1DBBH

Three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Three-dimensional structure of an anti-steroid Fab' and progesterone-Fab' complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1992-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbH02
3IDXL 3RQ3A 1DQDH 4MQXD 5IV2A 2DIAA 2AGJL 4M6AA 3L5WA 1MUJB 1XIWB 4XNZB 1JIBA 3MNVB 1MJUL 2R56H 5ICYB 1QSEE 5I74C 5IMMA 3X3GH 2IGFL 3TGXA 1A6UH 5ITFA 5DD0L 1OGAE 1IMHC 1X5AA 5C9JB 1HE7A 2E6JA 4U6XA 1MCPH 3VFOB 2DQJH 2X05A 4KUZL 1FIEA 1A14H 3PWPD 5EZLA 2C1PB 1R3LA 4K94L 2Y9RT 2Q8AL 1BPVA 5JUEL 5CEZE 5FO8A 3QFJA 5C9KA 2BJMH 1CIDA 1PQZA 4F7PA 3OZ9L 4AIOA 4HCRH 4DKEH 2H9GA 4MX7A 3WNMA 3UJIH 5JHLL 3FT2A 2RFXB 5CINL 4PJ5E 4GRLA 2YA1A 3U0PA 5DRZB 3I02A 4HWZA 3DTXA 5TDNB 3PXJA 3ULSA 4ONHA 1LEGA 2D4FA 4PREA 4IRJD 4L4VA 2EDHA 3WJJA 3CZFB 3T1FB 1IC5H 1JPGB 1REIA 5DSCA 3CH1B 4CN6A 1LP9F 3STZB 2BVTA 3I6GB 4N0CC 3H3BC 4QYOB 2CLZB 2F15A 3T65B 5IHBA 4HLZG 3O4LB 1OAQH 4IS6A 4R4NC 3ES6B 3MJ6A 1LMKA 4NO5B 2GKIA 5FYKL 4TNVF 1WZ1H 1I8IA 1OQOA 4Z76B 1CGXA 2QQKL 4JRXA 3V7AE 2Z8WC 2BFVH 2JTDA 4XCEB 4PRPB 4Y89A 3VCLA 4HKXB 3MRDB 3KAAA 3C5SB 3PDGA 5FDWB 2BNRD 3QUZB 4XAKE 3SOBL 4OGXL 1JZ7A 3BFOA 2VLKB 4I2XE 5DRXB 1SY6H 1MWAB 1BJ1J 3GSRA 4K94C 5HDQL 4JKKA 3V7AG 2KKQA 4M8QB 1HIML 1UWGL 2FX7H 3IRPX 3MRMB 4HJJL 2A73B 1G0XA 3ELAT 5EBMA 4GKOA 4DN3L 3CSYB 1D9KB 1IJ9A 4S0SD 4PS4L 5E6IC 5I1AB 2UUDK 4NM4L 1XF2A 1JGVL 2QSCH 1LD9B 2BVQB 4OZ4A 5INCA 1VFMA 1ZS8B 4NC0B 2B1HL 5HYJE 1JK8A 3D85B 4BSWB 2AXGB 3HG1A 4UT7H 3RWIA 3KJ4B 1AIFB 1UM6L 1Z9SA 1JUFA 1MJ8L 2ADFH 2EO9A 2APWA 2B4CH 4OFYD 5LGHL 5EZJB 4JN1L 3VWKB 4LQFH 5FYJH 1CD8A 4PJBF 1QFWL 5TQ0L 3BO8A 4P57B 3TT3L 2PYFA 5T1DH 4BSVA 2FBOJ 1OHQA 3T2QA 4D9QE 1KYOK 1T66C 2EH8H 2NY5H 5HPMB 3LQZB 3DHMA 3FQRB 1YEGL 3OHXB 4K71C 2CK0H 1NQBA 3W0WE 1S5IH 3QUYD 2FJHA 2ZZUT 4WJ5B 4A2MA 1I7ZB 5DC4B 5IFHL 2IMNA 5K33A 3GMOB 2J6EL 4XXDA 3FHAA 2Z35A 1SYSA 1AI1L 4X0KA 3RWHA 4EI5D 4FNLL 3CC5B 4R4BA 5E2TH 5LAXA 5C09A 3MBXL 1OGAD 1J10A 4NT6A 4FQLH 2R0LH 5KW9L 5I19H 3IDXH 4CW1B 4JPIB 5CCKL 4MD0B 1SJHA 1MRCL 3QEUA 1DUYB 1BP3B 1A02N 3E6HA 1MJUH 4JDZA 1NFDE 1N59B 2IGFH 2KZWA 2X89D 3MLVL 3BZEB 4GLRH 1UJ3C 5DD0H 1HHHB 2FCBA 3ARDB 1AFVH 3UXFA 1LK2A 1QPXA 4NZJA 5JNYA 2ZG1A 4C56A 4NN5B 2RR3A 4KUZH 1CXFA 3F8UB 3RVXD 4OZIA 3KPSE 4MS8D 2QV2A 1DE4A 2Q8AH 5BO1H 4F37K 2DLEA 4A2LA 5TE7L 3BP4A 1TPXB 3QH3B 3QPXL 3STBA 4LVNC 2YD1A 3ROLB 1PKOA 3OZ9H 5FYJU 1MFDL 5BZDB 3CH8A 1BBDL 4RQQA 5CUSH 3U7WH 5K9QG 3ULVD 5EU6B 1JRHL 4LCIL 2ZNXA 1J0KA 1RUKH 3MJ7A 4AZ8A 4DVBA 5JHLH 1FFNB 4G9DB 3TZVB 1S78D 2XT1B 2ZPKL 4KAQH 4MA8L 1NCAL 1G9NH 1FL6B 4MNGE 2ORBH 3QQ4B 3PV6A 4ELKB 4WEBL 2DTSA 1KIRB 5DT1L 1JTTA 2BP3A 5SWZA 2A1WH 1BMGA 1AQKL 2R2EA 3L7EA 3PHOB 5I8EA 1A47A 2JIXD 4L3AA 1Z9LA 4QOKB 4QHKI 4FQJL 4ZOCA 4ZNEA 4G9FB 5L8JB 1CDIA 3C2AL 3A0OA 5FYKH 3RIAK 2EIEA 4UDTB 3UAJD 3O2DA 5CGYD 2CLRA 3UPRA 4QTIH 5GS1C 2QQKH 5ANMB 4ETYA 4PY8I 5F7EH 1V3JA 1TCRB 3RWJA 4UDUA 3QCTL 3AU1A 3L3GA 3PABA 1H3TA 2BDNH 5D5MF 2J12B 1Z2KA 4OM0L 3SOBH 3DWTA 2VDNL 3H9YA 1LNUB 3CXDL 5D7JA 4NN6C 1BBJB 2F8XC 4JM4L 5FGCE 1CFTB 3HPJA 4EVNA 3FQXB 4Y19B 5BOZG 3JTTA 4HW6A 3MRHB 4YC2B 5BOPA 1HIMH 1NFDF 4HJJH 3AS2A 3SY0B 3QEQB 4NKOB 1S9XB 1E4WL 4MNQA 1ZOXA 4ZFFB 3TH2T 3WUWB 5SWSE 4W4OC 4NM4H 5GSRA 1HSBB 4U1NB 4OZHE 3VFSB 4UNUA 3BOVA 3VFUA 4O9HL 5EU7C 3IDUA 3PNWA 3QRGL 4NRXB 3H8NA 1UM6H 3BP6B 4V2CB 4LOUC 1NGWA 2OI9C 1X7QB 3PQYA 1VPOL 5LGHH 3IJHA 1C5DB 1J11A 4M3JA 3TWCL 2DMCA 4HPOH 1C08A 3QNXA 6FABL 1P7QA 1QFWH 1X5XA 1JNJA 1MI5B 4G7YL 4PRDB 2EYSB 2OTWA 3TT3H 2XPGB 2ICCA 3KYOB 3QO0A 1HN1A 4MAYB 1C5BL 2CIKB 3QZWB 2P4AB 1H3UA 4RA3A 4NQXA 3WUZA 4MJ2A 3GRWA 1RUAL 3O2DH 3SKOA 1MAKA 5IFHH 1J5OL 2F8VA 5DURD 1LO5A 5A2FA 4P23B 3PWPA 2EEDA 1BQLL 3U0TA 4YAQA 3QYCA 4P5TD 3MBXH 2J8UB 4OKDA 4QRQB 5D9SB 3X11A 3VW3H 4UAOB 1CR9H 4OLZL 2ICWJ 2I9LB 5DI8A 1FV1B 1MRCH 2NZ9C 4U4BA 3IDGA 2FIKA 5FHAL 3G5ZA 3ARGD 3DXAE 1NCNA 2VUOA 1DBML 2ZP0T 1IZJA 1ZWIA 3MRBB 1YEKL 1YEDB 1DLHB 4PJFE 4GAFB 2NX5E 3T2NL 5MHSD 3MV9B 4CVZB 1OP9A 2SEBB 3CFCL 1JFQL 2F8OA 3FQUB 4GRWH 5C0BD 2F74B 4PV8A 2ZUQB 4GKSB 4TNVK 4MVBD 3GMQB 1CGYA 3MGOA 3Q6FA 5TE7H 1PYWB 1Y18A 1GGBL 1WFTA 1F3RB 3WSQH 2JLLA 2F58L 3VRIA 3DETD 3O45B 5EPMA 1MFDH 1BBDH 1JRHH 2BNQE 4IMLA 2PTVA 1EERB 4S11A 2O61A 1J8HE 3BKJH 4OZHF 5L88L 3MV11 4Y5XA 3BKML 3NFPA 4Z77A 1JL8A 3MRIB 4BUHA 4RGND 5ECJE 4WEBH 5DT1H 1U8NA 2X42A 5A2KH 5I1HH 4KDVA 4G6FD 1FFRA 3V8CA 4TTDC 4YO0B 2VE6B 5IG7B 1BVLB 2Y5TB 2BNRA 1YC8A 5IK3A 1B90A 2WIIB 3L3DA 4FG6D 1TQCB 4F7EB 4R0LB 3X12A 4NQEB 4FQJH 4PJEB 3LMJL 3O8XD 5JXAL 3UC0L 3ZKNC 3S88L 1MCBA 4NFBA 2IAMD 3QULA 3ARSA 5I8OL 1YYML 4TTGA 3G08A 3C2AH 1CT8B 1VESA 3B9KC 3ARBD 5C0ND 1N8ZB 2OXHA 1AO7E 5GXBB 2MKLC 5FO7A 3QCTH 4UV7H 3OAYK 1UWXH 2DM4A 1QBLL 4NUJB 3AROA 4JCLA 1SJVA 2IFFL 2XZAH 2HLFD 4Z0XB 2W60A 3I3DA 1LP9A 4LHQB 4RISL 1K3ZA 5KS9B 3EDEA 3CXDH 4ODWA 2DKMA 4PJDF 5SWSD 4JM4H 5MEPA 4HDIA 4HZAA 4IOIA 1JWSB 5CBAB 1YN6A 1INQB 3PDOB 2EDRA 1CICC 3ZTNL 2DI7A 2I07B 4OFYA 5F6HI 1XF5A 3ZE1E 1DQQB 4L3CB 4HJGB 1CU4L 5IW1B 1KEGL 2PYEB 2Z92B 5ITBL 2VTFA 1AGDA 1E4WH 1N5YH 3DBXA 5IROC 2GSGB 1YECL 1DBBL 4ZO6A 2V9TA 5C71A 2UVFA 3T0AA 5AZEL 3QAZB 4GAJL 3FB5A 4CVXB 2ESVB 3H0TB 5GZOC 1D7FA 1JGDA 2Q76B 2VNCA 1M7IA 3VXSE 4QY8A 2VLJB 5E99L 1HQ4A 1FNFA 1JWUA 5D1XD 1CDHA 3UBXG 1QSEA 5CZXC 1UCTA 5CEXB 3RL2A 1BF8A 2DQGL 2E9WA 2WBJA 2JB6B 2QSVA 5EZIH 3TWCH 4ZS7L 1C1EL 3VDBA 2IBZY 1OGAA 6FABH 3DHJA 2W1NA 2VO5A 4MNHB 4XNMA 4APQD 2NW2A 2WUBL 5IB5A 1CZ8H 5DUPL 1P4LA 1TXKA 1WSST 2FECI 2XN9E 4D8PB 1KIUA 3NCFB 1RURH 4RMWA 2Y06L 1BZ7A 1FDLL 5IKCB 1RMFL 4O2EA 2ADIA 2YBRA 3B43A 1MREH 4NBXB 3BQUB 3DGGA 2VLLB 3RGVD 4PTTB 4OSUL 4JFQA 3MRCA 4MJ5A 2IJ0C 4PJBA 1EUUA 2W0PA 4PJ8B 4PJ5A 5D1QC 3LEXA 1X5ZA 2BNUA 1U8IB 4OLZH 1BVKA 4JFZH 4N1EA 4X83A 2PW2A 1NJ9A 3UTTE 1I1RA 3BMVA 5J9PB 1T7YA 5GGTL 3A67H 1J9CT 1QBML 3GSNB 5HJ3A 4ZD3L 3NFNA 5DK0B 1A6AA 3TO4C 4QO1A 2X4PB 1AGFA 4TUJB 1DBMH 2VDPH 2R2HB 4U6TA 5E9DE 3V5KA 4WI4A 3T2NH 4JFYA 1RUMH 4M7ZC 3CFCH 4U0RC 4FXLA 2YA2A 4DOHE 1JFQH 3H9SD 4MD4B 3A6OA 2MJWA 4E9LA 3ZE0F 3HNTH 1S7RB 1AD9B 5LGJA 1J8HD 3F7QA 3G6AA 4JHZA 1HHKA 4JLRB 3ZE1F 3L3KB 1NEZB 4KJWD 1Q94A 3SDAB 5DDHB 3RWDA 4PJAE 5I2IA 1RVFL 3C5ZC 3CK0H 3DRTB 4O00A 2VISB 4XP5L 3UZEA 1DQJA 3O3BA 4JY5H 1PGRB 5DTFA 2C7UA 4I2XA 5L88H 3VD3A 4FXGA 3BKMH 2AABL 2QADC 1EJ6A 4YWGL 4ODUB 1J1XL 4LDEB 2OCFD 1FFPA 2V9QA 4PR5B 4XT1C 4Y5VA 4P59H 5HYSB 4XHJC 3WKML 2NY2D 3P73B 1KN2L 4CBPA 5CEZH 1DR9A 2OL3B 4WUUB 3RKDC 1P6FA 2EDNA 1AO7D 3EO9L 4K2UL 2JB5H 1M71A 4PRHE 2FNBA 4YEEA 3BWUC 4YHLH 1GVIA 2CH8A 3LMJH 5JXAH 3UC0H 3S88H 3QEHA 4YR6A 2G2RA 1JMXA 3M1BB 1PKQE 5JOEA 1MELA 1UKQA 4N1CA 4NCC1 5HHVL 5I66B 2MCPH 1FGNH 3MLXH 1J05B 3BYYA 3OKKB 4JKMA 3W39B 3P40A 5AUMB 1RU9H 2X9YA 4X8JB 4HLZH 1T7ZA 2P5WD 3C6LA 1QFUL 3F65A 2AQ2A 1KBGH 1QBLH 5T1KB 1ZSDB 4CMMB 3QG7L 2IFFH 4YHPB 4U1GB 3RPIA 4JPVL 4F3FB 3DO7B 4OI7A 2ZUXA 4WU7B 2YK1H 3FRUA 1A22B 4OCXH 5AEAA 3QDME 4NCDA 3R8QA 4HS8H 2ED8A 5DEFA 4OIIL 2Z93B 4JHWL 4OLVL 5HHQB 3ZTNH 4QT5A 2FBJL 4HFWB 1S7WA 4XNXL 4NUGL 3VGFA 4ZYKB 3DMMA 3MR9A 5F89B 5C70A 2Z31B 3VFMB 3B9VA 3VXSD 5ITBH 1S7QA 5EFIA 1XR8A 4TQEL 3OXSA 1BHGA 1R5VA 5CSZA 1YECH 1DBBH 2N7AA 1DANT 5C0CB 1BFTA 3VMPA 5K9JL 2R1XB 1TETL 4F58H 2WSKA 4DK3A 1S7VA 3FRPG 2NYYC 4GAJH 4O5LL 5L7XL 5GRVL 2HFGL 5L2KD 4KJPD 3U7AA 3GHBH 5E99H 4PGEA 1QLEL 2XN9D 3WIIL 3BD4A 2VWEE 1NFDA 3EJJX 1QLFB 2DQGH 4N90D 5GJTH 5DJ0B 4BK4A 2R1YB 4ZS7H 4HGMA 1NAMB 1S9YB 1MY7A 4PB9L 4PJAF 1D5IL 3QIUD 3SN6N 1AY1H 4CU8A 3UYRL 4HKBA 1MHEB 5DUPH 3O9WD 5L6YH 5FCUL 2QLVB 2YD9A 2F54B 1KLUA 3KPSA 2Y06H 5EORL 2GQHA 4NN7C 1FDLH 3UTPD 3NN8A 1ZLWH 4Q9BA 4K07A 5C0AB 4PRNB 2X4NA 3PV7A 5CILL 4EUPB 2I24N 4QRSA 1NC4B 1XGQB 2Q6WA 1TZHA 2BVPB 4OSUH 4ODTL 2DBLL 4FQXC 3MXVL 1IL1A 4TULL 1P2CB 5E5MA 4ZPTA 3DX6B 2OBGA 2D7QA 4GG6E 1EEZA 4HBCH 4QRPE 5GGTH 2ZCLL 3OB0H 5CEYA 4MNGA 1QBMH 3LKOB 3MLUH 1XGTB 3B6SA 4POYA 3VXQB 3P0GB 2XWTA 2D0HA 2FO1A 1CFQA 2AXJA 5DEGB 4IRZL 4JO3L 1OCWL 3P9WB 5TPWL 1IAIM 1BX2B 3VXUD 1N5AB 2Z4QA 4JDVA 5GS3A 43CAA 3U9UB 5HHOB 4ZAKC 4RGOH 3DIFA 4P2CG 2EXYC 3QUKB 4P2RE 5IGXL 2IH1A 2H41A 2R0KL 3UP1A 4I0PC 4GXUN 3C60B 3BIKA 1D5BB 3PWVB 3IJSB 5HHPB 5I76B 5JDSB 5JW4R 3MNWB 3C08L 3O8XA 2Y5EA 1RVFH 2D0FA 2IAMA 2DJ4A 3CDFA 4U31A 4YFLI 5F70A 1K4DA 3QXWA 4PRID 4N0CD 5EUOE 1XGPB 3ARBA 4AENB 1CLOL 2FLBT 4PRHD 4R4ND 1JGLH 2AABH 4QRTA 4YWGH 1J1XH 2GCYA 5CAYB 5ID0A 4RDQF 3QPQC 1AKJB 3CD4A 2B20A 1UXSB 1KN2H 3FAWA 1IC1A 2ICEA 2VXSL 4UUJA 3EO9H 2HTLC 4K2UH 1G7QB 5SWSA 5C86A 4EXKA 4OZHA 1RUQH 1MRDL 2Q3AA 3P2TA 1P7KB 4N9GB 3TJEH 4CGTA 5GRJH 3FO2A 4JFEE 5HHVH 4G8IB 5CJXC 3RWCB 2DQHL 4ERSH 3OR7A 1BD2E 5DR5L 4XZUB 1ORSB 3T08A 5TGBA 3EAKA 1EAJA 3FT3B 4R97B 1EXUA 3DX8B 3WS3A 1W72A 5ICXB 1ETZA 4JPVH 5CD3B 1FYTD 1CGVA 1QRNE 5BRZE 5DC0A 3LIZH 1OT2A 2JKXA 5IJKA 1LHZA 3D0VA 4QHUA 4OIIH 1HHGB 3KXFE 1JCKA 5C0GB 4LASL 4JHWH 4GG6F 3MJ8A 2HT4D 1RIHL 3FFDB 5GGRB 2UZIL 5H35A 5IF0B 4PLKC 5T1LD 1SYVB 4PBWD 1BQHA 3MRKB 3WXWL 3DRQA 4APQA 1DQTA 5H2BA 1UJTA 3QNZB 1MLCA 4ZUTB 5JW3H 1IC4L 5F88A 4I48B 4YDIH 4NDMB 5F9WC 2L7UA 4ALAH 2DL2A 3EYFB 1TTFA 1AP2A 5K9JH 1TETH 3NGBB 2FB4L 2VDML 4ZTPL 3MO1A 4JPKH 3SBWC 5BS0B 1MJJA 1F5WA 2X4UA 4MJIE 2FEEI 4L8SB 5L7XH 1ZMYA 1R24A 2W07A 2HFGH 4PG2C 4DWHA 2NXZD 5JOFB 1IEBB 1X4XA 4WCYL 5C08E 3RGVA 4PRAA 3MZGB 2YUVA 5CJOH 3OKOA 1NEUA 3DXAA 2G5RA 3B5TA 4MA1B 1L6XA 1V5JA 2GJZB 3IDYC 3MCLL 5IHUH 3SBWA 3ZO0A 3LPGA 5ALCL 4PJFA 1Y6MR 2V5SA 4OZFB 2NX5A 2WWMC 3RDTB 5EUOF 1H3WM 1H5BB 4ISVB 1R5WB 2XQBH 4B53A 1BEYL 3QQ3B 3F58L 1IKFL 4NP4H 4HIEA 3V79C 3SGKA 3P0VL 5IFAL 5GQBA 4NFCA 3CDYA 4GBXC 2BNQA 4NQCB 3ARUA 3D0LA 2CRZA 5CZKA 3BGFC 5IB2B 2APBA 1P53A 3PL6C 3TBYB 1J8HA 4ETQA 4WHTA 3W9EA 4CN1A 5IB3B 2AK1L 1JF5A 2ZCLH 2AXFB 2V9RA 3QQ9C 4G42A 4U05A 3TBSA 1FVDB 5ADOL 3RFZC 1HZHL 2H8PB 3JWOH 4NSKB 3TF7C 2A9ML 1HINH 1C7TA 4RFEA 4Z7WF 3SO3B 1S9WB 5KBNC 2GYSA 5CZVL 1AHWB 1OCWH 3WO3B 2M2DA 3AM8C 5TPWH 2HVJB 1QLRB 3BZDA 3OXRA 1XH3A 5F93C 3GSVA 3UTZB 4HUUB 3O3UN 3BKCL 1CL7H 5CWSA 1FSKB 2LVEA 3KR3L 4PJ9C 4XH2B 3TBTA 4FZEL 4OCYL 4DTGH 4H5SA 1T2XA 3DROA 3B9EA 3ZDZE 1H0DB 3KPMB 4OV6F 3KYNA 4U1MB 1SMAA 4MXVE 1AO7A 1MCSA 4OCWL 5DHXB 5DD1H 4LLVB 3PIQA 2VDLL 5IVNA 3T77B 1U0QA 2YOCA 3K80A 4HIXL 3TT1L 4RGMB 5BJTB 2GITA 3FQWB 5D1ZB 1T0PB 4H1LB 1GGIH 4H25A 2EDQA 4JJ5B 3ARRA 3KYAA 1A1MA 3U83A 4WO4A 4S1RL 4MJ4A 2JK5A 5IEKA 15C8H 5J13B 4IIQB 2WK2A 1ACYL 4JFED 5JW4M 4HUMB 1LILA 1ZVSA 1KPRA 2MTPA 2VXSH 4LRNL 2R4RL 1BD2D 4HK3J 2CUIA 3L5XL 2YZ8A 3O4LE 3FCTB 2R2BB 3HI6L 4D0CB 3U4EA 1M05A 1D5MB 3EYVB 4FMFA 4E41D 3SKJL 2DBJA 5F6IB 4M5YL 1FL5B 2XG5A 4V2BA 4NRZA 3F7YA 3S4SB 3QXDA 4PRPE 1U8PB 1I7TA 1QRND 2FGZA 2DQHH 3OKLB 1BAFH 4S1DD 5IJVB 3WL9B 2HT3C 5DR5H 3L5JA 3VXSA 3GBNL 2YKLL 1EVUA 1TENA 2VLKE 3KGRA 3IDJB 4ONFL 1IM3A 5ADPL 1FZKB 3QA3B 3E8UH 2AK4B 3B9DA 3NA9L 4A6YA 4M61B 1T04A 1U3HB 4WTZG 4Y16A 3TCLB 2VLRB 2EE9A 4IJ3C 1OTSD 2E8YA 3S34L 3DSFL 1VACB 4Z8FL 2XN9A 1CXIA 1RHHB 1RIHH 2UZIH 4MJID 5L9DL 1J1OL 1R0AL 3QIUA 5GSVA 4D3CH 3FFCD 4Z95L 4DK6A 3OAUH 3MV8B 1F11A 4AL8H 2VL5A 3CFJA 1G7JB 1MCEA 2GTZB 1A1NB 3QJHA 4NNPL 4Y4FD 4HUVA 3QO1A 4XMLL 3FKUS 5DFVC 5BV7H 4C54A 2G75A 4YHYB 4GQPH 4H20L 5E94A 4JZNA 4WCYH 2G60L 2ADGA 4JKPH 4MXVF 3GSOA 1A6VL 1SHMA 1FNAA 2LE9A 3HE6C 5HPOA 5SX5H 2IALA 4LHUD 4LMQI 5I71B 3B9AA 1I7UA 4QXGL 3WE6B 3N85H 4F7CA 5E9DA 5DJDB 1U93A 1HKFA 1KB5B 1NMAL 2EEAA 5IT2L 1Q9WB 2BC4A 3RL1A 1FVCB 5FO9A 3M17A 2H1PL 5ISZB 4RWYL 1ITCA 4X6FA 2NZ9D 1FBIH 3VE0A 4UU9A 2HJFB 2DWEA 1CVRA 2B1AL 1BEYH 4YLQT 5KSVB 4BH7A 2Y36L 3F58H 1IKFH 1IGJB 1ZGLP 2HTKC 5IFAH 3WLWC 3EZ8A 3CVHL 1KJ2A 3JUZA 2EDWA 4YFLF 4D9LL 4PJCB 4NO0A 4PJAA 3RRQA 5INDB 5IWLA 1KPVB 1ORQB 4A6YH 1DLFL 2A0LD 1NDMB 5B38B 2AK1H 3EGSB 3NIGE 4M9PA 5EOCL 4JFPA 3VGHA 3B2VL 3TBVB 3ZL4L 4WV1A 5CKAA 1F4YL 4OM1L 4O02H 3IXTB 1WAAE 3AREB 1U6AL 4ZFZA 5E5UB 4PRHA 1N26A 2FSEB 5C6TL 1PSKH 1A7OL 2XWJB 3SKMA 2IANB 4EDWL 1PKQA 3MC0A 2FDBP 4FZEH 1JMZA 3D3VB 4N0UB 4OCYH 3VDCA 2FECL 4KKBC 5IMOB 4HUKB 3GGWB 1A4JB 5EU6E 1JVKA 4JN2B 5DJZA 4I18A 3QRFM 1F2QA 5TFSL 4PJGB 4RMVA 4OCWH 3AXLA 3TYGL 2HT2C 2VDLH 3CIQA 3M45A 4NHCL 1CD1A 3TT1H 4HIXH 5EDXA 2EE3A 3RGHA 1X5FA 5JR1H 1S5HB 2X9XA 1E6OH 2HVKB 4WFED 1RI8A 4I5BA 2BVOA 2ITDA 3H7BA 3WIHL 4J2XA 3OX8B 2P8LA 4D0BA 3QDMA 3RY4A 5F7NC 4OFIA 3B9KD 4S1RH 3MJ9A 4IOFD 1VFAB 2YPLD 3GSXA 1MFAH 3FRPA 3H9HB 4PJXB 3BXNB 1I1FB 4J7RA 3QUXC 4PRPD 4QOKE 4LRNH 2R4RH 1ADQL 3MRQA 1NBVH 4MXWL 4G9FE 5DJXB 4Y2DB 2VWEC 3EOBB 3UX9B 1KJ2H 5C92A 2VLKD 3SKJH 5DD5L 3VA2C 1PDKA 1UVQB 1G9MH 5ANME 3IU3A 1ZA3A 4OV5B 2A6KB 2JJUA 5DD6B 3WJLA 2EO1A 4QGYA 5I75C 1F3JA 2WINA 3GBNH 5DVOA 2A6JB 4LIQE 2Q86B 3VXMB 4LSTL 2E6QA 1CF8L 1C5CL 2YSSB 4UIKL 3WEXA 4NHUA 5ADPH 4ZTOL 3CZJA 3OB8A 4Y19E 4ZXBB 5E2WL 3DVGA 4IMKA 4C4KO 4P2OC 4XC3L 5DD3L 5ITFB 2BHUA 3S34H 3DSFH 3O11A 2X44D 5CSBA 5GZOD 3QEQE 3NIGF 1OY3B 2APXA 2I9TA 2IQAA 3VH8A 4P4RB 2AW2A 4GRMB 4L8DA 4QRRB 3EDFA 4OQTL 1R0AH 4PD4K 1X5GA 2CKBL 4U1HA 1ZA6A 4P2OA 5HXMA 1BQUA 1WAAF 1ZV5A 4BFIA 3R06B 2ATPA 1DCLA 4I3RL 3RBSA 2XQYG 3MRPA 1MPAL 4P2YA 5JO5B 2H9GB 4MX7B 4H20H 2C4XA 5KSAC 3FT2B 4GG6A 3LSOA 1K8IA 4QRPA 3D2UD 4ZDHA 2G60H 3BDXA 3MJ9H 4MXQD 2OX5A 4XWOD 5IR1B 1MI5E 1A6VH 5DYOA 1NGYA 1BZQK 2XICA 4QXGH 1NANH 3DUUB 3OKNB 1GYAA 4JR9L 3D25B 1NMAH 4L4VB 2J5LB 2GAZA 3ROOA 3IKKA 5F1KC 1CXLA 5D1QD 2Z0BA 2M8XA 4WUKL 1ZEAH 3UROR 4U7KA 1A0QL 5JQ6L 4JAMB 4G8GB 1Q9LA 4YXHL 4E42A 5I16A 5C0FA 4P2RA 4U1JA 2HN7A 5C0EB 3GDBA 2B1AH 1ADQA 5AZ2H 3UJJL 2IH3A 2Y36H 3TO4D 4DJMA 4NQDD 1EA9C 3WN5A 4IS6B 4NQSB 4GW4B 5I1IL 2NMSA 2J8UE 3FOMB 3FONA 3KLHD 2N56A 1FZMA 3TFKD 4D9LH 4XVJL 5EOTA 5F8QC 4JM2B 2EDYA 4KRPB 1VDGA 1DLFH 1Q9KA 5F3HA 43C9A 5EUOA 5I1LA 4WDIB 4JFOB 2DYPB 3MA9L 4TNWF 2FYYA 5FF6B 3SDYL 4BZYA 1MQ8A 4LVEA 5IQ9B 3LKQA 3BH8A 1A9BB 1KTDA 3T0EC 1CFVL 1P7HL 3ZL4H 3MV9E 1U9KA 4OM1H 1OF2A 3RPKA 3C5ZD 1U6AH 4RZCA 1KLFA 3V0VA 4BZ1L 1QFPA 3DNKA 1EBPA 3DX7A 3BAEL 1X9QA 1A7OH 2HFEA 2BOCA 4NKDA 1NKOA 4LGPB 4HLJA 4JFEA 4XHJD 2NCMA 3FB7A 4QCIB 5J1TC 2CUHA 1BD2A 1RHFA 3ARFA 4U1SB 2QR0B 3CFDB 3TYGH 4OI9A 2PXYB 4NHCH 3BJLA 1X5YA 4WU5A 4KH2A 2PW1A 4E41A 4LCCC 1IGIL 4QOKD 2DWDA 1QKZH 1B0RB 3UMTA 1EHLL 4RNRB 1WBXA 4X80H 4H8WL 3GMNB 5T3ZE 5LXGL 1QRNA 5BRZA 5J1AA 4XVSH 3H7LA 3QWOA 4X6DB 3KXFA 3PWJA 5HGGS 3HZVA 3WNOA 4MJ6A 3BO8B 1KB9K 4FQHB 1X6NA 1DDHA 4BSVB 1LE5A 4PLJC 5E8OA 4NQEE 4PJEE 1ADQH 3QT2A 3LKNA 5JLZA 3W9DA 2LAAA 1DTUA 5D71H 5F7DA 4LLMA 4YXLL 2ADJA 2GI7A 5DD5H 3GEWB 4M7LH 2EYRA 3L3OA 3MPCA 1R3KB 1N3NB 4XXDB 4Y19D 4MJIA 3LN5A 3VXRB 1OSPH 5F9OL 3F6IA 5C09B 2OR9L 5C08A 3PWNA 4OI8A 3F6LA 3EBAA 3QEQD 4ZFOA 3RNKA 4P4KC 3TCXA 4N1HB 5KS9E 3LN4A 1SJHB 2J8UF 1PZUB 5ELIA 4BUGA 1R5IA 4ZTOH 1KJVA 5LGKA 1AGEA 4Y4FA 1AXIB 5E2WH 4XC3H 2LAGB 2BERA 4NQVA 4UV4L 3ARQA 1GH7A 2PYEE 1IFHH 1U3ZA 1UM5H 5JNYB 5DRNB 1WBYB 1KT2A 3CFEB 4LHUA 7CGTA 1QQDB 2LV4A 1FHGA 3V6ZA 2YUZA 4HC1L 1CGUA 5JHDD 5GGRY 4LKXB 1QHOA 2GJ6B 2CKBH 3DV6A 1MI5D 1AXSB 1WEJL 4PRBB 3NVQA 2ESVE 4NWUL 4FTVD 1CK0L 3WNLA 3QG6B 3ARZA 2HA1A 4KROB 4H8WC 2VLJE 1MUJA 1MPAH 1S9VB 1XIWA 4JFFD 3MNVA 4CNIB 1Q1JL 5ICYA 5FAAA 1NLBL 4X99B 1X5IA 1NL0L 4LAQL 5C9JA 5HVHB 4XPHL 1Z3GL 5FCSH 1I4FB 4E5XB 3VFOA 3E2HC 2OK0L 4H26B 2C1PA 3PV6B 3GMPB 3EZJB 5L2JB 4JR9H 3U6RB 4FQXD 2MSPA 5I1CH 5SWZB 1CXHA 4HF5H 1URLA 1WT5C 4WUKH 5AWNH 4OCRL 3SKUD 1A0QH 3L7EB 5I8EB 3NOIA 3DVIA 4GKNB 1RZJH 3UJJH 2JE8A 2NY7L 3SGJC 2NW3B 2RFXA 5EBLB 1ZTXL 1SJXA 4GO6B 4U6HB 4B5EA 5DMGD 1WT5A 5C0RL 3NABH 2VDKL 3MV9D 5DRZA 4MZ3A 5AD0B 1NC2D 2YUXA 4QKXB 4QXTA 3RWJB 5C8JB 5TDNA 3AU1B 2E6PA 4KHXL 3P0YL 4P3DB 2FEEL 5D7KE 1KELH 4NC1E 4Q6IB 4JFDD 3SDYH 2CUMA 3CZFA 2Y23A 3O3DB 3T1FA 4LLAA 3OR6B 1CFVH 2RHEA 1JPGA 4M7JL 2C3WA 3V52H 2NY4D 3CH1A 3VDAA 3STZA 4K55A 3I6GA 1I3GL 5KS9F 3JTTB 4LSDA 1I8KB 4QYOA 2CLZA 3T65A 4NQUA 3O4LA 4YFEA 4DUWA 4OGYH 4YQXL 3ES6A 4R90L 3T4YB 4K23H 4NO5A 3BKYH 4Z76A 2VABB 4MQ7B 1RZ7L 1LE9B 2CJUH 4XCEA 4PRPA 3S35L 3NCEB 3OL2A 1U8OB 5EUKB 3GZKA 3MRDA 3QPQD 4HKXA 3C5SA 5ILTL 5FDWA 1V8HA 3RZCB 3QUZA 3VFUB 2APTA 4H0GA 2HTLD 2VLKA 5DRXA 4OLWL 5I6XB 1IGIH 1MWAA 1UM4H 2UY7A 3QIBB 1AC0A 1NGWB 4NQED 2B7DT 1NEZG 5LXGH 1JTOA 5BXFB 3D48R 5GGVY 5IVZB 4M8QA 3FO9B 1C08B 3MRMA 1FRGL 1QSZA 4WUUE 1TNMA 2A73A 3KJ4C 5EA0L 3RI5F 1LK3L 3CSYA 1D9KA 2AJ3B 2YXMA 3FB6B 5D96C 5I1AA 2PNDA 5ACLA 1LD9A 2BVQA 3VWKC 4CKVX 1ZS8A 1BREA 2YPKB 5HYSG 5JZ7D 2RCSL 3D85A 4BSWA 1D6EB 2AXGA 2DS4A 1T6VN 2B0SH 4W4NA 1KIPB 4ENED 3O0RL 1EEUA 4MCYB 3PWPB 1FNLA 2VH5H 5F9OH 5EZJA 4DZ8B 1B3JA 3VWKA 4WHDA 5FM5M 4EBQH 2BY1A 2PYED 3IU4L 3R4DA 4P57A 3UZVB 2D7MA 1MCOL 1EIBA 3BMWA 4LEXL 4MCZB 5HPMA 3LQZA 3FQRA 4N9OB 3OHXA 4XP4H 4B7LA 1A7NH 4JE4B 4HIIB 3FZUC 5D7LB 4WJ5A 1I7ZA 5A3ID 4Z7UB 2FD6L 4EI6B 3GMOA 2QHRL 5C0CE 2CMRL 3CC5A 5B21A 4IRJB 4LPTA 4X7TB 3CFIC 4UNTA 1WEJH 4LPWA 5H37G 4KRNA 4MD0A 1CK0H 1MWAH 4ZUVB 3LY6A 1DUYA 2R4SL 1Q1JH 1N59A 1NLBH 3BZEA 4NQDA 4UILH 4G6ML 7FABL 1NL0H 1HHHA 4LAQH 3ARDA 3TN0C 3LB6C 3WNNA 3N9GH 5JMOC 4XPHH 1HEZB 4K3JH 5GRUL 2VXUL 3EDJA 4GBXD 5DQDL 5DMJB 2F54E 3CX5J 1WAAA 4PJ8D 3PL6D 3MZTA 4QHNB 3TZVC 1WZKA 2XRAH 1AQDB 4OCRH 3QH3A 5C0AE 4I1NB 4DEPC 1G6RB 4JDTH 5FHBH 4PGDA 5BZDA 1P6AB 3N0PB 3QQ9D 4N68A 4JG0H 5EU6A 4P48A 1MCJA 2NY7H 1N0LA 4M7KL 1FFNA 1NUDA 2IPTH 3HC3H 3EYQC 5C0RH 4P46C 2VDKH 2FLRT 1FL6A 1QPPA 2WLYA 3BT2L 3BJ91 3QQ4A 4KHXH 3CMOL 4P2QD 4PJ9D 4ELKA 1YNTA 1KIRA 4OGZA 3QHZL 4O2FA 1EMTL 3DECA 3RY6A 3RUGB 3D6GA 5I17A 2H26A 3VFWB 5C07B 4KWUA 1EJOH 3PHOA 1J86A 2BX5A 4J6RL 3SDAD 2BCKB 4QOKA 1I3GH 4KKLD 5HHOE 4XI5D 3VFPB 1U3JA 1IAII 4G9FA 4K3HA 3IFLL 4PUBL 4YQXH 4R90H 4UDTA 1MCWM 3FN9A 5J57B 1H9VA 1F8TL 4YDKL 5ANMA 4ODSH 4EZMA 5FOBB 1KTRL 1RZ7H 1F58L 1TCRA 1QR4A 4L1DA 4YC2C 1OTTC 3OKEB 2V5TA 4ZOBA 1UB5A 4JB9L 5ILTH 2YD3A 5DFWH 4U2YA 4WUUD 5GHWL 3QUYB 3F7VB 1LNUA 4YFDB 3T8XB 4OLWH 5I8KL 1BBJA 4GQ9H 1JWUB 1CFTA 4CMHB 3FQXA 4Y19A 3I75B 3BD3A 3MRHA 1MAMH 4KI5C 4EI5B 4LLYB 3HI5L 3QEGH 4XNMB 2VZOA 3R8BB 3SY0A 2FATL 1FRGH 4U1KA 5J6HB 3QEQA 4NKOA 5EA0H 1FJ1B 1S9XA 3AY4A 1U8KA 4ZFFA 3WUWA 3TBWB 3IGAB 3U79A 4CU6A 5D93C 1HSBA 5C2BH 2DLFH 4U1NA 4B0MM 5D2NB 2MKWA 1BZ7B 1NCBH 1S9KC 3VFSA 4L9LC 2YRPA 1SJEB 4NRXA 4X6BB 4FRWA 3BP6A 2JJSA 4IM8A 4GSDL 2P45B 4J4PD 2DJSA 4PJBB 1C5DA 4JO2L 1UCBL 5CLTA 4U6VH 1DBAL 3QDJD 5A1AA 3VI3E 1MI5A 4PRDA 3IU4H 2EYSA 1NGZA 2XPGA 2K1MA 3FO0L 2IC2A 2LFGA 3P4LA 4FTVA 4ODXB 4P23C 3KYOA 5F9JB 2BMKB 4D0DB 1MCOH 5C0CD 4P9ML 5D8JL 4MAYA 1L0YA 2APVA 3U82B 5LQBH 3NTCH 1FC2D 2CIKA 2VC2L 3QZWA 5DWUL 4UAOC 3LKSA 4YBQC 3K4AA 3TA3C 1GGCL 1KUMA 2CDEA 5GS2H 2AEPL 3O6FC 3WO4B 1IM9D 1YNLL 2R9HD 3OJMB 1ZLVK 4MQTB 2P42B 1V3LA 2FD6H 1NDGB 2D4DA 3HE6D 1I9IH 3C6SB 2F9BT 3BPCB 4LIQH 2J8UA 4HH9B 4R96B 4QRQA 5D9SA 5TE4H 3CLEL 2JELL 5BS0E 2R8SL 2Q7YB 4HUWB 4JVWA 2I9LA 1FV1A 3ZHLA 3B5HA 2JIXB 3AB0C 4AIZB 4NFDA 5GGSB 4G6MH 3MCG1 3E3QE 3Q5TA 1L6ZA 2R0ZH 3MRBA 4M62L 1RZFL 1YEDA 1NC4D 1EGJA 1JYXA 2AJUL 1F13A 3MV9A 2VZ3A 2SEBA 3WLWD 4CVZA 3VFGL 3WIFB 1OB1B 1NC2A 3ECBB 4Y5VB 2AV7B 3RX7A 3ESUF 1BFVL 5DQDH 3FQUA 3UDWA 5HVGB 2F74A 3RP1A 3FQNB 3WDHA 2V2XB 4HGKC 1A2YB 4POZD 3GMQA 3DUHA 1PYWA 1I1AD 2E8ZA 4HX1B 1OLLA 3RA7L 1CS6A 3EFDL 2OQJB 4K8RL 4AIXA 2YHGA 3O45A 3V5HB 5LJYH 2P5ED 1JPTL 4NQCE 3TPUB 4M7KH 2KDGA 4M93B 4Y4KD 2FX8L 3RVUC 2MPAL 3G04B 1IGFH 3G6DL 4BQBA 3EYSH 3MRIA 2F53D 4AEEA 3HN3A 5I0DA 2AJVL 3BT2H 3CMOH 3QHZH 3JV5A 1EMTH 5EC1B 3RI5K 4KKBD 4YO0A 4GT7A 5E56A 5IG7A 3OSKA 1BVLA 2Y5TA 5FB8B 1RV6X 1BFSA 2WIIA 3NCYP 4N0FB 3H3PL 3N1PC 1AGBB 3VI3F 4F7EA 4R0LA 4HH8A 4NQEA 5KZCB 4C83B 5A43C 2XZZA 1CT8A 1UQSB 4PIRF 4MDIB 1N8ZA 2L4OA 4YUEL 3RAJH 1F8TH 4I8DA 3D18B 5D5MB 1KCUH 2IMMA 3QUXD 2Q8BH 1JZ6A 1F90L 4NUJA 2XIDA 2A77L 5GHWH 2X10A 4WY7H 1U58B 4Z0XA 2ERJC 2XZQH 5KS9A 1EGJH 2CR3A 1RULH 4I4WB 1LO2L 1JWSA 5DURB 1T2QL 2B2XL 2UWEF 5F71A 5CBAA 4IRSB 3PDOA 2YMXL 2I07A 3SDCB 4P5TB 1DQQA 3U46B 3HI5H 4L3CA 4HJGA 5IW1A 3B8YA 2PYEA 4K8RC 4U49A 5F1IB 2C1OA 2GSGA 1RIUH 4Y8AA 2A2QT 3DV4B 1G7HB 3ARGB 4MAUL 4NZUL 4WFGE 5JW4Q 4CVXA 2X4NB 3H0TA 4KKNA 5B22A 2Q76A 1FN4B 2ZG2A 5DF0A 2VLJA 4GSDH 4PJ7F 5T3ZH 1TQBC 4R2GC 2O5YH 4JANB 3STLB 5C0BB 2EDLA 3EOAB 5CEXA 2JB6A 1WTLA 2AK4E 3IRZA 4YPJA 1BJMA 3I6KB 5DZNA 5IHLB 32C2B 1E27B 1NCCL 3BQUC 3S4SG 1EO8L 3BD5A 2VLRE 3FO0H 1ZLVH 2FZ3B 4P9MH 5IESH 5D8JH 5IBLC 2R23B 2VQ1B 3W82A 4N5UA 3VGEA 4UQ2B 1S7SB 5IKCA 5BS0D 4XGZA 5DWUH 1CFQB 2DIBA 5CD5D 3U0WH 1KIQA 1YNLH 3BQUA 2VLLA 4Z7NE 4PTTA 1XGUB 1GC1H 1NSNL 3MV8E 2Q7NA 2J4WL 3DIFB 4RGNB 1OWWA 4NC1C 4PJ8A 1KC5L 3BEVB 3DO3A 5BW7C 3CLEH 2JELH 1VGKB 3KS0H 1U8IA 3WXVL 1CGSH 3JSSA 2A74B 2EC8A 1U95A 1IGYB 3EDKA 5J9PA 3IFNH 4LNVA 3GSNA 1ES0B 3O8XB 5EIVA 1RZKL 5DK0A 3L5HA 2D9QB 1K4DB 4JHBA 2X4PA 1ZT4A 4TUJA 4HKJB 3ARBB 3MUGB 1RZFH 4M62H 2R2HA 3KYMB 4ZS6D 3F7RA 3ILPB 2UZXB 3V4VL 1RIVH 1F97A 2AJUH 4KHTL 4O4YL 1KV3A 1N0XL 3QXTA 4MD4A 5ISZE 3LVEA 3V0AC 1AD9A 2ICEB 1WCQA 5MERB 5EO1B 4OUUA 4Q2ZB 4JLRA 4MWFB 5GRZA 1VEPA 3L3KA 1NEZA 2FR4B 3EFDH 4K8RH 4FFWD 3S37H 1KN4L 2WP3O 3SDAA 1TTUA 1MSPA 4PJCE 1SVCP 3DRTA 5IBUG 2VISA 2FHBA 4JQXA 4GLRI 3RVWC 1I3RB 4LSRL 3VG0H 3G6DH 3INUH 4OF3A 2HH0L 4ODUA 1FNSL 2NR6C 2V5YA 1JZ5A 4PR5A 5GGQH 3MLZL 5HYSA 1Q8MA 1KOAA 5JXED 3P73A 4I3SL 1ETZB 4KMQA 2AS5M 2OL3A 2DN7A 4WUUA 2X70B 4WENB 5DK2B 4KY1H 3VWJC 4HHAB 3WFCL 5D1XB 2X40A 3ZZ1A 3VFNB 2IANE 4MDJB 4Q9RH 5HHMB 1PY4A 3D3VE 4N0UE 2VDRL 3OGCB 5IB1B 5I66A 4KQ4L 3AUVA 1J05A 4X98B 3OKKA 4YUEH 3W39A 4AJ0A 4D9RE 4APQB 2Y25A 5AUMA 4PJGE 5FV1L 4I0CC 5TH2B 2HKHH 5IM7B 1MIEL 4WI8A 1RZKC 1PBYA 1D5XB 4Z7NF 4YHKL 4R7NB 5LKNA 5T1KA 1F90H 1ZSDA 2IBZX 1YYLL 4PJDB 4CMMA 1MJJB 4YHPA 2MOVA 4GG8B 4EEEA 4F3FA 3DO7A 4WU7A 1QEWB 2DQIL 4WWKD 3RGVB 3VXTB 1T2QH 4PRAB 4KK9D 1R3HB 3HE7C 3DYPA 2YMXH 1WC7A 4HK3N 2Z93A 4YIQB 2XOTA 1YY9D 3C09B 4HFWA 4PJXE 3PGFL 2WBKA 3IT8D 4ZYKA 4BQ9A 2AJSL 2JJWA 3QDJA 5F89A 2Z31A 3VFMA 2WM0A 3MX0A 3C87A 2AEWA 5DJCB 3MLTA 4P4KD 5C0CA 3C5JB 4K3DH 2R1XA 1ZANL 3UYPA 4XCYB 4M1CD 2W0LA 2FEDC 5I15H 2BHYA 3BHBB 1JPSH 2JJTC 1IM9A 2H32B 5CIPB 1EFXB 1NBYB 3VXME 3QUML 3BPNB 1GAFL 3H9SB 4GUPB 1FYHB 5DJ0A 2R1YA 1NAMA 1S9YA 1YJDL 4PJCF 2OL3H 5I18H 3HC4L 2NY6C 3HMXA 1H8OA 4YGAB 1MHEA 2JJTA 4G7VL 4DQOH 3MV8D 4TVSa 3FQTB 4GW5A 2Y1VA 5AYQA 2F54A 3ARWA 3IAQA 5E2UH 2ZJSH 1HKLL 4HPYL 5GJSH 5B4MD 5C0AA 3Q5OA 4PRNA 4QRRE 1HYSC 4YH6A 3V7MA 4EN3B 4EUPA 3EYOB 5ACMA 1NC4A 1XGQA 4UBDC 3IETB 3H42H 2BVPA 1NSNH 3IAGC 2ITCB 4S1QL 5FECB 2C4FU 2NY2B 3TIDB 1P2CA 1SBSH 2H3NB 3WLBB 3DX6A 4UIMB 2QTEA 4CUCA 4G5ZL 4P0DA 5KAQG 3OG4B 3S5LB 1AXTH 2FJFB 5JQHC 5ISZD 1XGTA 3GIZL 4PJGF 1VERA 3KPNB 5H37H 5A2JH 1QRKA 3UO1H 5DEGA 1V3MA 3TVMC 4YBLB 2D7NA 3MLWL 4JFHE 3LEYL 5FA3B 4L4VE 1BX2A 5EN2A 3TV3L 1PJ9A 4KHTH 1N5AA 1N0XH 5IEKB 3U9UA 5HHOA 2P5WB 4WTWA 3THML 4G8GE 3ME0A 4DAGL 3QUKA 1UB6A 1ZVSB 1VCAA 3TH4T 3L3JB 5F9DC 4F8TA 1JNNL 4OCSL 4MA3B 3MV7D 3C60A 3Q6GH 1FFQA 3PWVA 3IJSA 3RKPA 3FO1B 4OLXL 1KN4H 5HHPA 5EBWB 1PG7W 5I76A 4GOSA 2WW8A 3MNWA 1LWRA 4HS6A 1CDBA 3UCRA 1YJDC 5EULV 3F7YB 1NAMH 3BISA 4PGJA 4KK5C 3IDMA 5TE6L 4I77L 2NY0C 4OF7A 1MCDA 1XGPA 3HMXH 4LSRH 4AENA 3WFEL 2AEQL 3V2AR 5T5NG 3SCMD 1WIUA 1PG7L 4F7MB 5DHVB 1KNOB 2HH0H 5DJYB 2F5AH 5K9KA 2IAND 4TSCL 3SDXB 2C26A 1UKTA 1UXSA 3BI9X 4JREB 1ONQB 3LD8C 1YMMD 3MRLA 4HGWB 4EUPH 2GJJA 5L2KB 4JQVC 2YPVL 2X4TB 1G7QA 1MCKA 3MJGX 5ID1B 4R97C 3T0WA 4DFHA 3OAZK 1CE1H 4N9GA 1P7KA 1YNKH 5DFTA 2VDRH 4JZJC 4KQ4H 3RTQC 2AQ3A 4G8IA 3RWCA 3AAZB 5JOPE 4XZUA 1ORSA 3ZT7A 3O9WB 1MQKL 1MIEH 5KVDL 3CFJB 3FT3A 3DX8A 4YHKH 5HGBA 1QUNA 5ICXA 2VN4A 5CD3A 5I74B 2PO6C 3IF1B 2D2OA 4Y2DD 2DQIH 3GBLA 4X6DE 3CVIL 4AEIH 1HHGA 2CRYA 2KL6A 4PP1D 2YC1B 5SWQB 4WVRA 3NGBC 3P11L 1C7SA 3FFDA 5FGBC 5FIEA 4OGAD 4L8SC 5B3JF 2AJSH 2VRAA 3BWAB 1TJIL 5IF0A 1A8JH 1SYVA 3MRKA 5IFJB 4OD1L 5ABDE 2OXGA 5KVFL 4KDTA 1U2CA 3QNZA 3RL1B 3TP4A 4RX4D 4I48A 4NDMA 1DL7L 5GGVL 3EYFA 1ZANH 3E3QC 3ZKMC 5D6DC 5MP6L 1CXKA 3G5XB 5BS0A 2VXQL 4WRLA 4L8SA 1JF6A 2UWEA 4O58L 1IAIL 4QHKJ 4XMPL 3VXRE 5JOFA 1CLCA 3J8F7 5C09E 1IEBA 1H5BC 3VXUB 3JWDL 4U33A 4BQ6A 1G7LB 4OLEA 3LDBC 3S35X 4PY8J 2BXYA 1T7WA 4M6OH 4JPWL 3OF6A 4JM2F 4OZFA 4LSSL 1N2RB 2DDQH 4G7VH 3RDTA 4V1DD 1KENL 4OQ1A 5CMAB 3O41A 1ZGLM 3OJVC 4ISVA 1RJZB 1R5WA 4HMCA 2XKUA 1HKLH 2O5ZL 2RAMA 3IDNB 4OAWB 5MEQB 4HPYH 4PRIB 5DRWA 3NMEA 3LRGA 1K6QL 3QQ3A 5IBTH 2GJ6E 3LB6D 4G80B 3G5YA 3SKMB 4NQCA 1PZ5B 4U3HA 1N64H 4QRUB 4S1QH 5IB2A 2EC9U 4W6XB 1T20B 5J89A 3TBYA 3O6KL 1T3FB 2P8PB 5IB3A 2UVEA 4BSJA 3BZFB 3VMNA 4XPFL 2AXFA 2Z91B 1FSKC 1FGVL 5M94B 1FVDA 5B8CB 5FYLE 3SE4A 5HI5D 2H8PA 4NSKA 4DW2H 4KXZI 4PP2B 1JPFB 3C8KB 1GGUA 1S9WA 3B3IA 2FH6A 3GI8H 1AHWA 1CD0A 2HVJA 1QLRA 5GGSY 1YA5A 3TV3H 3UTZA 4HUUA 5SWZE 3EYQD 2BVUA 4UINH 3GSXB 1ZE3C 4X6DF 4XH2A 5DMYA 5D1ZC 2DQFB 5JXEA 2YS4A 4DAGH 5E6IB 1H0DA 3VXPA 3ZYZA 4KMTL 1FYTB 3KPMA 3M8OH 5GS0H 2DD8L 3P9LB 4GXVL 3MRQB 2DYPD 5I73C 4U1MA 3JWDC 4FQ1L 2H2SC 4OLXH 3T77A 1U8MB 5A16B 4IIQC 5BJTA 5TF1L 1T1XB 5T3XE 3FQWA 4G6KL 5BZWB 4H1LA 4I77H 4QHMB 5T1LB 2DI8A 2AEQH 1TDQA 1PG7H 3MCKB 3M07A 4IIQA 3V4PL 4FQ2L 1MLBB 4WFHE 3ARPA 1GRWA 3IJYB 1HQRA 5FKAA 5JOPD 2HJLB 4K71B 1GIGL 2R2BA 1FH5H 4WWKA 2PXYD 4XXCA 4D0CA 4WGWB 3QP3A 1D5MA 5K93A 2Z8RA 5C0JB 3KNBB 1YDPA 1FL5A 4L8DB 4R8WL 3S4SA 1X5LA 1U8PA 2XKSA 3DOSA 3OKLA 3QDGD 1DUZB 5IJVA 3WL9A 1ZA6B 3KDMB 5KN5B 1MQKH 3ETBF 4IHOB 3IDJA 4XRCB 1FZKA 3QA3A 1NCWH 2AK4A 3BPLB 2NY1C 4M61A 3BYTA 4TVPL 1U3HA 3QB7C 4G43B 2I25N 3QXUA 3VA6A 2FH8A 3X3GL 1WBZB 3TCLA 2VLRA 5MI0C 5F97E 2VZ1A 1F45A 1UJ3B 4NNXB 1VACA 1A64A 1RHHA 1FIGH 2XKNB 1MCPL 2DQJL 1Y6KR 1U3YA 1TJIH 1OSZB 5DUBB 4OD1H 3MV8A 1ZLSL 1N6QL 3ZTJG 4LVNB 1DL7H 5I71C 2MQ0A 5I16B 1G7JA 4HS3B 2GTZA 1A1NA 5MP6H 2ARWA 2VXQH 2X7LB 4HCRL 4XTRD 3PWPE 3UTSD 4F15C 3T2OA 4O58H 4XMPH 1IAIH 5I1JL 1INEH 5J6GB 2FIRT 1Z9MA 2A6IB 4YBQD 3TA3D 1PX4A 4MZ2A 3MSPA 2E5EA 3O6FD 1YQVL 1KGCE 5HI3C 3LCYA 3WE6A 4OJFH 1EHNA 5I1LB 3MYJB 3K46A 5DJDA 2GJ6D 1KB5A 1YEFL 3MBEC 5DJAB 4XPBH 3WV0A 1Q9WA 1KENH 1OM3L 1FVCA 3IYLW 1Z5LB 3LKQB 5D7LE 5ISZA 1I9EA 3QCUL 4KROD 1MHPH 4Z7UE 3QI9C 1JWMB 2AAVA 1OF2B 2HJFA 5KSVA 1K6QH 1IGJA 1IEHA 1OAQL 3WHXB 4Z7VB 5F6HJ 3SJVD 4PJCA 2BOCB 4NJAL 4F37F 1FORH 5GS1B 2QKIB 5INDA 1KPVA 2BFVL 1ORQA 1NDMA 3O2VL 5B38A 3MV7A 5E2JA 3EGSA 4XPFH 1ZGLB 1FGVH 5J06A 3VGGA 4Z7WB 4WU5B 3X14B 2E9BA 4NN6B 3TBVA 3AVEA 5EOCJ 1WBXB 4JKLA 3IXTA 3AREA 3N50A 3VD5A 3HZVB 3CDGB 4WHCA 1CLYL 4WIQA 5T3XD 2XWJA 4KVCL 1D6VH 2A9NH 1BFOB 2IANA 1WFUA 1LE5B 3BE1H 3D3VA 4N0UA 1DVFD 5IMOA 3BW9A 3GGWA 5DGQA 1A4JA 3VGAB 3U48A 4JN2A 2QSCL 5JLZB 5HDOA 1CE6B 4PJGA 3W11D 1N6VA 3L95B 2X41A 4UT7L 1D3CA 5TF1H 1FG2B 2V7NB 1HOCB 1S5HA 2OI9B 2C3XA 1WFOA 2B4CL 4Q0XH 2JCCB 2BSRB 3OX8A 1KB5H 4LQFL 5FYJL 5A2LH 3RUGE 3FFCB 3PWNB 3DJ9A 1JP5A 3RNKB 1ZAGA 1VFAA 5C07E 4G6AD 3LN4B 3S6CA 3H9HA 5ESVB 3BXNA 1I1FA 1BOGB 4DGVH 1QR1A 2ID5A 4Y4FB 2VUYA 3KPOA 3I50L 2NY5L 2P46B 3MRNB 2WMPA 5DJXA 4Y2DA 2Z8VC 3EOBA 5J1SC 1S5IL 5KG9B 2LQRA 1OQXA 3KPTA 3QIBD 3SDDD 5DS8B 3EW3B 1E4KA 1ZVYA 4R8WH 4OV5A 2A6KA 4LHUB 4ZXBC 5DD6A 4YGVA 2P47B 4K9EH 2CK2A 2V2WB 2R0LL 2Q86A 2A6JA 4FQLL 1BGXL 3VXMA 1RZ8B 1EO7A 4BELD 5I19L 2CPCA 2E3VA 2YSSA 3ULUE 4RX4A 4YHNB 4E0RB 5D6CB 3ARTA 3NPSB 1TFHA 3MROA 1L4IA 4TVPH 1MY5A 4ZXBA 4ODHL 5DJ2B 3CNKA 4XCFL 1AFVL 3ISWA 2BY2A 3TO2B 3CFKA 4F9PA 4P4RA 4GRMA 4YNYA 2HMIC 4R2GD 3RVVC 1TIUA 1IBGL 5E1HB 4DCQB 4QRRA 5F7FA 5BO1L 4OIBA 5D2NE 4GRLC 2FX9L 2NXYC 1ZLSH 1N6QH 1IAOB 3R06A 1KGCD 5K9OB 3AS1A 3SE8H 2B4CC 2XWBB 4Y7MA 5CUSL 3U7WL 4FFYL 5JO5A 3HZYB 2J5LC 3MYZA 4PJBE 5I1JH 3WJJC 1RUKL 3HMWH 2EDFA 5D7LD 5IR1A 4KAQL 5JPMB 1YQVH 4WW2F 1AD0B 1VKXB 5DUML 1WIPA 1G9NL 4QXTB 1GHFH 1B6UA 2NY5C 1NFIB 2ORBL 4DKFH 3DUUA 3OKNA 3ULVE 3D25A 1FFOB 1YEFH 4HWNA 5KVEH 2A1WL 5BVPH 3VGDA 4AEFA 1OM3H 4JO4H 3JVGA 5HYQA 3RUGF 4JAMA 1UYWH 3QCUH 3R1GL 4G8GA 1RK1B 1CVSC 5C0EA 2P7TB 4PBVC 1MCHA 4NQSA 4GW4A 2AEIT 3VRJB 3FOMA 2VB5A 4LK4A 3B9KB 4NJAH 2YPLB 4QTIL 4JM2A 2NY3C 5F7EL 3MREB 1G6VK 1OTUD 4M9OA 2BDNL 3O2VH 4WDIA 4JFOA 3S3SA 3RY5A 2DYPA 1XCQB 3X3FH 1JNLH 1XCTB 4AMKH 5FF6A 1JGEB 2YD4A 2V6HA 5IQ9A 1A9BA 1NLDL 2ARJB 3C9NA 1RFDL 4XBGB 5E5RB 5F7MC 3RHWF 3ULUF 1CICB 3O3AB 2YEZB 1GGTA 1AGCB 2HJKB 1LDSA 3RVWD 1CLYH 4KVCH 1NUGA 3ZLQC 25C8H 5IHZB 2NR6D 4QCIA 5KSBB 2GK0B 2Q20A 1FL3B 2YD7A 4U1SA 2QR0A 3CFDA 2EECA 2XFXB 5C07D 2M26A 2PXYA 3NFSH 1O5DT 1G9NC 3T3PE 3TM6A 1B0RA 1GOGA 3LKRB 2QQQA 4RNRA 3V6OA 3GMNA 1JF1B 3RVTC 1PEWA 5KVMC 3QDGA 3CU1A 4LSVL 4X6DA 4HPOL 4FQHA 2NPLX 5EO9B 1CL7I 2W65B 1I9RL 3MGTB 5ACZB 3U4AA 3I50H 5D4QA 3K8KA 3MQIA 5BCAA 4Q6YA 5ETUA 3F12B 3D2UB 3ULVF 3ULUD 5D72H 4HXAH 3NCCB 3O2DL 1EBAA 1F00I 4LEOB 3CXHJ 2D03L 2ICES 5E8NB 1R3KA 1N3NA 5D5ME 1OAYH 3HE7D 5JORB 4U1IB 3VXRA 2A83B 3VW3L 1RPQA 1BGXH 5FM4A 5D1QB 1CR9L 4NKIH 3IXAB 3S7GA 1MJ7H 1MVUB 3UTSA 4XP9H 4ODHH 1F3DH 3TO4B 1JYNA 4NQDB 4KV5E 4Y4HD 3EJZD 2UYLB 2W0KA 4XCFH 3QIWD 1MFCL 4URTB 1X5HA 1WIOA 5DRNA 1WBYA 3CFEA 1QQDA 1IBGH 4ONOA 2OR7A 1OAXL 1KCVH 4LKXA 3SGEH 2GJ6A 2FX9H 4HIJB 4P49A 1FE8H 5KTEH 4IDJL 4KK8D 1AXSA 4PRBA 4NOFA 1M7DB 3WSQL 3F5WA 3QG6A 3CDCA 1PVHA 4PGDB 5GZNC 1S9VA 5MHSE 4FFYH 4CNIA 4LPXA 1VENA 5C0BE 3C5ZB 3U30B 3NIDF 4X99A 3BKJL 1HYSD 2I27N 2MFNA 1I4FA 2E7BA 5DUMH 4E5XA 1DEDA 1P4BH 4AYFA 1MHCB 4H26A 1ND0B 3GMPA 3T3PF 1YNTB 1T89A 5L2JA 4O2FB 5E8PA 3U6RA 5I1HL 2O5XL 2E27L 1J0ZA 3BEWB 5I17B 3VJ6B 4K3EH 2H26B 3IFPB 5ERWB 5DLML 3GRWL 4LAJH 1FPTH 3R1GH 2IPUK 4NZRL 4J8RB 5DQJB 4GKNA 4LVHC 4Z78B 2I60L 2LU7A 2PR4L 3RX8A 4RGNE 2J8HA 2NW3A 4UTAH 5EBLA 3NH7H 4WEMB 4LPUA 3U2SB 4U6HA 5D7JC 4TRPH 3G6JB 3TJHC 1C12B 5AD0A 4X7FC 3LV3B 5JW5B 5C8JA 4UV7L 1UB5B 1WCBA 4PYHA 4P3DA 1MHHB 2XZAL 5F7YC 4Q6IA 3O3EB 1UKSA 5IP4A 4KJQD 1KLGB 3A6CH 3O3DA 2DMBA 2KH2B 1NLDH 3OR6A 1RFDH 3ZT5A 2J7LA 2UUDH 3R0MA 3UEZA 4J3VA 1Q38A 4ZO8A 1I8KA 1HYRC 2OP4L 4NZTH 1EEQA 4HT1L 5DHYB 3T4YA 4U1KB 3IB4A 4KV5F 4FFZL 5I6XC 4ZUWB 1N5YL 4ZOAA 1U8KB 2VABA 2B5IB 4MQ7A 4F80A 1LE9A 4RAVB 1X6LA 1QFOA 1HWGB 1U8OA 5EUKA 5C3LD 2DI9A 4ZPVB 1ZHLB 3RZCA 1CBVL 2VAAB 4MQXC 1MIMH 5FYLH 3K3QA 4G3YL 3QIBA 3REWB 5KZCD 3VI4E 4ONGL 4OZGF 3QXVA 2W59A 1ULVA 5BXFA 5IVZA 4PGZA 5EZIL 5JHDB 4N8VB 3FO9A 4LSVH 4OD3L 1NGZB 4FTVB 1I9RH 1CZ8L 2AJ3A 3FB6A 3QWQB 4JFFB 2AV1A 4DZBB 1RURL 5HHME 3S36L 1PLGH 1OAUL 2YPKA 3LKSB 3CGTA 2CDEB 1D6EA 1MREL 1ZHKB 5T3XH 1IC7L 1KIPA 2D03H 2XYCA 4IRSD 1A21A 3S96B 2E7HA 4MCYA 3IDIB 4GAYA 1AJ7L 4PTUB 3SDCD 2RQ8A 3EIFA 4FQXB 3QFDA 4LF3B 4DZ8A 4ELMB 4PJDE 5HDBE 1DEEB 1IZKA 2I5YL 4M1DH 4JFZL 4YDJB 2FHFA 4GXUM 1BQHG 4N0YH 3MLYL 1ZKAA 3A67L 1XF1A 3W81A 4JRYD 4DGYL 4MCZA 1Z0MA 1IRAY 4JFXB 5D7IB 4HIIA 2VDPL 5D7LA 4LU5L 1MFCH 5L8LB 1VSCA 4NM8H 1MF2H 4R3SB 1PG7X 1RUML 5ICZB 4Z7UA 4EI6A 1N7ML 3QHFH 1NC2B 3LPWA 4K7PH 1A4KB 1OAXH 3HNTL 4YX2L 4IRJA 4TPRH 1I75A 4X7TA 1CYGA 4IDJH 5IW6B 4JFDB 4Y5XC 4I0PB 2G5BB 4ZUVA 3LS5L 1YEJH 2NY4B 1YMHA 5EIIB 3H9SE 3CK0L 3ZTJH 4JY5L 2VXTH 2DF3A 3RHWK 1O0VA 1JHTB 1FAIL 2Y72A 1HEZA 3HRZA 4LSQL 2YN5A 1DZBA 2BVEA 4P59L 2OZ4A 2O5XH 2E27H 3FMGH 4KTEL 4QHNA 1W0VB 3VI4F 1FNEB 5CEZL 3SKNB 5DLMH 1AQDA 3GRWH 1MH5B 2JB5L 1G6RA 1TVBB 4NZRH 4C57C 4YHLL 1RZIB 2I60H 5I8CB 2PR4H 1T5XB 2P24B 4WW2A 3S9DB 3UPCA 5F7UA 1DBJL 2MCPL 1FGNL 3MLXL 4X9HA 3NIFE 3KLSA 4LLWB 1RU9L 1HNGA 1Q9OB 1DN2A 5E4EC 3KLAB 1NANI 1KBGL 5HYEA 3RUGA 3VFWA 1A6PA 3EOTL 5C07A 3BGMB 2ZSWB 2YK1L 3KVQA 4OCXL 5JPNB 3EFFB 5HDBF 4OT1H 1LO0H 2H2SD 2BCKA 4HJ0D 4HS8L 2EIBA 3ZE0E 1ACZA 4PYGA 4FQPA 2P5WE 4LSUL 4I9WE 3VFPA 2OP4H 1E0OB 1WJ3A 1IT9H 4HT1H 1G7IB 4FFZH 5GPRA 1T7XA 1DBKL 4HV8B 2DLHA 4FP8H 2C1OB 5FOBA 2V17L 3MUZ1 2WBJC 3OKEA 3T4AB 3WFDH 4F58L 5ALBH 4G8FA 1CBVH 3K81A 3QUYA 4PLNC 3F7VA 3T8XA 4G3YH 5CJ5A 2DM3A 3GHBL 4BZ2L 1EZVX 4ONGH 3I75A 2OZ4H 5HHMD 1IARB 3SDXE 5GJTL 4EI5A 1EUTA 4LLYA 2R69H 3C8DA 3EOYG 1B9ZA 4OD3H 5J6HA 4XX1E 1AY1L 1FJ1A 4LPVA 5L2KE 1G6RH 4JCMA 1YUHB 3TBWA 5L6YL 3IGAA 4R4FL 3LEVH 4XPAH 1IQWH 4KXZH 4XCCH 5D2NA 3S36H 2X89A 4N90E 1L0QA 4XGZB 1OAUH 4Y4HA 5DEZA 4I13B 4HD9A 1KIQB 1SJEA 4IBLT 1IC7H 4X6BA 4XX1G 1P84J 2DL9A 3RWEB 3P77B 4GBXB 1AJ7H 4X7SH 1HXMB 1BECA 2EICA 3HA0A 3BZ4B 3PL6B 3UTPE 1S78C 1XT5A 3WO4C 3VD7A 2I5YH 3HUJB 1U95B 4LCUB 4ODXA 4HBCL 5F9JA 4Y8DC 3MLYH 2BMKA 4D0DA 1NMCC 3NIFF 3MLUL 2IF7A 3X17A 4DGYH 1TLKA 3TESA 4J3UA 2Q87A 1MCLA 5I1EH 1ZT4B 3QDAA 3L7FB 5A2IH 5F1OB 4LU5H 5KJRL 5C0DB 1EFXD 3MNZB 1N7MH 1TTGA 3V5DA 1WZMA 1NDGA 1E28B 4RGOL 4P2QB 4PJ9B 3C6SA 4YX2H 4PJHF 3BPCA 1HWHB 1K9TA 4HH9A 4R96A 3N1MC 2QQLH 4OUUB 1QO3B 1MCWW 2Q7YA 3IKCB 4HUWA 1A6WL 5CFHA 3MBED 3LS5H 1B2WH 2I26N 4X6EB 4Y5VC 2JIXA 3VXUE 4AIZA 2XXMB 1DP0A 3CSBA 5GGSA 5TDPB 1GZPB 2K9UA 2Y4SA 4AQ1B 4EN3D 4YK4C 3LAFA 1FAIH 3UBXB 3IS1X 1JGLL 1K3IA 1MCIA 3D39B 2A38A 2ZOKB 4LSQH 3WIFA 1OB1A 3ZKQD 3ECBA 4P5MB 2AV7A 5EOQH 1KTKE 4F33B 3FQNA 2V2XA 4KTEH 1A2YA 4M03A 3SDXF 4PRIE 4HX1A 2OQJA 2PTTB 4PB0L 3V5HA 1T2JA 3C6LC 2E7LC 4J3OC 1A3LL 3OAYH 3HI1B 1FG9C 4GMSL 1WF5A 3TPUA 1RUQL 3TJEL 4FQQB 5GRJL 1AE6H 1DBJH 4ERSL 5A40E 3G04A 1OARH 5IMLB 2E7LA 4I9WD 3ULVH 5GGUB 3DMMC 1QA9B 1NGPH 1UH4A 5EC1A 5MEOB 2NQCA 5F7LB 4PJIB 3EOTH 3KPRD 5FB8A 1HH6B 4N0FA 3V6FB 3LIZL 2DMKA 1AGBA 5F1SA 4JJHA 4OLYL 1U91B 3L9RB 1WC7B 4C83A 4LSUH 3MUHL 1A3RH 4WI3A 1UQSA 3QDJB 4MDIA 1FYTE 1DBKH 3HAEA 5FM8A 3WHE1 3P4MB 3D18A 4U1LA 1UENA 3AC0A 2XTJD 2V17H 5HD8D 5DVMA 5D5MA 1U8QB 5JW3L 3MLTB 4YDIL 4ALAL 4RMRA 5MENB 5FUOL 1BZ9B 4JPKL 5KVGH 1U58A 2XNAB 2ZUWA 3ARYA 1IM9B 4I4WA 5FGSA 4BZ2H 2X6MA 2W38A 4KK6D 2R39A 4NJ9L 5HVFB 4YXKH 3OBAA 1EHXA 4IRSA 4UMGA 4GFTB 5CJOL 3SDCA 3ARGC 3HE6B 4K7FB 4P5TA 1G1CA 4CJ1A 3U46A 1UWEL 3VFRB 4YZFE 3PGCB 2X4RB 1AC6A 2CO7B 3P9MA 5IHUL 3VXOB 1U92B 3GKZA 5F1IA 4RFOH 5DQ9B 3HR5B 4GW5B 2E9JA 4R4FH 1LEIB 4RDQG 3QWRD 1H3PL 4JRYA 4U6YB 3DV4A 1PD6A 1IKNA 1G7HA 1XZ0B 2XQBL 3ARGA 4N0RA 3S8WA 4LP5A 4N5EC 3ZDXE 4R6UA 4NP4L 2GUOA 1FN4A 3DETC 2J88L 3QFJD 3VXNB 1S7XA 4JANA 3STLA 5C0BA 3EOAA 1W72L 1HCFX 3NA4A 3RVVD 3I6KA 4XBPB 3VH8G 1I1AB 32C2A 1E27A 5GRXG 4DKAA 3V9FA 4GRLD 1WITA 2NXYD 2FZ3A 3DX9B 2P5EB 3CFBB 5TQ2H 2R23A 2VQ1A 3JWOL 2J3SA 1HINL 4UQ2A 1S7SA 4UOW1 4LFHD 5KJRH 2IWGA 3BP7B 4FG6C 5FYJD 4Y4KB 1I7RB 5EN2B 3D69B 2D7TL 1XGUA 3LZFL 3O8XC 1CL7L 2F53B 4AEHH 2IAMC 4DTGL 3BEVA 1UB6B 3SE9H 5HGAA 4HG4J 3ARBC 2CDGB 5C0NC 3D1MC 3K2UL 4WI6A 1VGKA 1A6WH 2BSTB 4ZG1A 2A74A 4YPGB 1J18A 1IGYA 5DD1L 1JV5A 4JRXD 1CFSB 1ES0A 3QHTC 2ZKHL 4HS6B 2RGSA 2ED9A 1P1ZA 3IDMB 1GGIL 4HKJA 3MUGA 2DQDH 3KYMA 3ILPA 1OVZA 2WANA 1S7TB 1S8DB 4FHBD 5K9KB 1EH9A 4HUNB 3UJTL 4L8CA 15C8L 5F96L 3QUXB 2GSIA 5MERA 4XNUH 5EO1A 2QHLA 4Q2ZA 3MRLB 4GW1B 4MWFA 2BY0A 2EDJA 2DICA 4YZFF 2FR4A 3SQOH 4PB0H 3CVHB 3VG9B 5IUSA 4Z7VE 3HFMH 4NO3B 1A3LH 4ZQKB 3KWWA 4GMSH 4F57H 3U7YL 4BYHA 4LLUB 2VN7A 2ARJQ 3WFHA 1I3RA 3DVNB 3IAPA 1BAFL 5IJKC 5I75B 2LU3A 3ZDXF 2OMBA 4NZDA 5TDOB 4Z7WE 3JWOC 1ITBB 4E41E 5HGBB 3E8UL 5E6ID 4LGSB 1SMOA 3QR2A 1ZHBB 4APQC 2X70A 3FN0L 5DK2A 3GMRB 4HHAA 3GM0A 4OLYH 3MA7B 1BF2A 5D1XA 3VFNA 1UA6H 3CCHB 4MDJA 1FNGA 3DLQR 3BPOC 4JHAH 2W9EL 1GPOH 3OGCA 5IB1A 4DKDC 4X98A 1HSAB 3RGVC 2D3VA 4D3CL 3MLSH 3I9GH 5TH2A 3HZMB 3BN3B 3OAUL 3VFVB 5IM7A 4AL8L 5DMKB 3O2WL 3CUPB 4Y5YA 3ZHDA 1D5XA 4FFVC 4R7NA 5FUOH 4PJDA 1ED3B 1OD7A 1T66D 2K7PA 4GG8A 2UWEB 5BV7L 2JCCE 2YUWA 4F9LA 2XA8H 5KSAB 5FYKD 1QEWA 2ZUUA 4NJ9H 3VXTA 4X5WB 3FFCE 2FRGP 1R3HA 4JKPL 1WISA 4YIQA 5C0IB 1A7BA 3PP4L 1UWEH 5E95B 4FS0A 2F19H 4CL7A 5SV3A 2X4OA 3N85L 2G9HB 3SGKC 5E08H 4HAFA 4EKXA 3EJYC 3EO1A 5DJCA 3O41B 3C5JA 4C56D 1QBBA 1R3IH 1H3PH 3TNNB 4AG4L 3AGVA 4BJLA 1FBIL 3A6BL 4XCYA 3V4UL 3HCVB 5DRWB 4PJ7B 3BHBA 4KJWC 2H32A 2J88H 4WW1A 5CIPA 1QHPA 5HGHB 1EFXA 3V0WH 2P8MB 1NBYA 4LGRB 3G5YB 4UT9L 3GJEB 3HZKA 4GUPA 3H9SA 1UEMA 4KZEL 1W72H 5J3HC 4Z7VF 3JTSB 3DUSB 8CGTA 1PEZA 4DUVA 4A6YL 4JO1L 3KLDA 4LHUG 4ZUSB 1GL4B 2EIDA 2VIRB 4M02A 1F4AA 2EDTA 5F21B 3FQTA 1PW3A 2AVGA 4BQ8A 2NY2C 3T0EB 2BOBB 3KPPB 5GZND 1DFBL 1K85A 2D7PA 1OWRM 3B3IB 4O02L 3SGDI 1T83A 2CXKA 4EN3A 4GS7C 3EYOA 3MUY1 3D5OF 4RFNC 2BVYA 2D7TH 2J1KA 3IETA 5EU3B 3LZFH 3O6LL 4TUOB 4J1UB 3L3HB 1L7TH 1PSKL 4LDOB 1DQMH 2ITCA 1T1YB 5FECA 5C1MB 3TIDA 4L4JA 4YBLC 3VXPB 5BV7C 3K2UH 2H3NA 3WLBA 4WO4C 1UXWB 4UIMA 1KJ3L 3S5LA 2FJFA 5ENWA 1HH9A 3KHOA 2ZKHH 4LNRB 4YHOL 5JR1L 4LCCB 3KPNA 1E6OL 4W6YB 3P4OB 1YY8B 5ESAB 2ZSVB 1II4E 1NH6A 5FA3A 3OJDB 2BSSA 4PJHA 3QDHA 2JCCF 3UJTH 5D7JD 1S7UB 1MFAL 2P5WA 5F96H 4F7TA 2WQRA 3FAXA 3L3JA 4WFEE 1EX0A 1HQRB 5FKAB 1RJYB 3MACH 4MA3A 1NMBL 1NBVL 4MB5A 4Y2OA 2H32H 5CIPH 4WWKB 3FO1A 2YRZA 1KJ2L 3FTGA 3HNVL 3NCJH 5EBWA 2HLAB 3U4BH 1G9ML 2YPLE 1YDPB 3U7YH 1G9EA 4Y16C 3BN9C 1HILB 3GKWL 4F7MA 5DHVA 1KNOA 5DJYA 3EYUL 3W2DL 4LVOB 4YHMH 1CXEA 4KUCF 4P4KB 3SDXA 1T03L 1M6OB 2CLVB 3PQYD 4MB3A 4U2ZA 3QIUC 1ONQA 4HGWA 3E0GA 3FN0H 4KGLA 5L2KA 4ODVL 2X4TA 1P7QD 4XPTH 2W9DH 4RAHA 5ID1A 1CLZH 2D7OA 2QEJA 2PCPB 4LOUD 2W9EH 5LG1A 1K5NB 2EXWC 1HXYB 3N1QC 5IB4B 5KSBE 1JNHB 3AAZA 2VITB 2GTWB 3O9WA 4G6JH 1SY6A 3O2WH 4ZFGH 1B4RA 4HIHB 1UG9A 4M43H 3QWRA 1IQDA 3I6LD 2C3VB 2YR3A 5KSUB 2QQNH 3BIBX 3IF1A 4KKCC 4BH8B 1FO0B 3MJ9L 35C8L 2YC1A 5SWQA 4RWHA 3HC0B 3PP4H 3E2HB 5IEHB 3BWAA 1WV7T 5FFLA 4KUCD 5DMIH 5IFJA 5E4IA 4H0IA 4XC1L 3NZHH 1MFBH 5LCVL 5HY9B 1QSFD 1ZEAL 3RBGA 1G9MC 5IWLC 1OP5K 4J3WA 4AG4H 1RJCA 3DI2B 3JV0A 3A6BH 4L3EB 1RK0B 3G5XA 3V4UH 3SEPA 5AZ2L 1MCFA 2C5DC 4WI5A 4Z0BL 3V6BR 5DHVH 3IFOA 3VXUA 1G7LA 4UT9H 3NPZB 4KZEH 2P1YA 4WV1C 4BFEA 4CU7A 2VYRE 5I1GH 4JO1H 4NYLA 4YDLC 5F7WC 1N2RA 3MV7B 4NQDE 5T5FH 5EU5B 2KZ1B 3G9AB 4XNQB 4RRPG 5CMAA 4M7LT 1RJZA 2PN5A 3K7UA 4P9HL 1A7PH 1QTYT 3IDNA 4OAWA 5MEQA 1DFBH 1R3JB 1A9EB 4I18C 1TCMA 4PRIA 1T21B 3BP5B 1JN6B 4L4TD 2E7MA 4JGJA 3MXWH 4CADB 3SCMB 4HFUL 3O6LH 5B8CC 3UTOA 1ZHNB 1RAMA 3NAAL 4G80A 5F7KC 4H0HB 5E6YA 1PZ5A 3MRGB 5CJQH 4QRUA 4ZSOB 1XF3B 1TVDA 1T20A 4OFDA 4PBXA 3BW9B 1LVEA 1CTNA 4J3TA 4HMDA 5I9QB 1T3FA 1YMMB 2P8PA 1P9MC 3S36X 4TTDD 3E1F1 1KJ3H 3BZFA 2W91A 3JUYA 2Z91A 4M48H 5KSBF 4AM0B 5B8CA 1KCSH 4YHOH 4X9GA 1QKZL 3V95A 3S3PA 1W2KT 4PP2A 1JPFA 3C8KA 4X80L 3ZKND 3PWLB 2AJZA 4C58B 4XVSL 1P9MA 4R26H 4WFFD 2HT4C 5GRYA 2EH7H 3HS0B 1TMCB 5EZOH 1X44A 2DQFA 4KQ3H 3BH9B 3WJLC 5E6IA 4HAGA 5I1KL 5D96B 1QR1B 4KVNH 3KPOB 1FYTA 3GBML 3P9LA 1NMBH 4XCNB 1W8NA 5D71L 3HNVH 3T0BA 4FABH 1U8MA 2DQCL 5A16A 3NZ8B 2HAZA 2NLJB 3CLFH 3G6JE 1T1XA 3GSUB 4QTHA 5ESQB 4QXWA 3MLRL 4M5ZH 4M7LL 5BZWA 4YGVB 5IQ7L 1CI5A 4IMKC 1CICD 1NPUA 4QHMA 5SX4H 1OSPL 2NXZC 5T1LA 1GZQB 1LEKB 3GKWH 3OKDB 5HHXL 4HKZB 3EYUH 3W2DH 1H15B 3ALPA 3MCKA 4P9HC 1T03H 1U2HA 1QSED 1TZIB 1MLBA 3MROB 3U9PH 2WBJD 3IJYA 2F5BH 3FOLB 3ZKXC 1IGTB 4Z7OE 2XY1A 4MD5B 4S2SB 4EDXB 4LKCB 4ODVH 2HJLA 5BQ7B 1CD9B 3GSQA 2X4QA 1EEYB 1G7MB 1CFNB 2AGJH 1IFHL 1UM5L 3CFKB 3BPLC 3KNBA 5C0JA 2R2CA 4YNYB 3T0VA 3BRGC 3MODL 4OD2B 5CZXD 5F8RC 5CEZD 1DUZA 1CGWA 4O2CB 2ILLA 3KDMA 5KN5A 3GSWB 2X09A 4V1DB 4IHOA 4PY7B 4XRCA 3QNYB 4K94H 3WUWG 4G43A 4PJ5D 1OAKL 1WBZA 5EO0B 4HWBL 5DZLA 5JHDE 5JUEH 1UJ3A 4NNXA 35C8H 2AKRB 1KTLB 3TN0B 1J88A 3CX5K 1OP5H 2N1KA 4FTVE 2XKNA 1PY9A 2YN3A 1RY7B 4F2MB 2OJEB 4JFFE 4HZLB 3WN5C 1OSZA 1T22B 3L3IB 5DUBA 5CINH 5FOJA 5I1CL 4XC1H 4HF5L 5LCVH 5AWNL 3TIEB 4N8VG 5HYQB 4RIRA 4AT6B 4DEPB 4M8VA 4OB5L 4HS3A 2X7LA 1RZJL 3OG6B 1BWMA 2ICWB 5DXWA 1WTGT 4JY6B 5J6GA 1FNHA 4Z0BH 2A6IA 4ELME 4ZFOL 1U8LA 3QZWG 4XB8A 3NABL 4P46B 1CTOA 1T1WB 3G6JF 1YC7A 4ZUUB 2WAHA 3MYJA 4MMXC 5E00B 4XAKD 3KPLB 1KELL 1ZK9A 5DJAA 5D7IE 3HRPA 4M4PA 1Z5LA 2OSLB 3C9NB 4P9HH 3V52L 3DARA 2J6EA 3OKMB 4BFGA 4PG9B 1JWMA 4ESKA 4QF1B 3ARFC 4JRWA 3WHXA 3UBXI 1RJLB 5E1AB 4HFUH 4OGYL 4Z7VA 3MMEB 4Z7OF 4OGXH 4K23L 5B39B 4J23A 3BKYL 3BSZL 3NAAH 4JFDE 2DM7A 2QADD 5GS1A 2QKIA 4QNPE 2WWKT 2CJUL 4Q9QL 5HDQH 1UWXK 5EC2A 5HYJD 1T0NB 4S1DC 1UWGH 5DJ8B 3RKDD 1ZGLA 4EOWL 3BRFA 4Z7WA 4DN3H 5C2UB 3X14A 1UM4L 4PS4H 3C6LD 3UTQB 1F6AB 3VGAC 4Y0GA 1JGVH 3REVB 2B1HH 3QDGB 4HWBA 1OTSC 2H6PB 3CDGA 1BFOA 5E2VL 3ZDYE 1E4XI 4D9QD 1MJ8H 1RZJC 4YDVB 1HHJB 4MYWB 5I1KH 5D93B 4W4OA 3GBMH 3DMMD 4JN1H 5ETUB 4LCWB 3W0WD 1CE6A 3L95A 4GKZB 4MQSB 5TQ0H 2DQCH 1EDQA 4L9LB 4W81A 1OD9A 5DO2C 1FG2A 2B0SL 2V7NA 1HOCA 3MLRH 5FYKU 4Y4FC 4JY4B 5IQ7H 1NGXA 5C3TA 1U8JB 1YEGH 2VH5L 2JCCA 2BSRA 2XACC 5CBEB 4QHLB 5HHXH 5FK9B 3FFCA 4EBQL 1OGTB 3E6FB 1JZ8A 3GMLB 2VZVA 3BUYB 5ESVA 4ELMF 2VLME 5J11C 2J6EH 1BOGA 1EPFA 2PTUA 1AI1H 3GHEL 3UTSB 4FNLH 3MGAA 3MRNA 4XP4L 1A7NL 5KW9H 2NYYD 3GJFB 1MCRA 3TA3B 5CCKH 5KG9A 2EKSB 3O6FB 1XIWC 3NPSC 4XNZC 5D7IF 5DS8A 3MODH 3KPSD 4TSAL 2Q1EA 3MLVH 3TYFB 2A6DB 2VERN 2V2WA 4P3CL 1RZ8A 1QSFA 3F5WB 1MWAL 4YHNA 4E0RA 5D6CA 3AB0B 2A0LC 4QNPF 2HWZL 4RCAA