1DBBL

Three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
DVVMTQIPLSLPVNLGDQASISCRSSQSLIHSNGNTYLHWYLQKPGQSPKLLMYKVSNRFYGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQSSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Three-dimensional structure of an anti-steroid Fab' and progesterone-Fab' complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 37
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1992-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbbL01
3U0TB 5C0BB 3L5XH 5C0CE 5CJXA 4R2GD 2RCSH 3VWJC 3G9VA 3G5YB 4PB0H 3OJMB 5EUOB 3PIQB 1G6RA 1WFOA 2GCYA 3BKML 1NGQH 4NN7B 4OT1H 3NIGF 3FN3A 4MDJA 4BYHA 1G6RH 3SQOH 1KEGH 3G9AB 3ZYZA 3FB8A 3RDTC 3WFCH 3LKSA 5ETUA 3HPJA 4AIZB 3BSZH 5IG7B 1DVFC 2RFXB 3DBXB 5HD8C 2X42A 5DS8B 1BFSA 3VCLB 3TO2A 4S10A 1I8KA 2HKHL 4K94H 3U79A 4CGTA 2XA8L 4FQCL 3SDYH 1VADA 4KKBD 3RPIB 4PJ8A 2R2EA 4OCRH 1C1EH 4J6RH 5CAYB 1OVZA 1J18A 2X70A 4X99B 5GQBA 2EYTB 3KPRE 4P9HH 1RZJH 2IH3A 2P47B 3QWRD 2AI0H 2E7BA 1DUYB 3RWCB 4WW1B 3E6FA 5D7JA 2PO6D 2E6PA 1X4YA 1I7UB 2HG5A 5D7KE 1ZTXL 3F5WB 3RRQA 4NQCD 4FZEL 15C8H 5T1LA 4DKDC 4X6FA 4PJXB 1WCBB 4XXDB 1T66C 3IU3B 5DWUL 2NY2C 1YUHA 5DD0H 2DQHL 4QTIL 4XP6L 2DMKA 5F9DC 4N9GB 3MLSH 2DL9A 5I66A 1JK8B 3WKMH 3TYFB 4XHJD 5DEFA 5CWSB 2CMRL 3IU4L 3BH8B 1G1YA 4JQVC 5DA0B 1LO5A 1KPRB 4LK4A 4N5EC 1DUZB 4JFEA 2LV4A 4MCYB 1MCOH 1P84J 3BMVA 3ILQC 4YX2H 5H35B 1XGPB 1AY1L 1LQSR 3JTTA 2CK0L 4HS8H 2OX5A 4DKFL 4RFEB 2EKJA 2HJFB 2C4FU 4XCNB 1VGKA 5LXGH 5J1TC 3FMGH 4ODXB 2D4DA 3DX9B 3V6FA 2O26U 2QQLL 1F90H 2X4UB 5LWYH 3LD8B 2PN5A 4I4WA 4WHCA 3C9NA 1NCUA 1PX3A 2ADFH 3MV7E 2WUCH 5F7EL 2MSPA 3UPRB 4PBXA 1M7DB 2A74A 3A6BH 4UTAL 1J0KA 5E8OA 5HHPB 2X1WL 4GS7C 3NH7H 1KXTB 3GBNL 3P11L 1NBVL 4ONOA 3IJSB 1G7JB 2EIZB 3RWGA 4G8IA 4F7TB 1P84K 3IFOA 1A3RL 3FOLA 3FAXA 1WBYA 1AI1H 4LLMB 3WLWD 3DYPA 4DZBB 3TM6A 5I71C 2CDEA 5TDOA 4AMKH 3GSRB 1K3ZA 3CZJA 1QYGH 3EYFB 1PG7H 1HYSD 4YFLI 1NGWA 3LKRA 2NY1B 1MJJA 1AGDB 3SOBH 2FR4A 4GW4B 5JHDA 5KS9B 1U3HA 4PYHA 1AKJA 4HUVA 4NKMA 4WUKL 3SGEI 2ZUYA 1FBIH 4QHUB 1TQCC 2ICEA 1AGEB 1A0QL 5B3NA 4QWWC 1AD9A 1X5XA 3IF1B 3Q1SH 1S9YA 1BEYH 4MNHB 2PUQT 3S98A 1N3NB 3VFRB 3GSOB 2F54A 5D7JD 4M93C 4OZFG 4TNWF 3GJFB 4R8WL 4DQOH 2I9TB 4O4YH 4TNVF 3HNTH 2JJTC 2CIIA 3MBEA 1AHWB 4PGBA 4R96A 4Y4HC 3W82A 4L5FL 5DC4B 5T1LD 3TPUA 4QYOA 5KOVC 5T1KA 1QBBA 3VXPA 3FO9B 4NQVB 3QULB 4OSUH 4L4TA 5INCA 3MNVB 1ZA3B 3CXDH 3V8CA 4OV5A 2OL3B 3TJHD 5CJ5A 3WN5A 1KC5L 4Y16C 3RY6C 3F6LA 1JHLH 1S5HA 1A1MB 3BT2H 5FGRA 3LKOB 4OI9A 5I6XB 4PTUA 4JFED 5CZVL 4Z7QE 1GH7A 2BMKB 4A6YB 3D3VB 1T1YA 1EK3A 1KPVA 1UG9A 4TNWK 4CNIB 4PYGA 5DK2A 1DE4A 3I6LD 4YWGH 5D93C 2ADJB 4PP1C 1A64A 2X1QA 3IS0X 4PJFB 4TNVK 1NFIB 4I48A 3MUZ1 1DDHB 3QNYA 4GKNB 1LO0L 5E8PB 1UB5B 4JPIB 5JMRA 1KB9K 3E6HB 3O9WB 3CLFH 4EXPX 5LCVL 3STLB 1A7OH 1JPFB 2PTUA 2YR3A 3MODH 4HWNA 2VXVL 3V6OE 2DWEA 4GW5B 4CL7A 2XTJC 3P77A 4HUNB 4QOKD 3CAFA 3MRJA 4E9LA 3WE6B 4WIQA 3RKPA 5F7DA 4KKLD 3ZDXE 5JW5A 3MO1B 4G8FB 2QQKL 1YEIH 2DIAA 4PY7B 5FO8B 5MI0B 2QTEA 5T3ZE 4KPHH 3ULSA 5GJTH 4PRIB 5IEKB 1YECH 3TZVB 2DQDH 2J4WH 1JHTB 1KENH 1KIQA 4E5XB 1RIVL 3F12B 3ZL4H 1FN4B 3LIZL 1ORQA 2C5DC 4Y4FC 2ATPB 4OGYL 5T33L 1T2XA 1U3HD 1C8PA 4QRPD 1G7LA 4U3HA 3QIWA 3WIIL 4N8PA 1MELA 3KNBB 4DK3A 5CJQH 4J3VA 3V4VL 1OSZB 4D0BA 2FO4B 2E9IA 5D1ZB 4IMLA 5E00A 4GBXC 2V7HA 4Q9BA 3W9EA 3VI3E 3PABA 4RFOH 3I85A 3MV8B 3DO7B 2F54D 1PEZA 3ROLA 4HUWB 4W6WB 3IXTA 3U4BL 1RZ8B 3NCJL 5IHZB 4KK6D 1SJEA 4XVJL 2ADGB 3MBED 4ZS6C 3C8KA 3EDFA 1X4ZA 1RK0B 5FKAA 4YFEA 4UDUB 2D9QB 4RIRA 1WJ3A 5HHQB 1XF5A 4BQBA 5KBNC 5GGRA 4H20H 3EDJA 4PBWD 3B5GA 2CH8A 4ZUWB 4BZ2H 5IBUB 1CDUA 1V8HA 3D25A 4XMKL 5TH2B 1KG0B 4PJEA 5CZXC 4BH7A 2C3XA 4TTGA 1HHHA 3S5LB 3F7VB 1SM3H 3VXOB 3IRZA 4NC2B 4NQUA 1JN6B 2QHRL 1FYHB 5DQ9A 1PY9A 1UCBH 2HLFC 1E4XH 1IEAB 3TBTB 1FZKB 2C3HA 4UT7L 4JR9L 4LCIH 1R3LA 5L6YL 3BPLB 1FH5H 1A7RL 1Q0XH 1TXKA 4I18B 4TULL 1X5ZA 1S78D 4GRWH 1EBAA 4JKWA 1YMMA 4GW1B 1OLZA 1C7TA 1G9NL 4Z78B 4C56D 4JFOB 3BP5A 1AP2B 1CGXA 2V6HA 3IDYC 2O5ZL 4X5XB 5IVXE 2PTTB 1E28A 5I1JL 4XWGL 2CGRH 2ZPKH 3Q3GA 1B0WA 4HS3B 2ICWB 4FNLL 1CFQB 4KJYA 1KSRA 5ILTH 2O5XL 1T5XA 4BKLA 5C09E 5A2FA 3HNSH 1PAMA 4Z7WF 1ZT4B 1KT2A 2ZG1A 4ZAKB 2AAVA 3GJEA 3BPNB 5IMLB 2PXYC 1J1XL 1MHHA 1BM3L 4KK9C 1U8OA 4YAQA 4JHZA 5L2KE 2DTMH 4NP4H 1RURL 2NW2A 5GGQH 2DBLL 3ARGB 1JYWA 1F00I 4M1CC 4ETQB 1TJIH 3LH2H 4ZNEE 3P9LB 1QLEH 1LK3H 2XKSA 1P7HL 3JUYA 3RL2B 4PJ9A 4QHNA 4O2EB 3H7BB 4NJAH 4Y5VA 4OCLC 2MNUA 3EYUL 5EU6B 1U3ZA 2AEQL 3GHEL 1J1PL 5I16B 3IFLL 3QZWB 1DBBL 1IC4H 4ZUTB 3GMQA 2V2XB 5BZWB 4GG8A 3M45A 4NQEB 4OI7A 3HZKB 4RAVA 3T0DA 4ZFOL 1JTOA 1BWWA 1BWMA 1HOCA 3O6KL 4X7SL 4MJIA 5JHDE 5GS1A 1PVHA 5JPMA 3TA3A 1XR8A 1I1YB 3OKLB 5D7IB 1S7QB 3OGOE 3MFGB 4PTTA 4Z0BL 3I50L 3C6LB 3CDYA 4MHHG 2BDNH 4BA8A 3T4YA 1W72B 3LPFA 3WMSA 2DLFL 1B6UA 3M17B 3I9GL 3VRIA 5EUOF 4XC3L 3CFJB 3RGVA 4YXLL 3BDXA 3UXFA 5EUKA 2IPTL 4PREB 3VWJB 3KWWA 5CSZA 1P7QA 3D9AH 3P4OA 1I1CA 4PJGE 3V4UH 1YMMD 3QQ4B 4F37K 4G9FD 1UM5H 3ES6B 4Q9CA 5B39A 1A02N 4HIEB 5IROC 1JWUA 3RDTB 3BP7B 4L4TE 2VSCA 1MREH 3TJEH 5BRZE 3TBWB 3WIHL 2VXTH 2ZP0T 5F7LB 1FAKT 2BSRA 2ZUTA 3DSNA 4WU7B 4O02H 5KOMC 5HHXL 4NGHH 5BS0A 2FGZA 4KI5C 4WTXA 3MLTA 1OM3L 4WVRA 3TF7C 1IAMA 4UB0H 4N0CC 4NO3A 2NY5L 3KHQA 2EC8A 3DRQA 3VMPA 4RCAA 1EZVX 3W11D 1T6VN 5SV4A 5JQHC 2EDJA 3VXRE 5HXMA 1NGYB 4KDWA 3C5ZA 2W0KA 1JV5B 4F15C 2KL6A 5JDSB 5JLZB 2FWOB 2B2XL 4HUMB 1N64H 4PJXF 1IGYB 3JV6A 3O2VH 5FYJD 3T0EA 5J6GA 2VIRA 4I2XA 4QKXB 5EZIH 2W91A 5CP3H 3LKQB 1Q9LA 2NY2B 4XP5H 4LAQH 1NUFA 2QQQA 1Z5LA 4PJ9D 2F74A 1AO7E 5IVZB 3QRGH 2LAGB 2QR0A 4G5ZH 2NY4B 3ESUF 3G6JB 2EE3A 1I9RH 2YD1A 2MQCA 1HKLH 1IC5L 4NO5A 4PRNB 3CFCH 3RZCB 1TITA 5FO9A 3KLHD 5T1MB 1OAXH 5DRZA 1T04B 1IM3A 1CU4L 5EBWA 5ABDE 2I60L 1R3KA 1LEKA 3DROB 4MJID 5FO7B 1J87A 3TA3D 1C12B 3JSSA 2A9MH 5A16A 4UQ2A 5HGHB 3LKPB 2V17H 5HI5C 4S0SD 2HH0L 5JOPD 2X6MA 3MZTA 5CP7A 5CCKL 2XWBB 1GJIA 2IEPA 4PJ5D 3TV3L 3QPXH 4LU5H 3VXSB 3RGVD 5BVJB 4M4RA 4H26B 2Z9TA 1BLNB 7FABH 2B4CH 4TSCL 1EAPA 1P7QD 4Z0XB 5L7XH 3T2OA 4X6DA 5TF1L 4LAJH 5C92A 3K0WA 2DL2A 4NHUA 4LKCB 5AD0A 2CDFB 1JNNH 1GGCH 3OXSA 3MGTB 1BFOA 5KTEL 5FK9B 3LRGA 2GSGB 4NQDB 5I18H 3SE9L 2LE9A 1ZK9A 4CW1B 5KS9F 1FNEB 4XCFL 5DZNA 5BS0D 3QEHB 4OZHB 4NC1E 3MACL 1JI2A 2H6PB 4JPKL 4XBPB 2NYYC 3AB0C 1Z9SA 1IKNA 1LP9B 4HMDA 4OFYA 2JJVA 1H5BC 5IM7A 4UAOB 1CLCA 1C08A 1I1AC 2CKBA 4GRWE 4UT9H 4LSPL 3TFKD 4PJBA 3OKKB 3T08A 4TSBH 4BJLA 2CKBH 1CFTA 3C5ZD 5DHVA 2VQ1A 5BQ7B 1PZ5B 2CLZA 4M43H 1OTUC 3BX7C 4PRPD 2BOCA 3T0ED 5AEAA 1DANT 1ZLUK 2DLGA 1QLRA 1TETH 4QRTA 1UCTA 5KN5A 5E8EB 1D9KD 3HC0B 4APQC 1BBDL 2AP2A 4X8JA 2Q86B 3I3EA 3VG0H 3X14B 2YHGA 1ZHBA 2HJKB 5CGYC 3NCCB 2P48B 3MLYH 4Y16B 5F7MC 4AEHL 4Z7VB 4JFXA 4HIXH 4OD3H 1S8DB 4S11A 3IFNL 4HF5L 3L95A 5DRXA 2GJ6A 5H2BB 3GUTB 2WBJB 5KVEL 1SJHA 3GJFK 4PJFF 4LRIC 1A22B 3KJ6L 4NQXA 4K23H 1BOGB 2VXSL 1WBZA 3WFDH 4F33A 4ZFFB 5D93B 5CD5D 2VLRE 2EKSB 4X4ME 3QDHA 4R7DA 5EWIH 2DJSA 5CUSH 4KY1H 3ZTJH 4BK5A 5C6TH 1MFBH 1ZMYA 2E3VA 3G6AA 1E4XI 3FCTB 3O11B 3T3PF 5GSRA 4EDXA 4XNMB 4EN3C 2UY7A 3NIFF 4KVCL 1YMHA 4PRBA 4YDIL 3SKNB 2XTJB 3IFPB 1CXLA 1V7MH 4QHKI 4PGZA 3VFPA 3O6FC 1S7SA 3HZMA 2ESVB 4E41B 4Y5YC 4YHOL 1UWXH 5ESVB 1P4BH 3LS5H 1RUQL 3UAJC 1CIDA 3OB0K 4U6HA 1AQDA 1P7KA 1QO3A 4HSQA 4RBPH 3PP3H 3VXQA 1FYTA 1KLGA 1G0DA 1YNKL 1Y18A 1MI5A 2JB6B 4JY5H 4L3ED 5E1HB 5GZNC 3VFNA 3WHE0 5EBMB 2DKMA 1RJCA 1YEFL 4MJ5B 1U8MB 4XP1H 5FAAA 1MFCH 3V0AC 3HCVA 4YHLL 5I8KH 4OJFH 4JN1L 4ZO9A 5FYKH 4FFYL 4OFYD 1W2KT 3V7AE 4RRPG 2Z31C 4XX1E 5SX4H 2QSCL 5CIPA 4GBXB 4JGUA 3SJVE 3U46B 4O9HL 5DI8B 1QBAA 5CIPH 2PW1B 5HYJA 3FT4A 1DSFL 2K7PA 1A7NH 3GB7B 2Y7QA 1DBKL 1N7ML 3TIEA 1GGTA 4U31A 1QSEB 1ACYH 1KTLA 5FECA 2NY0C 1TTUA 4WDIA 3GKWH 4GAYA 1A1OA 2D0HA 3ZHKA 4P4RB 1R0AH 1KCVH 3H9SA 3QJHA 3HG1D 4M4PA 3WFBL 4XXCA 5FYLH 4NUGL 4WHYG 5TE7H 5HYSA 2WZPD 1CFVH 3HAEA 1IBGH 2JF1A 2B7DT 5CEZH 2GJ6D 4UUJB 1N4XL 3RAJL 1PEWA 1Q9OA 3HAEH 1TCRB 5GGSY 3LS4L 3WS3A 3L3KB 1CD0A 1WWWX 4MX7A 4NM8L 3S5LG 3DX6B 3QHZL 2VRAA 1FVDB 2AV7B 1WBXA 1FO0H 1IGIH 1YPZB 1HHKB 1AC6A 2IALB 3WNMA 1GGIH 1CGSL 2ZOLA 3MRIB 3OKOA 1TZHA 3PQYE 4I3GA 3K7UA 3ZT6A 4NZJA 4I2XE 1I8IB 1W0VB 3WDHA 1E27A 3R4DA 1RZFL 1RPQA 3CFBA 1MAJA 3CH8A 1G9EA 5F9JB 3IDYB 1FFRA 1NCAL 2F8OA 3VFSA 3IGAA 5FM4A 1YYLH 4OB5H 2FYYA 2R1WA 4MCZA 5CMAA 4XP9H 2EYSA 1A7PH 5DUPL 1I9EA 1Z3GL 2MCG1 4OFPA 2BHUA 5GZOD 1T80A 4MLSA 3PDGA 3MROA 1NPUA 5GXBB 1RU9L 1IAOA 2BERA 1QNZL 1MHPH 1MCPH 3ARDA 4F8QA 4R2GC 5C0IA 2DOCA 1O7SA 3GI8H 2X4RB 1FYTD 3EDEA 1YY8B 4G7VH 1UJ3B 3KYOB 3QO0A 1ZLVK 3LDBC 3MRFB 5FYKD 1EUTA 2E7LC 1HHIB 1R5VA 3JVGC 1NCDL 1BQHA 1FFQA 4BSVB 4LFHG 3ZKMD 1XGUA 3OHXB 4TUJB 1IKFL 4WGWB 1TNMA 2ZKHH 5FGBC 3S88L 2XN9B 5E8DL 1L9MA 1MRCL 3CCHA 4X6DE 1CE6B 4KMTH 2P44B 4KKBC 1T7XA 3HUJE 4AT6A 1GVIA 2AXJA 4FQXA 2UVEA 4NSKA 4U1NA 4O2CA 3OR7B 2B1HH 1YN6B 2VC2L 3GGWA 3L3GB 3RWHA 4JG0L 4HH9A 4TUKL 1FDLL 2R29L 1O7VA 3QZWG 1RZKH 1OWRM 5DRWB 3ZMRA 5FYLD 2BSTB 2PO6C 4R26H 4L9DA 4LMQE 4LNVA 4H88L 5D7IF 1S7XB 3O2DA 5CEZD 3O2DH 4I0PA 2H3NA 2VABB 1NMBH 2NY7L 4LPTA 3BPCB 5EIQA 32C2B 2X4PA 2XWTB 3RNKA 1NCBH 3PHOB 3DUHA 1G84A 3WIFA 1VACB 4OIIL 4EKXA 4QCIB 4ZO6A 1KN4H 3OL2A 2AJYL 1SYVB 4ODSH 4UDTB 3O4LD 4K7FA 5ISZD 3VXNB 4LF3B 4XHJC 2HN7A 1N2RB 3L6FB 1I75A 2X4NB 4WHTA 3JV4A 4YDLB 3ZYJA 3ETBF 3ARFB 1KGCE 3WNNA 2EO1A 5HGDA 3AXLB 4UV4L 1BZQK 3LQMA 1ZE3C 3VFGL 3NIDE 3D39B 1NH6A 4X4YB 4NNYA 1D7FA 1FC2D 1MCJA 3MYJA 3BAEL 4UMGA 1OAZL 4P2RE 4PGEB 1F3JB 4MVBD 2E9WA 3M8OH 2D3VA 5DLMH 5J06A 5D6DC 2AJXH 3B6SA 3NFSL 1VKXA 3GSNL 3VXUA 4OLXL 2Z35A 3ARDD 2YPVH 2MKLC 2UZIL 2IANA 1R3IH 4OIAA 4HK0B 1DJSA 4YDJA 2NPLX 4TVPH 4LMQI 4K07A 4YDKH 5MHSE 1HSAA 1UZ8B 1V3MA 1G7HA 1R24B 2VN7A 2XWJB 3FTGB 5D5MB 4F15B 5C08B 4HV8A 5IMKB 4PP2B 4XPAH 5JNYB 1EEYA 1QRNB 3DMMA 1Y6MR 3WLWC 3QO1A 4MSWA 5IHUL 3IJHA 5C0EA 3QFJA 4MNQA 1RK1A 2JCCE 1HYSC 4K94C 3SKMB 2CRZA 5F7KC 4Z77A 3DYOA 3G6JF 2ZUXA 4AYFA 1X5HA 3G04B 1JZ4A 4F3FB 5C6WH 3C60D 3V0WL 1NGPH 3R1GL 4KZDL 3PWJB 5BXFA 4FQXD 5T5NF 3TESA 3HE7D 2YBRB 5DC9B 1JL8A 1YEJL 4H0GA 1T1WB 1YEEL 1JHKH 1QFUH 3L3HB 4TRPH 3EGSA 5HHNA 5T3XH 4XMPH 1YDPA 1ROWA 5D7JC 1MI5E 3SKJH 3DHMA 1IGFL 4EZMA 4PJAE 3O6ML 1J5OH 4CU6A 4B50A 4MA3A 1MLBB 3TVMB 1KB5A 5EBLB 5L2JB 3GK8L 2FX9H 1KB5H 1A4JA 1FVCA 4YE4L 3WXVL 3LN5B 2R23A 1KN2H 5INDA 2IQAB 4PGDB 1KCSH 2XPGB 4UTBH 3TJHC 3ULVH 2MCPH 1AJ7L 5HYJE 2HFEB 2VLKB 1CLZL 4HFWA 1T4KA 3N1QC 2CDGA 1RULL 4AM0A 3ARSA 2AQ3A 2VLLB 3SGDI 1CXIA 2NY6D 5DQDH 4MNGA 3RTQD 3VGHA 1ZS8B 1VFMA 2YZ8A 2YK1H 1CICA 1VFAB 1BVKA 4KQ3H 2V5SA 4JY4B 3HR6A 3H9SE 3EOAB 3NCFB 5C0AA 4OZHF 1GYAA 5CEZE 1EVTC 5CZKA 1C16A 5GS2H 1KTDA 4L8SA 3GMNA 1BVLA 1LP9F 5HVWA 1B88A 2LAAA 2HRPL 1IGJA 1YC7A 3VXUD 3AB0B 3HE6B 2IAND 2VN4A 5DQJA 2XIDA 3B9VA 2EH7H 4TVPD 4F9PA 3MRNA 3F58H 4OAWA 1I1AB 5TQ0H 2OK0L 1DQQA 5DMIH 4Q6IA 2BHZA 3PDOA 3IJYA 2O61A 1L7TH 2QSTA 1I7RA 4PR5A 4KKLC 3UYPA 1L4IA 4OZGB 4ZTPH 2G2RB 2VAAB 3DMMD 1J05A 3REVB 2XI9A 2QSVA 3QFJD 4MNQD 1EUUA 4L29A 3BGAA 3FN0H 3SBWA 4Z7VF 3IETA 3BD4A 4U6YA 3LKNA 2IG2H 3PP4H 4I0KA 3ARTA 1A6WH 1U3HC 4JO4L 1FPTL 1XEDA 4Y2DA 4X0KB 2DM3A 1B0GA 5LJYH 2R0KH 4LIQL 2Y9RT 4RGMC 2YEZA 3GSQA 3I75A 1H3PH 5T3XD 4Q0XL 3IKCA 1XIWB 4JDTL 1GPOH 43C9A 3FRUA 5C0CB 4G43B 3I6KB 3DI3B 3W2DL 3OTTA 4KK6C 3EYOA 3MBEC 3SE4A 4F7EB 2BOBA 5J1SC 3GMPB 4Y89A 1J0IA 1OGAE 5H37H 1A6ZA 4YO0A 3OQ3B 5I15H 4EN3B 3ZT7A 2GI7A 4DCQA 1NKOA 1QSFE 3KPSE 5EBGA 4S1SH 3WN5C 3KPNA 1RUMH 3BYTA 4L8DB 1F42A 5GGVL 4MAUH 3NZHH 3QUYA 3H0TA 2WUBH 2CLVA 4ZYKB 1LO2L 4GKSB 4WU5A 3FT2A 1WFNA 3OV6A 4OM1H 5LGHL 2KUTA 4Y5YB 3BZFA 1CICD 3WHXB 3I02A 5F96L 1RIUL 2L7UA 4HLZG 4HC1A 5IOPA 4X4XA 4IHOB 5CD3A 5C0AD 2HT3D 3KPRB 1BBJB 3KXFD 1OP5K 3EJYD 5GGSB 1QA9A 4KVNL 3PWPE 3O6LL 4JRXA 1MAKA 3A6CL 3CSGA 1S78C 2YC1A 1CGVA 1K8IB 3HMXA 4XNQA 5D9SA 2R69L 1F8TH 3MRMB 3KPOB 1BIIA 43CAB 4JFHD 4XPHL 4O2FA 4ZTOL 4M5YL 3FHAA 3H8NA 4WUUA 4N90D 2APBA 4F7MB 1MPAH 5IFAL 5DHYA 3ECBB 3L3JA 1KBGL 2Q8AL 1MJ8L 1WEJL 5IB4B 1TZGL 2P5EA 5DMKB 4RDQG 1ZHLB 2N56A 4JFZH 3P73A 3VFTA 1OARL 4UU9B 3WUWB 1K6QL 4F57H 4WCYH 4DGYH 3OAYK 3MRQA 3IVKA 4OD2A 3PWUA 4ZSOA 4HXAL 1JGVH 3VFUB 4Y2DD 1HH6A 3O8XA 5FUZL 3C2AL 3CVHA 4JZOA 4BK4A 5EOCH 4IOIA 2LTQB 4TVPE 1YEHH 5BMFL 1PYWB 3CVHH 1A14H 4K3JH 4NBXB 5GRUH 4ESKA 5ID1A 3SE3A 2RAMA 4TQEL 2P8MB 3Q6GH 5F88B 5JA9A 1IC1A 3BPOC 4NKIL 5EG6C 4U6VH 3ZE1F 4YHPA 3G5YA 3R06B 4JQXC 4EVNA 3O3UN 1KELL 4OCXH 4YHIA 2V5MA 4NKOB 4U3XA 1PJ9A 3P40A 3DVNA 5E2VL 1BFVL 1QBML 5C2BL 2E8YA 4XRCA 3QUYD 5IG7A 4LSDA 5H8DA 2FBOJ 4W81A 2RFXA 3O3BB 1MIML 4L4VA 3N1FC 2BSED 3MYZA 3KJ4B 5F1OB 3VCLA 1F4AA 1QFOA 4JFDA 1ZLSH 3NCEB 3WD5H 2MJWA 4DW2H 3W5NA 3DX8A 4JRXD 5CS7A 4K3DL 3FFDA 5HHOA 3BDBA 1XH3A 4K3GA 3QDGA 3QIBA 1DUYA 2OJEB 1CFBA 3ULVE 1OF2A 4B53A 4YBHA 4YDVB 3GMLA 4ZUSB 1Y6KR 4KK8D 5JHLH 3KYKH 1H3XA 4H1LA 4WUUD 3NACL 4PS4H 3F5WA 4W68A 2EDNA 4H1LH 4PJXA 4R4FH 3U9PL 1UH4A 3MLVH 3MNZB 4QHLB 4JLRB 4WFGD 4XBEH 4JANB 5GGRY 2NW3B 3H2WA 1GOFA 5E6IA 4NKDB 3W11C 3GZKA 1CF8H 2H32B 5TF0A 1AD0A 1KPRA 3KLAB 4PY8J 3S37H 1MWAA 5FYJU 5TE4L 4YHNB 3U36B 1KXQE 4JAMB 3RNQB 2NR6D 2AKRB 1MWAH 5ACZB 3KDMB 1WFTA 4CVZA 3DX7B 2Y36H 4MA7L 3OPZL 3MLXL 1NJ9B 4FFZL 4YQXL 5F1NA 2KZ1B 4XC1L 1IQWL 5D72H 5HGAB 2W92A 1EGJA 2J12B 4OCYH 2CIKA 4D3CH 3DX9A 5DK0B 4ONFL 2KQMA 4HKBB 4PJ9C 4XZUA 2X4UA 5E2TH 4JVWA 5C0BD 5IWLC 2VZUA 2ZCLL 3MFFB 2DMCA 4NYLB 4Y5VC 3RWDA 3UPRA 3OAZK 1RJZB 4PJHE 3KYNB 5M94B 1XT5A 5HHPA 4EI5A 3WFCL 4P3CL 4RSVA 5CBAB 2F5BH 2OQJA 3KLHC 5BJTA 4F7TA 5IP4A 3GSUB 4Z6AT 1ZVHA 5E2UH 4LLMA 5GS1C 4DZBA 2PYFA 4KI5F 4NUJA 4ZS7L 3TA3C 3T1WA 2Z4QB 3LQZA 1RFDL 3GSRA 3T0XA 4HPOH 3HI6H 1V7NH 3VJ6B 4L4VD 4K94L 3AVEA 2BNRE 3GSXB 5KANI 1N0XL 4P2QE 4HGMA 5B3JE 3EOYG 4V2BA 5ITFB 5EN2A 4X5WA 5FHBL 1MUJB 2DN7A 3RGVC 3MLZL 3FONA 4QF1B 5LQBH 5KVDH 1EPFA 1P2CB 1MCIA 5IBTH 2WM0A 4LLUB 2FD6L 1G6RB 3BN3B 4EIZC 5HHOD 2GCYB 4MNHA 5DXWA 3BXNA 1N3NA 1EXUB 1VEOA 3UTPE 4MDJB 3VFRA 4Z9KB 3T09A 3LKSB 2GTZA 4GG6A 4K8RH 1CG9A 3GBLA 1JNJA 5ETUB 2I9TA 1ZA6A 3HPJB 4JG1H 1CLYH 3DGGB 3VH8A 5FCUH 3AUVA 4WENB 4OCWL 1HXMA 1RUPL 3Q5OA 4P4KA 4UZGA 3TO2B 2VDQH 1I8KB 2WV3A 3CX5K 1JVKA 2H2PD 3MCLL 4GSDH 3FO0H 2QL1A 3QEQA 4PJ8B 2R2EB 1IVLA 1LK2A 2X70B 5E6ID 3A67L 1FGNH 1SMOA 3GMOA 2IH3B 3TFKC 1A8JH 4Y19A 1JZ2A 5EIIA 3U48A 3E6FB 3C5ZC 4XNUL 5LAXB 3ALWA 1HINL 4WEBH 5DUMH 5GGTH 3N1GC 4YHML 2P8PB 1BJ1H 4NHCL 2EDWA 2HG5B 4L8BA 3JWOC 3P4NA 3T0EC 3ZYIA 5IV2A 4LVNB 2YD2A 3EO1A 5DMGD 5F72S 4GKNA 5T1LB 1D9KC 1UB5A 4WUUE 1HQ4A 3E8UL 1U6AL 4F8TA 1YQVH 1GIGL 5I66B 3WNPA 4XPFL 1JPFA 4HDIA 1CTOA 5DEFB 5T5FL 4GW5A 4H5SB 2P5EE 4LPVA 2ZCHH 1KJ3L 1LO5B 3AU1A 2V9RA 5AZEL 5K59F 4JFEB 3WE6A 4PV9A 4WTZA 5GS0H 3BEWB 4JFFE 3JTTB 5C09B 2YD8A 2AJUH 5CD5C 4CVXA 2ZJSL 5F70A 4PY7A 1NLBL 2AK4A 1VGKB 3H9YA 2YD7A 3O3EA 3C5JB 5I1IL 4PRIA 4OZIA 4KXZH 4NZTH 2NY1D 4YUEH 4E5XA 3V6FB 5L2KB 5ALBH 4QEGA 1MFDL 3BN9D 2B4CC 4KTDL 4I4WB 3RUGA 3C9NB 4HBQA 6FABH 4OLVL 1BEYL 3KYMA 3KNBA 2A74B 3QDJE 1OSZA 2W0PA 4XPGH 4NRXA 3B4NA 2EH8L 4OZGF 5E8OB 3QXWA 3GDBA 5DEGA 4C57C 5FGCB 5DR5H 1MEXH 1DQMH 2JIXA 4GKZA 4S1RH 4YGVA 3RWGB 4F58L 1S3KL 1MCLA 3IFOB 5I9QC 2YXMA 4E0RA 5DDHA 2Y06H 3SKOA 3IB4A 1WBYB 4M5ZH 4XP4H 3TH2T 3UTQA 3RU8L 4PG2C 2W38A 5JR1L 1DLFH 2ADGA 5TDOB 3M1BB 4PPTA 2X05A 3N9GL 4OLUL 3U83A 4IRZL 4OLZH 4P4KD 1UM6H 1RK0A 1NGWB 3BGFC 4UDUA 2BC4B 2ED7A 1OSPL 1MJJB 4P5MB 1FNSH 5HHQA 3THML 5CKGA 2FR4B 5JHDB 4HUVB 1U3HB 2FGWH 1AKJB 3BT2L 1F6LL 2OZ4A 3ROOA 3T1FB 1IKNC 1OD9A 2A73A 4JFDE 1X3DA 4KJPD 2ICEB 2OZ4H 3C2SA 1S9YB 4Y19D 3VXOA 1YJDC 2F54B 4LP4A 3MRRA 4RGNE 1PGRB 3QDGE 4M6OH 5CINH 3T8XA 1IEAA 3TBTA 4CUCA 3BISA 5KZCB 1CE1L 3OKEA 1OTSD 3DSFL 3ZHLA 4R96B 4DUWA 2P4AB 4L3CB 4QYOB 5T1KB 1CVRA 5FXCH 3VGDA 4G8GA 5EA0L 3MODL 4XCYB 2VXUH 4L4TB 1TVBA 5SX5H 4Z78A 4ZD3H 1JYXA 3WN5B 3VGFA 4ODUA 1AP2A 3VFVA 4HK3J 4GH7B 2Q8BL 3DVGB 1QKZH 2PTTA 5DFVD 4GFTB 4U7MA 1M7IA 1HHJA 1B4JL 1QZ1A 3JWDC 4R90H 2CO6B 1F97A 4OQTA 3RZWA 3OAUL 2WQ8A 4PTUB 1YYMH 3V5HA 5GJSH 4OQTH 1ZLWH 2JB5L 1IILE 3EAKA 5JXAL 1T1YB 1F4WH 3UJJL 5DK2B 3CK0H 2UWEE 2JELL 3T2NH 2HKFL 1SEQL 2AK4D 3VXRB 4JHAL 5TDNA 2EE6A 3QNYB 4P57A 4PRID 1KULA 3TZVD 5J12C 4HUUB 2YWYA 3ARWA 2E27H 4PFEA 5EZOL 1WV7T 3V0VA 2KQNA 3SKUD 4X4ZA 4IRJA 2DMBA 5AZ2L 4PRHA 3QSKB 2DWEB 4DTGH 4YFLF 3EHBC 2VDPL 3P77B 4U7KA 5F1SA 3VMNA 1IEHA 2JIXD 4YHYC 3P9LA 5F7DB 5GZOC 3NPZB 2YUWA 1M7XA 3KPTA 1T2QL 3LVEA 1JWSB 4GRMB 1MNUH 3NFNA 3OSKA 1T03L 5FYKU 4U0RC 5ALCH 3B9DA 4P9MH 4POUB 4HIHA 1VESA 3ULSB 3WUWG 1EHLL 1KIQB 2UUDH 1ITBB 4ZUTA 1F11A 5AG8A 5BZWA 5K9QI 1CWVA 4HWEH 2DM7A 1G7LB 2XY2A 3O81A 4NQEA 3QIWB 3LEVL 1R5IA 4JB9L 3ZKMC 4IRSA 1EEQA 4FOMA 4D0BB 5E9DA 2YD6A 4RISL 4IMLB 4YBQD 3OKLA 2V7HB 1S7QA 3W9EB 3QXUA 3PABB 4HCRL 3DPBA 3ROLB 2ITCA 1QPXA 3M17A 3IXTB 2JJUA 1TNNA 5JW3H 1SJEB 1YEKH 4GG6E 5IFJA 3LEYH 4PREA 2X4QB 3OJ2C 4G3YL 5DMYA 1NBQA 2APVA 2E8ZA 4TPRL 1FE8L 5JO5B 2IGFH 1U8PA 4YXKL 4G8GD 1XF5B 2R0WH 1J8KA 5E0QA 3UYRH 4QY8A 4LHQB 5GGRB 4X80H 3QCUH 3C08L 3QHTC 5DD5L 2FX7L 2VDOL 1YEGL 3BP7A 3D25B 4XXCC 4PJEB 3TBWA 3QEQE 1K85A 1GGBL 4MMZC 1EMTH 3LQAC 2W9DH 3E2HC 3S6CA 1IC7H 4WU7A 25C8H 4FFWD 4PRAA 2R0LH 3W9DA 4BZYA 4HX1A 4G6KH 5DQ9B 4F7PA 4PGCB 4QRQA 3D6GA 1UACL 2Y6SD 1DBMH 1B0RB 1I1RA 3WKNA 4WEMB 4M1DL 3OG4B 3C8HA 1QTYT 2DTML 1YMMB 2YMXH 3QIUB 1MCDA 4K71B 3UCRA 4KWUA 3TT1H 1BD2A 1HZHH 2Q1EA 3NAAH 4FTVE 3BP5B 5JDSA 1JGLH 4QXUL 1BQLL 2FWOA 2D0GA 2VL5B 3LH2L 4LFHD 4WFFD 5FYJL 2AABL 4AEEA 1NLDH 3ARGD 1E28B 1LK3L 5E8NA 4MVBC 3JXAA 3Q3GB 4LASL 3DURA 3C6SB 3LKQA 3PL6A 3QQNA 4KJYB 1CDIA 2A9NH 3ARDC 1TVHB 3G5ZA 4BKLB 4DUXA 4IDJH 1GHFH 3ORJA 5GRWA 5EU6D 3R8BB 4I9WD 3O0RL 1A3LL 2XYCA 4FQ1L 5ACLA 1W0WB 2OI9C 4YNYA 4OZIE 3RZCA 4DN4H 1U8OB 4FFVD 4NQED 1T04A 3UBXG 2FHFA 1S7VB 5D7SH 4D9LL 1JPTH 2BVPA 4MXWL 2YD9A 4IRSD 1C12A 1D6VL 1DQLH 4X7TB 2WK2A 5E9DD 1BAFL 2AERT 2FRGP 2FHCA 5HGHA 2HFGL 4KFZC 1U8LA 2BY3A 2GITB 1MCEA 3U4AA 2M26A 3UTZA 3OGCA 4G7YH 1MY5A 2F53A 4QHNB 2A0LD 3C60C 5I1HL 4CAGA 2RHEA 1IGCH 4FQXC 3FQWB 4Y1AE 5JQ6H 1U8JA 1UM5L 2WNGA 3HE7C 5BZDA 1RZKC 4Z0XA 1OP3K 1X5JA 4LCYB 1NCCH 5C07A 4GG8B 3K4ZA 2GAZB 3KPPA 2CDFA 4RAVB 1U3YA 2XNAA 3QRFM 3MGTA 5L9DH 4MJIB 4O02L 5GS1B 4NGHL 2BRRH 5JPMB 4LLYB 4N0UA 5EU7C 5KJRH 3KPQA 1FCCA 5IMOA 4CW1A 1FNEA 1AGCA 4JKLA 3SDXA 2FHBA 1HXYA 3BKJH 1FNLA 4FQ2H 3QUKA 3VI3F 3VRIB 4XBPA 4MAYA 2I9LA 2O5YL 3OWEA 4WO4A 4KXZI 4LLDA 3EYQD 1EHNA 3SJVB 2BHYA 3KWWB 3HTLX 3SPVA 1P7QB 3P4OB 5JOFA 1MFEH 3FQTA 3EYVA 2NY6C 4WTWA 3RTQC 5ID0A 5B39B 4MD0B 2GY5A 1JWUB 1G0YR 1OAUH 4U05A 1PZ5A 3NVQA 3J7HA 4ZMAT 3JWOL 1T20B 5CJOH 4ODHL 1DP0A 2VQTA 1U8KA 3PXJA 1UB6A 5C0RL 2HVKA 2BSRB 1JRHL 1CYGA 4B7IA 5ADPH 4XPBH 4X6CA 2VDMH 3SGJA 5BS0B 4KHTH 4FA8A 3MLTB 4XTRD 3VD3A 4KRMB 1IM9A 3QA3A 1MIEL 3I3BA 4M6ML 2IF7A 5IEHA 3U30C 4ELME 3DRQB 1I7ZA 4YHZL 3MC0A 4HBCL 2NY4D 1WWCA 2J7LA 2A6DA 2IFFH 1ZANL 5TE6H 4LEOA 4U2ZA 5C0FB 5H2BA 3HNVL 4S1QH 3RZCD 1JNLL 3C5ZB 3BP4A 1FFPB 2AVGA 3DMMC 4LEXH 3V6BR 4KV5E 3JV6B 1SJVA 4PRHE 5F3BA 2VIRB 3G08B 4I2XB 4Y0GA 1XGQA 5DYOA 1J88A 1ND0A 4LU5L 5F7FA 4FP8H 1Q9LB 3LPWA 5LKNA 3OZ9H 1K4DB 4GMTH 1F58L 5CJBA 5ITBL 1Z5LB 2F74B 4KHXH 2LABA 3VXSD 3ZHDA 2QR0B 4Z8FH 4M6NH 2ICES 3IFPA 2DIBA 4WI4A 3BESR 3IDMB 1GGCL 3QUZA 2C26A 5C07D 2ESVA 2AJVL 4PJ7A 4E41A 4EBQH 5FO9B 3PGDA 5DRZB 1P4IH 2GK0A 4XAWH 1LE9B 1IM3B 5IKCA 4N0RA 1LEKB 1R3KB 5IQ9A 3BO8A 4DGVL 3T0BA 4D94A 3BZ4A 4NQDD 5ELIA 5FA4A 2BJMH 1A6UH 1IEBB 3PGFH 3U6RA 1RMFH 1FG2A 2NX5A 4LCCC 1WTGT 6CGTA 1XFPA 5CP7B 5F71A 4WI2A 1IQDB 1JZ5A 3EO0A 2DQTL 4MAYD 4MDIA 4WO4D 1VPOL 2PR4L 2APXA 1EAPB 5D70L 1KLUA 2G60H 4RMUA 4X6DB 3U46A 1YJDL 3GI9L 1S9WB 4R0LB 3QUMA 1QG3A 1CICC 5I9QB 1FCGA 4IIQB 3HI1A 1MFNA 4X9FA 3QUMH 1BFOB 3GB7A 2EDOA 3N1MC 3V5DA 1N6VA 2BK8A 2HT3C 5DGQA 4KKAD 4OGXH 2EDLA 3EJYC 5FCSH 3VG0L 1QSEA 3RVTD 5IR1A 5E08H 1N26A 5SWZE 4L8SC 3BGFB 4ONGH 3Q6FA 4YR6A 4JO3H 1QOKA 4FG6D 1FRGH 2GSIB 4XVTL 4P4RA 1JZ3A 1IM9D 4RMWA 3TH4T 4KQ4H 5D7LA 1CXHA 4JHWH 4HK3N 1J1OL 4N68A 2VZ3A 3JWDL 4F9PC 4YHKH 4J4PD 5IM7B 4HW6A 2CKBB 2FX8H 5B8CB 3EBAA 4Q6IC 4PJBB 2WBJD 3P30L 3WFDL 4DOHB 3L3KA 1QEWA 3DX6A 1CFTB 4F80A 2VQ1B 1FFOA 5FUCC 2CLZB 4GXVL 1YPZA 1BD2E 1NEUA 3UTSA 1ORSA 4NZRL 3IDUA 5GRJL 1QLRB 3OKYA 5E2WH 1J10A 1JGUL 5BO1H 1N6QL 4X8JB 3SBWC 4PUBL 1ZHBB 1I3UA 1Z9OA 2C3WA 1LD9B 3PGCB 5GGUA 4Y2DC 1I3GL 4P2RB 4R6UA 5F9JA 3BIAX 2X1XR 1RD6A 3ARQA 1CQKA 2CXKA 3QEGH 4J1UA 4BZ1H 5J11C 3QYCA 4OM0L 2Z93A 3L95B 2GJ6B 5IT2H 4JDVB 3WO4C 4I3SH 4NJ9L 3QUZD 2ESVD 2A77L 2VUOA 4E41D 1E6OL 4X6EA 1WBZB 4F33B 3MJ6A 2MPAL 5M7QA 2V7NB 3N1PC 4QRUA 4FRWA 5GRXG 1Q38A 3G6AB 5J12B 1PSKL 5GSRB 3VXMA 1YMHB 3MRFA 1H3UA 3WCYA 4XGZA 2H26A 1MF2H 2QBWA 5HHME 3DYMA 4KH2A 2F53E 4D9RE 2COQA 2Q87A 1UZ6E 4ODBD 3QUYC 4MJ6B 2HT4D 4TUJA 1ED3B 2CR3A 4LPUA 3VFPB 1S7SB 1X4XA 3HZMB 5F9WC 4XCCL 2XN9A 3TNNA 4YHYB 3VU2A 1IGML 3MLWH 3S36X 1X6LA 4U1GC 1T0MA 3V4PL 1NAMA 1FP5A 2VJXA 3DHJA 4IOSD 4U6HB 1AQDB 1P7KB 1QO3B 4GMSL 1QSED 2VDNH 2VITB 3L3GA 1NAMH 3VXTA 3VXQB 1FYTB 5EZJA 4N0UE 1Y18B 1MI5B 4YXHL 3VFNB 4QNPE 1C5BH 1A6VL 1CFVL 3HLAA 1KCUL 3MCG1 3NABH 4JPVH 3SDXE 4A2LA 2GFBA 3NIGE 3I3DA 1P53A 3LQAL 2VABA 5ICYA 1I85A 3ULUH 5CIPB 5I2IA 1A5FH 1U93A 4HJGB 4LCWE 1PQZA 1S7RB 5K9JL 1Q9WB 1ZGLP 4LBEA 4BQ6A 2EDYA 4QCIA 5HYJB 3PV6A 3UTSD 2YA1A 2Y7QB 2EEDA 4CN6A 1J0JA 3VXNA 1N2RA 2EDRA 2R4RL 1L7IL 1KTLB 2X4NA 1UYWH 4Z5RA 4WDIB 2F58H 1CD8A 4GAYB 1DEEB 1A1OB 4U33A 2VNCA 2OJZL 4HFUH 4PJEF 1EX0A 4X6CE 2NR6C 2I07A 3H9SB 3QJHB 4TTDD 5LBSL 3CVIL 3VI4F 3CUPA 4NT6B 4U7SA 4KAQL 4I5BA 4M48H 4XP9L 5HVHC 5HYSB 1I1FA 3HAEB 4PGEA 1F3JA 1T0NA 1JPGA 3K46A 4LVHC 1Q9OB 3WS3B 4MX7B 1FO0B 1E4WL 1MHPL 1MCPL 1Q0YL 2ZNWA 3OKNB 5I1EH 1CXKA 1WBXB 3SE3C 3S36L 1CL7H 2VQUA 4LSTL 1CN4A 4G7VL 3FZUD 5D1XB 4OLWH 3ZYOA 2A2QT 2ZOLB 3OKOB 5C9JA 4JO2L 3K81A 3FOMA 4EOWH 2WWKT 4NN7C 3GO1H 2FEEI 3VXMD 1R24A 5D6CA 3ARXA 3FQRB 5D5MA 1E27B 5ESAA 4NCC1 5IMKA 4WFEE 3JV5A 3KAAA 4HZAA 2J8OA 5IGXH 3X12A 1OAKL 2NTFB 3VFSB 2DQIH 4ORZC 4J3OC 1AQKL 2FYYB 2R1WB 4MCZB 5AWNH 5T1DL 1QR1A 2EYSB 2W1NA 2WMPA 2XN9D 3BW9A 3U7WL 1I4FA 2ED9A 3MROB 5GRVK 3RIFF 4HQQH 3ARDB 1A6TA 2ZUSA 4JM4L 3PWJA 1EVUA 3CMOH 4G42A 3WNLA 1RZKL 4JVUA 2YBRA 4K7PH 5MEPA 4ALAL 3FN9A 5KVFL 4RWYL 2AXFA 2DWDB 2NX5E 2P49B 3KG5A 1R5VB 1NMBL 2Z8WC 1BQHB 1IAIH 1PLGL 3ULUD 3U2SA 1OGAB 1XGUB 5EPMA 3TVMA 1T3FB 5JUEH 1QSFB 3CFKB 4EDWL 5KAQG 1FZMB 3KPSB 2Z91A 3CCHB 3K2UL 5AG9A 1MY7A 4PGDA 2H2PC 2ZCKL 4UNVA 2EIEA 1D3CA 1ZXQA 2EE2A 2W9EL 4AT6B 3MJ9A 3R8QA 4NSKB 2HFEA 5E6IC 1UM4L 1OAQH 2Z8RA 3QHFH 3RWHB 4IMKA 3SEPA 4HH9B 3LEXA 4DVBA 2VLLA 3LPGA 2YPLA 1NAKL 3ARFD 4S2SB 3PG2A 1ZS8A 5F3HB 3BEVA 2H1PH 3QG7L 3M8OL 3EIFA 3D69A 1OY3B 3CFIC 2NZ9D 3EOAA 5D7LE 4I0PB 2J6EL 1P4LA 2P7TA 1VGEL 3CH1B 5DMGC 2DF3A 1ZGLM 3MBXL 2X4PB 1OPGH 2ARWA 3RNKB 1JGEA 5F7YC 5J3HD 3WIFB 1UH2A 2YPVL 2CLRA 2AEPL 4Y8DC 3BE1H 2VLMD 5CEXA 2R2CA 4U6TA 5C8JA 4ODVL 3HE6A 4K7FB 2HN7B 3TIDB 3GMMA 4XX1G 3LB6D 3UTSE 3JV4B 3FJTA 3AGVA 3N85L 5KSVB 2NY6B 4XPAL 5HGDB 2DD8H 1K3IA 5B39G 1DBJL 4EXKA 2R2HB 5F1IB 4NNYB 2Y5TB 2YPKA 4HG4J 3MYJB 3GIZL 5DGRA 5IB1A 2F5AL 2DI8A 1FFNA 3B6SB 1NGPL 2NY1C 1VKXB 1Q1JL 3BKMH 3RJQB 3S4SA 5CILL 4KJWD 4J3TA 4CN4A 3BN9C 1NCTA 1T7YA 4LARL 2Z35B 3VXUB 3O2WL 1RJYA 2HWZL 4PJIE 3U30B 4X0KA 2YS4A 1DBAL 4OQ1A 2HP4A 4XMPL 4YDJB 5CLWA 1Q9KA 1HSAB 1G7HB 2OR9L 2AJ3A 1PD6A 3RQ3A 3DV6A 1RIHL 4HV8B 4DVRL 2HKHH 5I1GL 1EEYB 3DMMB 2XA8H 4FQCH 3QO1B 4WEUD 3RWJA 4ZFGL 4MSWB 3I2CH 4PV8A 3BGMB 4HH8A 3CLEL 4F7EA 5C0EB 3TVMD 2DLIA 1KN2L 1RK1B 4NBYB 4FQHB 5HI5D 4P4KC 1D5XA 5HYEA 2MMXA 1S9VA 4Z77B 3ARUA 4O5LH 3JBG7 5BXFB 2DLTA 2PCPA 1C5DB 4HGWA 1QRKA 4O00A 1RZIA 2ED8A 1ZTXH 1U8QA 1C5CL 4M1GL 5I6XC 2YPLD 3K1KC 4FZEH 3IDNA 3EGSB 2ARJQ 3W81A 1YDPB 2YXFA 2DQEL 2DQHH 4QTIH 4XP6H 1MCKA 2MQ0A 3MMEB 4IHOA 1QHOA 3KPRA 4OUOA 1OTSC 4MA3B 4WJ5B 3GKZA 1KB5B 2Q20A 2CMRH 4ORGA 2MKWA 1A4JB 5BW7A 2PW2A 1FVCB 1K8IA 3VFMA 2R23B 1JP5A 3MRGB 5INDB 2AXGA 3MRMA 1AY1H 3H3KA 3HE6D 4X6DF 43CAA 2CK0H 4ELKA 3IDJA 1Z0MA 4HFWB 1T4KB 4DKFH 5DFVC 2CDGB 4AM0B 2R1YB 4JZJA 4N8VA 2Z92B 3EFFA 4MNGB 4U3CA 1NDGA 2NMSA 1FZOB 5DRNA 2QQLH 1BVKB 3KPMB 4BUHA 1ADQL 5IB4A 1RHFA 2DQUL 4MWFA 4KMQA 3VGGA 5C0AB 5JDJA 5MI0C 5F7EH 4NOFA 4TYUA 1C16B 1H3TA 1KTDB 5CBEA 1Y0LB 4UTAH 3GMNB 1BVLB 3GBNH 3P11H 1NBVH 3GNML 5C6PB 4W4OA 3BRGC 4PJBF 1H3PL 1A3RH 5ICZA 5AUMA 1I3RA 1NUGA 1NANI 1HNGA 1GPOL 3C5SA 3MRNB 2VDKL 4OAWB 1DQQB 3SO3B 3PDOB 1D5IL 3IJYB 1XIWD 1CD9B 1V3JA 4PR5B 1N6UA 3MV7A 1PW3A 1J05B 2VDRL 3CDGA 2NLJA 4PJHB 3EDDA 3NIDF 1MRDL 4WUKH 4LNRB 1A0QH 3IETB 4GOSA 4U6YB 3LKNB 1RUML 2X4TA 4NWTL 4BSWA 2KPNA 3NCYS 4Z7WE 1KNOA 3LMJL 4Y2DB 2NY3B 2WUBL 5A2LH 4R8WH 3OG6B 5A3ID 2BNRB 5J11B 2YEZB 3F7RA 5E6ZA 3GSQB 3I75B 4XT1C 4QRRE 4YBQC 1RJLA 3L5IA 5FA3A 3IKCB 4L5FH 3OB0H 3QP3A 3MRCA 43C9B 3FRUB 4P5TB 4X7DC 4HC1L 4NOBA 3EYOB 1HDMB 1KC5H 3KPRD 3RY5A 3WNOA 2BOBB 1N8ZA 3H3PL 3DJ9A 4H8WC 5MENE 3DIFA 3MOAL 1A6ZB 2XG4A 4YO0B 4QXGL 1F8TL 4PGJA 3HMXL 3MGOA 4XNYL 1CL7I 2HMID 4DCQB 3R0MA 5CZVH 4BQCA 3E3QC 3FO2A 1P5VA 5D7KD 4JKPH 1DL7L 3QQ9D 1H9VA 1L0XA 1TJGL 3QUYB 1R5WA 3H0TB 2CLVB 2EDEA 3D85B 3FO1A 1LO0H 3FT2B 4FFWC 3BZFB 2VZSA 4JLRA 4U1GB 5LCVH 4WWKA 5IOPB 4X4XB 3WNKA 5CD3B 4JY6A 3HA0A 4JANA 5JXED 3UTTE 2Y6SC 1YNTA 2NW3A 3QG6B 2VXVH 5E24E 4POZD 4JRXB 1X6NA 3LV3A 3MXVH 5C1MB 2YC1B 1EJ6A 3C8DA 3H3BC 5DJAB 4QHMB 4LRNL 3VGEA 3U36A 3WLBA 3BPNC 4JAMA 1P9MA 5D9SB 2UVFA 2AK1L 1BIIB 1EO8L 1HQRA 4G6JL 2QQKH 1PKQE 4O2FB 3HPLB 2I5YL 1UWXK 3ARGC 4WUUB 1KTRL 3HMWH 3O45B 1IAII 4RBPK 2Q7YA 3L3JB 3QFDA 3WV0A 4K9EH 2QKIB 1RIVH 4LPCA 5C70A 5DK0A 3MV7D 2YKLL 4U1JA 4L8CA 3LIZH 4I3RL 4OGYH 5T33H 2P5EB 4WHYH 2P5WE 4TSAL 1A6AA 3P73B 3VFTB 4IJ3B 3CSBA 3WIIH 1VSCA 2APTA 4YBLB 4MXQD 4OKDA 4EEEA 1MCWM 4Y8AA 3SQBA 4GLRH 3IVKB 4OD2B 3PWUB 4HS6B 4M03A 4L9LA 1T0PB 4FFVC 3QB7C 4WNQA 4I0CC 2VZVA 3GSUA 1HH6B 3O8XB 3U4BH 2CRMA 4TUOB 2XOTA 4MHHI 2EXWD 3NCJH 1M05B 3CVHB 4IRSC 2Z4QA 1V05A 4JZOB 4XVJH 1UADC 5HYSG 3HAEG 2IBZY 4IOIB 1G9MC 3BKYL 3INUL 4M8VA 2IADA 4CRPA 3WD5L 4UIMA 1ZLVH 2A0LC 1MUJA 3BKCL 5EU5A 3RGHA 3TBSB 4RMVA 4ODWB 4XMKH 1BHGA 2FSEA 4YHPB 4QF1A 1P2CA 3L1OL 4EVNB 1LILA 1SQ2N 4LLUA 1Z9MA 4YHIB 1EXUA 2W59A 4NQTA 4PRDA 2QHRH 4MMXC 4NO0A 2PNDA 3DVNB 1XMWA 4G6ML 1CR9L 1BGXL 3B3IB 3DGGA 4XRCB 5JIPA 4UT7H 4JR9H 3IDGA 5L6YH 2FATL 4Z7UA 4L4VB 4TULH 2H2SD 3V52L 2GT9B 5ICXB 1ZGLB 4JFDB 1G9NH 4HZLA 4WWKD 3NCBB 4X7CC 5JOEA 1H0DA 3AM8A 1MCWW 2N7AA 2YUVA 3EYQC 2O5ZH 4XH2A 4RX4A 2GQHA 3DX8B 5C3TA 1MWAL 3FFDB 5HHOB 5I1JH 4XWGH 1CVSC 4LSQL 4NN5B 1XH3B 5AYUL 4FABL 3QDGB 3QIBB 2Y36L 3WHE1 1OF2B 5LAXA 4DWHA 3GMLB 3ZKND 2P8PA 2O5XH 2R8SL 4OCYL 4H1LB 1KACB 3TNMB 4LSVL 1EGJL 4M7LL 4XTRC 4EI6B 1H3VA 3O3DA 5DVMA 1J8HE 5IVXA 1J1XH 5KS9E 1BM3H 2XXCB 3ET9F 1CZ8L 3MJ7A 3MGAA 2NY4C 5E6IB 2DBLH 4H5SA 2F5BL 2F8VA 4TOYH 1AD0B 3QXDB 1MWAB 3T3MF 5DJ2A 1F4YL 3RZCC 3CNKA 1XR9A 3BEWA 5C09A 4HPOL 4CVZB 5T3ZD 3QCVL 1VFBA 4Q74A 3EYUH 2DICA 1OWWA 3C5JA 3GM8A 5F1NB 2WLYA 2AEQH 3GHEH 5E4EB 1J1PH 4JVPA 1JYNA 2CIKB 3IFLH 3VRLF 2NZIA 1DBBH 5L2KA 2AJZA 4ZFOA 4XZUB 5D8JH 1NSNH 4WI7A 1DVFA 1LO3L 3D2UA 3RWDB 2GUOA 4PLNC 3WFEL 1FV1A 3K1DA 2XKUA 4ZNEA 4LOUD 4EI5B 4NRYA 4M62L 3IKKA 3RA7L 3NFPA 1R3JA 2G5RA 4Z0BH 3I50H 1LEIA 2OQJB 1K5NA 5BJTB 4O58H 3D3VE 3MLUL 1WSST 3I9GH 2UZXB 4XC3H 4FQQB 1QVOB 2PYFB 4NUJB 4PJFE 3LQZB 2QEJA 4YXLH 3M1BA 3W0WA 2OCFD 2BC4A 1VHPA 3B2VH 4P5MA 1Q8MA 2OL3L 5EN2B 2X2YA 4X5WB 4OBSA 4MAYC 4PJ8D 3U7YL 3T1FA 4WO4C 5MEOB 3NIFE 1AR2A 3WIHA 3FONB 5HPMA 1WITA 5C86A 3L5JA 4UAOC 3QPQD 3WIHH 2VUYA 3BXNB 4RQQA 5HHXH 4Q7DA 4A6YL 3QUXA 4YGAB 5CSGA 4D0DA 2GTZB 4GG6B 2BVOA 4HEPG 1CG9B 1WGOA 1ZA6B 3MRLB 4X7FC 3ILPB 3VH8B 4XNXL 2NY5H 4PJGA 1M71B 4KKAC 3RVTC 1HXMB 3TP4A 4L3CA 1KB9J 2N1KA 4P4KB 1WUNT 3SGJC 3OKMA 1D5MA 4FG6C 2WP3T 4WI8A 4XCYA 1DFBL 2XQYG 3LSOA 2VAJA 4NCDA 2DQCL 5BRZA 1R3HA 3QEQB 1CK0L 5IF0A 4NFDA 1I9IL 1LK2B 2B2XH 1QFWL 2XZZA 2GYSA 3DVGA 2VR4A 4J4PC 1DLHB 3FQUB 2MOVA 1RVFL 3GMOB 5BOZG 2WBJC 4Y19B 5EIIB 1UWEL 2VR5A 4BFBD 1KLFA 5C09D 1U91A 1JGDA 3X11A 2AV1A 5DO2D 4L8BB 3ULVF 3P4NB 4NFBA 5IV2B 2XQYK 3VXRA 3EO1B 5C0ND 3B43A 4HUUA 1HQ4B 4FTVB 1MCRA 1IC5H 3LHPL 3S35X 4WWID 5L2KD 1UA6L 2OLDA 2QLVB 3I6GA 3SY0A 4XPGL 1U58A 1S7WB 4HDIB 4KI1A 4MD4A 4YIQB 1CU4H 3D2UD 3CFEA 2I60H 3WYRA 5DR5L 3OJDA 4S1RL 3NCMA 3AU1B 4JPWL 4U1SB 2FO1A 3VGBA 3QUZC 4HUKB 4PV9B 3UDWA 3P2TA 1MCSA 3F7YB 1AO7A 5KANG 5CCKH 4JKMA 1JWSA 4GRMA 4CVXB 3TV3H 2F8XC 2AK4B 3L3DB 1CTNA 5I1KH 2DAVA 1KCLA 3MUHL 3O3EB 4NO2B 4TSCH 4PBVC 5FOJA 4OZIB 3K8MA 4FZ8L 3W0WD 3WSQL 2FH6A 5TF1H 1T5WA 2WW8A 3IDXL 1O5DT 5JHDD 1AKJD 3DO3A 3RUGB 5FDYA 2H9GA 2A83A 3TPKA 3KYMB 3WEXB 5KTEH 1I8MA 2OTUA 4NRXB 5J9PB 4WRLA 2HT4C 2D0FA 4U49A 3SE9H 1LWRA 5DEGB 4GKZB 2JIXB 4PJHF 4UILL 3QT2A 4XCFH 4YGVB 2HVJA 3QUXD 2VSDA 1DQDL 4E0RB 5DDHB 3U9UB 3SKOB 3MACH 4Q9RH 4JPKH 1P6FA 3UTQB 5KZCD 1A3QA 2OTWA 5EDXA 5EOTA 1RUAL 3GSVA 4H8WL 4URTB 4BM7A 2X4QA 4UINL 1XAUA 1MVUA 3FB6B 3TBYA 1HH9A 1TCMA 4ZD3L 5T1KD 1ERNA 5JO5A 1WZ1L 4MB4A 4Z7UE 4LSPH 4AENA 2G5BB 3NOIA 4KUCF 4L4TD 3S35L 5BRZD 3ROOB 2YD4A 2A73B 4DKEL 4GLRI 1QLFB 3DUSB 3VFWA 2VXQL 4LLVA 1OP5H 1BBDH 3QXTA 4N0YL 3MRRB 4HWBL 3MRBB 1UVQB 4LVEA 3T8XB 4PGCA 4C58B 3OKEB 4AEHH 1B0RA 1OD7A 4MD5B 3ESVF 4F9LC 1JTPA 3VXRD 2Q6WB 3IFNH 4HF5H 3GHBL 4G8GB 2XRAL 5KVEH 3FRPA 1TVBB 3QIUA 5ACMA 2DLHA 4TTDC 3BWUC 2DQGH 4ODUB 3VFVB 4U0QB 2VL5A 2VXSH 1KIPB 3E0GA 2A6IB 1M7IB 1HHJB 1N0LA 2C3GA 5D7IE 1NGZA 4Y4FA 3V5HB 5J1AB 3C6SA 3BOVA 4X9BA 1AO7D 4KC3B 4KVCH 1NEZB 3OAYH 1TPXB 1TVHA 1RUKL 2Q7NA 4YDIH 2YUXA 3FZUC 4KGJA 4U6XA 4KRPB 5TDNB 5D71L 4U1KA 2EDFA 5K33A 1JMZA 2FJFA 4P57B 4GQ9H 1UJ3C 1JZ6A 1JCKA 5JA8B 3BDYL 2D9CA 4RAUA 1LDPL 1FORL 1W0WA 2DIJA 4ZO7A 3V0VB 3ZO0A 2VLRA 2NXYB 4YHOH 3OKDA 4X4MA 4IRJB 3QIWD 4PRHB 1S7VA 1CDBA 1VERA 5D96C 4M7LT 1FSKB 2KZWA 4X7TA 1G9ML 3LY6A 4YK4B 4JM2A 5ANMA 2PYEA 2GITA 1WISA 2FJHA 1YNKH 1W72L 4B0MM 2PKDA 1JF1A 2R9HD 5TGBA 5F97E 1E6JL 3NFNB 4YHLH 1IJ9A 4MXVF 4JN1H 5CJ8A 4FFYH 3EYSL 3FQWA 3D87B 4HIHB 3RI5F 4KDTA 4IOFD 4OD1L 4X80L 2AGJL 1UGNA 1J11A 2QSCH 1F11B 4LCYA 5E1AA 4O9HH 5I0DA 3W0WE 2EEBA 2GAZA 4WHDA 35C8L 1HHGA 2NQCA 3FQXA 3QEUA 3ULUC 1R5IB 3MUY1 4IRSB 3ZDYE 4LLYA 2R0LL 3EJZD 1DBKH 1N7MH 5E9DB 1I85C 3CSYB 3FB5A 5DMJB 4ZXBA 2VDLL 3X3FH 3TN0B 4YEFA 4P59L 2ITCB 3K80A 1I7TA 1ZEAL 5E95B 2IJ0C 1U0QA 1TJHL 2CJUL 4U2YA 2E9BA 5HBBA 3VA2C 5IFJB 3WFBH 3SJVA 4NUGH 1CI5A 1NFDA 1ZVSA 2E9JA 4YDLC 1JYVA 3V2AR 1U8PB 1N4XH 3ARFC 3RAJH 1S5IL 3LS4H 3QIUD 12E8L 4MD0A 4QY8B 3ZT5A 3QHZH 4EIGB 4OFDA 1AXTH 3AMKA 4QLRA 2SEBB 3G5VA 1T20A 5SWZB 2NZ9C 3KLSA 3UJIL 1IFHH 1A1NA 1CGSH 5DJ0A 2PXYA 4PRAB 1ZKAA 1YY9D 2QADD 3W9DB 5DUBA 5J3HC 4HX1B 1GHFL 1NMAL 4F7PB 4Y4KA 4QRQB 1RZFH 2BVQB 4HD9A 3TLRA 4AEIH 5ADOL 3TT3L 1U3JA 3V79C 5FIEA 3S3SA 3LB6C 2DJ4A 1PBYA 1GZPB 3BQUA 4TN9A 5C0FA 5KSUB 3KS0J 5DUPH 1Z3GH 1KIRB 2EYRA 1BD2B 2VLRD 1FFPA 3QI9A 3VD5A 1RU9H 1QNZH 1CGUA 3HRZA 3PQYA 1MFAL 3N0PB 4J7RA 5CP3A 5E8NB 3G08A 4H1LG 3CFDA 3EW3B 4JM2D 2PYED 3DURB 4FQIL 4KJQD 4B5EA 2WWMD 3PL6B 4OZHE 1K4DA 1EJOL 4KJWC 3JTSA 2R56L 4BH8A 3G5ZB 5FFLA 4Z18A 4CU7A 4HPYH 5K9QG 5TFSL 1XF2B 5CKAA 5C0DB 1NCDH 4JFYB 4Y88A 3MA9L 4PJDA 5E5MA 4YEEA 2IAMB 1IKFH 3IDMA 3S88H 1T2JA 4JFQA 4YNYB 3BUTA 4PJCA 4HULB 5E8DH 2EC9T 4HJ0D 1MRCH 1LE9A 1OCWL 1NDMA 2FBJL 2BVPB 1CLOH 1Q94B 2Q76A 2VTFA 2JK5A 5E99L 1J12A 3TVMC 1TENA 1IEBA 1U8LB 1JFQL 4JG0H 5B22A 4TUKH 5F6IC 2FEEL 4M7KL 4HGKC 5HHMB 1FDLH 2R29H 2XQBL 1IQDA 3UTZB 3OGCB 5DZOA 2F53B 1EEZA 3UTOA 5I8CA 4JZNA 3SO5A 4P99A 4H88H 1U8JB 1MRFL 3SJVD 1ZAGA 5BZDB 5TPWH 2AS5M 3H9HA 4OCNC 2NY7H 5I1CL 1HK6A 5C07B 1S9WA 1XCQA 1GZQA 4R0LA 3HUJA 3KPPB 5F8QC 4IIQA 4OIIH 4AL8L 2XNAB 3QQ3A 2VB5A 1QFHA 4QT5A 4XPBL 4OGAD 5F44A 2AJYH 4ZO8A 3FB7A 4N0UB 1WAAA 3KPQB 2FH8A 4NDMA 4UI2A 4K7PY 2DM2A 4NKQB 3B83A 5IMOB 3TO4A 3B2UD 5H94A 1AGCB 4JE4B 3SDXB 1F3DJ 1HXYB 2XFXA 2GSIA 3QUKB 4MAYB 1NL0L 2I9LB 3HE6C 4WO4B 3VFGH 4K2UL 3IXAA 4LLDB 4AQ1B 1A9BA 1MJUL 2O93L 3BAEH 3SPVB 1DN2A 2GJJA 3BQUD 1OAZH 2J8HA 1IAIM 3OB8A 5B8CA 5JOFB 3FQTB 4GG6F 2DQFA 3EYVB 3HFML 1ZSDB 5ID0B 3ZSTA 1U8NA 4C4KT 4AY0A 3NFSH 3CU1A 3QI9D 4EUPA 3GSNH 3C09B 4M7JL 4OLXH 4EUPH 3PQYD 3OJVC 1U8KB 4ENED 2UZIH 1UB6B 3VH8G 2HVKB 5HDOA 4WFHE 3HZVB 4E42B 5JW4M 4X6CB 1I9JL 2BSSB 1K4CA 1UXWA 2X1OA 1GAFH 4M6NL 4N5UA 1RZ7L 2VH5L 4XB8A 4ZDHA 4JKKA 3MRHA 3ZLQC 1IM9B 3QA3B 2R2BB 1LD9A 4RFNC 5IEHB 3PGCA 2C3VA 4P2RA 1WC7A 1I7ZB 2BVYA 4X9IA 5FOBB 2A6DB 2HYMA 5IHUH 1KFAL 4LEOB 4AH2A 4JDVA 4G8EB 1XIWC 1XCTB 3L3OA 4ZNCD 3BP4B 3MRKA 3UO1L 1A7QL 5FHAL 1P5UA 3KLDA 3V0WH 5ECJE 3R1GH 4XMLL 1HIML 5F3BB 2V7NA 4KZDH 1GRWA 4R9HA 5EOQH 1XGQB 5DYOB 1ND0B 1YEJH 1YN7A 1FLRL 1YEEH 3LRSA 4JFPB 5ANME 2PYEE 2B1AH 4UBDD 3DETD 5F9AC 1IGFH 3O6MH 4C54A 2JCCA 4NNPL 4LKXB 1F6AB 5DJ6A 5A3IC 3JZ7A 1WIPA 5K9OA 3L5WB 2VE6B 4MJ6A 3LAFA 1ED3A 4ZUVA 4LSRL 3QUZB 4LDOB 5DJDB 3S96A 3QUML 4PJ7B 3WFZA 5F93C 1Z9LA 3PGDB 3WDJA 3WXVH 2GK0B 4WTZG 4UT6L 5IKCB 2ZSWB 1QFPA 5D1QA 5IQ9B 4OZIF 3BO8B 1H5BA 3BZ4B 2F19L 5FA4B 1AJ7H 1MQKL 1CLZH 1VENA 2FECL 2VITA 2WSKA 8FABA 3TO4D 3RUGF 3U6RB 1RULH 1FG2B 4NWUL 2NX5B 5BW7C 2YA0A 2HMIC 1P6AB 4CADA 4PJAA 5IQ7H 1FVEA 3EO0B 4MDIB 1OGTA 1BJ8A 2KDGA 3QQ9C 3MOBL 5BCAA 1KLUB 4JZJC 4OF8A 4HJGA 3K4AA 1S7RA 1NFDE 1Q9WA 4Z7OE 1T1ZA 3QUMB 2Y1VA 3MX0A 1WZMA 3ZTNL 3HI1B 3CJJA 5E2WL 2HRPH 5BO1L 3V5DB 5JXEC 2WBKA 1EFXA 5IR1B 2ZNXA 4POZC 1KGCD 4GAFB 3LZFL 5KVGL 5DJXA 1Q72L 3Q6FB 4YR6B 1DEEA 2OK0H 4R3SA 2C4XA 2XICA 5F21B 5E94B 2XY1A 4W4OC 5D7LB 2BZDA 4FQLL 3RY4A 4P2RD 4NT6A 4JO1L 5EZLA 3MLRL 5IBUG 3ELAT 4JRYE 4LDLB 2LTQC 4M9PA 1JI1A 2WIIA 5IB5B 1J0ZA 2IQ9L 1QEWB 1FO0A 3OKNA 4J8RA 4WW2A 1FFOB 4NNXA 2M8XA 5DJCB 4B7LA 1QD0A 2FZ3A 3UTSB 2XZCH 1YA5A 1ORSB 1I3VA 4JO4H 1FPTH 5D1XA 4X7EC 2NXZD 4LHUA 4MXQC 1XGYL 5MHSD 5CLTA 4LIQH 3RVXD 2WINB 5KSBA 3HZYA 3MXWL 4Q0XH 4ODTL 2APFA 4JDTH 3FQRA 4DFIA 1PKOA 5GGUB 5JZ7D 4Q9QL 5HGBB 3W2DH 2ICWJ 2VR9A 4J1UB 2EXWC 3EHBD 2NTFA 2Z93B 3PHSA 4ZFZA 2EIDA 3TYGL 2UZYB 3MSPA 4PJDE 4YH6A 1PX4A 3KJ4C 4GAGL 2B20A 1U36A 4YZFE 4PJIB 4X6EB 3SHSA 1UENA 5D1QD 5GHWL 4PJCE 2NNAA 1FNGA 3VW3L 2Z31A 4LLWA 3VWKA 3P9WB 4FMFA 4QRUB 1JWMB 2WWKO 4KV5F 3DECA 1MHCA 5GGVH 5GISL 5JW4N 5EO0A 5DD3H 5DK3A 1MI5D 1GOGA 1LO2H 3VXMB 2FIKA 5LGHH 1DQJA 2DWDA 4H25A 4XGZB 5DJ8A 2PTVA 2H26B 3D39E 5F96H 1A5FL 5D96B 1RIUH 1WIOA 1OGAA 2C4FT 1WTLA 4AG4L 1T3FA 4ZODA 1WIUA 3U0PA 2QSQA 3NN8B 4KVNH 3O6LH 2H2SC 1QSFA 1YQ2A 3A6CH 3CFKA 3TNNB 1FZMA 3KPSA 5DSCA 4KI5E 1RZGB 2QQNL 4CMMA 1JMXA 5HYJD 4WWKC 1T0MB 2R69H 4HHAA 5MERA 1NAMB 3BH9A 1N59A 2CUIA 4XPHH 1EFXD 4M5YH 3VXTB 3SCMA 5EZJB 1JPSL 3H42L 1WAAE 5A2KH 5DJYB 3HR5A 4PY8I 4S2SA 5DD1L 5IFAH 2V9QA 5F7HA 5F3HA 3HLAB 1P9MC 4Q6YA 1KCRL 2X7LA 3H9SD 5C08E 2Q8AH 1KBGH 4MQTB 3ZKNC 1MJ8H 1QRNE 2GFBB 1WEJH 4DKAA 1AE6L 1TZGH 3PWPA 1JBJA 2OP4L 5ENWA 1B4RA 5ICYB 2VLJA 5IK3A 1OARH 3CH1A 5I2IB 3EFDH 1U93B 1K6QH 5MEQA 1PQZB 3VDCA 4K9EC 3TCXA 3HI5L 2W9LA 4LBEB 2DYPA 2R4SL 4XHQA 1G1CA 3V6ZB 3V6OC 4HXAH 4R4BA 3PV6B 4HXBH 3T65A 5I1AA 2BNQA 3CD4A 5D1XD 3TIDA 1FIEA 2ORBL 3C2AH 2DQJL 5DURB 1OP9A 4Z5RB 4I8DA 5C3LD 2K7QA 1NCWL 3L7EB 5KSVA 5I75B 1XGRA 5BMFH 1FL5A 2D03L 5SWQA 2I07B 2VISA 4L9LC 1G7IA 2R2HA 5F1IA 3CUPB 1DANU 2Y5TA 4I5BB 4TQEH 1I1FB 2WANA 4NKIH 1T0NB 1JPGB 5EC1A 4ERSL 4M8QA 2L0DA 2E7LA 1F45A 1KELH 1S7TA 3JVGA 4EJ1C 4JJ5A 4Y2OA 1Z6JT 2YRPA 2X10A 1JJUA 3S8WA 1OAYL 1P69B 5CJXC 3VWKD 4RZCA 3TBVA 5DD6A 2VLKE 5E2VH 1BFVH 5C9JB 1QBMH 5C2BH 4NPYA 3FOMB 3QCTL 4ONHA 4MA8L 4LOUC 1MIMH 4OLEA 3TWCH 5D6CB 2ERJB 5J4MA 5ESAB 3T0AA 3K8KA 4DAGL 4M6AA 5D2LE 4X8XA 3RJDA 5KW9L 1OGAD 5EU3A 3X12B 3BGMA 1QR1B 4RWHA 4FQHA 1QSFD 4UIKL 3BW9B 2D7TL 3KPSD 4K3DH 1I4FB 4XAKE 4JQIL 1U8HA 4P0DA 5DVOA 1OP3H 1A6TB 2C1PA 3MJ9L 4PJ8C 2J3SA 1X44A 3AM8C 4QRRB 1C5DA 4P9HC 4G42B 1RZJC 2X9WA 4NQCA 3SCMD 4I77L 3QPQC 4DN3L 5MEPB 3NACH 3JWNC 4KUZL 1A4KB 2AXFB 3U9PH 3NTCL 5T5NG 3PF2A 3MMEA 3U2SB 3PWPD 2V5RA 4I0PD 4KTEL 4LVNC 5EPMB 5TQ2L 4WJ5A 1SBBA 5FGSA 3U1SL 2Z91B 1NBZB 2DYPD 5F6IB 3WXWL 3MRGA 5TE4H 3GIVB 1LO4L 2DDQL 3WL9A 1KJMA 3UMTA 2CO7B 5CHNB 1YEDB 2R1YA 4MA7H 3LEXB 3OPZH 4DVBB 4FFZH 4OGZA 4CDHA 2Z92A 2YPLB 2GK2A 4YQXH 2BFVL 3U7AA 4XC1H 1BZ7A 1IQWH 3MV9E 4DZ8A 5IW1A 2UYLA 2IC2A 3QDME 3UTTB 2VKWA 3BEVB 1FZOA 3KPMA 4ONFH 4QNPF 4POYA 3D69B 5DO2C 2XZAL 2GEEA 3SDXF 3AS2A 2ZCLH 1P4LB 2P7TB 2OMNA 2AJSL 5C0NC 1SBSL 3MQIA 1Y0LA 5HDLA 1TDQA 2FDBP 1JGEB 1MJ7L 1IT9L 4P3CH 2CLRB 1PKQB 4OI8A 3KPLA 4MQ7A 5CEXB 1D5BB 5C8JB 1KEML 3GMMB 1U2CA 4KZEL 4U1LB 2ATKA 5IVNA 4ZS7H 1ITCA 5BVPL 3MUGB 4LIQE 1RFDH 5I8OL 1T89A 4G9DA 4OTXL 2X1PA 4XB7A 1FL3A 5KSBE 4LPWA 1N0XH 3BMWA 3I2CL 1L0QA 2P5WB 1IE5A 1UKTA 2IBGA 1GGUA 5FHBH 2YPKB 4X6CF 5SX4I 1FIGL 2J88L 4PJHA 1B3JA 3CZFA 2KKQA 5IB1B 4LSUL 3X3GL 4MJ2A 3D18A 3IYLW 3MLZH 4LNRA 4PLKD 4M3JA 5D2NA 1FFNB 2FD6H 4O5LL 3S4SB 3RIAF 3WO3B 5SWSE 4RFNB 4CU8A 2LU3A 1RJYB 4XVUD 4MB3A 3BIBX 1CBVL 1KPUA 1INDL 2BNRA 1UWGH 4P2QA 1J0HA 3UYOD 1Q9KB 4OCWH 3GSWA 1RUPH 1NC2A 4UQ3B 2AJ3B 3QUXC 3DV6B 4P5TA 4R97C 3EO9L 2NY5C 3WFHA 3MCLH 3RWJB 4PV8B 1HDMA 3G6DL 1ES0B 4P46A 5FF6A 1A9EA 3LRHA 3A67H 3QWOB 2RJMA 3P9MA 1D5XB 3ULVD 1S9VB 3MNWA 2B0SH 3NA9L 4X9GA 3RIAK 4XNUH 1HSBB 1HINH 4YHMH 4AIOA 1CGWA 2PCPB 4HGWB 3MA7A 4PJ7F 2X9YA 4NHCH 1RZIB 1ZHNA 3V5KB 1SY6A 5FB8A 1U8QB 1F4XL 5IFHL 3DRTA 5E56A 3ZZ1A 3D85A 4GXUM 1SY6H 4ZOAA 5I17B 3IDNB 3E8UH 5I19L 1U6AH 1LHZA 1N5YL 1GIGH 3ZKSD 2EDDA 4XPFH 5GS2D 5E2JA 4QOKA 3QG6A 4ORGB 5T5FH 5DA4A 4JDZA 4MZ2A 4L3AA 5DJAA 1KJ3H 1TQBC 2PW2B 2VLJE 4FS0A 4QHMA 3VFMB 2Y07L 5AZEH 3ARYA 1LEGA 4U1MA 2AXGB 4OLYL 2D7OA 4RGOL 1KV3A 3HB3D 4ELKB 3IDJB 2G75A 2ZJSH 3HPLA 2LQRA 2BNQE 1RI8A 4JZJB 1NLBH 4N8VB 4HWUA 4D9QE 3EFFB 1FLTX 5F6HJ 1J8HB 5I1IH 3UJTL 3O45A 3UDWC 1NDGB 4QRPA 5HDQL 2QKIA 1JPST 2FB4L 5DRNB 1MFDH 4MWFB 4KTDH 2YD5A 3D48R 4OLVH 4YPGA 5CBEB 4D0CA 1SEBA 3NGBB 2EH8H 3PHQB 2P24A 1INEL 2A1WL 4JFFA 2GTWB 2R1XA 4UOW0 3CC5B 4N8CL 4HS6A 3GMRA 4F58H 1CDCA 1S3KH 5DT1H 3QIWC 2NY3D 3RVVD 5ICZB 5AUMB 1I3RB 4TUOA 4KUCD 3RU8H 1M05A 2BNRD 2J8UA 3C5SB 5JR1H 4KKCD 5IESL 4P2QD 3N9GH 1YPZF 4OLUH 4CVWA 3BZEA 4MJ4A 3BZDA 4H0IA 4IRZH 3PWLA 4UNTA 1NC2D 1NGXB 2Q3ZA 3KR3L 2R9HC 1OSPH 2LVEA 3MV7B 4P5TD 2AQ1A 3THMH 3CDGB 4P3DA 2NLJB 3QDJA 4KRNA 2HFTA 3AREB 4P46D 3CGTA 3PWVA 1NBYB 4ODWA 4KDVA 5GRYA 3TBSA 4IOFC 3UTPD 3UPAA 2W65A 4RA0C 2A6KB 4JKPL 2X4TB 4BSWB 3UEZA 2ZG3A 4ZQKB 4LSSL 3EOTL 1GL4B 1KNOB 3T2PA 4K3EL 5I76B 2P42B 3B3IA 1CE1H 3EJZC 4PJIF 4ZPVA 3DSFH 5ESQA 5C7XL 1RJLB 4NC1C 1EZVY 3P3YA 1FGVH 4NQCE 3D85D 5FA3B 1ZWIB 4C56A 1MAML 2FJGA 2GT9A 3MRCB 5ICXA 4CDGC 1QHPA 5EA0H 1ZGLA 1ULVA 3MZGB 3QWQB 1EDQA 4LQFL 5E70A 3MXVL 4BUGA 1KJVA 5EC2A 3FT3A 1JIBA 1N8ZB 1AXSB 2Q8BH 3DIFB 2EICA 1B4JH 3MGOB 1CFSB 2ZSVA 3OAUH 4PB9L 2A6JA 2Y72A 1AGFA 3DV4B 2VKXA 3QIUC 4K71C 3EZ8A 1JZ7A 3FO2B 2JB5H 5JXAH 1KOAA 2ZWLT 3UJJH 1ETZA 3HMWL 3QISA 4Q2ZA 3PJSA 2MHAA 1J86A 1KJ2A 4MS8D 5C71A 1R5WB 2JELH 2HKFH 2GW5A 1SEQH 1BP3B 3TNMA 4K9EL 1KJ2H 3HC4L 4JHAH 1MLCA 2H8PA 3FO1B 2YUZA 1YY9C 2QADC 5F9OL 5HPOA 5L88H 4EI6A 1CDGA 5EZOH 3T4AA 3A6OA 1MQ8A 3BP6A 3GFUA 1V3LA 1B2WL 4WWKB 1KXVC 3U0WL 2P5ED 4JY6B 1YNTB 1GSMA 3BIKA 5AZ2H 3SDDB 3UC0L 5K9KA 5HYIA 4NZUL 4WGVB 3BWAA 3LV3B 3SGKA 5JW4Q 4XBGA 5IB3B 5IJKA 2VDPH 2R0ZL 4LLQA 3UBXI 3QXDA 3KGRA 4DGIH 5EORL 4JFFD 3P0VH 4MB5A 1FQ9C 3WLBB 3ULUF 3S34H 4Z95L 5FM5O 1UJTA 2UWEA 5T3ZL 1HQRB 1HNFA 3O8XD 2DI9A 1T2QH 3HS0A 3OX8B 1B90A 4JQXA 2I27N 1T03H 2YN5A 2JJSA 3T0WA 4JM2C 1BQSA 2Z0BA 4KJQC 4GXUN 3S9DB 1EHLH 2WWMC 3SDCB 1S9KC 2Q7YB 3QFDB 1IZKA 1TZIB 3L5XL 4L8CB 2RCSL 4U1JB 4U1IA 4PB0L 2B5IC 1X5AA 3QDJD 1A6AB 5HHVH 1A2YA 3LEVH 1ZOXA 4XWOD 3UROR 1NGQL 4OT1L 4JGJA 4JB9H 4KDTC 2M1KA 1G6RL 2HAZA 1IGTA 3SQOL 5DVNA 1KEGL 5F8RC 4HCRA 1MCNA 4RISH 5IIEA 2Q3AA 4HCRH 1AH1A 4GUPA 4L9LB 5D2NE 3BSZL 4P49A 4HJ0C 3VRJA 4UV7H 4HWZB 4WNQB 5A40E 1S7UB 3AS1A 5CFHA 1QPPA 4HUXB 2RIKA 1QVOA 4FQQA 1QSVA 1WWBX 1CDHA 4S1DD 4G3YH 4G9FA 4ZXBC 3CX5J 3SDYL 2IADB 4TPRH 4HIIB 1FE8H 4OCRL 1C1EL 4WY7H 4J6RL 4YXKH 1FAIH 1GOHA 4JFDD 4UIMB 3EKCA 1F13A 3C08H 5DD5H 3MCKA 4P9HL 2FX7H 5EU5B 1RZJL 1YEGH 2VDOH 5HDBE 3ZDZF 5MEOA 2AI0L 2FSEB 5C0GA 4R4ND 5D5MF 5B38A 1GGBH 3RVUD 4JFEE 4RGND 3QDGD 3QIBD 2YD3A 5EU4A 4PRDB 4AZ8A 4NO0B 3I6LE 1MH5A 1PG7X 15C8L 4OGAC 3REWA 3MRLA 4NCC2 1OQXA 3ILPA 2F9BT 1UACH 1M71A 1HE7A 3IDGB 4Z7UB 5DD0L 4M1DH 2D31B 3MLSL 3B2UC 3C87A 3WKML 3DNKA 4HZLB 1MCCA 4Y4KC 5KSAB 4GRLA 3TCLB 4TOYL 1H0DB 4QXUH 1BQLH 1UEYA 3PUCA 3T04D 2XACC 4XH2B 3FFCA 5FYJH 1MCOL 2AABH 4YX2L 2EO9A 3BQUC 1DLHA 1U42A 3KVQA 3FQUA 4QOKE 4WV1B 5FGCE 4LASH 4HS8L 5GGTA 1HILB 1H15A 5IWLA 3STBA 1J9CT 4MA1C 3QI9C 3V95A 3SDAA 2EXYD 5LXGL 3FMGL 3IAGC 3EZJB 2YRZA 3TH3T 4ENEC 4QXTA 1PZUB 5E5RB 4F37F 3MR9A 2WP3O 1OOAA 1F90L