 3BQUA 5GIRA 2J1KA 3WS6A 1JJUA 3HAEB 5JMRA 3RWIA 3VFOB 3GMQA 4K3JH 2PN5A 3KJ6L 4OZFB 3ZSTA 1CLOL 2YSSA 3IYLW 1C5DA 3JWOL 3VXSB 4LCWD 5FUZH 5J13C 4HC1H 3IXTA 3SDDA 3WDHA 4HWBH 4BFIB 3DTXA 4J4PD 5FK9B 3L5IA 1TCMA 3OR7A 5KVEL 1T89A 3ULSB 1IILE 5TQ2L 3KPTA 2JB5H 4I48B 4JGUA 3UPAA 4R4ND 4O2CB 4UU9B 3CLFH 3QIBC 2DMBA 4U1SA 2BERA 3QB7C 2AKRA 3HE7B 1E4KC 3BQUC 1WWBX 2UWEA 3QI9A 5IMOB 2CGRH 4MA8L 3C8KA 3T0EB 1R3IH 3IDYB 4TTDC 1MRDL 2YWYA 2HWZH 2VZTA 5I1DA 3MCKB 4DZ8B 3NVQA 4AT6A 3Q6GH 3MRJA 3FFCA 3MLTB 3QDJD 1IC5L 3NCFB 3FFDB 1OTUC 5IB3B 5K9JL 4ONOA 2V2TA 4HWEL 5BVPH 4I0PC 4XPTH 2PO6C 3TO4C 4I0CC 1CXEA 4HUVB 4XI5C 1C16B 4FTVA 1GPOH 3G6JA 3HRPA 5HPOA 1YEIH 4MJIB 2MCPH 4PGBA 3TZVD 3S3JA 1PQZB 3TBYA 3KWWA 5JOPD 2FB4H 4KRPC 3RY6A 3CH1B 2BVQA 5J11C 4BK4A 4C59B 1JV5A 3ARVA 3PGFH 1RUAL 2OQJB 3CXHJ 4I4WB 5CUSH 2CLZB 3HLAB 3WN5A 4Y4KA 2LTQC 3SKOA 3BKMH 1YNKL 2ZUYA 3PGFL 3S6CA 1N5AA 3QCUH 2OL3H 5IW6A 4O5LL 1QBMH 2DKSA 4PJFF 1KJ2A 1VFUA 4PBVC 5I0ZA 4KVCL 3ISWA 3RDTB 3AM8A 1D6VH 3V4VH 5I30H 3HZYA 4L3EB 3O8XD 3VXUD 1I9JH 1XIWC 3RWDB 3SDXB 4QXGH 1IM3B 4WEMB 1SMOA 4Z7UA 2FO4B 2G60H 3NGBC 1YEFH 4ONFL 1N5YL 5JQ6H 5J1AB 3WUWG 1LE5A 3BN9C 3MBEB 3TN0C 3X11A 1FNGB 1SVZA 5CD3A 3X14B 2VIRA 3ZL4L 4IRSD 5KJRH 2NY7H 4H8WL 1DBJH 2EKSB 1C1EL 4QHLB 2YKLH 2GTZA 1T21B 3AB0C 4H1LB 4H1LH 2R0WH 5CIPA 1JK8B 4XMPL 4R4BA 3QDJA 5JLZB 2HFGH 2ZUUA 4ODTH 1HHKB 3NN8A 1NDMA 3BO8A 1A7NH 4NOFA 4UDTB 3LZFH 2V17H 3DUUB 1G6RH 4PRDA 1MHHB 1NBYA 1WIPA 2ZCLH 4UINH 3WUWA 4IOIB 3TC9A 1NC4A 1F6AA 4N8CL 5ISZA 4KJYB 3VRIB 3TZVA 1V3LA 2D7QA 3A6CH 3KLAA 1YMHA 4QHNB 4LHUG 2QQNL 4JANB 5GGSY 5IW3A 1OGAD 1GAFL 1PX3A 2NLJB 4KKLC 3WIIL 5F72S 4Y19B 3MZTA 4APQD 5L2KA 3SJVB 5EU6D 3O4LA 4KJPC 4E41D 3H8NA 1JNNL 3S3PA 4B7LA 2R23A 3UZVB 4TUOA 1G7MB 3PG2A 5EOCL 1LDPL 4IRJD 1J1XL 2DLIA 4WFGE 3VFRB 5GRZA 2VDRH 4LSDA 4L9LC 2QBWA 3N50A 4BSVB 4C56B 4Q7DA 2WUCH 4RQQA 3FT2A 3WS3A 4WO4A 4LLVB 2FJFA 3KPQB 1D7FA 5GGTH 5L6YL 3VFPA 1QSEE 1FZKA 4Q2ZA 2QSVA 4E41B 4LASH 3GB7A 2C1OA 1K2DB 3BRGC 4FQXA 2LAGB 2E5EA 3ZZ1A 4ZPVA 1CR9H 4YHNB 1A9EB 4OF7A 1AGEB 3WJLC 2E9IA 3L3IA 1OGAB 5DMGD 4DW2L 4XZUA 1S7VB 5DJXA 4LLAA 5HHMB 1IQDB 3QPXH 4OUUB 4LP4A 3MXWL 3VWJB 3H2WA 5DK0A 1MCWM 1II4E 4P5TA 3MOQA 5DGQA 3EO1B 2XXCB 3FQXA 1OTSD 4Y7MA 4UTBH 1NGYA 1KXVC 1RUQL 3HB3C 3M17A 5SWSA 3PQYB 5ADPL 1WBXA 3EJYC 4U1HB 4OGAC 4G6JH 1JNHB 4PJIA 3DX9A 3B2UC 2OR8A 3PWNA 4U7SA 5I66A 4JHAH 5HI4D 1HINH 2GJ6D 1MOEA 2ZUVA 3PV7A 1DBAL 4L8DB 2AABL 3CXDL 3DGCR 4IMLA 4PJGE 5E8OB 2AXFA 2VRAA 3H3BC 4KDTA 1DQLL 1I1YB 2H9GA 4DN4L 5IBUB 1JN6A 3LSOA 2F8OA 2D7MA 2UZIL 1FGNH 1OSZB 1LDPH 4X9BA 1B2WL 3E6FB 2Q87A 3V9FA 1QLEH 3OXRB 2KDGA 1UWEL 1XR8B 3NCYP 2ZOKB 4HAFA 3AS2A 1XGTB 3C2AL 4UQ3A 3MV8D 3P9LB 4ETYA 1DVFA 5GSVA 3UX9B 5DRNA 1IKFH 1S3KH 1FFOB 3U48A 5BW7A 5A16A 2DQHL 1M05A 1UZ8A 4PRPA 3T0EE 5IHZA 2WNGA 3NACH 5AYUH 1D9KA 4QOKE 5ACLA 5KVDL 1AXSB 1Q0XL 4HAGA 5AUMA 4ZTPH 1RK0B 1U93B 2P5EE 3MLUL 4WNQA 5J6HA 1MRCL 5JHDA 2DI8A 1UWXK 3KXFD 4G5ZL 4Z7VF 1KCRL 4KUZH 4YBQC 4HK3N 4ODTL 4C58B 4QEGA 5EN2A 3N1PC 2YN5A 4GW1B 2YPVL 1E4JA 1YEIL 4YNYA 3PGCB 3B9KA 2EDFA 2DQFA 2QHRL 2YKLL 3MBXL 3UZQA 1U9KA 4YBQD 2VWEE 2HVKB 3IJSA 3VE0A 4JFEE 4NUJB 2BZDA 3U9PL 1R3LA 2I24N 1HXYB 1RV6X 4Y88A 5DC4B 1U91A 4XVJL 4X6DF 4JY5H 3HUJB 2P49B 3C5ZC 4Y16A 2Q6WA 4X5WA 3MV9E 2X09A 4ODWB 3QXVA 4O2FB 5DHVB 5MHSE 4G7YH 4Y5VC 1Q38A 1KGCE 1DANU 4WEBL 3N9GL 2FEEI 3QUZD 1T0MB 1S9KC 3QULB 2YRZA 1IAOA 3HUJA 2ZOKA 4JAMA 4OV5B 4L8CB 2VLLB 1CBVL 3RTQD 4Y8AA 2CR6A 5JPNA 5E94B 4LRNL 3NZHL 1UYWL 1P9MC 3RWCA 3IJSB 1Y0LB 3WD5H 3D0VA 3I50H 5K9QG 4LOUC 5IJKA 1R5VB 3TT1H 2I5YL 3PGCA 3GKWL 5E8OA 3ZTNH 5I8OL 5C0IA 5C2BL 3AVEA 4HPOL 1N0XL 4JZNA 4U7KA 1JGUH 2NW3A 3WFCL 3VFTB 1FVDB 2W07A 4YWGL 4EDWH 4Z7UE 1JGDA 4PJAF 3LV3A 1FL6B 1GPOL 5BZWB 4EI5B 3ET9F 1RK0A 3UEZA 3QWRD 3FQXB 4POZD 1MVUB 3QCVL 3G04A 3HI5H 5FAAA 3QRGL 2EEDA 1ONQA 5DC0A 4XPGH 5CD5D 4JKWA 5HYSA 4XC1H 1C12B 1TZIB 1AXTL 2IBZX 3RUGF 4RSVA 4F3FA 2EYRB 1DUYB 5DR5H 4AIZA 3ARPA 3P4MB 4PFEA 1KTKE 1BM3H 1AGEA 4OZFG 3KPSE 2R4RL 5IEKB 3S35L 1MI5E 1PG7L 2BHUA 3LDBB 1NL0H 1P84K 4XX1E 4YDIH 3SDXE 5DLML 4D0BB 1I1RA 2IBGA 4R90L 4WO4B 4JRYB 3CLEL 3FO1B 4C56A 1K8IA 4U1JA 1JN6B 5ECJE 4M00A 4NPYA 2H9GB 5J1SC 3EIFA 2X40A 3KPSA 3H9SA 3RWGB 2W60A 3W9DB 3WD5L 3DVNA 4P3CH 4X6EA 4UV7L 4HT1H 3WXVH 2ZUWA 3QJHA 1JI2A 2XT1B 1CBVH 3CIQA 4QRRD 4APQC 4OKDA 3VXQB 1BQHB 1A3LH 3G5XA 3O11A 3M17B 1NCWH 4BZ2L 4OZGB 3L1OL 1L9MA 4RIRB 5DUPH 3QIUC 5KOVC 4L4VB 4KPHH 5I1CH 4RWYH 4W68A 4FQIL 2V2WB 4OTXL 4XVTH 1YEKL 3JWDL 1S9XB 1EEUA 2DTMH 1C08B 1NMAL 2PYFA 1SBBA 2CQVA 1REIA 5JIKA 4D3CL 1A6UH 3ILPB 2C1OB 5F7KC 3BO8B 1NBZB 3VFPB 3N1QC 5J4MA 4HF5H 1VADB 2QHRH 2IEPA 2X9YA 1VFAA 1MCHA 3WE6B 4BYHA 1I7UB 3HMXH 1G84A 3FMGH 5DSCB 3JZ7A 1DQJA 1OM3L 2IPTH 1CE6B 2R23B 1RZJL 3KPLB 4MSWA 5MEPA 4U2YA 1F4XL 3SDAB 4JDZA 4WENB 4PGZA 1LE5B 3FN0L 2KL6A 1PLGL 3OAYH 5FHAH 4C54A 4GKNB 2O5ZH 4NCC2 3P3YA 5EU3A 5DDHA 1NCCL 4HHAB 4U3CA 3ZKSD 2NY7L 2XNAA 3OHXA 4ZSOE 4H88H 4PJ5B 2B2XL 3MLSL 4CVUA 3RNQA 4LMQE 4U1GC 1PG7W 4OLUH 5C7XL 2X7LA 4I9WE 4P46B 3SDYL 5DD1H 5GSRB 5DJAA 5IW6B 1QRNB 4LKCB 1A7PL 5D7JD 1NBZA 2FH8A 4YFEA 3FCTB 4Y5YC 4JRXD 2EIZA 1FFPB 3HE7C 3RWJA 1MY7A 5H35A 5KBNC 4UTBL 4NQCD 4HXBH 4AL8H 3P0YL 1IGFL 4GMSL 4HBQA 4O5LH 4MJIA 3BPLB 4XI5D 1KLUA 4RMVA 1YEDB 1YY9C 1QSVA 4R0LB 4WTZA 4DVRH 4FQHA 3CCHA 4OZ4A 3SY0A 1WFNA 1NGWA 1S8DA 3B5GA 2QQKL 5I1HL 5LXGH 2V2TB 5J13B 2NY2C 1CD9B 2P5WD 3RWDA 3ZE1F 2FJHB 1CLCA 5CEZD 4A2LA 3BKJH 3O3DA 4PUBL 4Z7VB 1JWUB 3W9DA 4QHKI 5DJDA 3SE3C 2X4QA 3DJ9A 3LKNB 1T5WB 4NPYB 5DJ8B 5EDXA 4XBGB 1MREH 4RISH 4YHKH 3HE7A 4EXKA 4PP1C 2R0LL 1WTGT 1TVDA 2D4FA 2OBGA 4OLUL 5T1MA 1RZ8B 2IALA 3LH2H 3D1MC 4R26L 4O9HL 1NFDF 2HWZL 1NLBL 2KZ1B 1T1WB 1CGVA 1DCLA 1K4DB 2X70B 4P23D 3NH7L 1MCEA 4KK8C 1E6JL 2AI0L 3O6FC 5H37G 3EFFA 1OD9A 2X42A 5TE6L 5DTFB 2VUYA 5F97E 4KV5E 1UCTA 3PHSA 1EEYA 3G6AA 5ESAA 5BQ7A 2PW1B 1DLFH 2BDNH 3IAPA 4EI5A 3QWRA 5D2NA 3MGAA 4LSVH 3A0OA 1YQVL 3FFDA 1FO0A 3VG0H 3TFKD 1QSEA 3C9NB 2L7JA 3QG7L 2FR4A 4TSBH 3FKUS 1K6QL 4PTTA 4NM4H 4Y5YB 4JM4L 4OGXL 2BVPB 1R5VA 1MFAL 1LO5B 3KYKL 4M3JA 1OCWL 3C8KB 4PRPE 3T0EA 1I7RA 4HK0A 3SPVA 4YPGB 2OTWA 4J23A 1TZHA 2M26A 1X5ZA 4O02L 3RWCB 4HWZA 1IKNC 4PLOB 1DBML 3LEYH 1A6VH 3LN9A 4X4XA 4U0QB 4EUPH 1WFUA 4JFPB 1N6QL 2EDYA 3O4LE 3X3GH 3QULA 4N1EA 2EC8A 2YC1B 5FYKD 2B1AL 2CDEA 1JRHH 3D0LB 1MI5D 4CBPA 1DUZA 3TA3A 3KPMA 3ARGC 1ZHKA 3HE6A 1R3KA 4WI4A 3PABB 5GS0D 3OL2A 5K9QI 3CDCA 1MLCA 4I2XE 3HR5B 2NY0D 3RUGB 3MRNB 3D39D 2OXHA 2CRMA 4AG4L 2YSSB 4XAWL 3OKKA 4QXGL 4WRLA 3VWKB 1R3LB 1BECA 4Y89A 1TVBA 3BD4A 3ZLQC 1HNGA 5DEGA 2QSCL 1AHWA 5JXAL 3T0EC 3CGTA 3MV01 2XICA 1FCGA 4G6FD 2PCPB 5T1DL 3UJTL 4YNYB 4ZFZA 5C6TH 3A6OA 4IDJL 1YC8A 2HJFA 4AEIL 1AGDA 2J12B 2RR3A 2IC2A 3UJTH 2FX7H 2VLJD 2DQHH 3NH7H 4D0CB 4XPFH 5EO1B 3T77A 1IAKB 5ITBH 3ARBA 3QZWG 1U8PB 1KFAH 4PTUA 4L9LA 1BM3L 1BEYH 5D71H 3N85L 4KTDL 1HI6A 5AUMB 3TCXA 4EIGB 1IE5A 3HB3D 2CKBA 4XCEB 5DR5L 5DZOA 1LEIA 1JGLL 2ZZUT 4C4KO 3ARDA 1DJSA 4DN3H 3WHE1 4OLXL 4WUUA 4QWWC 4PJ8B 1R3JA 1CD8A 2JE8A 3MO1B 4ELMA 1C7TA 4M5YH 5SWZB 5T5NG 5DI8B 4X7TB 1PKQB 4LGPB 4BZYA 4E0RB 4NZUL 3IF1A 1DBMH 4OSUL 3WIHH 3P9LA 3FB7B 1RUQH 3VFMB 2H32A 1Q9WB 5LGHL 2VLKD 4MJ6B 5DD6B 1NCAH 4NWUL 1P5VA 2JJSC 3OKNB 1MCNA 4OD2B 1BIHA 1A6ZA 1JBJA 5DMYA 3BEVA 1YMME 1HHIB 2LAAA 1D5IH 5HDLA 5IB5B 4YHPA 3T3PF 3PP3K 4NJAH 43C9B 3LKQA 3GSQA 3ARBC 1LMKA 2GY7B 4G6MH 4QXUL 5F1KC 1L0XA 4UNUA 3ULVH 1HH6B 3C5JB 5JOFA 5BXFB 1H5BC 3MV11 5ID1B 1LDSA 3MFFA 5JQHC 5TDPA 2NY4C 3HCVB 3INUH 1FYTD 4ZFOB 1B0RA 4JO1H 4LASL 1INDH 3EJZD 1LK3L 5SX4I 3MXVL 2HH0H 1GOGA 4ZUSA 4HCRA 5GS3A 4H8WC 1X5AA 2MHAA 4NKQB 3UYOD 3H9SD 2E7LC 3CFBA 1NGQH 4RFNC 3MLSH 4HJJH 1WZMA 1KCVL 1MWAB 5ICZB 4ACPA 5D5MA 4FQXB 5BRZD 3QPQD 2FHBA 4LLQB 3EJZC 5D7SL 1J0KA 1WT5A 3K8MA 1GC1L 3IDXL 2DQUL 1KT2A 4WY7H 1LE9B 1GC1C 4OD1L 1H0DB 1G7JA 2CO7B 4JFQB 2IF7A 4S1DD 3ILQC 2XKSA 3RI5F 3L3KB 5I8EB 1CD1B 5I16B 3B2VL 3DARA 4D94A 3MLYL 3SKMB 5A2KH 5C0GB 4V1DE 4PJ5E 1I1FA 4LSSL 3CUPA 2YD7A 4M8QA 4XNUL 4H26A 1LO0H 4OLYL 5DEZA 1I3GL 4FXLA 3U4EA 2WWKT 4P2OA 3A6BL 4JPKH 3FN3A 4W4NA 4K9EC 2QQKH 3JV4A 4NJAL 1X4XA 2CRZA 1UXSB 5BOZG 1EDQA 2AJVL 4L1HA 1OP9A 3QNYA 4ZS7L 4RWHA 1XIWD 2YPKB 2I07A 2X9XA 4P99A 2QV2A 3GMMB 2NR6C 1RUPH 1E6OL 3SGKA 1F6AB 2GT9B 4LKXB 4KHXL 4PJHF 3VXTA 1C1EH 2XFXA 5E56A 5TQ0H 3ESVF 1RK1B 5KJRL 3VFNA 1BFOA 2Z31B 3KHQA 3RUGE 5GRJH 5DT1H 2HJKB 3V6BR 3BJ91 2B4CC 5GGVY 3SJVE 5D70H 1QSFB 4OD3H 3O6KL 2YMXH 4PJCE 1KEGL 1Y6NR 5HYJD 4ZXBD 5D9SB 4P59H 5D1XA 5C0BD 5FDWB 4YHZL 1AP2A 4NWTH 1OWWA 4HS8L 4WGVB 3BSZL 3VFGH 2BMKA 5JW3H 1A47A 3ARDB 4WV1B 1RIUH 5D7JC 3EGSB 1XEDA 3U6RB 4DOHE 4OLYH 1D5XA 2GCYB 5F96L 1ZGLM 4XBPA 3R8QA 4WV1C 3X13B 3GHEH 2CDFB 3L3GB 2X4SA 3RX7A 2UYLB 1IAKA 4Z76B 3L9RA 5DS8A 2CIKB 2I9TB 4DGVL 3EZJB 5D72L 4Z77B 2J88L 2K7QA 1N5AB 3SE8L 2C3WA 1OHQA 3HFMH 3V52L 2ZSVB 2FGWL 4LIQE 5CMAB 1A6VL 2N1KA 1MFBH 3BMVA 2XQBL 1U3HD 1JNLH 3KPRD 2P43B 3HRZA 3QNXB 4O4YL 3W82A 1ND0A 2GJJA 5K33A 2R15A 5KSUB 1NCWL 3C60B 1T5XB 5I73C 1HHJB 5C2BH 3VW3H 3B3IA 3RTQC 5T3XE 3UTQB 1LVEA 1I7TA 2X5PA 5EOTB 2X6MA 2HH0L 3QUML 4YZFF 5DUMH 3VA6A 1OVZA 1FCCA 4TUKH 2VXQL 1DUZB 5DUPL 3RPIA 3TA3B 3INUL 2Y5TA 1W0VB 4KZDL 1Q72L 2YC1A 3IGAA 4KVNH 1EMTL 4RRPA 5I1GH 4G9DB 1NEUA 3IDNA 2A9ML 3ARSA 4KKBC 3ECBA 4F7EA 3L5WB 2O5YH 4TOYL 4G8FB 1T3FB 3QUMH 2RIKA 4WW2B 3S9DB 2AKRB 4U1SB 4GAYB 1P5UA 4JCMA 1QUNA 4LU5H 3QEQD 1J1OH 2Z4QA 3OSKA 4YDIL 2B8OT 2ICES 3IDGA 2JCCE 5D6DA 1BIIB 5F1SA 2CO6B 1J1PL 2D7TH 2JJWA 5ICYB 4KUCF 2I25N 1YMMB 4XXCC 3ULSA 4ODHL 1U6AH 1KULA 3OGCA 3QISA 3BKJL 4PUBH 4RA0C 1XF3A 2H3NA 3IU4L 2H45A 3NTCL 3OMZA 1IC4H 4PLJD 4QO1A 4PBXA 5DFWH 2F53D 1XF5B 3HA0A 3R8BB 3V7MA 1KEMH 4QLRA 1CDJA 4KI5E 1K4DA 4RFOL 5CZXC 3MGOB 1OTTD 1ZA3A 2RGSA 1JP5A 4JZJA 4OLWL 5KS9B 1JTTA 2C4FU 4GMTL 2XZZA 1Q0XH 2P24B 2UVFA 3BQUB 4Y8DC 5GIRB 1IAIM 4QRPE 4JFFB 4MCZA 4R2GB 3RGHA 4S1SH 4LF3B 1AR2A 1BVZA 1LO2L 1MLBA 4NBZB 1KJMB 3IDUA 4XBEH 3TH4T 1JWUA 2QSCH 2VN4A 3IRPX 1KIPB 5TPWH 4UTAL 3KS0H 5E4EB 1VGEL 1YUHB 5J7CC 4ZD3H 4G7YL 2YMXL 2NNAA 5I1IL 1S78D 1A1OB 5EORL 3BGMB 5ERWA 2YD1A 1X3DA 1ZHLB 4XCNA 5F6IB 4V1DA 4KZDH 3BI9X 5IMMB 4FQHB 1QR1A 3U7WH 2AEIT 2D03H 4XCFH 2C5DC 5A2JH 2VLJE 5IHLB 5D7IA 1S5IH 1UEMA 3Q48A 2OJEA 3TIDA 3DI2B 1SYVA 3P4NB 3F8UB 3MA7B 4KMQA 2OYPA 2MNUA 3U7YH 3QEGH 2E9WA 3W81A 5I9QC 3RWJB 4JVWA 1ADQL 5FUCE 5ALBL 1T1ZB 1V8HA 1HSAA 3ZKQD 32C2A 3PWPD 5ETUA 3D25B 1E4WL 1KENH 3C8DA 4WWKB 2MKWA 4LKCA 3GI8H 3QFJB 5CP7A 3TBVA 1LNUA 1I8MA 1DP0A 1WZLA 1XR9B 5C0AD 1BGXH 4KDVA 3OX8A 3FRUA 4JREC 5A2LH 4I0PA 1G0DA 1SJVA 4ODBD 5BS0D 2XNAB 3S34L 3TO4A 3ZKND 4XNZC 1CXKA 1M1SA 4P2QE 5EB9A 5KVDH 3QQ9C 3QDGE 1YPZB 1A0QH 3SDAA 2R0ZH 4YGVA 4ZOCA 4NZTL 5E8DH 4WFHE 4X9IA 5CKGA 1CXFA 4F37F 4QCIA 2FHFA 3STZB 2XXMB 1NMBH 2PTTA 1VGEH 5J89A 4Z18A 3ROLB 4PRNA 4U4BA 5DK2B 3VD4A 1YY8A 2FL5A 2BY0A 4PJXA 1QQDB 1ZGLP 3LB6D 2DYPB 1GAFH 2J8UF 1JF6A 3TBSB 3DROB 4PREA 3ILPA 3WV0A 4ELME 3MNZB 5FECA 1YDPA 4FQJH 1J05A 4X7DC 4Y4FA 4DEPC 2P5EA 3FO9A 4P46D 5F9WB 1T20A 4RFEB 3DMMB 4P4RA 3MNWB 4W6YB 3IDYC 4X5XA 2DQJH 3FB5A 3LKRA 1IEBA 2BY3A 1W8NA 3B5TA 3L3OA 2V2WA 3S96A 4UBDC 1IKNA 2NY5H 4M62H 4YHIB 5T5FL 3Q1SH 4LMQI 1EAJA 2J7LA 4Z0BH 1VGKB 3CMOH 3GUTB 1OAXL 3O6FB 2P8MA 5L88H 4Q9RL 2X4RA 1NANI 3QHZH 4FG6C 5EC2B 2JB6B 3TA3C 3ARGA 3NTCH 4XC3L 1DSFL 1SJHA 2FYYB 4PJAE 3UPCA 3SOBL 4EN3D 43CAB 5F9JA 3GNML 4W70A 3EO9H 4BM7A 2VZ3A 4Z7QF 4LSRH 5HYQB 4P2OD 1HIML 4M48H 4LARH 1CS6A 3BXNB 3FTGA 2H1PL 1KC5L 3ETBF 5CJXA 3FQWA 1KCUH 1P7QA 2QKIA 4XH2B 3D2UD 1X5XA 4KDWA 5CEYB 3VH8G 4KTEH 2J4WH 5JDJA 1A3RH 4KVCH 2P8PB 1QHPA 2R0ZL 3O41A 4XGZA 5CJOH 4Y4HD 1MEXL 1INQB 3MRBB 4LU5L 4POZC 4U33A 1DN2A 4ZS6C 1INEL 1X9QA 2CSPA 4EN3B 4HMEA 5D8JL 1SY6L 4U1NA 3UCRA 1S7UA 4X80L 3UPRA 2OZ4H 4BZ1L 1JGDB 2V17L 3N9GH 3QA3A 5D7LD 3SKJH 1KOAA 2XYCA 1EEQA 1T04B 4LLMB 2KKQA 1YYML 4MA7H 2JELL 1MFEH 1X7QB 2WSKA 3F5WB 1PJ9A 1WBZB 3MZGB 5D2LB 3WCYA 4CRPA 4A6YH 2EYTB 3WJLA 3CVIH 2DICA 4TTDD 1MCSA 3DMMD 2EKJA 5E5MA 4KI5F 1IARB 1LILA 4NKDA 4NNPL 4QRQA 3FOMB 4NFDA 3SE8H 5E1HB 3HUJF 4I3RH 3OKDB 4P46C 3OKMA 5T1KD 2W1NA 4NC2B 4NBXB 5IKCA 4JY4B 3IB4A 3RNKB 1T1YB 2ZUSA 1HILB 4ELMF 4O2FA 1M7XA 2BXYA 3QFDA 4OFKA 3QYCA 5IBLD 4N1HB 2BNQB 1MRCH 5CKAA 1LEKB 5M95B 2YPVH 4XHJD 3PHOA 3ZHDA 4AEEA 3OKLA 2JTDA 3RVUC 2AJYH 3LIZH 3NFNB 1BD2B 3T2QA 4JHWH 1I4FB 4KDTC 3NIDE 5ENWA 3D39A 3FFCD 3GJEB 1ZT4B 1I75A 5C0BA 3QUXD 3CC5A 3PGDA 1HZHL 4YC2C 3Q0HA 4JB9L 3P9WB 4HC1L 3FQUB 3FO0L 1MIEH 4L4TD 4Y4HA 1V3KA 3DV6B 1UM5L 4F8TA 3F58H 4ZO8A 3MFGB 1AE6L 1RUAH 1WT5C 2WV3A 5HHVH 5C71A 5MEOA 4PJFE 3BHBA 4F7CA 1QFOA 4FQ2L 4LPVA 2XN9B 4U1KA 5DVLA 3T2NH 5F9OH 4HX1B 1KEML 4XNMB 4XP1H 1RZ7H 4AZ8A 2PW2A 3LEVL 2VLKE 2R2BB 4ODVL 1S7RA 5C0JB 5KANI 4ZUWA 3U9UA 3I6GB 1CFBA 4OGAD 4DN4H 3OZ9H 3ALPA 1G7LB 1AQDA 4PJXE 1FFNA 1MSPA 4G43A 5B8CC 4YWGH 2CGRL 5IB1B 4Z7OF 5IFHH 2X9WA 4QXTB 3HI1B 3W39A 1QD0A 1OGTB 4XPHH 4XP5L 1OSZA 2CRIA 2NY4B 3CFEA 2H26A 1JVKA 1NUNB 3TBWA 4RAUB 5AZEH 1FGVH 4J4PA 2GITA 1IGIL 1ZS8A 3PDOA 5H2BB 1BBDH 4TNWK 5AZ2H 5IFJB 4YHML 3TLRA 1UFUA 3RWFB 5EZIH 3KLDA 4P5MB 1PYWA 1ED3B 2NTSP 3B9EA 4IRZH 5C0ND 5EPMA 1E27A 4LSSH 1ZLUH 4Y5VA 2QQQA 4JM2A 2RBLA 3JWOH 1YEEL 1CE1H 4R2GD 2R8SL 3QO1A 2CUHA 4S0TD 3QR2A 1IC1A 3UDWA 3BQUD 1AR1D 2V9TA 2A1WL 3L3JA 3QXUA 1G9MH 4NQED 5C3TA 4AK1A 5HYSG 4LAQL 3Q6FA 1NMBL 3S3SA 1P9MA 3BP5B 1G0YR 3WMSA 3NIGE 2ESVB 3GIZH 3O45B 5E03A 3ULVL 5JOEA 3CK0H 1MRFH 1WF5A 3MRQA 3T2OA 1HWHB 1VEMA 3KPNA 3PQYE 3RZCD 4R4FL 1YYLH 2YUXA 1YMMD 4XVUD 1DFBL 1RI8A 4YHKL 5EZJB 1YEHL 3D5OF 3H9YA 4LLDB 5EZLB 1FVEB 1NGPL 3PF2A 4PJHE 5DMKA 4XP5H 3VFVA 2NY6C 4G6AD 4YXLL 3BE1H 1JWSB 3VXPB 4KUZL 1QKZL 2VOTA 3F7RA 3E8UH 4OCXL 3L95B 4RNRA 1UJ3B 3SEPA 3WIFA 3EYOA 4TPRL 4S1QL 5CZVL 1TTGA 3RVUD 3MJ9A 3GMPA 1BWWA 1VFMA 3CFKA 1NDGA 4OZIF 2EDRA 5EBWB 4DVBB 3IXAA 2R0WL 3PWPA 2V7NB 1MFCH 3V4PL 3N85H 3S37X 4GOSA 5C0FB 5HJ3A 1WZ1L 3JTSA 1NAMA 1I9IL 1MI5A 4FQQB 2R69L 4ZOBA 3MMEA 1M6OA 1EHXA 1WJ3A 2JKXA 2ZCKH 4HFUH 2FH6A 4N1CA 5HBBA 4IS6B 3DX7B 1OAYL 5CIPB 3QSKB 3O81A 1A6PA 4M61A 4YZFE 3T08A 1CL7L 2OMBA 1EFQA 4W4OC 3NZ8B 3MOBL 2EKSA 2PYED 5C0CD 4APQA 5L0QB 1RFDH 2ADGB 1WVZA 4AEIH 4GKSA 2G5BB 5BV7C 2WBWB 1U8QB 4HZLB 1WEJH 3X14A 3ZT5A 1XF2B 3LN5A 1O7VA 4WFED 3RA7H 3OR6B 1KXTB 1WC7A 3FT3B 3PIQA 4NQXB 5F44A 1FO0L 4HS3A 1OAYH 2B20A 4ISVA 4KHTH 4DWHA 5T1KA 3SDCC 2AXGB 1DN0A 1QO3B 2P5ED 5FHBH 2WZPD 3IFNL 4MDIA 1OOAA 1FL3B 2YUVA 2ZSWA 5DMIH 3CX5J 1I3RB 1MHEA 5LCVL 3U0PB 3OB0H 4XAKE 4XPTL 2DQTL 1T89C 1DFBH 1FZMB 5SWQA 4QYOB 1YN7B 4PD4J 1VPOH 3TPUB 3VI3E 3VXME 5D6CB 3ULUF 2JK5B 2K7PA 3QNZA 1S9VA 4RCAA 1JUFB 2KH2B 2BP3A 4S1QH 4ZYKA 5E4EC 2OQJA 2ID5A 2AXHA 1UCBH 3O2WH 3VU2A 4X7CC 5DA4A 3E3QC 3PP3H 5E6ZA 3IKCA 2NY2B 3B9KD 3DECA 2P46B 5HYFA 2YS4A 3A67L 1WCBA 3QUMA 4JM4H 3BUTA 3QZWA 1EFXB 1C16A 3R0MA 3KS0J 2HFEB 3PWUB 5DRWB 1P6AB 1BAFH 1UVQB 4NUGH 4PG9A 3QUKB 2X4TB 4WJ5B 1KPVA 1V5JA 3VXNA 3P0VL 3F7QA 3VXUB 1JI1A 3G5YB 4JLRB 3BJLA 3P2TA 1OARL 4FXGA 1AKJB 1BBJA 4WU5A 1IJ9A 1NUDA 3RDTD 1JPTH 3NCBB 4PR5B 4MD4A 4CNIA 4CL7A 5IVOA 4Z8FL 4ESKA 2XI9A 4PRIB 2FZ3A 3RIAK 1CFVL 4LVOB 4NHCL 4JHZA 5E5UB 3UZEA 4L8BA 4PJHB 4WW1A 4CU7A 2KQMA 1UKQA 2YUZA 3QQ3B 4L3CB 4NKMB 3FHAA 4HV8A 5F8RC 1A7QL 1A4KA 1XCTA 3ZE0F 3I6LE 2X41A 2FJGA 3UMTA 2J3SA 2BNQD 1OP5K 4XVSL 2P7TA 4LNRA 3KNBA 4OQ1A 2F5AL 1FNFA 2CLVA 1WCQA 4JO4L 3SE3A 2Q76B 1J8HE 1ZT7B 1UH3A 4PPTA 5TF0A 3FB8A 1Q9LA 3AXLB 3H0TA 1FG2B 3MJ8A 4OFVA 5I71B 1VEOA 1F4WH 2ZOLA 3SDAC 5KTEH 4NZUH 1GGYA 1TNMA 2YEZA 4HFUL 4XMLH 3DYMA 4MNQD 5IIEB 1IT9H 2BNRB 5I0DA 1AO7B 4K3DH 1A6WL 5HGHB 1PAMA 1Q1JH 3PE9A 1LQSR 5IV2B 4JQIH 4WWKC 2FCBA 3QDMA 4KZEL 1RFDL 3EOYG 1QVOB 5GGUA 4OBSA 4GRLD 4JQIL 4E5XA 5FGRA 1TCRB 2VE6A 5JR1H 1CL7H 3O6KH 4GBXC 5D7LB 2IAMA 4LCYA 4EUPA 4M3KB 2QSTA 1S7WA 4KK5C 1C5CH 1MIML 5FYLE 4LDEB 4I3SH 4NT6B 5MENE 1K8DA 3JTTB 5HHOA 2BRRL 1AY1H 4IDJH 4EVNA 4NQDE 1F00I 1V7NH 4B5EA 4K7PL 5BVPL 3BP6A 5HVGB 5E2TH 5BS0A 1KPUA 4H0IA 4EEEA 5MERB 2EYSB 4K7PX 5TDNA 1U58B 3BWAA 3BE1L 3GSUA 1D5ZB 4XP6L 1XH3B 3O3EA 5SWZD 1MNUH 3UC0L 1F11A 5CWSB 4PJXF 5FM5M 4DCQB 1MJJA 1RZJH 2Q8AL 1JHLL 1MQKH 3I2CH 3MBXH 3MCLH 3U0WL 2ADIA 4Q9BA 3UYRL 3DIFA 4JZOA 2Q8AH 3VMNA 3O2VH 2FATL 4AH2B 4TNWF 3MROA 5HGAA 4XNUH 1KCSH 1IGJA 5FCUH 1WFTA 5JHLL 3U7YL 1AD9A 1P1ZA 2G75B 4LSVL 5CEZE 1BZ9A 1FN4A 4NRZB 3AS1A 4N90E 3B4NA 3EDDA 3GGWB 3V6FA 2HMID 1RMFL 1NAML 35C8H 4MD0B 4NHUA 3WLWC 1NJ9A 4EDXB 4F33B 4OZHB 5DD3L 1SEBA 3IVKA 1Z9MA 4HDIB 5IVXE 1UKSA 4KY1L 3VWKD 1AHWC 5MI0C 2FNBA 3GMOA 3I75A 5I15L 4JN1L 1A7OL 4NO0D 5KW9L 1U95B 3RHWF 4P5TC 4O2EA 5E6IC 1KUMA 3S98A 1F5WA 2P8LB 2IG2H 4PG2C 5EOQL 5AZEL 2X4PB 4RA3A 3HC4H 2P48B 1MCDA 4QY8B 2DYPD 3ARGD 3TH2T 1QFHA 2WIMA 2HLAA 4S1DC 1U8KA 3D18B 4RGOL 1A4JA 5E6IB 1YNLL 4LEOB 2EDTA 1UH4A 2ATPB 2VERN 2VLRD 5E00B 3DXAB 5IB4B 1FJ1B 2QR0B 4GAJL 4EIZC 3P4LA 4HJGB 3IFOB 2R4RH 3RP1A 3VFWA 3MOAH 4IHOA 4RMWA 2D7NA 4G9FD 3H9HB 4Z7NE 3IDMA 4TSCH 1VEPA 4FZ8H 2NPLX 4BKLB 1UB5B 3CDGB 3KPPA 4L3EE 3RWHA 1J8HB 5BV7H 4PG2A 1S7TA 4M1DL 1MCIA 4M5ZH 4AEHH 3WJJA 1NC2D 2X44D 4Q6IC 2W0FA 1B9ZA 1N2RB 4PV8A 2X4UB 5FO8B 4GRWE 4Z0BL 2A74B 5FF6A 3MLZH 2EDXA 3RBSA 5EUKA 1H5BB 4PBWD 2LU4A 2X89A 4ELKB 1AO7E 1U8NA 3NZHH 3RX8A 3RAJH 3L5XH 2IJ0C 5EOCH 3BZEB 2HG5A 4MXQD 2DQEL 5L8JB 4TNVF 3MV7E 3QHTC 3L7EA 2ILLA 3LRSA 4Y4HC 2YA0A 1UT9A 5F88A 1NC2B 4P57A 2ZJSH 4FZEL 3BP4A 4C57C 5EOQH 1RY7B 4Z7OE 3WUZA 1J8HD 2ERJC 4I3RL 2FHCA 2CIIB 3LEXA 3C5ZA 2IPTL 2SEBA 1CLZH 3MREA 2H8PB 1ACYL 4NM8H 4D9RE 1RZKL 2R29L 4H5SB 3BDYL 3FRPG 4N8CH 2XRAL 5FYKL 5I1AA 5MENB 2HJLA 3HZMA 4QHUA 3VFSA 4BH7A 2LVCA 4R7NA 1G6RL 3SN6N 4M7JL 1DL7L 4PY7B 1CFSA 4M43H 2PKDA 5E9DE 2DQCL 4MAUH 2Z92B 2K3TA 2FEDC 4CN6A 4NQCB 1JYVA 1CLZL 4PJGF 4YC2B 4DAGL 3BW9B 1MJUL 2VTFA 3L3HB 4JRXB 5I2IB 1CICD 5FUOL 4GG8B 5DQ9A 2R1YA 1S5IL 1WZKA 4NCDA 1OF2B 4MQ7B 2DIBA 4KJWD 4DKEL 4R96B 3IJHA 5T1LD 3S36X 5TFSL 3GMLA 5HTSA 2W65B 4GAGH 4DEPB 2J8UE 2W0FB 4NO0B 3KJ4C 3G5ZA 1TJHL 3NACL 4UIKL 1JPGB 1N8ZA 4M7LT 2VZSA 4O58L 3GM0A 2QSQA 4YHYB 2VQUA 2XA8L 1NGXA 5FV1L 1TJGL 4PJDF 1ZVSA 1G1YA 2DLFL 2CUIA 5LAXB 3HZVB 1CIUA 4KU1A 2BCKA 1NKOA 1Z5LA 2YUWA 3BZFA 2QADC 1VA9A 2RQ8A 1S3KL 4RFNB 1F02I 4L5FH 4ZD3L 5D1QC 2VL5A 1OT1A 3BIKB 4Z6AT 4M7KL 3KPOA 5TPWL 1BBDL 3KYMB 3LKOB 1YPZE 5D1XD 1AXTH 3S5LB 2R0LH 2AV7A 3GBNH 1CGXA 4I1NB 2X4PA 1QRKA 4G6JL 1Q9OA 4QTHA 3PUCA 4HH9A 4ZUTB 4P4KD 2VAAA 1EXUA 5DRXB 1U95A 4H0HB 1VESA 1QLRB 2ENSA 3OXSA 3BH9A 2GUOB 3GSRA 5I76B 4ZFGH 3W0WB 1PDKA 4KK8D 3H7LA 2CMRL 5JW5A 1U3HB 2YK1H 5EIIA 1KJVA 3QJFA 3TO2A 2OJZL 3C87A 1F3JA 1AC6A 5CZKA 3QAZB 2EXWC 3HE6D 1BZQK 4WI6A 2PXYC 3MUJA 4RGMC 5KW9H 1ZHNA 4MQTB 4PP1D 5JO5A 2WUCL 1KB5A 1FNSL 3MROB 4MNQB 4GUPA 4Z7QE 5C0AA 5ID0A 2I5YH 2X4NA 2YA1A 2NY5C 1DDHA 1UG9A 3V6OA 1S7QB 2CK2A 1P4LB 1CICC 2ZNWA 1HQRA 5E2VH 1MH5B 1CLOH 2VKWA 1XH3A 1OAQL 2R56H 2AK4B 3TVMB 1TJGH 1VSCA 4URTB 5I1GL 5E2UH 5EO0B 4X6DB 4B50A 3VFUA 4QRUB 4UINL 1ITBB 4CDHA 3ZDYE 3DUSA 4YHMH 2IFFL 2IPKA 5FCUL 4J1UB 5JHLH 3S35X 2BVOA 3JBG7 1R24B 1MAKA 4NT6A 4NNXB 1CFTB 3LKPB 4XWOD 5M94B 3GMNB 4WCYH 4XXCA 1XGUB 3CSBA 5HHME 1YECH 3BPOC 4HEME 1RJZA 2N56A 4OSUH 4F7PA 4XCFL 1QPPA 1ZK9A 2E7MA 4NC0B 2GTWA 5C8JA 1AO7A 2X1PA 3WFBH 1VFOA 3OPZL 3SCMA 4XNXH 3IFPB 3DRQA 4WUKL 1HQ4A 4C56E 3RU8H 3MUZ1 1T0NB 4GJTB 1AH1A 3MRIA 1CLYL 3EYVA 5GS0C 5HDQH 3LHPL 5TF1L 2HT2C 3BPOB 4OGZA 1DBBH 2ARJA 4MB3A 5EU7C 1ZT7A 4OTXH 3WHXA 4L8SB 2FSEB 3F6LA 3REVA 5JTWA 3KNBB 3MV9B 2P7TB 1I9JL 2J8UB 2QQLL 4JFEB 1HCVA 3UJJL 3CPLB 2W59A 1FH5L 1TXKA 3MRRA 4PJ7A 4HMCA 1AGCA 2G60L 4WI7A 2CD0A 3MRLB 1KACB 3ABZA 3UTSD 2XKNA 1W0WB 3BZ4B 4OM1L 5EC1A 5L2JA 3BWUC 3RWEA 2EH7H 3Q5TA 2DWEB 3QCUL 4FQXD 5BRZB 3PV6A 5F3HB 4ONHB 5ADPH 1JZ5A 3I9GL 4HIIB 2H1PH 4OKVA 5IQ7H 5HYJA 2FIKB 2VR5A 4CVWA 1J0HA 2A0LD 1VACB 3T04D 3VDBA 2HN7B 4P0DA 5CHNB 1QTYT 4JO4H 1ZWIB 2Z35A 1IEAA 2KPNA 4PJEE 4KV5F 1IL1A 4BSWB 1AKJA 2R69H 5KSBB 3MRDA 4CW1B 2F15A 4JHAL 2D3VA 2QADD 1FZJA 4L1DA 4Q58C 4Q74A 5HHPB 4ZXBA 3GRWL 2X89D 5H37H 5INDA 2DF3A 4ETQA 2XN9E 1K5NB 3PP4L 2XTLA 1P4BH 4M43L 3QCTH 3OPZH 3WL9B 4N5UA 3OAUL 4M1GH 3LVEA 3O4LD 1J1OL 3AREA 1EFXA 3QUXA 4MXWH 4NQEE 2DQJL 3VI4E 1WCBB 1Z3GH 1ZSDA 3G08B 3K81A 1T7YA 1C5BH 3NGBB 3MRFB 1S5HA 4L4VE 4QOKB 2NZ9C 3G08A 2IQAB 1GGCH 2RFXA 3ARZA 1RJLA 5I74C 4ZQKA 5FDYA 2DBLH 1QFWM 3TN0A 3PHQB 1EEZA 3DO3A 1NQBA 3SDCB 4XPBH 4ZO7A 1TQBC 2NXZC 1ZTXH 2DL9A 3MRHB 3GDBA 4PJ8D 1G7QA 4UT7H 1JPSL 5IOPA 5TQ2H 5INDB 5FYJE 3JVGC 1OW0C 4S2SB 1NGZB 2WBJB 4HFWB 1YN6A 1W72A 4FRWA 3U1SH 5C07E 5FUZL 1F2XK 1SEQL 1QO3A 3GBLA 2BFVL 4MLSA 4TUJA 4J3WA 3VWJD 2XPGB 1KC5H 4HMDA 2CLRB 1EBPA 5KVEH 5CHNA 4D9LL 4BK5A 1DQQA 2VXUH 4Q6IB 3BKCH 4PLKD 4HGWA 4PJIF 3T2PA 2PO6D 1HHHA 2BNUB 2NX5B 3SE4A 5C9KA 2ICWB 5BRZA 2GK0B 4OB5L 1U8QA 3GJFA 3T4YA 1J11A 3SKUD 2NY3D 3BZ4A 1UJTA 3DURB 2XKNB 3NCJH 4YJZL 4YHYC 4X6CE 4EQ3A 3WLBA 5DJ6A 4X0KA 2OJZH 1QEWA 4N5EC 1CZ8H 5E1AA 1JIBA 4GSDL 2HFGL 4OCLC 4G8EA 4UNVA 2DS4A 1KCRH 4JHBA 3I2CL 4FQQA 1MI5B 2YRPA 3C6LA 4LLUA 4ONGH 4UZGA 5KOMC 3SJVD 2JF1A 1DBKL 4MJ5A 5SV4A 3IXAB 5DT1L 1MAJA 3HC4L 3V6ZA 1S9YA 4Y2DA 4ZG1A 2UY6A 3VA2C 2C26A 1I8IA 4M7ZB 1IAII 2R4SL 5KVGL 1Z2KA 3D6GA 1CGWA 3V0WL 1CT8A 1JPFB 2YXMA 5F7YC 2DDQL 5KVGH 1XCQA 3LKPA 3T4AA 3VFVB 1D5BA 1T83C 2P4AB 2NY4D 1EAPB 1QRNE 3PWVB 2ITDA 2Q3ZA 3EOBB 1KG0B 5C0RL 4JDVB 3O6LH 3CD4A 4MHHG 2IQ9H 4JRYE 3D48R 4X6DA 4IRSB 3KHOA 3ARRA 5DD5H 5BZDA 4KKCD 5C07A 4P23B 4JFDA 5B22A 1SJEA 3ROOB 4U1MB 1X4YA 4IRSC 2D0GA 1J9CT 4FFZH 1CFNA 2E7LA 1Q94B 1N4XL 4JG1H 4XCYB 3VCLA 3GSWA 3VH8A 5FO7B 4X99A 3GK8L 3MXWH 2IANA 2IFGA 2XN9D 5L2KE 1B6DA 4ZSOA 2C7UA 4WDIA 5E5RB 1JRHL 4XVUC 4S10A 5C0DA 3W2DL 4HWEH 3ARFD 3LQMA 4R4FH 1J0ZA 2FX8L 3D87B 5DURB 3ZKXC 1B88A 5GZOC 2CXGA 3M1BB 1L7IH 1MCQA 1RPQA 4CADA 1PYWB 4ORGB 3EJJX 5D7SH 4LPCA 3VD3A 1RU9H 1TVHA 1MUJA 1DLFL 5ISZE 5FO7A 2P5WB 1H3VA 5GRUL 1XGPB 1ZLWK 3TNNB 1INDL 2GITB 2BNRE 1EVUA 1NGQL 3D9AH 3V8OA 1OB1A 5HSFA 4HKZA 3NIGF 3QUZA 1G9NH 1U8OA 3QDJE 4IRSA 4QXTA 2Q20A 2VLRA 4J8RB 2BJMH 3BX7C 4M7ZC 1ZOXA 4AEFA 4U49A 1FYTA 4PGDA 4MS8D 3P73B 1EAPA 2FATH 1IVLA 5K9OA 4YBLB 1ZHBA 4U2ZA 4XMLL 5IWLA 2ICWJ 3LAFA 5F9WC 2XKUA 1EJOL 2EO1A 2F54A 5JDSA 1MUJB 1TZGH 1XZ0B 3T8XB 4RX4D 2C1PB 4P2RE 4DTGH 1CI5A 1TTFA 5KZCB 4KFZC 3T0WA 5L8LB 1NCBL 2VDOL 5D1ZA 4BH8B 1HXMB 4GLRI 4HUXA 3ZT7A 1KF9B 2VDMH 4YBLC 4Y2DB 4WU7B 1BX2A 2BCKB 1TQCB 1XGYH 4G80A 3GSWB 1P7KB 5C92A 4RMRA 4OM0L 3QUZC 5C0AE 1I8KA 4J6RL 1OP3K 1CXLA 5GJSL 3OQ3B 3O4OC 3LKSB 3VD7A 3UP1A 3ZHLA 1LK2B 4P23A 3FJTA 4GW4B 4QRRA 5B39A 5KG9A 4UT9H 3MLRH 5IEHB 5C08A 2OSLB 4KTDH 2A6JB 3Q2CA 3T2NL 2DLFH 2HT4D 4QRPA 3E3QE 5K9KB 3BSZH 3VFGL 2X05A 2ITDB 1QEWB 1F6LL 1NFIA 4JREB 3HNSL 1NBVL 1KTLA 4JQXC 5DHXB 3TNMA 4NWTL 4NIKB 4Z7NF 3NAAL 4FTVE 4YHZH 5EBLB 4PJ7F 4FHBD 2ZUQC 1KFAL 4DQOH 1HZHH 2J2ZA 3P9MA 3QWQB 2BNUA 4PYHA 1UQSA 2PUQT 4M6ML 2I27N 4NQCA 4Z7WE 2X1QA 5CBAA 2DWDB 2H6PA 2MQ0A 3QEHA 2OX5A 3X12B 1DE4A 3D2UA 4DK3A 1BAFL 1FPTH 2CLRA 2HFFB 2V9RA 4M93C 4KKAC 2DN7A 4NUGL 4Y5XA 3VD5A 1S9YB 4M7LL 4P23C 2Y1VA 3V5KA 5F7DA 5DEFA 2EICA 4HFWA 1GYAA 2CR3A 3QIWA 4PB9H 3TN0D 3P0GB 4YUEH 5I15H 2B2XH 5HGGS 1JTOA 1G7QB 3PL6D 2SEBB 3THMH 4FNLH 1H8OA 1JNLL 1PG7X 1U3ZA 1FYTE 3PWLB 3PL6B 4YFDB 5DJZB 2YOCA 5GS0L 5E1AB 3PHQA 2IH3B 3UTPD 3OF6A 3TN0B 3S37H 3BZDA 1QFPA 5FKAA 1FVCA 5F6HI 1BD2E 1V3JA 3EOTL 4Z8FH 3WFBL 5F7HA 3U46A 1QBLH 4OLZH 3VXOB 2PXYB 1MFEL 4S1RL 4I5BA 1YEHH 1I7ZB 4Y5XC 4OCWL 5CJ8A 4CN4A 2VLME 1RZIA 4MAYB 3UBXI 4WY7L 4BFBD 4K94L 3WEXB 2BY2A 5FF6B 3V0VA 4H25B 5E8NB 5D7IF 5D8JH 3HS0A 1OTSC 1RHHA 1KCVH 3GZKA 1FPTL 4ZFFA 4EI5D 3CVHA 1KCUL 4X5LA 1XGQA 1Q9KB 3BESR 1UM4L 3QIWD 4KRPB 3W11D 4OD3L 1KEGH 3F7YA 3TYFB 3ULUE 1CICA 3FQRA 4HWBL 5IJVB 3U7WL 1R5IA 4JFDE 3GUTA 1CFQA 1RZJC 2FIKA 4JZJC 5JIPA 3DWTA 3LOWA 4E9LA 3OKYA 1ZA6B 4AM0B 4MNGE 5EUOE 5IK3B 3PJSB 1BLNB 2GFBA 5EIVA 4U1LA 1YEJH 5E7BA 3V4PH 1RJYA 3FQNB 1PZ5B 1T22B 4IRJC 3ELAT 4QY8A 4XNQB 2VKXA 1XGYL 4WEUD 3MCG1 4YX2L 1A2YB 2DYPA 2Y07H 4RRPG 3A6BH 3IJYB 3NIFE 3CDYA 1AIFA 3LB6C 4TPRH 1YY8B 5FGCB 4XTRD 4PRNB 4PJFB 3ROLA 5C1MB 1FO0H 1NFDB 1PFCA 2PO6A 4YDJB 4I8DA 5C0BE 2VZUA 3K8LA 2WK2A 3STZA 4N9GB 3O3BB 2P5WE 4LNVA 4PJGA 2F19L 1ZWIA 1OP3H 1UA6L 3D85D 3G5VB 5ACMA 4M1CD 4NHUB 3TH3T 4OQTA 4U6YA 4MYWB 4LLWB 5EBMB 5TDOA 4KTYA 4JPIB 5KSVB 1FIGH 4U0RC 1RIHH 3F7PC 3V6FB 2DQUH 4M7KH 2J8HA 3OKEA 3S4SB 4OKVB 1KLGA 4MQXC 4ZDHA 2B7DT 4X9FA 3B83A 5SWSE 3MR9A 4HXBL 4JFXB 5TE4L 1UGNA 4A2MA 2VSCA 3AB0B 5DD0H 5I17A 1IM9B 4MZ2A 3RVXD 1IAMA 4U05A 3OX8B 4X8XA 4YHOH 3UTZA 3RRQA 4FA8A 3R4DA 4NQVA 4X6CA 1R24A 5FA4B 2A83B 4Z7WB 2LVEA 3CPLA 1U8MB 4QF1B 2GSGA 4P5KB 1MJJB 5E8PA 2VDNL 2FSEA 3REVB 5I1EH 3K3QA 1T7ZA 1F3DH 1E0OB 2HAZA 1PBYA 7FABL 4N8PA 5JIIA 2IAND 1OAUH 2VDPL 3EDJA 2E8YA 5IVXF 1ZANH 1N3NA 1JPST 1HDMB 1P4IL 1MFDH 2ED9A 4MMXC 2Z8VC 3BP6B 3RKDC 3LN4B 3DRQB 2Y5EA 5IMMA 2OR7A 4OF5A 3IETB 5DVKA 4CJ1A 2DRUA 4GXUM 2MQCA 1LP9E 1M71B 1UACH 4NNPH 3QXAB 2GSIA 2G5RA 2GJ6B 1YUHA 3QUYA 1YEKH 5FYJU 4JY6A 1CVSC 1TPXB 3U9PH 4Z7UF 2D03L 5F89A 2WLZA 4EI5C 4U6YB 2B0SH 3WNPA 2BNRA 3B6SA 5IIEA 4J1UA 3GSRB 3TZVC 4A6YA 1B0GB 3N06B 4MA3A 1HDMA 2JCCB 1G7IB 3AXLA 2XY1A 4GKOA 1JF1A 3BDBA 4DUXA 2AJZB 1H9VA 1SEQH 1X5IA 3H42H 1J8KA 4YR6B 3FT4B 1ZA3B 5EORH 4HH9B 5ITBL 4GH7B 1HQRB 1BJ1J 1FGNL 2NY1D 2EIEA 2CDGA 4UV7H 4MD5A 3WSQH 3GJFK 4J7RA 2H2SC 3W9EA 3TJEH 4K3DL 3TBTB 2YK1L 1LD9B 4GG6B 1DEEA 3SQOL 3KPRB 4JKPH 5EBGA 1BFVL 2DLEA 4X6DE 2HFTA 3BEWA 2QL1A 5DQDL 4ZDHB 3O8XA 3QIBB 3HG1E 3DBXA 1CDIA 1E4XI 4NQDA 1HIMH 5GGSB 2VR4A 3L5XL 4MNGB 5EUOB 3CFJB 1HHGA 2Y07L 1HEZB 1U3HA 3EO9L 4RZCB 4IBLT 4WU5B 5BVJB 1XGQB 5HYEA 4P2RD 5LGJA 2UWEF 4PGEB 4ODSL 5CILL 3QCVH 2DJ4A 5CSZA 4LGRB 1L0YA 3TPKA 3X3FL 3ARDD 3LCYA 2Q86B 1T6WA 4HS6A 5L6YH 1AIFB 4AJ0A 5GS2H 4M1CC 3RPIB 4EDWL 4MA8H 2ADFL 4POYA 5CBEA 1OF2A 5EOTA 5HVHB 1CFVH 4YFLI 3VDCA 4OGXH 4RAVB 1XGRA 2OM5A 5DUBB 3MJGX 4JE4B 3QH3B 1QSFD 3G6JE 4XTRC 4G8IA 3MSPA 3DSNA 5IK3A 4LRNH 5HDBE 1G7HB 3T3MF 4WEBH 1MPAH 3NFPB 4ZYKB 5L0QC 3RPKA 5C0EB 1A9BB 3G9VA 5LAXA 4KI1A 2DJUA 5IB2B 1CFQB 3HG1D 5DGRA 1TMCB 4P3DB 4Z95L 1FL5B 3VJ6B 1T0PB 5I8CA 2Y4SA 1FC1A 1HCFX 2AJUH 3WNMA 1X5YA 1J0YA 1FIEA 1KIUA 2Z31C 1FL3A 3MUGA 5ESVB 4O9HH 4HW6A 2UWEE 5FUCC 1JHKL 4M1GL 4XBPB 2ORBH 5LQBL 3B5HA 2NY3C 1FFQA 1BQLH 1DE4B 2DQDH 2QADB 4K7FB 2OR9L 2FIRT 4F58H 2HTLD 1RZIB 4MAYA 2AEQH 4DGVH 4NQXA 1RD6A 3IS1X 4NQDD 3AMKA 1QOKA 3EYFB 4U6XB 2R1YB 4FFWC 5DUBA 1JFQL 2BC4A 3JWNC 4F7TB 1CG9A 4MS8C 4ZTPL 8FABB 5EZIL 2ATKA 4QHMA 3VWJC 2B1HL 2A6KB 3OKOB 3T0XA 5EO9A 4CUCA 3EDFA 1Z9SA 4FFWD 4WHCA 2V5TA 3BP7A 1IGIH 2M8XA 4RBPK 1VFBB 2Z93B 1JZ4A 4M7LH 1A3QA 2FLRT 3GSVB 4DVRL 3MTRA 2XACC 3GIVB 4HD9A 1U8HA 5DMJB 5IG7A 3FO2B 1RIUL 2XY2A 4Y16C 3VFSB 2WIIB 4DUVA 1FP5A 1N4XH 1J0JA 4KK9D 1GHFL 1RUKL 4PRHD 1D6VL 2WQRA 4HIJA 3JWOC 4JFED 4WI2A 4FN0A 1A02N 4XPAH 1EHAA 2V7NA 4X4YA 5IF0B 3C5ZB 4NQEA 2CIIA 4HSQA 3V5KB 4NQDB 2YPKA 3VGGA 4D0DB 5EBWA 3UO1H 2VXVL 5EU5B 4X8JB 3L1OH 3IDJA 2VDNH 5T1LA 2V5MA 2A6IA 4ODVH 3REWB 4UV4L 5JQ6L 1DBAH 5LWYL 3OV6A 3IS0X 2OP4H 3S36H 1Q8MA 3LPFA 3SKNA 3EYOB 3Q3GB 5EFIA 4JDTL 4GS7B 2YD6A 1UQSB 3TBTA 2C1PA 4Y2OA 3MACH 4GT7A 2BSED 1BVLA 4OIAA 1DBKH 1A6AA 1E28A 2OK0H 2DOCA 2CDGB 1EV2E 1JHTB 4TULL 3T09A 3NCCB 1WAAF 3KDMA 3MLWL 4KWUA 4LPTA 2W9DL 2DQIL 3HG1B 5GJSH 4CU6A 3MA9L 2F58H 5T1DH 2OP4L 4QRPB 4YR6A 3MRQB 3VXSD 2F19H 5HVFB 3I75B 2OMNA 1OGAE 1XFPA 4GW4A 2B1HH 1SEBB 3IVKB 3O6MH 4MB4A 4LGSB 1BPVA 2MHAB 4Z0XB 4XNYL 1IZJA 2YBRA 3TNNA 4LFHD 4JGJA 4TYUA 5T33L 12E8L 1TVHB 3VXRA 1FJ1A 3BEWB 2R1XA 2GSIB 3M1BA 1P1ZB 2V6HA 1CK0L 5GGVH 5D1ZB 1X5FA 1R0AL 4R97B 4KMTH 5JOFB 3O2DL 3CK0L 5IGXL 1OQXA 4JN1H 1IGCH 2ADIB 4LCUA 4NDMB 4D9LH 5IFJA 5DJ2B 3QQ9D 3I3BA 5IROA 4OLEA 1LK3H 3M07A 4Z95H 2O5YL 2DKUA 1BFTA 1WAAE 4Z5RB 1PY9A 5C07B 5IHBA 2AJZA 4QT5A 4J8RA 1OY3B 1EO8L 3RL2B 5TDNB 4N5ED 3ULUD 3GMOB 1B0GA 5IESH 4BZ1H 3VFMA 1T03L 4JDVA 1MCKA 1IGTB 1G7LA 2MSPA 1NCTA 4BFEA 4LBEA 3VWKC 5HHOB 4NQVB 4CMMB 4ELMB 4XP4L 3QIWC 5CSBA 1N7ML 4PLKC 2PW2B 3GSXB 3CFCL 4NRZA 5JPMB 3D3VA 4H0GA 1LHZA 2FBOJ 4UNTA 5C3LD 4U1KB 4J3UA 5IP4A 4JPIA 1ORSB 4RFOH 4J3SA 5C0DB 1SM3L 3EDEA 5DJ0B 1X6NA 4OF8A 3TO4D 2IH1B 5GGVL 3MV7A 3CXHK 5LGHH 4XPGL 5D96B 1CDCA 4PRAA 5D72H 3CC5B 5L9DL 2NXZD 1QG3A 3MRCB 4MVBC 1EX0A 2XG4A 4IOSD 3H9SE 3GBNL 3FQTB 1HYRC 2MFNA 5JMOC 2Q76A 5J12B 4F7MA 1A6TB 3DO7A 3BDYH 3VWKA 2XWTB 4DOHB 4LNRB 4RBPH 1MIEL 3OAZH 1JL8A 1QBML 4QF1A 3AAZA 5C86A 1FBIL 5GGRB 4YO0A 4YXHL 3SQOH 5T3ZD 5DJ6B 1A6WH 4LCIL 5I75B 1FZOA 2VWEC 2R39A 4O51B 4JY4A 3UO1L 4XNZB 4JFXA 4MB5A 4CKVX 3GSOB 3I85A 3WIHA 4L8BB 3QEQE 4FQLH 2F54D 4TULH 1KLGB 2VQ1B 3V4VL 5I30L 5EU4A 1SYSB 3HMWL 3QDMB 2ZWLT 4ONGL 4KVNL 4NYLA 1FAIH 5ICXB 2I26N 1WITA 5HGHA 1OLZA 2UVEA 5EBMA 1HK6A 1CICB 3FQRB 2XIDA 5GHWL 4YLQT 4HWZB 5D2LA 2AJSL 1TETL 1T1XB 4YE4L 3F5WA 1IC4L 4LDOB 2DL2A 3LD8B 2ARWA 2G9HB 5CLTA 5FB8B 5I8KH 2MPAH 3O0RH 3LD8C 3QA3B 4G8GD 3WDJA 3QI9C 3IJYA 2O93L 3DETC 5CEZH 1UVQA 5IUSA 3IRZA 4G8GB 5ANMA 1MWAH 4DUWA 4G42B 2D7PA 1GZPA 5HHQB 1CQKA 4K2UH 5CLWA 1XCTB 3MOAL 4F9LA 3U46B 2YD8A 3HUJE 2YZ8A 1KIRB 3VGHA 5JNYB 4TVSa 2IFFH 4U0RB 4L3CA 4NKMA 3IKCB 4R0LC 4WCYL 3QO0B 1F90H 1T1WA 2JB5L 5MEQA 3QAZC 2NX5A 5DC9B 1U8LA 4U6VL 5D7JB 4KGLA 1QRND 2FZ3B 1L4IA 5AYUL 3FONB 5B39G 1YN7A 3F7YB 1MCWW 5I1EL 4X80H 3RY6C 4XP9L 2OR9H 4QHKJ 4TSAL 3FAWA 1AQKL 1NMCB 2IG2L 4L8SC 1CF8H 3G5YA 4DKFH 1NLBH 1BQLL 4IMKA 2XG5A 1MFDL 2L0DA 1E4XH 3SGJA 5AAWA 1E6JH 1XF4A 5EC2A 5E8NA 1T7XA 3AUVA 4K8RD 4RWYL 1WBYA 3MXVH 4HLZH 1UENA 1S9WB 4QNPE 4R26H 2HFEA 4XWOC 5E2VL 3CCHB 4R0LA 1ZEAH 3QHFH 1OAKL 3GSOA 2DJSA 3UTOA 1P6FA 4QOKA 5JNYA 2BNQE 4O51A 2NW2B 3WKML 5LCVH 3DMMA 4P4RB 4ZAKC 1A22B 5HHOE 2APFA 3IDIB 1DQDL 3LZFL 4XBEL 4X6CF 4U31A 5GGRA 4OQTH 1H15B 4G42A 2AV1B 5E95B 1D5IL 1KCLA 2OSLA 4LRIA 3I6KA 3MC0A 5C6PB 4OAWB 1QHOA 1FV1B 3O3AB 1QFUH 2NYYD 4F7MB 3QDME 2BHZA 1HNFA 3N1MC 4ZXBC 2XWBA 1I1AD 2XTJD 1HH9A 3EYVB 3Q1SL 2EDDA 2PTTB 1MELA 1CU4H 2HKFL 1WWCA 1VENA 4OFIA 3MRDB 1P84J 2EH7L 1JNJA 4M6OL 1T1XA 1IEAB 5ITFB 3VGFA 5DJ0A 4HUXB 3KAAA 3MV8E 5ICXA 5KAQF 1RJZB 3WSQL 2W91A 1UJ3A 1SYSA 1PKOA 3FT3A 3C60C 4YX2H 4ONHA 3T8XA 2NR6D 4L5FL 1G1CA 4JFFE 4PJDA 5LBSL 4OIIH 4GKSB 3QIUB 5K93A 4OCSH 3X17A 3TCLA 2FX7L 5C09D 5DSCA 4OIBA 1ES0A 1N59B 3TNMB 5K9OB 4J2XA 1RULH 3FN0H 4Z9KB 4PRPD 2DM4A 3DX7A 3AAZB 2DQGH 2ZPKL 5FYJH 1BFSA 4P2QB 3S8WA 1U8OB 2ED7A 2Q7YA 3FQTA 2YPLB 3AMLA 1QBAA 2IBBA 4HKZB 3QBTB 4G9FE 1GXEA 2GI7A 3HNVH 3E8UL 2W9LA 4OCXH 4PB0L 4JKMA 4PS4H 4MXVE 5ESQA 1KN2H 3U36A 1P7KA 2VITB 2IH1A 3KYOB 3B2VH 3JSSA 5CJXC 5DO2D 1N6UA 5F7EL 1HXMA 1IQWL 4D3CH 5ERWB 3MYZA 3AU1B 3EO0A 3WDIA 1MJUH 3CSGA 3ARBD 1R3HA 3L95A 1BZ7A 1ED3A 2ORBL 2C7UB 3ZKNC 3FB6B 5B4MC 4HKXA 1XZ0A 1ZANL 2E7HA 1XGUA 3KYOA 3GSXA 4X99B 4U1IB 1QZ1A 4KROB 7FABH 2AXJA 3QEGL 2APTA 2NY6D 4Q0XH 1FFRA 3TBWB 5IM7A 4PB9L 2H26B 4GRLB 4X6FB 5CINL 4FQCH 3DI3B 4L29A 4JFDB 3WKNA 1KB9J 3ULUH 4P2QA 2F74B 5E8EA 4KH2A 3ULVC 2ITCA 3QUZB 5IVZA 2J6EA 2AK4A 3VXMA 4PJAA 2VC2L 4X6FA 1J0IA 3P0VH 4Y2DC 3I6GA 1RZKH 2R29H 4F3FB 4X7EC 3T65A 1XGPA 4ZAKD 5TE6H 4QNPF 4XRCA 5JW3L 3CZJA 3LKOA 2JLLA 1PX4A 4ODXB 4CADB 1UA6H 1R5WA 5GGQH 3GHBH 2DIJA 1F42A 4ZSOB 5AG8A 1ZHNB 3BRDA 5ITFA 2A6IB 5BS0E 3IDJB 2WANA 3ZSSA 1YQ2A 3CFIC 4JZNB 5TE4H 5D7IE 1Q94A 3TO2B 2UZIH 2EXYD 1AGBA 4DQOL 2R2HB 1HH9B 3SDXF 1ZV5A 4HIJB 3NAAH 3BAEL 3BT2L 2YPLA 2NCMA 5CD5C 3OXSB 4W6XB 1FV1A 3O3AA 4YGAB 3K1KC 3BT2H 1ZLSL 2X10A 5TE7H 5ELIA 2AV1A 4NO0A 3W5NA 4HWBA 5DURD 1LEKA 3WFDH 2CKBH 5FYLD 1Q9OB 4LHUA 5J6GA 1N59A 3SGKC 3TCLB 2NW2A 1D5BB 1JHTA 4MQ7A 5AWNL 5DHVA 3TWCH 3MV8B 1K9TA 1KTDA 3ZTNL 5I8OH 3L3HA 1UKTA 3BIBX 4AL8L 1KNOA 2XA8H 5EFIB 2ADJA 3S5LG 4C55A 2C4FT 2DLTA 1VDGA 2A9MH 1MCPL 2N4IA 1WBZA 2A0LC 2HVKA 4EUPG 1ZMYA 1F2QA 5CMAA 4X8JA 5EU5A 1ZT1A 4K3GA 1IAIH 4ODUA 3B9AA 1PSKH 4JFZL 5JW4Q 3B9KB 4KI5D 4BH7B 5EWIL 4X4MA 3VMPA 3MUY1 4ZPTB 4FP8H 2ZUQB 4TUKL 5FV2A 4F15C 5GRUH 9CGTA 3NCMA 5IOPB 4P3DA 2MTPA 3HKFA 4OAWA 1U8HB 3D3VE 3VW3L 4MZ3A 3X3GL 3DVFA 3KVQA 3QDAA 1H15A 5BO1L 3TV3L 4JFYB 4ZQKB 4WV1A 3HI6L 5HHMD 3WLBB 3C08L 1UCBL 4R8WH 3RNKA 4KQ3H 5SWSD 12E8H 2QQNH 1KJ2L 3GJFB 2Z91A 4HLZG 5B38B 3FL7A 1VPOL 3FMGL 5FDWA 1GIGL 1IQWH 3O2VL 5E7FA 1OAUL 4QRSA 3RDTC 1Z9LA 2O5XH 3R06B 1JGVL 5TGBA 1WAAA 1CDYA 1JGVH 1XF4B 5KSAC 1KBGH 1NEZB 1L0QA 5CSZB 3H7BA 4IRJB 1I1YA 1EJ6A 1AC0A 3S37L 3MA9H 3WS6C 4KHTL 4LK4A 4F8QA 2FYYA 3C2AH 4YAQA 3GI8L 1NGZA 3DUHA 3L3DA 3MLWH 3KPRE 4PJIB 5HI4C 2GT9A 4LKXA 4I18A 3O9WB 4OIIL 2NX5D 3GMRA 3JUYA 1IC7L 5B3NA 1VACA 4FMKA 4JFOA 2L4OA 5SWSB 4P4KA 3CSYB 5GRJL 5C0EA 1C5CL 1MIMH 5EU4B 5I1KH 3JV4B 1A7PH 1RJLB 4K7PH 4XGZB 1TPXC 1IEBB 2YPLE 5AD0A 1S5HB 1JMXA 1KIRA 2NY1C 1MCPH 3VG9B 4AIOA 2HG5B 5ALCH 2Z9TA 1F3RB 2ZP0T 5HY9A 1OGAA 4Q9CA 1G7PA 2WBJC 1IGYB 3L3IB 3AFLA 4M8QB 4UDUB 1MCOH 2E27H 4YO0B 3NFSH 5DMGC 2R2CA 3FQWB 4JO2H 4PREB 1H3PL 2AJ3B 3QXDB 3ARQA 5CBEB 3MJ9L 2Q3AA 3BYYA 1RUKH 4OV6F 3FTGB 4FXKA 4OUOA 1QQDA 4JFQA 4HS6B 5A1AA 2WWKO 1FIGL 3HPJB 5DK2A 4PV8B 3BKML 1X4ZA 4LPYA 5IBTL 1N6VA 5J56B 3QRFM 3MRCA 4HG4J 3MRIB 4LPUA 1G7IA 4I18C 2HKHH 1F4YH 2CXKA 2VMFA 1QSFE 4PJCB 2OI9C 2EIDA 3UTTE 2NTFA 5C6WH 3MBED 3V6OC 3CFBB 4E42B 2HLFC 4IOFC 1HEZA 3BD5A 1HHGB 5ABDE 2X4RB 2GTWB 2ESVD 5B3JE 2E3VA 3O4LB 2CJUL 1XF1A 3EYSL 5MHSD 3VFWB 4K9EL 3TJHD 2DLHA 3VGAC 3O8XB 3QIBA 3D3VB 3BDXA 1J1XH 3PV6B 4HIXL 4JVUA 3QXAA 3OJDB 2DQDL 5DD1L 5ID1A 3KPRA 1W0WA 5EC1B 5C70A 5HGAB 5BXFA 5LQBH 2BXZA 1A7QH 1TNNA 4W81A 1NC4B 5B4MD 4HUNB 1IEHA 2BVOB 4LBEB 2IPKB 4Y4KC 1I8MB 3OG4B 4Z7WF 2F9BT 4JFEA 5A2FA 3M8OL 2X1OA 1NDMB 1DR9A 1HHKA 3RL2A 1A6TA 3DO7B 4QT5B 3P30L 1KB5L 3TYGH 3HPLB 5JLZA 4NN5C 1T80A 4IRZL 5IFAL 1DZBA 1IAIL 1MH5A 3BWAB 3QPQC 4OD2A 5E9DA 4MJID 4Y4KD 1CE1L 2GSGB 5D4QA 1U8MA 4HIHB 2E7BA 3MV7B 1CXIA 4WI5A 4EKXA 4NQTA 5FA4A 4K8RH 3OJMB 3H9ZA 1QR1B 4JKLA 4MJ4A 4TSAH 1K85A 3CLEH 4JRXE 3GK8H 2XTJE 3TYGL 1A1OA 4IIQB 4HIEB 4LSPL 3U0TB 1YPZF 2R1XB 4GXVL 4NJ9H 5I75C 3WN5C 3ULUL 4YBHA 5D5ME 1M71A 3WFDL 5FUOH 4RGNC 1J12A 3BGFB 1N64L 2YD9A 1F90L 3WLWD 2AERT 4XVJH 3MGTA 4KJWC 1IGTA 1YEFL 5CP7B 3TBVB 4PJCA 1QFWH 4NFCA 5B21A 2N7AA 4KPHL 5I1CL 1AY1L 3D25A 4Y16D 5ETUB 1BEYL 2P24A 2HRPH 3NA9L 5D71L 1FNEA 1I9EA 4G5ZH 4I4WA 1IMHC 3HPJA 4LEXH 4ZUTA 1T2XA 3MGOA 4DN3L 1T66D 4WTWA 4AQOA 5A43C 1KPUB 4PJIE 4KRPD 3U30B 5E9DD 2D4DA 3V0WH 4LCUB 4MVBD 1A6AB 1E28B 2AW2A 5GGQL 2VDKL 4N0RA 4OFYA 3BKYL 2IQ9L 4HUVA 1ZAGA 4XCNB 4U1LB 1YMMA 3BKYH 5JW4N 4R90H 3KGRA 1EHLL 3GI9L 4I0PD 3MOBH 3IDGB 1YZZA 5JIHA 3MJ9H 5HD8C 1QVOA 3TVMD 4POUB 4H1LG 4NKOB 5KSVA 5I1DB 5JW4M 1KJVB 2VO5A 3QJFB 5KAQG 3ARXA 5ALCL 3ESUF 3TYFA 4BQ6A 2PXYD 1LO4L 1TFHA 1DQTA 1U36A 4OM0H 2YEZB 4EQ2A 4FXGB 4BQ8A 1CCZA 3SCMD 3ECBB 1LO5A 1CZ8L 3FO2A 3OB8A 4N9GA 5IG7B 4YXKL 2MOVA 4R97C 2FX9H 1EXUB 3ZTJH 4ODHH 4PJFA 1KPVB 4RMTA 1O5DT 2PR4L 5TGBB 5BMFL 3ZYJA 3QXDA 5HDQL 4OI7A 1I7ZA 1I7TB 1N0XH 4GG8A 3UTQA 2Z8SA 2B5IC 1T22A 3IXTB 1G7PB 4UDUA 4HQQH 2F5BH 4KK5D 3KPOB 3BW9A 5D93C 3CLFL 1YYLL 1QNZH 3V7AG 1JPTL 1VCAA 3VG0L 5AD0B 2GFBB 1SM3H 2EIBA 1ZE3C 2DM2A 1HYSC 4JFYA 1SY6A 3R0NA 5KSBF 3HMXL 2CUMA 5JXEA 2ZSVA 1JUFA 4P4KB 4PJEF 1F97A 3ARDC 1U3YA 1ZVSB 4UT7L 1JFQH 3GMRB 4KRMB 3MLYH 3CU1A 3V8CA 3LS5H 2AEQL 1A3RL 2H8PA 3L3DB 3HNTL 2ZPKH 3C08H 5GGTA 5IFAH 2CKNA 2X4SB 1FLRL 3GIVA 4Z7VA 4WHTA 5IB2A 4G9DA 4ODUB 3BP4B 1GC1H 3VXNB 3ULVF 1HOCB 1FLRH 2R0KL 4NN6B 3RY4A 1G7HA 3U1SL 4LP5A 1W0VA 3SBWA 4KY1H 4HUUA 5GRWA 5SX5H 3IJHB 4R96A 3PWUA 5DRWA 3QH3A 4LAQH 4G6AC 1D9KC 3MRKB 3NCYS 1WC7B 3U4AA 1RIHL 3CZFA 5JUEH 1XGRB 5I2IA 3MQIA 4JRXA 1KTDB 4HZLA 1CF8L 3O6FD 3CZFB 5I18L 4L4TA 1H5BA 1IGMH 1S7SB 5LGKA 4ZTOH 2XQYG 2Z92A 1R0AH 4FMFA 4X83A 2EIZB 1AJ7H 3W2DH 1S9VB 1U42A 5KVMC 4WHTB 5C08B 4ZO6A 5KZCD 1QACA 1F8TH 1RZFL 3EJYD 5I1AB 3RIFF 1RK1A 3KPPB 3CDGA 4P46A 1FRGH 1F4YL 2FD6L 3MREB 1FL5A 1I3RA 3LKSA 4DW2H 4HS8H 4Z76A 3ZE1E 5INCA 2VL4A 4NN7C 1T83A 1JGEB 5F7DB 5GGSA 4NFBA 4F57H 4LIQL 1ZT1B 2B4CH 1HKFA 4KMLB 3NFPA 2JIXD 1LGVA 1B4RA 4GKNA 3X12A 3SDYH 3ME0A 1FAKT 2DWDA 2H6PB 4HS3B 3HTLX 2VSDA 4HZAA 1KNOB 1I9RL 3OR6A 3TESA 5MEND 5SX4H 2YD4A 4XRCB 4MD5B 3B9KC 5D9SA 1I9IH 2BSRA 1KYOK 5I1KL 4I77H 3STLB 3SE9L 5EUKB 1EHLH 4JHWL 2HT3D 2EEAA 4M61B 5HHXL 4EN3C 5LG1A 5K9KA 3FT4A 1AQKH 3NPSB 2VAJA 1KT2B 5IVZB 1LE9A 3ARFB 4UV4H 2WAHA 2F74A 1MJ8L 1M6OB 4XP9H 5E8EB 2Z31A 5KG9B 2VXVH 3EFDH 4YDLC 5LGJB 1Y6MR 4L29B 1NAMB 3QFJD 5HJ3B 3Q6FB 3VRLF 1OB1B 3NMEA 4KKLD 4U6VH 1C08A 3PWPB 4NKOA 3UAJC 3DV4B 3IFOA 4U1IA 1IGML 3ARUA 5D2NE 4HCRL 1BZ9B 1FN4B 4AG4H 1BZ7B 1R3HB 2A77H 2G75A 1R5WB 1DEEB 3G5XB 3LMJH 1P69B 1BQHA 5MP6H 1EZVY 1IC5H 4FFVC 2HRPL 3NA9H 2OZ4A 4M7JH 4ODXA 1HH6A 3W9EB 4KAQH 3LN4A 4K94C 1NCDL 4F58L 3VH8B 3SKMA 2VITA 4XCYA 3VCLB 1Q0YL 3DVNB 3SQBA 5ESQB 1CD1A 1OAQH 1VERA 4LLDA 4WUUD 1N3NB 1J5OH 1K8IB 4NGHL 4PGDB 4PJ9D 1FNLA 4P9HH 1N7MH 1RUMH 3GSUB 4JFZH 4XHJC 1FNEB 3RQ3A 4D0BA 4NKIL 3DXAD 1UC6A 2VLRB 5E8PB 2NX5E 4LLQA 4R7DA 5E6ID 4MA3B 4R9HA 5D5MB 3QP3A 3EOBA 5IW1A 3MGTB 3OWEA 1A7RL 4X6CB 4QTIH 2D7OA 4KTEL 5GS1C 1ES0B 5SWZA 4ZUWB 1DUYA 1S7RB 3QIUA 2EDHA 2IAMB 4LCYB 1DQML 1ONQB 4JY6B 4HKXB 3OKEB 3E2HB 3S4SA 3U0TA 3VXRD 2CKBL 2YZ1A 5BZWA 1E27B 4OZIE 3T0DA 5IGXH 4LSTL 2ZKHH 2AEWA 4KUCD 4OCRH 2VB5A 5HHXH 2UV3A 4PJGB 3LRGA 2VXSH 5HDOA 3SOBH 4HIHA 5J3HD 2NY3B 3PWJB 5LBSH 3U36B 1B2WH 2AS5M 3O3BA 4LHJB 4MXWL 3OZ9L 4MJ5B 1I1AC 5D2LE 3RBGA 2PO6B 4YDJA 3C6LB 4FQ1H 3D0VB 4YXKH 2ADFH 4M8VA 4G8GE 1BOYA 5K9JH 2A77L 4LARL 3VRJB 4KQ4H 3LQZB 5GS1A 1YA5A 5DD6A 4XNQA 3PHOB 4F57L 1GZQB 1M7DA 2LE9A 3GSNL 1PZ5A 3MODL 4X0KB 3GSNB 3I50L 5IBTH 3E6HA 2WBJD 3FOLB 3GBML 1S7WB 3T4AB 3OAYK 4TSCL 1KIQB 3D0LA 5FA3A 4XAKD 2HT3C 3QDGB 3EKCA 1QSED 4PJDB 4QWWD 5LXGL 2RHEA 2ICWA 4E5XB 3FOMA 5FOBB 2EC9T 2X2YA 5D6DC 2VLMD 5E2JA 3I9GH 1S9WA 3SDCD 2A2QT 2VDKH 5IROC 2BSSA 5TDOB 1WICA 5EU6E 3DV6A 4UT6H 3WYRA 1YEJL 1HE7A 1UZ6F 3PL6C 4QRPD 4WFHD 2X1XR 3K80A 3SDDC 4QTIL 3FQUA 5LWYH 4JLRA 5FFLA 3DVGB 5DD3H 3UBXG 2LABA 2WBJA 1RHHB 3RKDD 35C8L 2XWBB 3C5SA 5ENWB 4H25A 1I3UA 1I4FA 2FGZA 4FXKB 4P2RA 5BJTB 4G8EB 3I6KB 2LQRA 5TQ0L 2AJ3A 1A0QL 1L7IL 4X98B 4F2MB 4HH8A 2COQA 3FQNA 2BNRD 4V2BA 5HGDA 5HY9B 3IDIA 2Y23A 1BLNA 1IFHL 3EZ8A 4JG1L 3MCLL 3CH8A 3C5ZD 5DA0B 5EA0H 5DVNA 2JELH 1OSPH 4XH2A 4RDQG 2IALB 3RFZC 1RZ8A 3H3PH 5T1MB 4PJ9C 1RIVH 4JFOB 4S1RH 3MLPA 2GY5A 1QKZH 2DIAA 5IBLC 3O9WA 4HKJA 1KN2L 1MCFA 3CSPA 2XPGA 2G9HA 5DJ8A 3Q5OA 4YAQB 4ZXBB 5ALBH 1Z0MA 2C4XA 3AS3A 5DEFB 2M1KA 4PTTB 3O3DB 4OZFH 3H7BB 4IRJA 1NEZA 3NA4A 4MXVF 4I77L 3KJ6H 1JNHA 4H20L 3MV9D 5E2UL 3WEXA 3VRLE 3SGDH 4PG9B 2FRGP 3R06A 1NGWB 2IANE 4QRSB 1ZKAA 2WUBH 1UWEH 2KZWA 2VQ1A 5T5NF 4P5TB 4C4KT 1PW3A 5B38A 5MEQB 2NXYB 2Z91B 2RFXB 1M4KA 4NC1C 1L6ZA 1IT9L 1IQDA 3MRFA 4M6OH 5IHUL 4UT6L 1FZOB 1T20B 5HI5C 1BVKA 5ADOL 2P47B 5DVMA 1P7QB 3O9WC 1BWMA 1F4WL 4F9PA 2DTSA 1PSKL 3HMWH 2NXYD 3SCMC 1FSKB 3FCTA 3VGEA 5ANMB 3GB7B 2AJXH 2JK5A 3QNZB 4OLVH 2XWTA 3SO5A 1MCCA 2H2SD 4X7FC 2DAVA 1QRNA 4JN2A 5L88L 4ETQB 4X9GA 4OCMC 3JTSB 3C5SB 4LQ1A 5FB8A 1FZJB 2X4QB 4S1SL 4PY8I 2OTPA 3BH8A 3EAKA 4G80B 3WKMH 1UM6L 1A8JH 3GBMH 5C8JB 5LJYH 1F6FB 2ADJB 4F9LC 1MCOL 2E27L 3SJVA 1ZEAL 3HI5L 2Y9RT 4FZ8L 3SY0B 1I85C 3VI4F 5JPMA 1XF2A 5FIEA 3MV8A 5FA3B 5EULV 4QHNA 4Y4FC 3RWEB 3QRGH 3J7HA 5JA8B 3K7UA 5EZLA 5ISZB 5J6GB 2BSTA 2E6QA 3GSNA 4GAFB 1NFIB 2P5EB 5F70A 4Y4FB 1FYTB 1EUUA 4LHUD 4ENEC 1MHHA 5FYJD 1BF8A 3DUSB 4WWKA 5E08H 3QQNA 1AD0A 2Y36H 3LQZA 3VFUB 3CDFA 4L8SA 4PJXB 4IMKC 5FYLL 1DQMH 1BJ1H 5GSRA 5TFSH 1RMFH 2AQ1A 5DFVC 2UZXB 4GBXA 1SMAA 5C0FA 4Z5RA 3SGJC 5J06A 3FZUD 1QBBA 1I8KB 1AGBB 3HN3A 1LO3H 4O58H 4QCIB 1S7QA 1D9KD 4QXWA 4UIKH 3T0BA 1FORH 1H3UA 4L4TE 1BX2B 4WU7A 4MA1C 1W2KT 5JHDE 1BGXL 4KK6C 3I6LD 1T7WA 2EDKA 1KB5B 1KB5H 3VG9C 2C3XA 1J5OL 4OLZL 4WDIB 1IFHH 4GLRH 4MLIA 3NABH 5F7WC 5GJTH 4NKIH 4OZGE 1F3JB 4OJFH 4P9ML 1RUML 2AGJH 1KJMA 1IBGH 3O2DH 1CFTA 4CMMA 1X5LA 4LRIC 4DAGH 4FFVD 3WE6A 3L5JA 4U1JB 4Z7VE 4DGIL 3K2UH 5IW1B 3VXMB 3S97C 4OLXH 1DBJL 5BZDB 1FE8L 1OGTA 2ITCB 3O2WL 4JFFA 4PJDE 5F96H 4R7DB 2VABA