1DC2A

Solution nmr structure of tumor suppressor p16ink4a, 20 structures
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
156
structure length
156
Chain Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 4 INHIBITOR A (P16INK4A)
publication title Tumor suppressor INK4: refinement of p16INK4A structure and determination of p15INK4B structure by comparative modeling and NMR data.
pubmed rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 25
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1999-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1dc2A00
2VGEA 4U8YD 2ETCA 1D9SA 5KNGA 4DX1A 1WG0A 1YCSB 4BEPA 4BESA 4ZHBA 1K3ZD 2NYJA 4ZFHA 2DZNA 3EHRA 2DZOA 3JXIA 1TR4A 4OAUC 3UI2A 1BI7B 2PNNA 3TWSA 2FO1E 4U8VD 1IHBA 2A5EA 4QFVA 3DEOA 4JB8P 2ZGGA 2Y0BG 3ZNGA 3T8KA 2QYJA 3ZUVB 5KNHD 5AQBA 3JUEA 1BD8A 2KXPC 2V5QC 5BXUA 3T9KA 4O60A 3TWQA 2HE0A 4DX7D 4DUIA 2P2CP 5CEDB 4G8LA 2QC9A 5EYPF 5HS0A 4A63B 1G3NB 1N0RA 1QYMA 3Q9UC 4CZ2D 4RLYA 4U96D 2XEHA 2Y1LE 3J5PA 3TWUA 4CYMD 4O1PA 3KEAA 4ATZD 1MX4A 1BI8B 2J8SD 1N11A 5D66A 4K5CA 1OY3D 3AJIA 4HB5A 4BETA 1N0QA 1MJ0A 5ENSD 1SVXA 4Z68A 4C48B 4UUCA 4GMRA 2B0OE 3SO8A 3TWVA 5CBOA 2BKGA 3TWXA 4OAVB 1SW6A 3AAAC 4HNAD 2L6BA 4LSZE 2ZGDA 5EN5D 1IKND 3J5QB 4N5QA 3W9FA 1K1BA 2XENA 3D9HA 4QQIA 1MX6A 5BXOA 2ETBA 5ENPD 5HKPA 3TWTA 5ENTD 4J8YA 1S70B 1BU9A 3HG0D 5EIBE 5JA4D 3W9GA 4U95D 2XEEA 5JMND 4DX5D 2RFAA 5AQ7A 3HRAA 5EILA 3C5RA 2RFMA 5ENRD 5ENQD 4B93B 2V4HC 2BKKB 3NOCD 4K5BA 5EIDA 5CECB 1OT8A 1IXVA 3V79K 1WDYA 2DVWA 3JXJA 3Q9NC 4O1OA 5FINA 3V30A 3V2XA 1A5EA 3F6QA 4YDWA 2F37A 5HRYA 5CEAA 4G8KA 4HRLA 5CBNA 3ZU7B 5CERB 1AWCB 3V2OA 1MYOA 3TWRA 4J7WA 3ZKJA 3TWWA 2F8XK 2DWZA 2AJAA 5AQ9A 5EYLA 4HI9A 4TUMA 1MX2A 5AARA 5AN8A 4LG6A 4NIKA 3EHQA 1NFIE 4HI8A 5ENOD 5AQAA 3UTMA 2KBXA 4HBDA 5KWDA 1DC2A 2JABA 2MYOA 4DX2A 3B95A 3NOGD 2XZTG 3UXGA 4F6RD 4BSZB 5FIOA 3NBNB 3LJNA 5ITZF 1AP7A 2XZDG 5AAOA 4YDYA 1YMPA 4GPMA 4HRNA 1UOHA 3DEPA 5KBAA 3V31A 4HQDA 1K1AA 3B7BA 4HRMB 4BERA 1BLXB 2ETAA 4DX6D 4LNUD 4K5AB 1YYHA 3EU9A 1DCQA 4DRXE 2F8YA 4HLLA 3IXEA 4F1PA
chains in the Genus database with same CATH superfamily
5G2NA 4L2YA 3T5VA 2BTDA 1OWPA 3L6AA 4U8VD 3I4GA 1E8WA 2ZGGA 1D8DA 2QYJA 3CV0A 3PE4A 2VJ8A 1H19A 2P9SG 3PREA 3UM0A 4DUIA 2QC9A 3BQOA 2FULA 1IQRA 2XEHA 3R9MA 4XIFA 1Z3XA 2J8SD 2BUGA 4JZYA 3EDTB 2YINA 4I6JA 3OXGA 4Z68A 3T5XA 1S64A 1HH8A 2J07A 3TWXA 1LF8A 5G05C 2WVIA 2OVFA 3CVVA 3C3QA 3D9HA 1FCHA 2ETBA 3TL5A 5ENTD 1DVPA 3FUKA 3Q73A 1N4SA 5EILA 5B1BE 2LAHA 4HOTA 2E0IA 4OVUA 1H6PA 2X6KA 3CHRA 1H2UA 4HRLA 4DLQA 3PZ2A 2B6CA 1TN7A 1TJFA 1NZNA 3DSVA 4Y6CA 3UPVA 5AQAA 1EF1C 2KBXA 3ZRHA 3EJNA 4EHMA 2EIME 3D9PA 2VSYA 2KZTB 2UY1A 1N52A 4ANXA 5BT1A 3ONKA 2DCPA 4CT4A 1YCSB 2AXZA 2WQ7A 2J4DA 5BNWA 3FY4A 1IHBA 4B94A 3RO3A 2HE0A 2WXKA 5CEDB 3Q5MA 1OCCE 1G3NB 3LS8A 1QZ2A 3UIOC 3TWUA 2EIKE 2NSZA 3TXNA 3D9KA 5BUZA 4GU5A 3FTSA 3FUEA 4XX5A 2FEZA 4UUCA 4UQZA 3SO8A 4GZ3A 3PZ3A 4LUNU 1SW6A 5ENNA 4LSZE 4CDRA 2XGOA 5BV0A 3CHMA 5ENPD 2IFUA 2KCKA 4U0SA 3WG7E 3UQ3A 3U3WA 5EIDA 2P9LG 3U4TA 3KSLA 5FINA 4TUUA 4ME2A 4GCOA 3CVUA 1KT1A 4ILIA 3CQCB 4GTRA 3CKBA 4UQYA 3FTWA 1O1TA 4DPRA 1NFIE 4HBDA 1Q2ZA 1TYQG 3ML8A 2WXLA 4A55A 5KBAA 4AV7A 3D9MA 4AY5A 4XEIG 3CVQA 2XPYA 2OEWA 4KBQA 1SZ9A 3CGHA 4K0RA 4JHKA 1WG0A 1N4RA 3IV0A 3Q15A 1SZAA 2XEVA 2ILRA 1U2VG 4PS3A 3FULA 1OXJA 2LSVA 4F7AA 3JUEA 5J08A 5LCWJ 3LY9A 4APOA 4NACA 3SBTB 3U64A 2YNQA 1E8ZA 4CCAA 5A7DB 4GYYA 4PS8A 2I1JA 1HF8A 4HNAD 4CGVA 3OXFA 2P9KG 4J8DA 3G2VA 3UM2A 4A1SA 4IYPA 4K5BA 5FWQA 4V3IA 2WXMA 4O1OA 1UW4B 3SF4A 3RAUA 4H7XA 4RG9A 5G04J 2ZIRA 3LPZA 4N3BA 1JCSA 4K03A 3G2SA 1SA5A 4HI9A 4TUMA 2WM9A 4JHJA 3BG1B 3LYAA 4GTQA 2VGXB 3TG5A 2Q7FA 1JWFA 3NQPA 1V55E 4HRNA 3AU4A 3ASOE 3G2WA 1HXIA 3MKQA 3B7BA 4J6IA 2FI7A 4MKTA 4U0UA 5FQ6A 1YYHA 3LY7A 1YA0A 3FU3A 2J09A 3DSXA 4BESA 2WXIA 4I9EA 3JXIA 1H0AA 2A5EA 3PVLA 3QDNA 2X6IA 1LD7A 3G2TA 2PQRA 3VTYA 4O60A 2XGMA 4DX7D 1X5BA 2BF0X 5HS0A 2OVBA 1N0RA 3J5PA 3RKVA 4BY6A 3NAWA 2Y4UA 1HG2A 1N11A 2PL2A 4Q94A 3EIQC 5JJTA 4B8AA 4WNEA 3ZHEB 1B89A 4JXTA 4CDMA 3CVXA 1E7UA 4N5QA 3PEUB 2XENA 2LAIA 2WMNA 4L7TA 5FZRA 4HVBA 1OT8A 3V30A 3TG4A 3AS8A 4JD2G 2RKKA 3JQ1A 3FUHA 3Q4AB 4BX9A 3UT4A 2F8XK 5CRUA 2AJAA 3OAWA 4AOFA 4MS6A 5G04C 5KCMA 1DC2A 2JABA 3AG3E 4DX2A 3FUDA 1QBQA 2XZTG 4BTBA 3ENEA 4HRMB 4E85A 2DIWA 4AXHA 4K5AB 3QKYA 1ELKA 1UJJA 2Y4TA 1K3ZD 1V54E 2DZOA 1O1SA 2X6HA 2EQXA 4GA1A 3DXKG 3RRNB 3HXEA 4LNBA 3TWQA 4GYOA 2GW1A 2R59A 1NA0A 4FC8A 4U96D 3AS5A 2Y1LE 3QC1A 4J8FA 3TXMA 4RSYA 3PZ4A 2XGSA 2LSUA 5HI7A 4MRUA 1ZB1A 4EBAA 2FO7A 4DK5A 4L9PA 3T8MA 3FUNA 5E75A 3J5QB 4YNDA 2R02A 2A4ZA 3KAEA 5H7PA 1JWGA 3MCXA 3FDHA 2WXOA 3C5RA 5ARGA 4I9CA 2BKKB 4HXIA 2FF4A 3JXJA 2JLBA 3CHPA 4R7LA 2V4LA 2QFCA 4KXKB 4AY6A 4BSXA 3R9AB 4G25A 5FZQA 3RK6A 3NBNB 3E32A 3FTXA 2CHWA 2BEDA 1N94A 3EU9A 1HS6A 4ACKA 4U8YD 3IHVA 4BEPA 1Y8MA 3CSTA 2FO1E 2VQ2A 3PZ1A 3TGOA 3QWPA 3DEOA 4A1GA 3ASHA 5FTPA 2J9QA 5KNHD 3FH5A 2L0TB 3N71A 5ARFA 2KXPC 3UT7A 3CQGB 1TNBA 2CFUA 4AIFA 4A63B 3HVEB 2C0LA 3FH8A 4RLYA 4CYMD 4O1PA 2AXUA 4ATZD 1BI8B 3IKOB 1OY3D 2IEJA 4W9RA 4ANWA 5CRVA 3KD7A 3DSUA 3LCAA 2H6HA 3UMVA 4FA6A 1MQSA 3BUAA 1OUVA 4N3AA 1TNYA 2MHKA 1N95A 4IULA 3CK8A 2R5SA 3HIZA 5HKPA 4WWOA 2MRIA 4I2ZA 5CHEE 5J90A 4GTOA 1IXVA 1WDYA 3PNLB 2I1KA 2IO3C 4GTMA 3KS2A 3NF1A 4JA7A 3QNKA 4NIKA 4HI8A 5DBKA 4M3OA 3VLDA 2CG3A 4JL0A 4X8QA 2XZDG 2F8YA 1ELWA 1FVFA 2CFZA 3PE3A 4I6GA 4CEMA 5KNGA 3EHRA 5DIZA 2PNNA 3SD5A 4UWKA 2IY0C 1N4PA 2WXPA 2P2CP 3QWVA 1N4QA 2AWIA 4UWFA 4D10C 4KZCA 5D66A 4LERA 4XI0A 3FU0A 4I6EA 3D9OA 4G23A 3FHEA 1PY1A 2L9BA 2XPZA 3PUJA 2CHZA 1MX6A 3Q7AA 4N3CA 4FLBA 2LXMA 2RFAA 3UKUG 3HRAA 2RFMA 4HOSA 3HDXA 2V4HC 3NOCD 4UQXA 3ABKE 1QQEA 3SBSA 5A23A 2P9NG 1IYGA 4HOUA 4ANUA 2UY1B 3L22A 1TNOA 1MYOA 1E7VA 4DLOA 5HQ8A 4N2SA 4WWPA 3UTMA 4RVBA 2IQCA 2VTBA 4GTTA 1UOHA 3VLFA 3FU6A 3V31A 3X2QE 4DRXE 3RSEG 5D2MC 4WNGA 1D9SA 1TN6A 3MJWA 5BW8C 3LDZA 2GRPB 3LY8A 4EQFA 2XRZA 4XKBA 2PQNA 1MHQA 2IO2C 3RRMB 3O48A 5EYPF 3PS6A 4IRUA 5G55A 4AJWA 4EBAG 3CVWA 3CLJA 1OWMA 1FVHA 3APDA 4C9BB 3FP3A 4U07A 5KJNA 3GZ1A 1JPLA 3Q47B 1SVXA 1U3DA 4EPZA 1FPPA 4ANVA 2B0OE 3TWVA 4NQ0A 1KT0A 3SFXA 2HM8A 4I1OB 1E8YA 2NXPA 4UWLA 5FJYA 4J8YA 1S70B 3FUJA 3CHOA 3FUFA 3ZFWA 3W9GA 5JMND 2PM7A 4XE0A 4BTAA 3AS4A 4F3VA 4C0EA 4B93B 5JJ7A 2R2LA 4B0ZA 1TEZA 3F6QA 2WXHA 3FTZA 5CEAA 4WUYA 3ZU7B 4Y6WA 1S63A 1OWLA 4GYWA 1LD8A 2J4BA 4G2VA 2VSOE 2IF4A 3HXCA 4GTSA 5AQ9A 5AARA 3ZPJA 5JHAA 3D9NA 2MYOA 3B13A 3CEQA 4ATGA 4BFRA 3ASGA 4BSZB 4TXQA 1O5MA 1VDYA 2V8SE 3WXXA 4JVSA 2KC7A 3LVRE 4E6HA 2ETAA 2XS1A 2EIJE 2IOLA 4ACLA 1ZU2A 3ABLE 1DNPA 4ZFHA 3L82A 1K8KG 5B1AE 3TJPA 3EU5A 3SI5A 3SY2A 3ZUVB 4FU3A 2OCCE 4MLPA 2V5QC 5AJDA 3Q9UC 3S7JA 5BPPA 2GRMA 2J49A 4GA2A 2OOEA 4WWNA 3Q78A 3QWWA 4K5CA 3AJIA 1FT1A 1NP7A 4HS2A 4GMRA 4AEZC 4I2WA 4GZ6A 3UM1A 5ANRA 4G1TA 2EINE 3FUIA 3RU0A 3S2AA 4JPSA 3D3MA 3ZXPA 3ULQA 5LCWC 2QY7A 4GZDA 3MKQB 4H7YA 1AWCB 1NL4A 3V2OA 5CCMA 4OYSA 1IHGA 3PNTB 4LRZA 3EHMA 2F0YA 4OVVA 4FLHA 2XS8A 4A3VA 5FIOA 4GZCA 1AP7A 3CK7A 4TRQA 4AVXA 3MV3B 4UI9K 4IN3B 4ABNA 2R17C 2GRQB 3E37A 4J7WA 1UN9A 4C0MA 3U9WA 4GPKA 4ILHB 4AM9A 1EDUA 2Y0BG 2EILE 3GZSA 3CHSA 3ZN3A 1P5QA 3LEWA 4NRHB 1HG5A 3P1UA 2YQ8A 1RZ4A 3ZEFA 4APFA 1WM5A 4BETA 4HB5A 3HYMB 4KVOA 3QK0A 5KJLA 4JA9A 3ONLA 4P29A 2QYUA 3E30A 1HO8A 3AAAC 3ZYKA 2L6BA 5C2YA 2IU1A 3W9FA 3ZYQA 1BU9A 5CMWA 5CMYA 5AQ7A 4UI9J 3QAQA 2E2EA 4N39A 1HFAA 1SQMA 3V2XA 3GZ2A 3ABME 1UJKA 3UUXA 3CK9A 1Z3YA 3RIBA 1H6OA 2DWZA 2KATA 4RQIA 5AN8A 2VGYA 5KWDA 1BPOA 2L0IA 3PDNA 4KT6B 3L16A 4F6RD 2V0PA 5D0OD 1K1AA 4BERA 2L6JA 3I3NA 4F1PA 4HLEA 4DX1A 4ZHBA 3UIPC 3MX3A 3QB2A 5G05J 4GAAA 3BG0B 4AP2A 3UI2A 1BI7B 3DPYA 3MA5A 1JUQA 3DSSA 1E8XA 1X81A 5BXUA 2J08A 4FADA 1H6KA 4XKCA 4CZ2D 1HE8A 1OWOA 4YDEA 1EYHA 1MX4A 2WXNA 3R7RA 3UX4A 3QJZA 3B7UX 4BT8A 3FU5A 3IHYA 3VLEA 3O4ZA 3SFYA 3BU8A 3B7RL 2PM6A 5BXOA 2XHEA 3TAXA 5ENQD 2WXRA 3I5PA 3IEGA 3Q9NC 4TXPA 2XCBA 5CERB 3C3OA 3ASDA 4UI9C 4FJZA 2R03A 3Q7FA 3LKUA 1UG3A 4JW1A 1TJCA 5FQ8A 3L54A 4CRWA 3EHNA 1N9AA 3ASFA 3SGHA 2X3MA 2WXJA 4JHRA 4O6FA 2XCCA 3U66A 4DX6D 2KCVA 2OEVA 4PH4B 3CR3A 3C72A 3CVNA 4L1BA 3IXEA 2ETCA 3L13A 2WQHA 4WNFA 1TN8A 2P58C 4JEHA 3C98A 1KZPA 1IQUA 4PDXA 1OCOE 2MOWA 5B3SE 4G8LA 3DSTA 4Q96A 3SNXA 4N2QA 3ESKA 2KZTA 2WXFA 3E4BA 3NZSA 2I9CA 3PUKA 1JCQA 1NA3A 3NZUA 4LCTA 5KJKA 4GMLA 4U0ZA 4C48B 3MV2B 4DI3A 2BKGA 1NI1A 2ZGDA 3CIAA 3E33A 3DPDA 5EIBE 4HOQA 1Y6IA 5ENRD 3L9TA 5CECB 4KMOA 1S0PA 1H2TC 3TWRA 1QNFA 3G2UA 4F1SA 5EYLA 3OXLA 4I1AA 5LP0A 5D0QD 2IOSA 1N54A 1JCRA 5FZSA 3NOGD 3UXGA 2FBNA 3CVPA 2GRLA 3LJNA 5ITZF 4J8SA 4FJYA 1HX8A 3HXBA 3PEVB 4HQDA 3AG4E 1DCEA 3AG1E 4TXRA 4XI9A 1PAQA 3Q75A 4GZ5A 2RG8A 1GW6A 5T4YA 1SA4A 2YHEA 3URZA 5LOZA 2NYJA 2WB2A 2P9UG 2LNIA 1TR4A 4OAUC 5T3RA 1OCZE 4HFGA 3MYVA 4EZLA 4F53A 1W3BA 4GCNA 1BD8A 1E90A 2X6JA 3T9KA 5E76A 3AU5A 3PZDA 5A6CA 3JQ0A 2ZU6B 1U3CA 2XPIA 3K9IA 3JUIA 3FEYA 3KSQA 1INZA 3MGBA 3LXUX 5EDSA 2KM4A 3CVLA 4WNDA 3VTXA 3P2BA 2M63A 4A3TA 2XEEA 2WQ6A 4DX5D 3SZ7A 2VTBB 3V79K 2R05A 2YHCA 2DVWA 4UWHA 3LVQE 1OWNA 4YDWA 5T8IA 3GYZA 3DRAA 5CBNA 1D8EA 3D9JA 4LEUA 3ZKJA 2ZISA 3CVYA 4GB9A 3ZGQA 2H6FA 1MX2A 4L2LA 1HU3A 4G24A 3FFLA 5BV1A 3EUVA 3KEZA 4KYOB 3EIJA 4YDYA 5EKQD 4GTPA 3LJ3A 3SFZA 3FEXA 2HR2A 3RRUA 2I6HA 3ISMC 4LNGA 5AYWD 4BWRA 2I2OA 2VSNA 1RW2A 5FT9A 3TWSA 3ASNE 2VGXA 3DXMG 3L08A 4UWGA 5ANLA 2IONA 3UM3A 3ZNGA 2XQ0A 3T8KA 5LFAA 5AQBA 4L23A 1L5JA 1EPUA 4U63A 3FWVA 3ULYA 2X38A 4URKA 4YVQC 2OV8A 2UWJG 3KEAA 5FQ4A 3GW4A 3PRZA 5ENSD 3L17A 4EZJA 5CBOA 4XZ4A 4B89A 4YDOA 4PUCA 3SQVA 1IKND 4QQIA 4ILGA 1WAO1 3SHFA 4EZKA 5JA4D 3CSFA 5AENA 1E96B 3FTVA 4TV3A 4G11A 2WXQA 4CDNA 4CT0A 4G8KA 4G26A 3ZHEA 3ULEG 1UN8A 3HHMA 3DBSA 3CKCA 1XNFA 3UINC 3I4RB 3EHQA 2A5UA 5C1DA 3MEKA 3B7TA 3CHQA 3ZXSA 5EX3A 2VYIA 4U04A 5CCLA 2HO1A 3FTUA 4GPMA 1MZCA 3QARA 4PS7A 3RJVA 1BLXB 4LNUD 1Z5SC 3S7FA 2GRNB 3QOUA 5JHBA 4WAFA 4FULA 3FH7A 3BEEA 2DZNA 4U8HA 4U7EB 3MKRA 1FT2A 5AJLA 4J8EA 4JB8P 2IJGX 4NURA 4BX8A 3UKRG 1WY6A 2VSXE 4YVOA 1H2VC 3Q79A 2AW6A 2KCLA 3Q49B 5LX8A 1TNUA 3APFA 2V5FA 1MJ0A 1N0QA 4GTVA 3S7DA 2H6IA 1KLXA 4N5CA 3FTYA 4RG6A 4OAVB 1Z6TA 1K1BA 2Y3AA 3DSWA 4KZ0A 3R7QA 3TWTA 3S7BA 5IY5E 3HG0D 3HXDA 4J0UA 4U95D 1PC2A 2PZIA 4DJAA 3FUMA 2P9PG 4MBGA 4B8CB 2CG2A 2WMOA 1A5EA 2P9IG 1XGWA 2GROB 1O1RA 4CGWA 2DYRE 1A17A 4DI4A 4I1MA 5FQ7A 2Y69E 4EECA 4FHJA 3PH0C 3ESLA 5AAOA 3DEPA 3OTNA 3JYSA 2AVPA 4M7CA 1DCQA 4I17A 2VGEA 1OCRE 3ZYMA 4QFVA 4GMJA 3DWLG 4JC8A 1ELRA 2X6FA 2H6GA 5EX0A 2LO6A 1KPSB 2WXGA 3E34A 3D9IA 3ZW3A 3D9LA 1KZOA 5AIJA 1QYMA 5JJ6A 3ZIMA 3ML9A 4FHKA 1TNZA 2XRYA 3MZLB 4HORA 3HXFA 2HYZA 2ZXWE 3AG2E 3UT8A 5EN5D 4BT9A 2GRRB 2NC9A 3JCKC 3HVEA 4FP7A 2CHXA 1HZ4A 2LUHA 3RO2A 4GA0A 3APCA 3B7SA 2LXLA 5M72A 2C0MA 2AXVA 1ZBPA 2F37A 5HRYA 2GGFA 3NB2A 2C2LA 3ZVVA 4I43A 2RD0A 4Q69A 3TWWA 3ZYLA 1LTXA 2DYSE 2WPVA 4LG6A 5ENOD 2JEKA 3C3RA 3B95A 2DBAA 1YMPA 2QZAA 2ONDA 4KVMA 4JEUA 5KJMA 3IBEA 4HLLA
chains in the Genus database with same CATH topology
2VGEA 4U8YD 2ETCA 1D9SA 5KNGA 4DX1A 1WG0A 1YCSB 4BEPA 4BESA 4ZHBA 1K3ZD 2NYJA 4ZFHA 2DZNA 3EHRA 2DZOA 3JXIA 1TR4A 4OAUC 3UI2A 1BI7B 2PNNA 3TWSA 2FO1E 4U8VD 1IHBA 2A5EA 4QFVA 3DEOA 4JB8P 2ZGGA 2Y0BG 3ZNGA 3T8KA 2QYJA 3ZUVB 5KNHD 5AQBA 3JUEA 1BD8A 2KXPC 2V5QC 5BXUA 3T9KA 4O60A 3TWQA 2HE0A 4DX7D 4DUIA 2P2CP 5CEDB 4G8LA 2QC9A 5EYPF 5HS0A 4A63B 1G3NB 1N0RA 1QYMA 3Q9UC 4CZ2D 4RLYA 4U96D 2XEHA 2Y1LE 3J5PA 3TWUA 4CYMD 4O1PA 3KEAA 4ATZD 1MX4A 1BI8B 2J8SD 1N11A 5D66A 4K5CA 1OY3D 3AJIA 4HB5A 4BETA 1N0QA 1MJ0A 5ENSD 1SVXA 4Z68A 4C48B 4UUCA 4GMRA 2B0OE 3SO8A 3TWVA 5CBOA 2BKGA 3TWXA 4OAVB 1SW6A 3AAAC 4HNAD 2L6BA 4LSZE 2ZGDA 5EN5D 1IKND 3J5QB 4N5QA 3W9FA 1K1BA 2XENA 3D9HA 4QQIA 1MX6A 5BXOA 2ETBA 5ENPD 5HKPA 3TWTA 5ENTD 4J8YA 1S70B 1BU9A 3HG0D 5EIBE 5JA4D 3W9GA 4U95D 2XEEA 5JMND 4DX5D 2RFAA 5AQ7A 3HRAA 5EILA 3C5RA 2RFMA 5ENRD 5ENQD 4B93B 2V4HC 2BKKB 3NOCD 4K5BA 5EIDA 5CECB 1OT8A 1IXVA 3V79K 1WDYA 2DVWA 3JXJA 3Q9NC 4O1OA 5FINA 3V30A 3V2XA 1A5EA 3F6QA 4YDWA 2F37A 5HRYA 5CEAA 4G8KA 4HRLA 5CBNA 3ZU7B 5CERB 1AWCB 3V2OA 1MYOA 3TWRA 4J7WA 3ZKJA 3TWWA 2F8XK 2DWZA 2AJAA 5AQ9A 5EYLA 4HI9A 4TUMA 1MX2A 5AARA 5AN8A 4LG6A 4NIKA 3EHQA 1NFIE 4HI8A 5ENOD 5AQAA 3UTMA 2KBXA 4HBDA 5KWDA 1DC2A 2JABA 2MYOA 4DX2A 3B95A 3NOGD 2XZTG 3UXGA 4F6RD 4BSZB 5FIOA 3NBNB 3LJNA 5ITZF 1AP7A 2XZDG 5AAOA 4YDYA 1YMPA 4GPMA 4HRNA 1UOHA 3DEPA 5KBAA 3V31A 4HQDA 1K1AA 3B7BA 4HRMB 4BERA 1BLXB 2ETAA 4DX6D 4LNUD 4K5AB 1YYHA 3EU9A 1DCQA 4DRXE 2F8YA 4HLLA 3IXEA 4F1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGE A;  4U8Y D;  2ETC A;  1D9S A;  5KNG A;  4DX1 A;  1WG0 A;  1YCS B;  4BEP A;  4BES A;  4ZHB A;  1K3Z D;  2NYJ A;  4ZFH A;  2DZN A;  3EHR A;  2DZO A;  3JXI A;  1TR4 A;  4OAU C;  3UI2 A;  1BI7 B;  2PNN A;  3TWS A;  2FO1 E;  4U8V D;  1IHB A;  2A5E A;  4QFV A;  3DEO A;  4JB8 P;  2ZGG A;  2Y0B G;  3ZNG A;  3T8K A;  2QYJ A;  3ZUV B;  5KNH D;  5AQB A;  3JUE A;  1BD8 A;  2KXP C;  2V5Q C;  5BXU A;  3T9K A;  4O60 A;  3TWQ A;  2HE0 A;  4DX7 D;  4DUI A;  2P2C P;  5CED B;  4G8L A;  2QC9 A;  5EYP F;  5HS0 A;  4A63 B;  1G3N B;  1N0R A;  1QYM A;  3Q9U C;  4CZ2 D;  4RLY A;  4U96 D;  2XEH A;  2Y1L E;  3J5P A;  3TWU A;  4CYM D;  4O1P A;  3KEA A;  4ATZ D;  1MX4 A;  1BI8 B;  2J8S D;  1N11 A;  5D66 A;  4K5C A;  1OY3 D;  3AJI A;  4HB5 A;  4BET A;  1N0Q A;  1MJ0 A;  5ENS D;  1SVX A;  4Z68 A;  4C48 B;  4UUC A;  4GMR A;  2B0O E;  3SO8 A;  3TWV A;  5CBO A;  2BKG A;  3TWX A;  4OAV B;  1SW6 A;  3AAA C;  4HNA D;  2L6B A;  4LSZ E;  2ZGD A;  5EN5 D;  1IKN D;  3J5Q B;  4N5Q A;  3W9F A;  1K1B A;  2XEN A;  3D9H A;  4QQI A;  1MX6 A;  5BXO A;  2ETB A;  5ENP D;  5HKP A;  3TWT A;  5ENT D;  4J8Y A;  1S70 B;  1BU9 A;  3HG0 D;  5EIB E;  5JA4 D;  3W9G A;  4U95 D;  2XEE A;  5JMN D;  4DX5 D;  2RFA A;  5AQ7 A;  3HRA A;  5EIL A;  3C5R A;  2RFM A;  5ENR D;  5ENQ D;  4B93 B;  2V4H C;  2BKK B;  3NOC D;  4K5B A;  5EID A;  5CEC B;  1OT8 A;  1IXV A;  3V79 K;  1WDY A;  2DVW A;  3JXJ A;  3Q9N C;  4O1O A;  5FIN A;  3V30 A;  3V2X A;  1A5E A;  3F6Q A;  4YDW A;  2F37 A;  5HRY A;  5CEA A;  4G8K A;  4HRL A;  5CBN A;  3ZU7 B;  5CER B;  1AWC B;  3V2O A;  1MYO A;  3TWR A;  4J7W A;  3ZKJ A;  3TWW A;  2F8X K;  2DWZ A;  2AJA A;  5AQ9 A;  5EYL A;  4HI9 A;  4TUM A;  1MX2 A;  5AAR A;  5AN8 A;  4LG6 A;  4NIK A;  3EHQ A;  1NFI E;  4HI8 A;  5ENO D;  5AQA A;  3UTM A;  2KBX A;  4HBD A;  5KWD A;  1DC2 A;  2JAB A;  2MYO A;  4DX2 A;  3B95 A;  3NOG D;  2XZT G;  3UXG A;  4F6R D;  4BSZ B;  5FIO A;  3NBN B;  3LJN A;  5ITZ F;  1AP7 A;  2XZD G;  5AAO A;  4YDY A;  1YMP A;  4GPM A;  4HRN A;  1UOH A;  3DEP A;  5KBA A;  3V31 A;  4HQD A;  1K1A A;  3B7B A;  4HRM B;  4BER A;  1BLX B;  2ETA A;  4DX6 D;  4LNU D;  4K5A B;  1YYH A;  3EU9 A;  1DCQ A;  4DRX E;  2F8Y A;  4HLL A;  3IXE A;  4F1P A; 
#chains in the Genus database with same CATH topology
 5G2N A;  4L2Y A;  3T5V A;  2BTD A;  1OWP A;  3L6A A;  4U8V D;  3I4G A;  1E8W A;  2ZGG A;  1D8D A;  2QYJ A;  3CV0 A;  3PE4 A;  2VJ8 A;  1H19 A;  2P9S G;  3PRE A;  3UM0 A;  4DUI A;  2QC9 A;  3BQO A;  2FUL A;  1IQR A;  2XEH A;  3R9M A;  4XIF A;  1Z3X A;  2J8S D;  2BUG A;  4JZY A;  3EDT B;  2YIN A;  4I6J A;  3OXG A;  4Z68 A;  3T5X A;  1S64 A;  1HH8 A;  2J07 A;  3TWX A;  1LF8 A;  5G05 C;  2WVI A;  2OVF A;  3CVV A;  3C3Q A;  3D9H A;  1FCH A;  2ETB A;  3TL5 A;  5ENT D;  1DVP A;  3FUK A;  3Q73 A;  1N4S A;  5EIL A;  5B1B E;  2LAH A;  4HOT A;  2E0I A;  4OVU A;  1H6P A;  2X6K A;  3CHR A;  1H2U A;  4HRL A;  4DLQ A;  3PZ2 A;  2B6C A;  1TN7 A;  1TJF A;  1NZN A;  3DSV A;  4Y6C A;  3UPV A;  5AQA A;  1EF1 C;  2KBX A;  3ZRH A;  3EJN A;  4EHM A;  2EIM E;  3D9P A;  2VSY A;  2KZT B;  2UY1 A;  1N52 A;  4ANX A;  5BT1 A;  3ONK A;  2DCP A;  4CT4 A;  1YCS B;  2AXZ A;  2WQ7 A;  2J4D A;  5BNW A;  3FY4 A;  1IHB A;  4B94 A;  3RO3 A;  2HE0 A;  2WXK A;  5CED B;  3Q5M A;  1OCC E;  1G3N B;  3LS8 A;  1QZ2 A;  3UIO C;  3TWU A;  2EIK E;  2NSZ A;  3TXN A;  3D9K A;  5BUZ A;  4GU5 A;  3FTS A;  3FUE A;  4XX5 A;  2FEZ A;  4UUC A;  4UQZ A;  3SO8 A;  4GZ3 A;  3PZ3 A;  4LUN U;  1SW6 A;  5ENN A;  4LSZ E;  4CDR A;  2XGO A;  5BV0 A;  3CHM A;  5ENP D;  2IFU A;  2KCK A;  4U0S A;  3WG7 E;  3UQ3 A;  3U3W A;  5EID A;  2P9L G;  3U4T A;  3KSL A;  5FIN A;  4TUU A;  4ME2 A;  4GCO A;  3CVU A;  1KT1 A;  4ILI A;  3CQC B;  4GTR A;  3CKB A;  4UQY A;  3FTW A;  1O1T A;  4DPR A;  1NFI E;  4HBD A;  1Q2Z A;  1TYQ G;  3ML8 A;  2WXL A;  4A55 A;  5KBA A;  4AV7 A;  3D9M A;  4AY5 A;  4XEI G;  3CVQ A;  2XPY A;  2OEW A;  4KBQ A;  1SZ9 A;  3CGH A;  4K0R A;  4JHK A;  1WG0 A;  1N4R A;  3IV0 A;  3Q15 A;  1SZA A;  2XEV A;  2ILR A;  1U2V G;  4PS3 A;  3FUL A;  1OXJ A;  2LSV A;  4F7A A;  3JUE A;  5J08 A;  5LCW J;  3LY9 A;  4APO A;  4NAC A;  3SBT B;  3U64 A;  2YNQ A;  1E8Z A;  4CCA A;  5A7D B;  4GYY A;  4PS8 A;  2I1J A;  1HF8 A;  4HNA D;  4CGV A;  3OXF A;  2P9K G;  4J8D A;  3G2V A;  3UM2 A;  4A1S A;  4IYP A;  4K5B A;  5FWQ A;  4V3I A;  2WXM A;  4O1O A;  1UW4 B;  3SF4 A;  3RAU A;  4H7X A;  4RG9 A;  5G04 J;  2ZIR A;  3LPZ A;  4N3B A;  1JCS A;  4K03 A;  3G2S A;  1SA5 A;  4HI9 A;  4TUM A;  2WM9 A;  4JHJ A;  3BG1 B;  3LYA A;  4GTQ A;  2VGX B;  3TG5 A;  2Q7F A;  1JWF A;  3NQP A;  1V55 E;  4HRN A;  3AU4 A;  3ASO E;  3G2W A;  1HXI A;  3MKQ A;  3B7B A;  4J6I A;  2FI7 A;  4MKT A;  4U0U A;  5FQ6 A;  1YYH A;  3LY7 A;  1YA0 A;  3FU3 A;  2J09 A;  3DSX A;  4BES A;  2WXI A;  4I9E A;  3JXI A;  1H0A A;  2A5E A;  3PVL A;  3QDN A;  2X6I A;  1LD7 A;  3G2T A;  2PQR A;  3VTY A;  4O60 A;  2XGM A;  4DX7 D;  1X5B A;  2BF0 X;  5HS0 A;  2OVB A;  1N0R A;  3J5P A;  3RKV A;  4BY6 A;  3NAW A;  2Y4U A;  1HG2 A;  1N11 A;  2PL2 A;  4Q94 A;  3EIQ C;  5JJT A;  4B8A A;  4WNE A;  3ZHE B;  1B89 A;  4JXT A;  4CDM A;  3CVX A;  1E7U A;  4N5Q A;  3PEU B;  2XEN A;  2LAI A;  2WMN A;  4L7T A;  5FZR A;  4HVB A;  1OT8 A;  3V30 A;  3TG4 A;  3AS8 A;  4JD2 G;  2RKK A;  3JQ1 A;  3FUH A;  3Q4A B;  4BX9 A;  3UT4 A;  2F8X K;  5CRU A;  2AJA A;  3OAW A;  4AOF A;  4MS6 A;  5G04 C;  5KCM A;  1DC2 A;  2JAB A;  3AG3 E;  4DX2 A;  3FUD A;  1QBQ A;  2XZT G;  4BTB A;  3ENE A;  4HRM B;  4E85 A;  2DIW A;  4AXH A;  4K5A B;  3QKY A;  1ELK A;  1UJJ A;  2Y4T A;  1K3Z D;  1V54 E;  2DZO A;  1O1S A;  2X6H A;  2EQX A;  4GA1 A;  3DXK G;  3RRN B;  3HXE A;  4LNB A;  3TWQ A;  4GYO A;  2GW1 A;  2R59 A;  1NA0 A;  4FC8 A;  4U96 D;  3AS5 A;  2Y1L E;  3QC1 A;  4J8F A;  3TXM A;  4RSY A;  3PZ4 A;  2XGS A;  2LSU A;  5HI7 A;  4MRU A;  1ZB1 A;  4EBA A;  2FO7 A;  4DK5 A;  4L9P A;  3T8M A;  3FUN A;  5E75 A;  3J5Q B;  4YND A;  2R02 A;  2A4Z A;  3KAE A;  5H7P A;  1JWG A;  3MCX A;  3FDH A;  2WXO A;  3C5R A;  5ARG A;  4I9C A;  2BKK B;  4HXI A;  2FF4 A;  3JXJ A;  2JLB A;  3CHP A;  4R7L A;  2V4L A;  2QFC A;  4KXK B;  4AY6 A;  4BSX A;  3R9A B;  4G25 A;  5FZQ A;  3RK6 A;  3NBN B;  3E32 A;  3FTX A;  2CHW A;  2BED A;  1N94 A;  3EU9 A;  1HS6 A;  4ACK A;  4U8Y D;  3IHV A;  4BEP A;  1Y8M A;  3CST A;  2FO1 E;  2VQ2 A;  3PZ1 A;  3TGO A;  3QWP A;  3DEO A;  4A1G A;  3ASH A;  5FTP A;  2J9Q A;  5KNH D;  3FH5 A;  2L0T B;  3N71 A;  5ARF A;  2KXP C;  3UT7 A;  3CQG B;  1TNB A;  2CFU A;  4AIF A;  4A63 B;  3HVE B;  2C0L A;  3FH8 A;  4RLY A;  4CYM D;  4O1P A;  2AXU A;  4ATZ D;  1BI8 B;  3IKO B;  1OY3 D;  2IEJ A;  4W9R A;  4ANW A;  5CRV A;  3KD7 A;  3DSU A;  3LCA A;  2H6H A;  3UMV A;  4FA6 A;  1MQS A;  3BUA A;  1OUV A;  4N3A A;  1TNY A;  2MHK A;  1N95 A;  4IUL A;  3CK8 A;  2R5S A;  3HIZ A;  5HKP A;  4WWO A;  2MRI A;  4I2Z A;  5CHE E;  5J90 A;  4GTO A;  1IXV A;  1WDY A;  3PNL B;  2I1K A;  2IO3 C;  4GTM A;  3KS2 A;  3NF1 A;  4JA7 A;  3QNK A;  4NIK A;  4HI8 A;  5DBK A;  4M3O A;  3VLD A;  2CG3 A;  4JL0 A;  4X8Q A;  2XZD G;  2F8Y A;  1ELW A;  1FVF A;  2CFZ A;  3PE3 A;  4I6G A;  4CEM A;  5KNG A;  3EHR A;  5DIZ A;  2PNN A;  3SD5 A;  4UWK A;  2IY0 C;  1N4P A;  2WXP A;  2P2C P;  3QWV A;  1N4Q A;  2AWI A;  4UWF A;  4D10 C;  4KZC A;  5D66 A;  4LER A;  4XI0 A;  3FU0 A;  4I6E A;  3D9O A;  4G23 A;  3FHE A;  1PY1 A;  2L9B A;  2XPZ A;  3PUJ A;  2CHZ A;  1MX6 A;  3Q7A A;  4N3C A;  4FLB A;  2LXM A;  2RFA A;  3UKU G;  3HRA A;  2RFM A;  4HOS A;  3HDX A;  2V4H C;  3NOC D;  4UQX A;  3ABK E;  1QQE A;  3SBS A;  5A23 A;  2P9N G;  1IYG A;  4HOU A;  4ANU A;  2UY1 B;  3L22 A;  1TNO A;  1MYO A;  1E7V A;  4DLO A;  5HQ8 A;  4N2S A;  4WWP A;  3UTM A;  4RVB A;  2IQC A;  2VTB A;  4GTT A;  1UOH A;  3VLF A;  3FU6 A;  3V31 A;  3X2Q E;  4DRX E;  3RSE G;  5D2M C;  4WNG A;  1D9S A;  1TN6 A;  3MJW A;  5BW8 C;  3LDZ A;  2GRP B;  3LY8 A;  4EQF A;  2XRZ A;  4XKB A;  2PQN A;  1MHQ A;  2IO2 C;  3RRM B;  3O48 A;  5EYP F;  3PS6 A;  4IRU A;  5G55 A;  4AJW A;  4EBA G;  3CVW A;  3CLJ A;  1OWM A;  1FVH A;  3APD A;  4C9B B;  3FP3 A;  4U07 A;  5KJN A;  3GZ1 A;  1JPL A;  3Q47 B;  1SVX A;  1U3D A;  4EPZ A;  1FPP A;  4ANV A;  2B0O E;  3TWV A;  4NQ0 A;  1KT0 A;  3SFX A;  2HM8 A;  4I1O B;  1E8Y A;  2NXP A;  4UWL A;  5FJY A;  4J8Y A;  1S70 B;  3FUJ A;  3CHO A;  3FUF A;  3ZFW A;  3W9G A;  5JMN D;  2PM7 A;  4XE0 A;  4BTA A;  3AS4 A;  4F3V A;  4C0E A;  4B93 B;  5JJ7 A;  2R2L A;  4B0Z A;  1TEZ A;  3F6Q A;  2WXH A;  3FTZ A;  5CEA A;  4WUY A;  3ZU7 B;  4Y6W A;  1S63 A;  1OWL A;  4GYW A;  1LD8 A;  2J4B A;  4G2V A;  2VSO E;  2IF4 A;  3HXC A;  4GTS A;  5AQ9 A;  5AAR A;  3ZPJ A;  5JHA A;  3D9N A;  2MYO A;  3B13 A;  3CEQ A;  4ATG A;  4BFR A;  3ASG A;  4BSZ B;  4TXQ A;  1O5M A;  1VDY A;  2V8S E;  3WXX A;  4JVS A;  2KC7 A;  3LVR E;  4E6H A;  2ETA A;  2XS1 A;  2EIJ E;  2IOL A;  4ACL A;  1ZU2 A;  3ABL E;  1DNP A;  4ZFH A;  3L82 A;  1K8K G;  5B1A E;  3TJP A;  3EU5 A;  3SI5 A;  3SY2 A;  3ZUV B;  4FU3 A;  2OCC E;  4MLP A;  2V5Q C;  5AJD A;  3Q9U C;  3S7J A;  5BPP A;  2GRM A;  2J49 A;  4GA2 A;  2OOE A;  4WWN A;  3Q78 A;  3QWW A;  4K5C A;  3AJI A;  1FT1 A;  1NP7 A;  4HS2 A;  4GMR A;  4AEZ C;  4I2W A;  4GZ6 A;  3UM1 A;  5ANR A;  4G1T A;  2EIN E;  3FUI A;  3RU0 A;  3S2A A;  4JPS A;  3D3M A;  3ZXP A;  3ULQ A;  5LCW C;  2QY7 A;  4GZD A;  3MKQ B;  4H7Y A;  1AWC B;  1NL4 A;  3V2O A;  5CCM A;  4OYS A;  1IHG A;  3PNT B;  4LRZ A;  3EHM A;  2F0Y A;  4OVV A;  4FLH A;  2XS8 A;  4A3V A;  5FIO A;  4GZC A;  1AP7 A;  3CK7 A;  4TRQ A;  4AVX A;  3MV3 B;  4UI9 K;  4IN3 B;  4ABN A;  2R17 C;  2GRQ B;  3E37 A;  4J7W A;  1UN9 A;  4C0M A;  3U9W A;  4GPK A;  4ILH B;  4AM9 A;  1EDU A;  2Y0B G;  2EIL E;  3GZS A;  3CHS A;  3ZN3 A;  1P5Q A;  3LEW A;  4NRH B;  1HG5 A;  3P1U A;  2YQ8 A;  1RZ4 A;  3ZEF A;  4APF A;  1WM5 A;  4BET A;  4HB5 A;  3HYM B;  4KVO A;  3QK0 A;  5KJL A;  4JA9 A;  3ONL A;  4P29 A;  2QYU A;  3E30 A;  1HO8 A;  3AAA C;  3ZYK A;  2L6B A;  5C2Y A;  2IU1 A;  3W9F A;  3ZYQ A;  1BU9 A;  5CMW A;  5CMY A;  5AQ7 A;  4UI9 J;  3QAQ A;  2E2E A;  4N39 A;  1HFA A;  1SQM A;  3V2X A;  3GZ2 A;  3ABM E;  1UJK A;  3UUX A;  3CK9 A;  1Z3Y A;  3RIB A;  1H6O A;  2DWZ A;  2KAT A;  4RQI A;  5AN8 A;  2VGY A;  5KWD A;  1BPO A;  2L0I A;  3PDN A;  4KT6 B;  3L16 A;  4F6R D;  2V0P A;  5D0O D;  1K1A A;  4BER A;  2L6J A;  3I3N A;  4F1P A;  4HLE A;  4DX1 A;  4ZHB A;  3UIP C;  3MX3 A;  3QB2 A;  5G05 J;  4GAA A;  3BG0 B;  4AP2 A;  3UI2 A;  1BI7 B;  3DPY A;  3MA5 A;  1JUQ A;  3DSS A;  1E8X A;  1X81 A;  5BXU A;  2J08 A;  4FAD A;  1H6K A;  4XKC A;  4CZ2 D;  1HE8 A;  1OWO A;  4YDE A;  1EYH A;  1MX4 A;  2WXN A;  3R7R A;  3UX4 A;  3QJZ A;  3B7U X;  4BT8 A;  3FU5 A;  3IHY A;  3VLE A;  3O4Z A;  3SFY A;  3BU8 A;  3B7R L;  2PM6 A;  5BXO A;  2XHE A;  3TAX A;  5ENQ D;  2WXR A;  3I5P A;  3IEG A;  3Q9N C;  4TXP A;  2XCB A;  5CER B;  3C3O A;  3ASD A;  4UI9 C;  4FJZ A;  2R03 A;  3Q7F A;  3LKU A;  1UG3 A;  4JW1 A;  1TJC A;  5FQ8 A;  3L54 A;  4CRW A;  3EHN A;  1N9A A;  3ASF A;  3SGH A;  2X3M A;  2WXJ A;  4JHR A;  4O6F A;  2XCC A;  3U66 A;  4DX6 D;  2KCV A;  2OEV A;  4PH4 B;  3CR3 A;  3C72 A;  3CVN A;  4L1B A;  3IXE A;  2ETC A;  3L13 A;  2WQH A;  4WNF A;  1TN8 A;  2P58 C;  4JEH A;  3C98 A;  1KZP A;  1IQU A;  4PDX A;  1OCO E;  2MOW A;  5B3S E;  4G8L A;  3DST A;  4Q96 A;  3SNX A;  4N2Q A;  3ESK A;  2KZT A;  2WXF A;  3E4B A;  3NZS A;  2I9C A;  3PUK A;  1JCQ A;  1NA3 A;  3NZU A;  4LCT A;  5KJK A;  4GML A;  4U0Z A;  4C48 B;  3MV2 B;  4DI3 A;  2BKG A;  1NI1 A;  2ZGD A;  3CIA A;  3E33 A;  3DPD A;  5EIB E;  4HOQ A;  1Y6I A;  5ENR D;  3L9T A;  5CEC B;  4KMO A;  1S0P A;  1H2T C;  3TWR A;  1QNF A;  3G2U A;  4F1S A;  5EYL A;  3OXL A;  4I1A A;  5LP0 A;  5D0Q D;  2IOS A;  1N54 A;  1JCR A;  5FZS A;  3NOG D;  3UXG A;  2FBN A;  3CVP A;  2GRL A;  3LJN A;  5ITZ F;  4J8S A;  4FJY A;  1HX8 A;  3HXB A;  3PEV B;  4HQD A;  3AG4 E;  1DCE A;  3AG1 E;  4TXR A;  4XI9 A;  1PAQ A;  3Q75 A;  4GZ5 A;  2RG8 A;  1GW6 A;  5T4Y A;  1SA4 A;  2YHE A;  3URZ A;  5LOZ A;  2NYJ A;  2WB2 A;  2P9U G;  2LNI A;  1TR4 A;  4OAU C;  5T3R A;  1OCZ E;  4HFG A;  3MYV A;  4EZL A;  4F53 A;  1W3B A;  4GCN A;  1BD8 A;  1E90 A;  2X6J A;  3T9K A;  5E76 A;  3AU5 A;  3PZD A;  5A6C A;  3JQ0 A;  2ZU6 B;  1U3C A;  2XPI A;  3K9I A;  3JUI A;  3FEY A;  3KSQ A;  1INZ A;  3MGB A;  3LXU X;  5EDS A;  2KM4 A;  3CVL A;  4WND A;  3VTX A;  3P2B A;  2M63 A;  4A3T A;  2XEE A;  2WQ6 A;  4DX5 D;  3SZ7 A;  2VTB B;  3V79 K;  2R05 A;  2YHC A;  2DVW A;  4UWH A;  3LVQ E;  1OWN A;  4YDW A;  5T8I A;  3GYZ A;  3DRA A;  5CBN A;  1D8E A;  3D9J A;  4LEU A;  3ZKJ A;  2ZIS A;  3CVY A;  4GB9 A;  3ZGQ A;  2H6F A;  1MX2 A;  4L2L A;  1HU3 A;  4G24 A;  3FFL A;  5BV1 A;  3EUV A;  3KEZ A;  4KYO B;  3EIJ A;  4YDY A;  5EKQ D;  4GTP A;  3LJ3 A;  3SFZ A;  3FEX A;  2HR2 A;  3RRU A;  2I6H A;  3ISM C;  4LNG A;  5AYW D;  4BWR A;  2I2O A;  2VSN A;  1RW2 A;  5FT9 A;  3TWS A;  3ASN E;  2VGX A;  3DXM G;  3L08 A;  4UWG A;  5ANL A;  2ION A;  3UM3 A;  3ZNG A;  2XQ0 A;  3T8K A;  5LFA A;  5AQB A;  4L23 A;  1L5J A;  1EPU A;  4U63 A;  3FWV A;  3ULY A;  2X38 A;  4URK A;  4YVQ C;  2OV8 A;  2UWJ G;  3KEA A;  5FQ4 A;  3GW4 A;  3PRZ A;  5ENS D;  3L17 A;  4EZJ A;  5CBO A;  4XZ4 A;  4B89 A;  4YDO A;  4PUC A;  3SQV A;  1IKN D;  4QQI A;  4ILG A;  1WAO 1;  3SHF A;  4EZK A;  5JA4 D;  3CSF A;  5AEN A;  1E96 B;  3FTV A;  4TV3 A;  4G11 A;  2WXQ A;  4CDN A;  4CT0 A;  4G8K A;  4G26 A;  3ZHE A;  3ULE G;  1UN8 A;  3HHM A;  3DBS A;  3CKC A;  1XNF A;  3UIN C;  3I4R B;  3EHQ A;  2A5U A;  5C1D A;  3MEK A;  3B7T A;  3CHQ A;  3ZXS A;  5EX3 A;  2VYI A;  4U04 A;  5CCL A;  2HO1 A;  3FTU A;  4GPM A;  1MZC A;  3QAR A;  4PS7 A;  3RJV A;  1BLX B;  4LNU D;  1Z5S C;  3S7F A;  2GRN B;  3QOU A;  5JHB A;  4WAF A;  4FUL A;  3FH7 A;  3BEE A;  2DZN A;  4U8H A;  4U7E B;  3MKR A;  1FT2 A;  5AJL A;  4J8E A;  4JB8 P;  2IJG X;  4NUR A;  4BX8 A;  3UKR G;  1WY6 A;  2VSX E;  4YVO A;  1H2V C;  3Q79 A;  2AW6 A;  2KCL A;  3Q49 B;  5LX8 A;  1TNU A;  3APF A;  2V5F A;  1MJ0 A;  1N0Q A;  4GTV A;  3S7D A;  2H6I A;  1KLX A;  4N5C A;  3FTY A;  4RG6 A;  4OAV B;  1Z6T A;  1K1B A;  2Y3A A;  3DSW A;  4KZ0 A;  3R7Q A;  3TWT A;  3S7B A;  5IY5 E;  3HG0 D;  3HXD A;  4J0U A;  4U95 D;  1PC2 A;  2PZI A;  4DJA A;  3FUM A;  2P9P G;  4MBG A;  4B8C B;  2CG2 A;  2WMO A;  1A5E A;  2P9I G;  1XGW A;  2GRO B;  1O1R A;  4CGW A;  2DYR E;  1A17 A;  4DI4 A;  4I1M A;  5FQ7 A;  2Y69 E;  4EEC A;  4FHJ A;  3PH0 C;  3ESL A;  5AAO A;  3DEP A;  3OTN A;  3JYS A;  2AVP A;  4M7C A;  1DCQ A;  4I17 A;  2VGE A;  1OCR E;  3ZYM A;  4QFV A;  4GMJ A;  3DWL G;  4JC8 A;  1ELR A;  2X6F A;  2H6G A;  5EX0 A;  2LO6 A;  1KPS B;  2WXG A;  3E34 A;  3D9I A;  3ZW3 A;  3D9L A;  1KZO A;  5AIJ A;  1QYM A;  5JJ6 A;  3ZIM A;  3ML9 A;  4FHK A;  1TNZ A;  2XRY A;  3MZL B;  4HOR A;  3HXF A;  2HYZ A;  2ZXW E;  3AG2 E;  3UT8 A;  5EN5 D;  4BT9 A;  2GRR B;  2NC9 A;  3JCK C;  3HVE A;  4FP7 A;  2CHX A;  1HZ4 A;  2LUH A;  3RO2 A;  4GA0 A;  3APC A;  3B7S A;  2LXL A;  5M72 A;  2C0M A;  2AXV A;  1ZBP A;  2F37 A;  5HRY A;  2GGF A;  3NB2 A;  2C2L A;  3ZVV A;  4I43 A;  2RD0 A;  4Q69 A;  3TWW A;  3ZYL A;  1LTX A;  2DYS E;  2WPV A;  4LG6 A;  5ENO D;  2JEK A;  3C3R A;  3B95 A;  2DBA A;  1YMP A;  2QZA A;  2OND A;  4KVM A;  4JEU A;  5KJM A;  3IBE A;  4HLL A; 
#chains in the Genus database with same CATH homology
 2VGE A;  4U8Y D;  2ETC A;  1D9S A;  5KNG A;  4DX1 A;  1WG0 A;  1YCS B;  4BEP A;  4BES A;  4ZHB A;  1K3Z D;  2NYJ A;  4ZFH A;  2DZN A;  3EHR A;  2DZO A;  3JXI A;  1TR4 A;  4OAU C;  3UI2 A;  1BI7 B;  2PNN A;  3TWS A;  2FO1 E;  4U8V D;  1IHB A;  2A5E A;  4QFV A;  3DEO A;  4JB8 P;  2ZGG A;  2Y0B G;  3ZNG A;  3T8K A;  2QYJ A;  3ZUV B;  5KNH D;  5AQB A;  3JUE A;  1BD8 A;  2KXP C;  2V5Q C;  5BXU A;  3T9K A;  4O60 A;  3TWQ A;  2HE0 A;  4DX7 D;  4DUI A;  2P2C P;  5CED B;  4G8L A;  2QC9 A;  5EYP F;  5HS0 A;  4A63 B;  1G3N B;  1N0R A;  1QYM A;  3Q9U C;  4CZ2 D;  4RLY A;  4U96 D;  2XEH A;  2Y1L E;  3J5P A;  3TWU A;  4CYM D;  4O1P A;  3KEA A;  4ATZ D;  1MX4 A;  1BI8 B;  2J8S D;  1N11 A;  5D66 A;  4K5C A;  1OY3 D;  3AJI A;  4HB5 A;  4BET A;  1N0Q A;  1MJ0 A;  5ENS D;  1SVX A;  4Z68 A;  4C48 B;  4UUC A;  4GMR A;  2B0O E;  3SO8 A;  3TWV A;  5CBO A;  2BKG A;  3TWX A;  4OAV B;  1SW6 A;  3AAA C;  4HNA D;  2L6B A;  4LSZ E;  2ZGD A;  5EN5 D;  1IKN D;  3J5Q B;  4N5Q A;  3W9F A;  1K1B A;  2XEN A;  3D9H A;  4QQI A;  1MX6 A;  5BXO A;  2ETB A;  5ENP D;  5HKP A;  3TWT A;  5ENT D;  4J8Y A;  1S70 B;  1BU9 A;  3HG0 D;  5EIB E;  5JA4 D;  3W9G A;  4U95 D;  2XEE A;  5JMN D;  4DX5 D;  2RFA A;  5AQ7 A;  3HRA A;  5EIL A;  3C5R A;  2RFM A;  5ENR D;  5ENQ D;  4B93 B;  2V4H C;  2BKK B;  3NOC D;  4K5B A;  5EID A;  5CEC B;  1OT8 A;  1IXV A;  3V79 K;  1WDY A;  2DVW A;  3JXJ A;  3Q9N C;  4O1O A;  5FIN A;  3V30 A;  3V2X A;  1A5E A;  3F6Q A;  4YDW A;  2F37 A;  5HRY A;  5CEA A;  4G8K A;  4HRL A;  5CBN A;  3ZU7 B;  5CER B;  1AWC B;  3V2O A;  1MYO A;  3TWR A;  4J7W A;  3ZKJ A;  3TWW A;  2F8X K;  2DWZ A;  2AJA A;  5AQ9 A;  5EYL A;  4HI9 A;  4TUM A;  1MX2 A;  5AAR A;  5AN8 A;  4LG6 A;  4NIK A;  3EHQ A;  1NFI E;  4HI8 A;  5ENO D;  5AQA A;  3UTM A;  2KBX A;  4HBD A;  5KWD A;  1DC2 A;  2JAB A;  2MYO A;  4DX2 A;  3B95 A;  3NOG D;  2XZT G;  3UXG A;  4F6R D;  4BSZ B;  5FIO A;  3NBN B;  3LJN A;  5ITZ F;  1AP7 A;  2XZD G;  5AAO A;  4YDY A;  1YMP A;  4GPM A;  4HRN A;  1UOH A;  3DEP A;  5KBA A;  3V31 A;  4HQD A;  1K1A A;  3B7B A;  4HRM B;  4BER A;  1BLX B;  2ETA A;  4DX6 D;  4LNU D;  4K5A B;  1YYH A;  3EU9 A;  1DCQ A;  4DRX E;  2F8Y A;  4HLL A;  3IXE A;  4F1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...