1DC7A

Structure of a transiently phosphorylated "switch" in bacterial signal transduction
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
124
structure length
124
Chain Sequence
b'MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATION PROTEIN
molecule tags Signaling protein
source organism Salmonella typhimurium
publication title Structure of a transiently phosphorylated switch in bacterial signal transduction.
pubmed doi rcsb
total genus 18
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1999-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dc7A00
3H5IA 3HEBA 3LUKA 3I42A 4OLAA 1ZGGA 3DZDA 4Q6WA 1JDPA 1DP4A 5C5CA 4GPAA 2E4YA 3QEMA 4KFCA 3KS9A 1Z12A 4Z99A 3N8IA 4EY3A 4OTZA 4Z4GA 2OQRA 4MR7A 1NY5A 3T6KA 4JAVC 4M88A 1JX6A 2FMHA 2HPHA 3SM9A 2RJOA 3O1JC 4G0MA 1E6MA 5D2CA 1F4VA 1P6UA 1ZHHA 3O1HB 4MYRA 4KQ9A 4RWEA 2GX6A 2NZVG 2JVJA 3H5WA 3FGZA 5T7BA 4RY9A 5C5EA 4N76A 3RVJA 3JVDA 1NXVA 4RY0A 5T3YA 3ILHA 1NXXA 3N0RA 4LDZA 3HVRA 4MRMA 3H6GA 1D5WA 4OATA 2IKSA 3O1IC 4Z0NA 4H3HB 2FLKA 1Z2DA 3NHZA 4UHKA 5CNJA 1T34A 5KWSA 1ZH2A 3I09A 1LJLA 1OXBB 2R47A 1BDJA 1IIBA 1YVUA 1A0OA 4IGAA 1M5UA 1RXIA 2XDYA 2FQWA 1Y1LA 3HDGA 3M6MD 3F73A 1AB6A 3LUFA 3OM1A 3G1WA 3T95A 3OM0A 2ZWMA 5HQJA 1Z13A 3O74A 4GNRA 1Z2EA 2F8TA 3OO1A 3SQNA 3A0RB 2LPMA 4WT7A 3OMXA 3IP5A 3Q7TA 4FB4A 3QLVA 1JYFA 4RXMA 4MRMB 3UKJA 4NQRA 2YHBA 3TB6A 2J48A 4RS3A 5DTEA 3I5AA 1M5TA 2ID7A 4RK0A 5JNVA 1FFWA 3KYIB 3MMNA 4WXEA 2FSPA 2MYPA 4LE1A 3TD9A 3CTPA 3DLBA 4Q6BA 3QLUA 2M1ZA 3FFWA 1VPWA 1SD5A 2PLNA 3KSMA 3QLUC 3RVKA 4LE2A 4MR7B 4F3TA 3H5TA 1YS7A 1TVMA 1VLZA 4PYRA 4DN6A 1DRJA 4JB0A 4Q7EA 4E7PA 2JBAB 4EVSA 2JVKA 1QPZA 5PNTA 5TPWA 4G0PA 3RVLA 2DRIA 4MQFA 5IUJC 1E2BA 3QLVC 3EDCA 3HSYA 2NT4A 1DBQA 2CHEA 1YTUA 1ZY2A 3BREA 3BBLA 4KMRA 5IX8A 1FFGA 5CNIA 3JTEA 1QP7A 2A9QA 4XLTA 3CG0A 2WMYA 1K68A 2JB9A 3IP6A 4TMYA 3FFTA 1ZESA 1EWKA 2GBPA 5TQJA 4HNSA 2VYCA 3D8UA 3MYYA 3N0XA 3H5OA 4G0YA 3FFXA 4YP9A 1ZAYA 3GYBA 4B09A 1E6LA 4RK4A 1Z26A 3E3MA 1YK1A 3CZCA 3LUJA 3MA0A 3EGCA 4EYOA 2IPAB 3H1EA 4LX8A 3RVSA 1SXIA 4YRZA 4EVQA 4XFKA 3H5VA 3QX8A 4MGEA 4N47A 3QLTA 1YS6A 3HZHA 3JY6A 5FWXA 4P1ZA 2MSLA 1D4ZA 1NXPA 4MLDA 4WXMA 2LUOA 3E61A 1FSPA 4WUTA 4QPJC 3S99A 6ABPA 4ETNA 2LBPA 1RZRD 2WWVD 4F06A 2AYXA 2VUIB 2IPNA 3RVNA 1DBPA 2MYNA 5DCLA 4Z4IA 3F6PA 1ABFA 1TMYA 1YMUA 2TMYA 4S05A 3JPYA 3Q15C 3OLVA 2PAFA 1DJMA 1ZITA 4QYMA 3HK2A 3HDVA 1Z17A 1W25A 1YK0A 1ABEA 4G0ZA 4XASA 3CNBA 4ZMRA 1NXTA 3GBVA 1TM2A 4N0QA 1LBHA 3DGEC 3R0JA 4JOQA 4D6XA 4RSMA 1MVOA 2FXIA 2A9PA 1BVHA 2ZAYA 5GOTA 3CFYA 4YCSA 3CKMA 1C0EA 3DLHA 3MQ4A 4QICA 2JRLA 1SRRA 4N41A 3SG0A 4P98A 3Q41A 2QSJA 5BR1A 2V0NA 4MS3A 2B4AA 3SNKA 2P9HA 5JNWA 2WRZA 2E4VA 1RPJA 2HQOA 5FWYB 1XHEA 2E4ZA 1RNLA 3LOPA 4JB2A 5FWYA 2L2QA 5ED4A 4KPYA 4MS1B 5EWMA 5IBQA 3L49A 4IMJB 3MM4A 2WJWA 3IP7A 1JH9A 4YLEA 4RKQA 1QP4A 5E3JA 3KHTA 4MQEB 4MR9B 5HSGA 5HM6A 4O1IA 2WB4A 4MS3B 3QK7A 4Z9AA 5IC5A 5KC9A 5EWJB 1ZH4A 2I6FA 2CD7A 1JLKA 1JWLA 2VUHB 2PJUA 4H60A 3KLNA 5DKFA 4MAAA 1URPA 3A3KA 3L6UA 1Z18A 3N6VA 3OLXA 2PE5A 3MF4A 3RVOA 3H5LA 4KK4A 4W5RA 1JBEA 2QZJA 1RZRA 2N9UA 2MYUA 2E4XA 2YHAA 4MR8B 3GA5A 2IDMA 4W5TA 1A04A 1CEYA 3CLKA 1KMIY 3OLYA 1PNRA 3C97A 4ZJPA 2PL9A 1SXHA 1EWVA 3LUCA 1KRXA 2A9OA 3KJXA 3KKEA 1NTRA 5IUKC 5JNTA 2NT3A 3NHMA 3H1GA 3RQIA 4YGXB 4Z4CA 2WY2D 4JASB 3N53A 1DCFA 5FBKA 5TPZD 3IP9A 5JNSA 2R25B 2CHFA 4WWHA 1QMPA 1USGA 3BRQA 1JYEA 3NNSA 4RDCA 3OLZA 5JS1A 1JFSA 2FKAA 3NNNA 4XAQA 1LJUA 2LP4Y 1JDNA 1U04A 3K9CA 4G0QA 8ABPA 1PUXA 1A2OA 4UHJA 1PHRA 4RV5A 5TQ0A 2FN9A 3KG2A 1L5YA 3EQ2A 5KC8A 4CBVA 3GBPA 4W5OA 1W9HA 4FE7A 1D1PA 4TN5A 3RVMA 6CHYA 2WJAA 3HXMA 2QR3A 1U8TA 3A0UA 3DGFC 2PUGA 1ZN2A 3NBMA 3EODA 3HO1A 3RH0A 2HSGA 4G0OA 5IEJA 4RXTA 3QELB 1HEYA 3M9XA 1BAPA 2LIVA 3KYJB 4ETIA 3CU5A 4PICA 2OENG 3OMWA 1VRVA 2FW0A 1S8NA 3DBIA 4KQCA 1DC8A 3HM9A 3T38A 1I3CA 2FEPA 5BQ3A 3OQMA 4N03A 1USIA 1DRKA 4RZSA 4YV7A 3LFTA 1GCGA 3GRCA 4JP1A 5F64A 4YWHA 4IRXA 3KTOA 1H9CA 3QX9A 1USKA 1UDRA 1LBIA 1SXGA 2ID9A 4EVRA 1MAVA 3HJFA 3GL9A 4ML3A 3QELA 3N0WA 3N75A 3GT7A 5KQGA 3KLOA 1DCMA 3FMVA 5KQLA 3C3MA 3OO0A 1WETA 4KREA 1EFAA 4EYQA 4MLCA 3RVPA 4E7OA 2X7XA 4FE4A 5B3JA 2CWDA 3CZ5A 4Z4FA 4KRFA 4MS4B 3H1FA 2A9RA 4NICA 3HV2A 4F8JA 4ZMSA 1D2AA 2FTKE 4D6YA 2BGGA 4RY8A 4RU1A 4XARA 5TQ0B 3HUUA 2QV0A 3OQOA 5I4CA 4TLLB 5TQ2B 2MSKA 1MB0A 1TJYA 3C6QA 4IILA 1FQWA 2FMKA 1QO0D 3TO5A 2R48A 3URMA 2HJ9A 3HS3A 3GV0A 4YO7A 3Q9SA 3M9WA 4ZYLA 1DCKA 2FEKA 2JCGA 2W42A 3Q7SA 4RK1A 4H3KB 3BILA 1GUDA 4G86A 1EAYA 5TPZA 1QP0A 4KNYA 3VNAA 1TLFA 3IPAA 4HNQA 2PKXA 3VNBA 3BRSA 4JA2A 5EWLA 2HQRA 4KVFA 5B3JC 2VK2A 3LUHA 4ZPJA 1XHFA 5FWXB 1P8AA 1GLGA 4S04A 2IPLA 4O1HA 4EUKA 1BDIA 4WZZA 3ILYA 2KYRA 1MIHA 4MS4A 1QKKA 2JVIA 3RVRA 1NXWA 4OG2A 4Z9BA 4LRQA 1CHNA 1EWTA 3ROFA 3KCNA 3NNDA 2IYNA 1NXSA 1LK0A 3LKBA 1VKRA 1YMVA 4MQEA 3Q7RA 1QQBA 2E4WA 1U2PA 1YIOA 3C3WA 2RDMA 1P2FA 4DQDA 3HUTA 3LKVA 4HYEA 4NCBA 4MR9A 1APBA 2FN8A 2HQBA 3H75A 9ABPA 3B2NA 4KK3A 2PUFA 2FQYA 1M2EA 4HNRA 4L4UA 3F6CA 1F51E 1C4WA 1RXEA 4KV7A 2PMCA 1XWWA 1PEYA 1PEAA 4PE5B 3LUAA 3TMYA 1AB5A 3I45A 2PL1A 4QYWA 3ROTA 1JFTA 1ISRA 2GKGA 1EHCA 1NXOA 4KZKA 2E4UA 3EQZA 1P6QA 3H6HA 4L85A 5DLEA 5IULC 4RK5A 4IMIB 2QW1A 4MQFB 5HKOA 5CHYA 2QVGA 2PUDA 1U2QA 1DC7A 3O21A 1DZ3A 1Z16A 2JBAA 3CHYA 4LZLA 4OBBA 5EWJA 5TE9A 3O2SB 4Z4HA 7ABPA 4G97A 4YR7A 3O2QB 3LUGA 4D74A 5CNKA 3OQNA 1PNTA 5BRAA 3OLWA 5FBHA 1Z15A 1OXKB 1ISSA 3C3KA 1BA2A 2GI4A 1GUBA 3D02A 4MPTA 4RXUA 3CRNA 3K4HA 4EGSA 5ABPA 4Z4EA 2IPMA 1BDHA 3O2JA 1GCAA 2O20A 3O75A 4Y9TA 4DADA 4NCAA 4XXHA 4EYGA 1L5ZA 5BRJA 3HCWA 2GWRA 4RK7A 3RVQA 3A10A 4EYKA 3JVIA 2FMFA 2FLWA 1ZVVA 3JS5A 2L19A 5JNRA 5IUNC 4W5QA 2L18A 1J56A 1JF8A 2M98A 1Z25A 5IEBA 1KGSA 3QEKA 1NATA 2FQXA 4RK6A 2F8SA 2FEWB 4NV3A 1QNLA 2PUAA 2RGYA 2QXYA 1U0SY 5EWLB 3F7NA 3CS3A 2IOYA 3G85A 1ZGZA 3LMKA 2R4QA 3W9SA 3EAFA 3IPCA 3T8YA 3JPWA 2NUBA 2FVYA 5KI6A 2B1JA 1R8JA 4G0XA 1M2FA 4TLMB 4F11A 1MB3A 5GQSA 1D1QA 3MIZA 1QQAA 1ZDMA 4RKRA 4PZ0A 3SY8A 4LDAA 2AYZA 4PEVA 5CNMA 2QU7A 5KQMA 4F12A 4MR8A 1JFVA 2PUEA 3P9YA 4YS6A 4ETMA 2RJNA 3CG4A 2MYTA 2L17A 3TX6A 4OLBA 1JHZA 3EJWA 2MSWA 5JS2A 5TQ2A 1B00A 5TPWB 3SAJA 2PUBA 1K66A 2NZUG 3LTEA 2PUCA 2QVCA 1FFSA 1KRWA 3UUGA 3QEMB 5JNUA 4IF4A 3LUDA 3GWGA 4W5NA 2H3HA 3EULA 4O5AA 1QO0A 3UK0A 3FDFA 1E6KA 1DG9A 2Q5CA 1DBWA 1JL3A 2P4UA 4MS1A 5DGCA 5EWMB 5KQPA 2H0AA 4N0PA 4LE0A 3IDOA 2FMIA 1CYEA 2JK1A
chains in the Genus database with same CATH superfamily
2QRQA 1N78A 3B12A 3T3IA 1EDBA 4L2IB 2FG7C 4HKTA 4NYJR 1RYDA 3TDNA 3CLRC 4QAJA 3RJ5A 4CKZA 1NW9B 1KL7A 3D5QA 4N7BA 3SWWA 2AE2A 3G5AA 1QONA 4YJFB 1M34B 2VOEA 1GR0A 1ZQ1A 1PZFA 1KJQA 1ZXBA 2YJGA 2AMLA 2Z1DA 4BV8A 3KE8A 1E62A 3MJSA 5ER6A 4F5WA 4I1IA 3AG5A 3QMVA 5T6BA 3SM9A 1QHIA 1UMKA 4OEHA 1AQLA 1U81A 2CCGA 3DUWA 1N1DA 1R0LA 3G2HA 3VH4A 3BXPA 2EARA 2AFRA 1SD1A 2FWPA 3F78A 3K2IA 2IE8A 4IM7A 5GJWC 4KQ9A 1FDOA 2GX6A 4QDKA 5B5SA 4AKIA 4G8JA 1BE8A 5JSQA 9MHTA 1V2GA 4ZVTA 2EBWA 1KC3A 5ES3A 4FQ5A 1GKUB 1II8B 3LVRE 4RNDB 1XTIA 3QG5A 4EWLA 2GESA 3A6KA 5TMPA 3OZBA 1QGED 3H84A 2FZKA 4WNAA 1YJ5A 3A4LA 4FFDA 5FUQA 2Q45A 5E8RA 3X1XA 1YDFA 2Y9MB 2QX4A 3I09A 2LCQA 1SZPA 1YVUA 4Q03A 4WEOA 4C43A 1QFMA 1RXIA 2XDYA 1G5FA 4P82A 1KJWA 1EGHA 1XTBA 1ES9A 3DKKA 1BMTA 2HSJA 3LY8A 2XRMA 4V0QA 5A4IS 3EVEA 4MV5A 3U48A 3OM0A 4E1AA 2C54A 1VGRA 2Y1XA 4IHJB 1PL7A 4GNRA 1EDZA 1POWA 1R0CA 1RMQA 1Z2EA 1JS1X 2IT1A 4H1VA 4HN4B 3BTOA 4R6XA 3VZQA 4DCVA 3U4QA 3TJMA 2F59A 4NI5A 3W8RA 4ND8A 1YFLA 3PX7A 1U3DA 1KEKA 3PCTA 4LQDA 3D4PA 2UUCB 3K70B 5A7HA 5IT0A 2OO5A 4HUQA 4E0BA 4DGQA 1OH8A 5AOAA 5LP1A 2MOKA 2ZJZA 4FR0A 2CLFB 1ZIPA 1J2RA 1NJGA 2AOUA 2XOEA 4K6OA 4RZIA 4LK2A 5BQOA 3VV2A 1HG0A 4KQGA 1VPWA 1I6LA 4RE5A 4WGFA 3VFDA 4IZ6A 5KTKA 3L06A 3CA8A 1H2YA 2VXCA 4PM4A 4KR0A 5CP8A 3R4CA 3G59A 1T5OA 2Y77A 3M7IA 3T9FA 1DKOA 4BFYA 4PBRA 3FTEA 4D8XA 5LZ9A 1S7CA 3L6DA 1MNAA 5AI5A 2O3RA 5DCUA 3GJ4A 3NYQA 4J03A 5AK0A 4II3A 3BREA 4GECA 5ALWA 4B71A 2A4MA 5D7BA 4QHTA 2GB4A 5ENDA 2A9QA 3W8DA 4ZHQF 1N6LA 3NV9A 4X00A 2ONCA 2BW0A 3P9ZA 1XEFA 3OG9A 4GE3A 1FJ2A 1YRAA 2JB9A 1B4DA 1K0FA 3PDWA 2HT6A 4TMYA 1C2TA 5EP4A 1D07A 3S27A 3Q9UA 3OJLA 2F3UA 3AEYA 2VT7A 3H5OA 4YP9A 1M5RA 1F2UA 4P4SB 3GEIA 1J4AA 2QMUA 5I7OA 4FC6A 2RHOA 1BHJA 1Z73A 4ZDIA 3M4NA 3WSTA 5JJ5A 5JZ9A 2B7CA 3GBSA 1EH5A 2QAJA 2IX3A 4QZVA 1AJEA 1HQCA 4IDAA 4NOLA 3WYBA 1V7PC 1S2LA 1KU6A 3TDMA 5F7OA 1N6KA 5BSGA 4J1TC 4BXOA 4KDRA 3BE6A 4A6PA 7GPBA 1T35A 2B3TA 5IJ9B 1PL8A 3A6JA 3SJCA 2AG0A 1QX4A 1RZRD 4P7JA 4PR0A 5HIMA 3AR6A 1UZLA 3I4FA 3KE9A 2ZKIA 3BJZA 3L9WA 1IZ7A 5EE5B 1DBPA 1ST2A 2MYNA 3DDOA 3PFGA 1RI5A 4R5HA 3X2SA 2ZKLA 4HEJA 3F6PA 2O3TA 1KJYA 4M1SA 3C6BA 1IXSB 3QFFA 4NPAA 4XD2A 2IV3A 3SHWA 3CKYA 1FRVA 2Z6AA 3MMSA 3E58A 5C4GB 1A9SA 4L22A 5L3SB 2B7BA 2YJTD 3GLIA 5CEEA 2DH6A 1JEQA 3UYKA 4AQ7A 2QRVA 3TSZA 4CN8A 3Q6NA 3DZIA 4R2LA 1BCRB 3USCS 1S8FA 1K97A 5JAQA 1T1JA 2JCXA 4R1QA 3OLQA 3LUBA 4JLMA 4NK4A 1YZUA 2FWRA 2WHQA 1NOIA 3D31A 1EP2B 3DQPA 2MTBA 3AF0A 3KBOA 1JIKA 1RRFA 3D8SA 3KDAA 4PSKA 3UW1A 4QDOA 1RQ7A 3H87A 1OOEA 1GZ7A 2IL1A 4RGBA 4ZT5A 2P4EA 4YCCA 4CG1A 1OXSC 2BKEA 4EJSA 5E1DA 4URFA 5IZCA 1AMOA 2P5TB 4RGYA 1CLUA 2B0JA 3GFVA 2XB6A 4UOQA 4HWKA 3RS3A 4OA8A 4OHOA 3UW3A 5G0UA 4BDSA 1C1XA 2A8YA 3KVYA 1E5XA 5KREA 4BJ3A 3DOCA 4PLVA 5BWOA 5HM8A 1J49A 2GEUA 2WJWA 3DT6A 2CEAA 4RKQA 1PGOA 4YI3A 1U0EA 1NVXQ 2DFPA 4DQ0A 1KJIA 1P77A 1EJBA 2RH8A 4I81A 1JG2A 4E22A 1F8UA 1QR6A 1W2WB 2YYSA 3OZWA 4G63A 4E5YA 5JPDA 3C7DB 5AW8A 3JQEA 3E9CA 3HMKA 4DWWA 4D56A 4ITRC 2EAUA 3PIRA 2R7MA 1XJQA 3LP5A 4I9UA 3RB8A 3MG9A 3G9ZA 4W5RA 4GAEA 2WAYA 2YRWA 2GLXA 2N9UA 4XX1A 4YUVA 3T5CA 3TE6A 4NBRA 3SKVA 5KWEA 4AURA 1XCGB 2ROQA 2CLDX 2COEA 2IDMA 2G5TA 3DZHA 3MCVA 4PFKA 3WKDA 5JAIA 2I9KA 1TOAA 5HE8A 3OLYA 1PBNA 1U7UA 2J0UA 1VL5A 3SX4A 2KI5A 3QKRA 5JRJA 2RARA 3A9SA 3THXB 4M9RA 3BB4A 1GARA 4BO1A 2EL9A 3FSEA 1UBRS 1E59A 1B41A 1ECLA 1L7XA 2JW5A 2XGSA 4UASA 4Z4CA 1XTVA 2I4NA 3BWVA 1W29A 1HNZB 2G72A 2CHFA 3S44A 5AUPB 1FP7A 1AZLA 1I0LA 2X9QA 1SCAA 3EVAA 3E05A 2PA0A 1GXSA 4IO0A 1JIJA 4AJ2A 3Q1KA 5ADHA 2CJXA 4WBNA 3EMVA 2EJTA 2ETXA 1ZUD1 1GFZA 3PE4A 4TM8A 2JJYA 4YJKA 4OI1A 3U4CA 3KR1A 1YS1X 2PKQP 3EE6A 4TQAA 3ZVRA 1ZGBA 3BH7A 4OHFA 3QBDA 2WD7B 3OUZA 3UB2A 3WAKA 2X8JA 2LE0A 3IRVA 4LV8B 1GYQA 1H2HA 5EZYF 5AK6A 1U3UA 1BGWA 3AU8A 4MDEA 3B1WA 1RAHA 1HDZA 5I7RA 2XUAA 1G7TA 5GZ3A 2TMKA 4Q1FA 3T0FA 3QOXA 2A58A 5MN5A 1DIGA 3DCNA 3EK2A 3HN6A 2IYRA 3FCUB 4OXNA 1HEYA 1K63A 3FDXA 5BNTA 1FSZA 3PUIA 4JOSA 4BQNA 4CMGA 2OXCA 2JZNA 5FIUA 2RKBA 1AKTA 2GN8A 2QF7A 4PICA 2R7NA 4ZQCB 4OD0A 4Q48A 3OHSX 3KPVA 3NZEA 3OE4A 3FFAA 4JC8A 5JYBA 2BJWA 1HWYA 2ZE7A 2D8MA 3F47A 5BY2A 4XD7A 3U7GA 1FYVA 2RHHA 4AZVA 1FDTA 4Q39A 5CYFA 1NF8A 1D2MA 5E7IA 2LTAA 3BWBA 4WESB 5DTRA 4JVOA 4CEJB 4GYKA 2R6ZA 2PN1A 1OU0A 3E1GA 2OB2A 2X86A 2X42A 4QU8A 3JQAD 1OHHD 5H9VA 2FPWA 3H18A 2A57A 4DV5B 1K4MA 2JDIA 3IC5A 3A31A 4JCCA 3I6ZA 3KSZO 1QPBA 2R00A 4LC9A 1CV2A 3FBGA 4L9WA 3HABA 1HT3A 2GJSA 5KQGA 4DFDA 3WGQA 3SQMA 3NT5A 5BYJA 5FTKA 4Q02A 3C14C 3AV3A 4Q24A 1FP2A 4Q9DA 3R3HA 5C7IO 2C61A 5P21A 3GRYA 3SC2A 5JALA 1V7ZA 5CBPA 4LKRA 2ICAA 4R7ZA 4JJIA 4JLPA 5F5XA 4BLQA 4C05A 2K7FA 3BDIA 3RANA 4ZHQB 4ER6A 3RBXA 5LZ4A 1M54A 1C2YA 4PS0A 4EGJA 3UV7A 4J7AA 2QMHA 2D5AA 3BN3A 2TMGA 4JT2A 4G2TA 5HXAA 4BLTA 2FWMX 4XARA 4HB3A 1KK2A 2D1YA 2KMLA 2P2NA 3OQOA 3F4KA 1GAEO 4BRSA 4A03A 3KHUA 3PE6A 5I4IA 2IS1A 5F2EA 4XYLA 5BUZA 4DAEA 4ZJYA 1BWPA 1FVXA 4JR1A 2XWSA 3TTVA 2WYIA 3KUCA 5K3FA 1OY1A 721PA 1HZZC 1FK8A 3PR2B 3T3EA 3F9IA 4J49A 1FU4A 4E5UA 1F3OA 2F1HA 4DIOA 4BZXA 1NP7A 4OB6A 3QVVA 1X7WB 1W76A 2ZI4A 4KNYA 2PLFA 5LQJA 2X4GA 3VPAA 3VNBA 3BRSA 5KYXA 2HMSA 2ZUWA 3J7TA 3R6WA 2IP4A 3GFPA 2IYZA 2RAPA 1DKMA 4MP6A 1YFJA 1DWQA 3NHSA 2H1VA 2QAIA 3P19A 4G5YA 5B3JC 3GJ3A 5KU7A 4EQ6A 4NE9A 3K0BA 2DQKA 4OI0A 1O94C 3TVDA 1HFKA 1K7EB 4WZZA 3G7SA 4GRDA 5BMOA 2AFHB 2G4LA 5IBRA 3WGZA 5CYOA 5BW5A 4CFYA 4N01A 4TTSA 1DOHA 4DV1B 1XB2A 2LNDA 2H6EA 2AD1A 2FPOA 3MCAA 5K3AA 4ZU6X 1UBFA 5IHPA 1BKDR 1RADA 1R6AA 2ZVPX 3W8NA 3KEGA 1JLSA 4Y1FA 4LVUA 1UPFA 2H9YA 3RABA 3PZRA 4C7KA 2PV7A 4EQZA 3BAFA 3TIFA 4PCUA 2Q21A 1TM1E 4EGAA 4N7RA 3LCMA 1APBA 3V8QA 3HWRA 4D9HA 2Q9BA 2PUFA 2R8XA 5DNEA 1JLMA 1SXQA 2BFCB 4L4UA 4YP7A 1T6NA 1GRQA 2C2XA 2XUZA 5DOVA 4AKGA 4BGUA 1CJKC 1YC5A 2EERA 4DT1A 1CZLA 3T4PA 2JFGA 1PJSA 3LPMA 1P61B 2AZMA 3LXMA 4NOJA 3R09A 7MDHA 2QK4A 1SU8A 3OU2A 1T2NA 3K9NA 3VVBA 3ZJ5A 4X45A 3ZWWA 2AI1A 3V9AA 3CZAA 2IHYA 4OUKX 1ODIA 1X7ZB 3JQ6A 4YCAA 4L8VA 4DV6B 3OIVA 3HGQA 3HM2A 4PYQA 1DPFA 5GADl 2VSFA 1V3VA 2V4ZA 2XR1A 3C3CA 4JUBA 2QY9A 2JBAA 1XRLA 4GDFA 3LV8A 3HB9A 1Z06A 1NM5C 3O2SB 3D3WA 1JAYA 4KXNA 1S3SA 4MO2A 1U0JA 3O2QB 4TPKA 1E2UA 2YRFA 3OQNA 1V4BA 1PGPA 2IPOA 4FW9A 4NECA 2EJVA 1GV1A 1JSXA 4UM5A 3GAZA 4CCAA 4ISBA 2FP4A 4MVXA 4XW2A 2IPMA 1KAOA 5KOHB 3LC7O 1KERA 1Q0ZA 2W2LD 1X0XA 3AKEA 3OBIA 4JU8A 1OPXA 3LWZA 1OFVA 3EXHC 3T4EA 3KSDO 2ZB3A 4XCVA 3R6GA 1TTPB 5JS8A 1C7QA 3KKMA 5SYAA 1BVYF 5E4TA 1ZD4A 2AXNA 1JDJA 2AKYA 2KE5A 4YRJA 4C1NA 4DIEA 1VYTA 1NE7A 2V7UA 1UOQA 3VV3A 4MKRA 2G7MC 3QEKA 2VAPA 1IN7A 2Z04A 1E3WA 1HQKA 3GVHA 3A9RA 3IOCA 3M0EA 5FPKA 1QV7A 4TMWA 3NH9A 5BUSA 4RTJA 1DLJA 5TY0A 3W1VA 3LMKA 4R1TA 2DR0A 1KDOA 4IV5A 4CKWA 2JGJA 2EP5A 4IZHA 4L8WB 3T8YA 5DGTA 3OE7D 1YQGA 4HLCA 4Z9FA 1KI9A 1B1CA 3DLCA 4D99A 1ORRA 1A3CA 2SBTA 3T94A 4FINA 4NYMR 4WZBA 4F11A 3CPEA 1IZYA 1YT5A 4AP5A 4JWKA 3MFQA 4MH0R 1QHSA 4MVJA 1B8VA 5IS2A 2C9BA 1NRJB 2QU7A 5FRDA 4ZCIA 2GA9A 1X94A 2I34A 4C88A 4TUYA 2XGMA 2W2QA 4NWIA 2BYTA 2D7DA 1XU9A 3CG4A 1OYOA 3IELA 4DYHA 4E31A 2O2YA 3F6SA 4URZR 2PH1A 2EX1A 3EW7A 2ZQYA 4KH0A 4ZD6A 2NZUG 3I30X 4NZOA 2WTEA 4ADSG 3V3TA 4DWOA 3DHEA 2L82A 1DV2A 4A8PA 1FC0A 4L9RA 4UCQA 1NBHA 4XSGA 3M6AA 4M9SA 3EZFA 2F9LA 2AOUB 2CXHA 3NM4A 4OXKA 4HEHA 2H0QA 3HB1A 4TWBA 5WRFA 1J5EB 1DBWA 1E0KA 4DJAA 5B1DA 4H27A 1A96A 1P4HA 4OYLA 1PFVA 1VIYA 3OVMA 1YRHA 5KSWB 4DIKA 3TX2A 1ULTA 2FZLA 5BWCA 4YT8A 3OQ6A 2NU6B 4DM4A 5BT9A 2AH5A 5CCBA 5IABA 4IF6A 3EBOA 5KAMA 3NX4A 2BKAA 1C4XA 2DKNA 1BSVA 3COWA 1F0YA 2XGJA 4GOOD 1QHYA 2DKFA 5JD3A 5SICE 3PNSA 4HGOA 3K9HA 3AY6A 1SURA 2XY4A 1Z4OA 2I7TA 1OIWA 1OFHA 2HCBA 1RLJA 1Z36A 1ZQ9A 5SV2A 5C81A 1IVSA 1E98A 1VBKA 4ZI5A 2BGLA 3OIUA 5CLIA 4IQFA 2FEAA 4BBZA 3UGKA 3TZ6A 1CNMA 3K72B 1FXUA 1BQ4A 2X6RA 3S8MA 2Q3FA 1F6WA 1RACA 1T3SA 2V9ZA 4JEMA 3TRHA 4DR1B 1O95C 2VYVA 5T7BA 2DULA 2WMDA 4N76A 1J97A 3NRJA 3GD7A 4EPWA 3ILHA 5IAAA 3MT9A 1N6IA 2D2IA 2QTLA 4AKEA 2DAPA 1JKXA 1RAEA 2OZLA 4O63O 4YQZA 1O4WA 1QRUA 3BMOB 1NFRA 4G4SP 3L7LA 5FOUA 4B8YA 4UTXA 2W7TA 4ZT7A 3ZWYA 5ERYA 2FOXA 3ZNNA 3HV0A 2QJRA 3HN2A 1YUMA 2AKAB 3PT5A 4X41A 2R6HA 4OBEA 1DXQA 1X7GA 2Q7XA 2FHSA 1D6JA 3AJDA 2BCJQ 5C1IA 1E79D 1Y1LA 1F4PA 3L5OA 3M1AA 4KXXA 3T5AA 4P93A 4HDRB 5LR6A 3EIWA 3MJHA 1NBMA 2ORYA 3B1YA 3L0YA 1VECA 4U8GA 3O83A 1XCOA 3AJRA 4WZAB 2IV7A 4FZRA 4EJ6A 5K8IA 2AC4A 2ECFA 2VIIA 1XZAA 4TGLA 4OK6A 1MCZA 4GOMD 2FSHA 3GZNB 1QGUB 2AMJA 3EN0A 3I5AA 3K9GA 2FA9A 4FB5A 2C2HA 1NX6A 1T1IA 4TSFA 3O4RA 2O8VA 4U2KA 1K86A 4WFKA 1ZN8A 1W4BA 3DVLA 5JISA 3U1BA 3DHWC 3KKQA 3OICA 4YJ2B 3SSAA 1CP2A 2QX7A 3WNDA 2V1XA 1Z6TA 3AUXA 2VEDA 4OOEA 1DHRA 3KSMA 4DTCA 4C7OB 3FYUA 4B46A 1WB6A 2WTXA 1P2VA 2DBRA 1V4NA 3ZCXA 2X0KA 3DVAB 3IODA 4J6FA 4ZT3A 2EFHB 4X90A 1KAMA 1WKCA 1A7JA 3ZQKA 2G82A 4IKPA 1JG4A 1KU0A 3M49A 1SVNA 3I1YA 3V5NA 5AI4A 1JHAA 3ZEAA 5EP3A 3ABZA 4IRUB 2BAGA 3RUPA 1GVNB 2HEIA 3LPLA 2XSZA 3QLVC 5IUJC 2NT4A 1ZY2A 4HB4A 3NBQA 2Z9CA 2OBNA 2HL6A 3GLFA 3B9RA 2RI0A 2X1VA 5A71A 3K2BA 3TB4A 3ZGVA 3I64A 4YLYA 1PZMA 3BSYA 4DT1B 5EJFA 5CB4A 2QTVA 3RFTA 3ASUA 5E6SA 1X80A 3R8FA 2GBPA 1FB5A 1UJ5A 3PNKA 1R27A 1VB5A 3KB2A 2XUGA 3U61B 1W59A 3E8MA 1BEZA 2ZT8A 3GEGA 4KRGA 3Q2KA 1EB9A 1J6UA 1QVRA 3FKQA 4IOJA 4PY2A 1CUEA 4WLNA 4ZVKA 5LDGA 1OW3B 3E3MA 1E2PA 3INGA 2HGSA 3LP8A 3PF8A 5TX7A 3AJ9A 4EYOA 4XYGA 4I66A 4C76A 5LDDC 5I7SA 3O8QB 4ZZ1A 3CWZA 4GI5A 1J8DA 4NF2A 1MT3A 4R1SA 3H2JA 4EJFA 1D6MA 3SDSA 4DR4B 2GLUA 4FOPA 3URKA 5BMVF 1PVDA 4MUBA 2B5OA 3X1MA 3PNYA 1DOAA 1MA0A 1UK6A 3F8TA 4ZCTA 4LFBB 4PC2A 1TQDA 5D7NA 2B30A 5A05A 1KJZA 4HLQB 1L8XA 3GAMA 1RHQA 1SOMA 1N33B 2H1IA 4KIWA 3ZDCA 1YMUA 3ZK9A 1NMZA 1R9MA 3Q15C 3H17A 4HWGA 4Q3AA 4BZPA 5JJKA 1CX9B 3ABIA 1XKTA 4YN3A 5TNXA 3UAWA 2EF0A 4LDRA 2JFUA 2RGUA 3WGHA 1AY0A 5DYGA 1QGYA 3WGNA 1NF9A 2D0DA 2VJQA 3G2PA 5H68A 3RC2A 3JZDA 3RRFA 2LDBA 1YFZA 2P3LA 2DFVA 4QNRA 4UCXA 4NNOA 1M7GA 3RC7A 2X8WA 3LY9A 3U7EB 4DNQA 2JLAA 2PX0A 1KWKA 3HJCA 3EH2A 2CD9A 2H52A 1QZXA 2KSQA 3A6LA 5CD9A 1N5LA 2WA2A 2QP9X 4EB3A 4IS3A 3EQ9A 3IMFA 4FZJA 2BP7B 3NRCA 1I4WA 3TOVA 1XMJA 1KVUA 3K96A 2PKQO 3UK7A 3ZWVA 3D81A 3K20A 3OFKA 4I1UA 4M1WA 4G4GA 2OHOA 3K9QO 3KR2A 4P98A 2Q3EA 2ZGVA 2VHXA 2ZWPA 1CT9A 1JIIA 2REOA 3MLEA 3UMYA 3GFFA 2IYLD 1QIFA 2DTEA 4MJLA 1VMIA 1Y80A 4Y2QA 3ZDXB 1WE2A 1KR5A 1T9HA 1VHLA 3QHPA 2VP2A 2MU1A 3PVSA 4I46A 3T3OA 2G5GX 5LNK6 2A94A 2YS6A 3JVEA 3HJNA 3PXEA 4G24A 4OJNA 1P7VA 1XEXA 3I37X 3SHVA 3IP7A 3B52X 4CFSA 1UP6A 1JH9A 4Q16A 3RSLA 1B0PA 1NBME 4HDKA 1ZCZA 1NUHA 1LTQA 4JI5B 4OHXA 5A3RA 4TZ0A 3RUFA 3LO5A 2UYYA 2VYND 1DBSA 2W11A 4TL7A 2BZGA 2BUCA 3AXSA 3EBLA 4E5DA 4NATA 4WOPA 1N5JA 1OI3A 2BT4A 2N3ZA 2AJCA 3DMHA 1LX7A 3KLNA 1G63A 4HH0A 1UBLS 2C2MA 2CNOA 4QYIB 5J2TB 3V8NA 1XXHB 1DFIA 2OXFA 3EOAI 5B2EA 2PGDA 1YNOA 4QYSA 2VDMB 4UVEA 3CNEA 1YR8A 3BIOA 4BKRA 5T67A 2B61A 3WQQA 5AJZA 4B74A 4FYJA 4FFOA 5DBHX 4JBGA 1NI4A 8LDHA 3WFIA 4G5SA 4OSEA 3HU3A 1LJ8A 1G8YA 1PP4A 4JUDX 4CL0A 4EKDA 2M9MA 1ZM9A 1FRFS 2WF9A 4JXJA 4P3XA 3H4TA 4UZSA 5FOVA 3U3DA 4DMCA 5JS7A 4JASB 2UVPA 3D4NA 4LIPD 3N7UA 4ZGGA 1YDWA 4X9XA 3WRXA 2CL7X 5KYVA 3BCHA 1Q1ZA 2I7DA 5LP6F 2R6JA 2FKAA 1RQ2A 2V6GA 3GMTA 2QBYB 3V7NA 1YO6A 1E7MA 1R5NA 1CVLA 3CRRA 1P1FA 1FDUA 4FEAA 3AHEA 1CZOA 1CUAA 4ZT6A 2W90A 2Y9PB 3TECE 3ZHRA 1L5YA 3ZLJA 4TV8B 1QCZA 3M6UA 5CK4A 5TJ9A 4Z9YA 2VWPA 1K8YB 3RVMA 2VG8A 3SOPA 1O0SA 2QTGA 2FOLA 2DFLA 3HL4A 1AGXA 3GPDG 1EHIA 1V5FA 5E38A 3VR4A 2PUHA 2GF0A 1CQXA 1NVEA 1ZN2A 4INPA 4Q7KA 4Z5XA 3L4EA 2FFAA 1DWOA 3G3EA 4HHEA 3C1AA 3GFBA 4HDAA 2I65A 3HA7A 3QFCA 2KBFA 1M1ZA 3KYJB 1UBSB 1WCV1 4EECA 1I5EA 4F96A 1CRZA 4BLOA 1DL5A 1I9CA 4EEZA 1R4NB 4IGIA 1E4VA 1W46A 3PENA 4XM0A 4C2TA 3RREA 1LTKA 2C29D 4JJEA 3D6UA 4KO2S 3D0RA 5FFNA 4YV7A 4YJHB 1JQEA 4JP1A 3UJHA 2PUVA 3F6BX 5FBLB 4F2GA 4CIYA 3OE5A 1G1AA 4MVJE 4HDMB 3BVPA 3TNLA 4RKWA 4BNIA 2EATA 2ZAGA 1E2EA 1SXGA 3L77A 3DBOB 1Z2CA 3I6IA 3N0VA 4HLNA 5REQA 1WXEA 1U0LA 2MSEB 2I4OA 3N0WA 5AJHA 3A6EA 4ALLA 4D42A 5C46F 4OMFG 3AF6A 1YI1A 2JLCA 1VRCA 4TTQA 2FGJA 2J3IA 2XVXA 1QYIA 3LL4A 4DREA 3IULA 5KQLA 2IXAA 2PNJA 1EXNA 2PX5A 3A1SA 3EHDA 1O5TA 2BFFA 3OETA 4HY3A 4ZYTA 3BH0A 4M60A 5FTLA 5E9JA 3VPHA 1ZYUA 1NHWA 3L1JA 3UH1A 3QW4B 4RUKA 5C8ZA 4X97A 3K0FA 4TV9B 1WV0A 3COYA 2C4UA 2OGUA 2FNAA 4G9EA 4LQ4A 3LL7A 1Y5MA 4WK2B 2RIRA 2IU4A 5CT4A 4Q9JA 3IHKA 2ZTVA 5AUOB 3R3ZA 2JA1A 2D1FA 4E5MA 1JILA 4K9QA 4N7JA 1D04A 3EA0A 4J4TA 2XNDA 3GJ0A 2KBEA 3PKZA 1E1DA 2QL6A 2XUJA 3PEFA 4FX5A 4JZYA 3T7SA 3JWJA 1TJYA 3MCTA 2D0PB 3C0KA 1RKVA 1V8FA 1XVIA 5TSDA 4W8GA 4EMTA 3BCUA 4NG4A 3URMA 3ZE6A 2QRVB 1K7XB 4UUAA 3WWCA 1W2HA 1ITZA 4MUYA 4URXR 3G1UA 4QVKA 3WFJA 4FFLA 4GP9A 4B43A 1Y63A 5E7JA 1GUDA 5IARA 4EW3A 3DEHA 1AKVA 4YK7A 4V38A 4UBIA 2TRSB 4P3KA 4PIMA 4ERXA 1OFTA 1Y37A 2E18A 2EJUA 4X8MA 5FHRA 5H7XA 4DKXA 2CYCA 2X3FA 3W5BA 3OWOA 4EUKA 1YZLA 1UADA 2J5BA 2SKDA 3N70A 3FZGA 3PWSA 5K8JB 2C3YA 4L3WA 4KSYA 3T5DA 2WWFA 3ZDEA 5CAEB 3B3FA 2O8DB 1H1LA 3ZCRA 1B93A 1CHNA 2GYVA 2H92A 4R9VA 1WVMA 3D1LA 1NXSA 1R6TA 1VKRA 1EWQA 1BFUA 1SKYE 4ROSA 3CSSA 3EASA 3HKDA 1IEVA 3QE2A 4DLTA 3EDRA 4ZGWA 2V1UA 2VP0A 1K5HA 1Q0TA 3LDFA 3R5XA 2HV9A 2NV2B 2FQYA 3PCRB 4HNRA 2O8CA 4MMZB 4YDQA 4BBJA 2DWQA 3D7NA 1T5SA 4C7XA 1MC1A 1SOWA 1COZA 3I4CA 2YY5A 3AX6A 1ODCA 4PYIA 4RLSA 4ZI3A 2P3QA 1LDNA 4JNCA 2NZJA 1XUOA 1QK4A 3N2ZB 3DTYA 1KZ9A 2E4UA 3GPLA 3H6HA 1RYFA 1M1XB 3KXPA 5J47A 1HEIA 5JEDA 5K2OA 1OAKA 4E5PA 5ALQA 4CV1A 1NUQA 2RG1A 5EGSA 1DZ3A 4BCBA 3NVAA 2Z5GA 4RHXA 3NH6A 1BU5A 7ABPA 3AILA 3FPEA 1UC9A 1B74A 3RTGA 1ISPA 1Y9ZA 2C4WA 2ON6A 2P8JA 4J91A 4JJ6A 3M6WA 2OXTA 2IKQA 3ONFA 4E6PA 2J0EA 2QRKA 3A1EA 3P96A 1XP5A 4H7EA 1FDSA 2C7RA 2XDAA 5FP0A 3HXLA 2O2JA 3LT2A 1GUBA 1QOZA 4RXUA 1CJUC 3ZU3A 5J43A 1C9YA 4RIHA 4U3JA 3IAAA 3L1KA 4DADA 2W4QA 3R5FA 4LFCB 3EPJA 4LF8B 2CLHB 1VMAA 1N5MA 1VLJA 2CYBA 5G0SA 4AP9A 5JXJA 1RWNA 2PZLA 3PXBA 1VIDA 2JIMA 4P3PA 3JS5A 3LBFA 1WA5A 1E4EB 3S70A 4AMZA 1LDBA 4NS4A 3EEBA 5HF6A 4G5GA 1A8IA 1S2IA 2HWYA 3C70A 3EY9A 1ZGCA 3KBBA 4N0EA 3Q7EA 7REQB 4O4IB 1JDBB 3DE3X 4Q7QA 1ILWA 4PQRA 5L3QA 3RRYA 1YI8A 2Y3IA 3HNOA 3CE9A 4WBSA 1ZGZA 4BUJA 3EPPA 2GUWA 3ZWBA 2AMVA 2I3AA 3EAFA 3MOIA 4RA9B 5JSUA 2C4NA 2FVYA 2SNIE 3ZW7A 5LBUA 3CXUA 1N6OA 3MIZA 4J3JA 3RHSA 4JEUA 1QB7A 3OCZA 2VFAA 3HY4A 4M9CA 1PR2A 4XPIB 4YECA 3WV5A 3MVEA 1O94D 3EIOA 1THTA 3RCBA 2C5AA 1NVMB 2IHZA 3ANSA 2ZS8A 3CZMA 4PR3A 4RYDA 1CJVC 1SM4A 2PMFA 4M86A 5C8XA 3I0ZA 4K0RA 5DGHA 2WG0A 2J0SA 1O4VA 1BKYA 4EF4A 2GZMA 3LVFO 1Q2XA 3WHIA 4ZYYA 1IOVA 4WLOA 1MX1A 3AI2A 2A1UB 3D0KA 5TLSA 1KY4A 1SOAA 2BHSA 2O1XA 1JEYA 1IQRA 2QN6A 4M6WA 4M76B 1WQ4A 4WADA 2FPLA 5JZMA 4WX2B 5TS3A 3FR7A 2IUYA 1XNGA 2ZRHA 5DHAA 3EX7C 3ZDYB 4Q01A 3ENVA 4MUNA 5THXA 1KVQA 1ZKMA 1DBIA 4NRDA 4X8HA 4ZV7A 2GJKA 2J9FA 4KXUA 3E9NA 1JR3E 2XYGA 1JZSA 3RWMB 3NFRA 4H2DA 1WV1A 4GOND 4RCYA 1QRAA 2EX0A 2F17A 1G3MA 4B7AA 3F5MA 4Q12A 1GG5A 4Q7MB 1A8PA 1JDPA 4M0KA 5FUVA 3CH5A 1NOJA 2G9NA 3W9YA 2H1OA 4P53A 4MV3A 4TUYF 4X85A 4FUTA 2G80A 2P8SA 3EZNA 2ZYUX 5F5LA 3BXOA 1CDDA 3W9UA 1BN6A 4MR7A 3K9LA 4IJUA 3RUIA 1SGWA 4RD2A 3TVTA 4JAVC 2E7ZA 4QXMA 4QUKA 1IBMB 2FMHA 5AKYA 3UJPA 3SMQA 1XCBA 3HFJA 1O97C 4FYHA 5EQTA 2YCLA 4FU0A 4J7XA 3NC1C 3ZOZA 3D64A 1FIUA 4LXIA 2NSJA 2J3HA 1U3VA 1L5QA 3H4IA 2JVJA 4AJEA 4P2BA 1QQ5A 3MS2A 2HU2A 3PUYA 3ELWA 4RENA 4HJXA 1YH3A 3FLMA 2OA0A 3GFTA 3O3MB 1QK5A 1VB3A 3TZLA 2I3DA 4FIZA 2WB2A 1WWKA 2AR0A 3TKLA 5E6RA 2DUUA 1FLVA 1Y1RA 1MLDA 2QU8A 2C4HA 1ZMTA 5B1IA 2B92A 3TQTA 4LNUA 3ZBTA 4YRIA 1PJ8A 2VPIA 4C4ZA 2HXGA 2CDRA 2ZQ5A 4K88A 1G8PA 1WW8A 5FTJA 1LJLA 2P5UA 3SMVA 3SYRA 2V3WA 4CVNA 5AVTA 1CQIA 3G02A 5ICCA 1NVWQ 5A7FA 3JZMA 2XA9A 3BE4A 4Q93A 4NKRA 1QYVA 4G3XA 1J0EA 2FF5A 3PHCA 1EMDA 4V0NA 4B3FX 1FFEA 4DPKA 2ZWMA 3BXGA 5JXWA 2FMXA 3H1AA 4E3ZA 4IVPA 2X2PA 4A2PA 4BN5A 1FMLA 3ELYA 3IP5A 4B3TB 4MRMB 4BJ1A 1G5TA 1LV7A 1NVAA 1XZCA 1QOPB 3ABSB 3WI7A 1QAQA 1OLXA 4WDQA 2DR3A 1KMQA 2YFYA 4BMCA 1M5TA 1KMHB 3TUZC 1ZAKA 2W58A 3PPWA 4B3GA 1XRSB 1XMSA 1GP2A 1X1EA 1HRKA 3EDQA 3JZIA 3DMYA 3EY4A 4ACBA 4PX9A 1A9TA 2BFAA 3FYUC 3I9V1 3IQWA 4O0LA 5JQGF 4DUPA 3NPAA 2CSUA 1ZD3A 2F62A 3FFWA 4TVSA 5HWSA 4C2BA 1U9IA 1HC7A 2VHWA 3AGQA 4BV9A 2GERA 1PBTA 3YASA 1KEPA 1UK7A 3L0PA 3PXGA 2LR0A 1U2GA 4YIKA 2AXPA 5G4LA 2FG6C 3EXG2 3PPYA 2G0AA 1FTYA 4H7HA 1GL3A 3PNVA 3LCUA 4XFDA 1FA9A 4C6SA 2E87A 4BC1A 1XVAA 3IQGX 5IBPA 4RJTA 3P9NA 3TG8A 4LOKA 4LVOA 2YVAA 4ZREA 5H3LA 1U31A 5FXMA 3CRW1 1JIUA 3M2TA 1QS0A 4OU4A 2BI4A 3K3PA 4L9SA 3A1CA 2A5LA 4G5QA 4JYCA 2D54A 2ZRFA 3MD9A 1ZK4A 3K4QA 4FDUA 4Y2HA 4FXPA 2F7SA 3OESA 3DCIA 4OJYA 3TPZA 1OXUA 3S55A 3VOSA 1IHDA 1OILA 1Z26A 1PSZA 2AUNA 2O0JA 2GYUA 2R6CA 5T4FA 1QFXA 2YWXA 4G8CA 2QRUA 4X91A 3DTVB 1V16A 3DOEA 2J0QA 2JJ1A 3WBBA 5FO1A 3BHNA 3B6IA 1ZEMA 2QRNA 5I51A 5IG2A 4XYBA 3DF7A 3C16C 1ZK1A 2VNSA 2B99A 3ZNQA 4BBPA 5L4SA 3DWIA 2C8JA 4JJZA 5FL3A 2NV0A 5ALRA 3U17A 2RB4A 3OA2A 1E9BA 2AYXA 4B8ZA 2WF6A 4LQCA 2OZLB 2YH2A 1W88A 4CDGA 1K2WA 3M70A 5CVVA 3M4YA 4XVHA 1GPDG 2D74A 3IIMA 3KQSA 2HLPA 2PAFA 3TDKA 1Y8AA 1YK0A 3NC0C 4GWKA 4UEJA 1H6BA 2PEYA 5JE8A 1GA6A 2FPMA 3O94A 3SR4A 3H2KA 3ZQ4A 1H2FA 1EFLA 4JJAA 1SCUA 2Q1XA 4RSMA 5TMDA 4D4JA 1CUYA 2GASA 4I36A 1M34A 2C95A 4UDNA 1TM5E 2VDPB 4HGNA 4Q4AA 4YMVA 2JF0A 1FVFA 4KO8A 4ESOA 3KQKA 3AVQA 4B87A 3RAFC 3V42A 4PHTA 1BG6A 3JD2A 1KR2A 2BJVA 2HMWA 3PWZA 4GDMA 2Z5FA 2EOAA 2GBCA 3BWYA 3DG9A 3SNKA 3CLSD 5TGZA 1ESEA 4C4YA 3KX2A 1E3DA 1PFQA 3W1EA 1MRZA 5EXSA 3UJ9A 3HXOA 5I3CA 1YWGO 1ZK2A 3VHXA 4O0MA 3ER6A 1HM5A 1IL0A 1RYMA 2Y0PA 3RWOA 3VPDA 1PJCA 4F84A 3K1AA 3ICWA 1CYDA 2EFYA 2Q2VA 1UJ4A 2VNIA 5AXCA 1UZAA 5JDCA 4ND2A 1AE1A 1AZWA 1VP3A 3NT4A 3TMKA 5AVVA 3I5XA 3V4RA 5JQGA 5EIWA 4HH1A 3RK4A 5INTA 1ZIDA 1L7MA 2V3VA 4TL9A 4GI1A 1SCDA 3SD7A 2XHZA 3A1NA 1AKYA 2CNWA 2QGNA 1QH1A 3L6UA 4NULA 1OKKA 5HCIA 4C4SA 1XPUA 2GFIA 3MMXA 4PRLA 3KYDB 1JBEA 1IRIA 1RAFA 1FZQA 5BSWA 4B40A 2YHAA 2IDZA 2P91A 1Y42X 3NHYA 2GAJA 4IXTA 1L4LA 1M8FA 1XZJA 2DYKA 3QKSB 1SWWA 4YAJA 5DHUA 5A5GA 2HR1A 3TNJA 1SHKA 1VE5A 2XUIA 4DZZA 1T3TA 1BXGB 3UT5A 5IYZA 2RHLA 2O8CB 4FPXA 4PYJA 3D8RA 1ONPA 2CXQA 1PFYA 1RXYA 2A9OA 1HDIA 4RANA 4K6MA 4F21A 2B37A 3H1GA 4CMIA 1IY8A 1QANA 3EB9A 3INRA 2EKQA 2VJOA 1L7QA 4XQGA 3O92A 1GV0A 1ECFA 1TYDE 3DNMA 3KKZA 3QV2A 4AJ1A 1PUJA 1MQAA 4R7TA 5A4MS 1Q6ZA 4MWZA 3VSDA 4WFIA 1FTQA 2ZUTA 3JWPA 2BFEA 4HAIA 4B35A 3E23A 3L04A 1ZKDA 2C03A 3MCZA 2J31A 4L0DA 4OJKA 2X0RA 4N48A 5ULLA 1J9ZA 1LNZA 2QD5A 5HKBA 5ICFA 1LD3A 2ZJAA 1W5FA 2I80A 3EGXA 1R4AA 1XZFA 3GBPA 4M99A 2A5YB 2XUDA 4YPOA 3TQFA 5H59A 1GSHA 2CFIA 5EE0A 4I9GA 5ITZB 1IJFA 4K9LA 3ERCA 4I55A 4BQQA 1RAAA 1B2LA 1JQAA 2BFFB 2V6BA 2OPHA 1ECGA 3HO1A 4MW0A 3VC7A 1SZJG 1U0TA 3AONB 3QE4A 3F4BA 4LZWA 1GGEA 1TRKA 2W83A 2NACA 4JB3A 4FYVA 5CK5A 5EZQA 1PI3A 2F1OA 3D7RA 3TLAA 4BO7A 2LIVA 3KZCA 3MELA 1NP6A 1JHQA 4I9NA 1CUSA 2BDUA 3ZH2A 1JIVA 1XEWX 1RKUA 1T2UA 2Q3BA 4OQYA 4BKQA 1AUVA 3Q5GA 1Z33A 3KKNA 1CRQA 4N40A 4X6YA 4BJ6A 3A3PA 4G41A 3HM9A 1X1DA 1EEHA 3MAJA 3OX3A 4N03A 4MEBA 2ZT7A 1UAGA 2R3SA 1QTRA 3BGWA 2ODEA 2OZKA 2COUA 4QPZA 3L8YA 1FSSA 5D84A 2YVUA 4IRXA 4UBMA 4D8TA 4HQKA 4C6RA 4EG4A 3H3JA 4QARA 3F8WA 1YB6A 1TA9A 2ID9A 5CM8B 4YJ3F 5G0VA 4ALKA 1UQUA 2QUIA 2DPMA 1GTG1 1HOXA 4U00A 2PS0A 1Z9BA 3LX4A 4YCDA 2CMFA 2JGDA 5G1OA 2NU6A 2PRJA 3N3BC 1DFHA 4IEIA 3PHJA 2PVPA 1IXRC 4JUAA 4OH7A 4WJLA 5EJAA 5HJ2A 1O94A 3SR3A 4EG3A 2R44A 4G09A 3KOZA 2XMSA 3ZPXA 2FK8A 4YTEA 4OK5A 1G291 3HVHA 3PGVA 2BGTA 4NIMA 1KY3A 3TKAA 4A23A 4XJXA 2ISSD 2CJPA 1J07A 2X6TA 5TT0A 4KMMA 2WTUA 4XEHA 3MGKA 2YJ6A 3IAM6 3B20A 1J33A 3FZQA 3ND7A 1W1UA 4HDMA 4WXPA 1FLAA 2P2GA 4Y7DA 3NP7A 3CZPA 2IZ0A 3OH8A 4FGKA 4RU1A 5TQ0B 4UNRA 5KNCH 4A0GA 3R9WA 3WWDA 1Z6GA 5K51A 2O7QA 1H94A 2NMVA 1SBCA 1HZZA 4R9SA 3C6QA 3IQXA 4GGMX 4C0WA 1OROA 4HVTA 4NG5A 4RAQA 4U39A 2NU9B 2CKDA 1WW3A 3V2IA 4KU4A 4OQZA 4YAKA 2HPZA 1V9LA 2E6KA 1IOZA 1Q0PA 4GR4A 4HNAB 1O95D 2W42A 3SHFA 2FUG6 4O4HF 4CMBA 3CISA 4Z0PA 1UL1X 3EC1A 4O4LF 3OU7A 1CUUA 3BILA 4WA7A 4TZ6A 1I3NA 3PEVA 3V7UA 1TLFA 2NUAA 1UKZA 2RGNC 3FBWA 4NZNA 5K1ZA 1WF3A 4JXKA 3WLMA 4B5KA 1OF1A 2YKGA 3U26A 3V4ZA 4EI2A 4AN0A 1W19A 1ZINA 1QKJA 4MUEA 3D7LA 4GKAA 1KZ7B 1XOIA 3Q8XB 3A6HA 3TW8B 2JLXA 4QM7A 2D5CA 3UMMA 4S04A 3EIHA 4MB2A 3CIFA 3WQSB 2ZIZA 3W2IA 5HGJA 3UJ7A 2Q1SA 4JJ4A 4C4RA 3AR9A 4B3JA 2VDUE 3Q3GE 1X7DA 1ZXXA 2ASEA 2F9FA 4LTMA 3RVRA 2GK6A 1AO0A 5AIAA 4GM1A 1E20A 1EWTA 4LRSB 2HWWA 4FYWA 3R7WB 4QU5A 1Z8HA 3ZGNA 1P1CA 2IODA 3IEIA 1DJLA 3RSGA 3RS0A 1ZVJA 2I3GA 2RBGA 4JEIA 4MMYB 3NVMB 3GU3A 5AP9A 1QORA 2WUFA 1IQPA 1VKJA 2Q5QA 3RIXA 3UJAA 1UMCA 1ZA2A 4R81A 3AJEA 4UREA 3AOGA 4BCDA 4CPDA 2I87A 4KOAA 1TPZA 3C41J 1VPTA 4QLOA 5COQA 3MMPA 4JIGA 4JLJA 4ZODA 3C24A 2JLUA 1DWPA 1SXJB 2PMCA 2XQVA 3OOEA 1W0KA 4U6NA 5F77A 1CY1A 4CMCA 2ZCJA 2YMQA 1GSIA 2YV3A 2Z95A 4PE5B 3AM1A 3NR2A 2ZATA 1A9ZA 4TXNA 4MUXA 2HGZA 1F12A 1BVUA 2YHSA 5IULC 4G5HA 4Z0TA 2NGRA 3VMFA 4Z53A 1ACMA 3BRWD 4KQWA 4IIJF 1BHQ1 3JD3A 3FHLA 3M4XA 4C0SA 4EHKA 4BRWA 1Z16A 4Q3KA 1RM0A 4LVNA 5EERA 3REQB 3HKEB 4L6AA 5KVVA 2ZUEA 2B34A 1TTHA 1H2XA 3JQPA 3NAGA 3DMGA 3NBFA 4XDYA 3VZCA 4I8DA 1VE9A 2WHXA 4X93A 4BNGA 3IVXA 1R8QA 5HDBB 2J07A 4MW2A 4DXDA 1PNTA 4UUOA 4Y67A 2YZ7A 2VUSA 3M1IA 1NNI1 2RHGB 1ESCA 3BQMB 4EDFA 3D02A 4GVXA 4LBYA 3S8EA 5EN4A 2PGLA 1RTKA 3JALA 4ZTZB 4ARAA 5KINB 4AROA 1LPBB 5EI5A 4DNFA 2R66A 3AVYA 4ES6A 1LFDB 2OR3A 5FTMA 3F6EX 1E96A 4RA9A 4FVTA 1SG6A 4CR6A 2HRRA 1VDZA 3CF2A 3HCWA 4E94A 3TUJC 4EYKA 1WZEA 3WNCA 3PXDA 1GPNA 1P5RA 1HFEL 3HCCA 5JNRA 1DO2A 4ZGBA 3TLGA 3ORRA 3IAFA 1BROA 1EG2A 3KD2A 4ISCA 1RZUA 5AVSA 3TQSA 3RD5A 1BS9A 3KAKA 4MA0A 4MUMA 3OJWA 3THWB 4Q9HA 4ESEA 1MX3A 5EZ6B 4JJGA 1U0SY 1M3SA 2V45A 4N3BA 3F7NA 1GKIA 3R23A 4GVLA 5IJWA 1RRCA 2GBLC 2GEJA 2NO5A 4OM7A 5I8ZA 4U2DA 4QEKA 3PFBA 1H4TA 4MPPA 3RVBA 3WGIA 2V54A 1IN1A 3D3KA 1UF9A 1RQGA 3OZXA 3U7FB 1XO1A 3D6MA 1E77A 1E5VA 4RKRA 1CQJA 3ESQA 2YTZA 3PC7A 1XTZA 1EFVB 3PWTA 3UZUA 4QC2A 3TD2A 5HNKA 5I6DA 4EPRA 3AL2A 4C06A 5BV8A 2PQ2A 1DUIA 1QF7A 2PIAA 5J2UA 5I7WA 3JQRA 1R0BA 1DZIA 5AVZA 4HXYA 3ZWCA 1H4QA 4EB6A 2NXNA 2JH8A 1V16B 4F56A 1ZN7A 1XNRB 2DLNA 4BUZA 1P0CA 1X86B 1X8KA 2YW2A 4KGZA 4L72A 4B73A 5AW6A 4TMZA 2GZSA 4P4LA 5FI0B 3NEJA 4LOHA 2NTNA 3K0HA 3OD5A 4W5NA 1TQ2A 2Z6QA 1WG8A 2OQVA 3TRIA 4ZAFA 3S81A 5T4EA 3P4YA 4U8HA 2Q5CA 5DZSA 4U3JB 3WWZA 2ECQA 3NQ41 4PLWA 3OZCA 3OKPA 3FSGA 1YRLA 5KYNA 3HA2A 4ON9A 3IT3A 1Z6AA 3EQ6A 2ZI7A 1VLVA 2VZLA 3AF3A 3AR4A 3H2GA 1GUZA 2PDAA 5DM1A 1KO4A 2IUUA 2Y0BA 1UJCA 2CLMB 4IUDS 4QUAA 4UDXX 3PHLA 2QAGC 3E5NA 3HN7A 1OGYA 5C5CA 5I45A 3WB2A 3BD9A 1DX4A 3L07A 4FX2A 4URVR 2ZJ2A 3G68A 5DISB 4F46A 3BA6A 3FMOB 3QJGA 4HXFB 4TLBA 5MGNA 4FD2A 4I8XA 2CNBA 1MOSA 3UJ8A 1D0SA 4XGIA 2R86A 3E8SA 4US2R 2C1EA 2WWIA 4QASA 3DXZA 1BRTA 3E9DA 3RAJA 2NZVG 3RIYA 2M32A 1NAHA 2FMUA 5KWVA 4RETA 3F2VA 5CCEA 5CBPB 1L4KA 2QQGA 2XCUA 4J0DA 4NCJA 4UE6A 3TR6A 4H77A 4CM1A 3N0RA 4KVAA 1X15A 1L8LA 3JWEA 3R3SA 3H2HA 3WADA 2GOYA 2ZIEA 1A4XA 1T3LA 2UUAB 3VYUB 4C0AC 4H3HB 1BA3A 3SX0A 2ODWA 4FN5A 5JH7F 3P27A 1Z2DA 4GT1A 1L4YA 3IPRA 1DKPA 3GFRA 3HJBA 4UHKA 4OU5A 2VPQA 2YWGA 2GYWA 2Z8ZA 1TZKA 1DTWA 4TRMA 5ECYA 4EGQA 1RHUA 1M10A 3L4BC 2VTBB 1AKWA 5T64A 4W63A 4Q1CA 3X1WA 4CTOA 2QLLA 2RH4A 3AB7A 3CEHA 2J41A 1KEWA 2A0YA 5H82A 1MXFA 1CR6A 2BBTA 2W0SA 5CLQA 1D4FA 1JTFA 2ZIVB 4FKZA 4C2UA 2OGWA 1YS2X 1ECPA 1F06A 4Y9RA 1MKYA 3RBVA 3WGVA 3RO7A 4DKJA 4JN6B 1KYXA 3Q3IA 2YXNA 2WEKA 3BE8A 5LZ8A 2DFDA 1KFEB 2E4AA 2P68A 5KTPA 2G25A 3G79A 2QT1A 2PKYX 3CX3A 4IOMA 1OXTA 4MUKA 1J2EA 4NU5A 4EHIA 2J0UB 1LSSA 5KTYA 1RHJA 5ICEA 2W8BB 1NKSA 3CLRD 2ZRNA 5BVGB 1U7ZA 3SGLA 3UATA 4E2WA 1E1QA 2PLNA 1IPEA 4WRRA 1LS6A 2JIQA 1RD4A 3IHTA 4UVIA 1SBTA 3C3YA 3DMTA 3EG9A 4P35A 5IM5A 2VTVA 4BMZA 2FR1A 2ZBVA 1F2TA 1XZIA 4JB0A 2R96A 3NM6B 1JDTA 1BD4A 2OHGA 3ETLA 1L5SA 4Q9LA 2VRNA 1A4IA 4FP9A 1N7IA 1U2EA 2G83A 1E8MA 4MCHA 2VQFB 4D9CA 3W5CA 3N6XA 1H69A 2KM1A 1I5RA 4UQLA 1UT8A 1U1EA 4LDPA 2N42A 3WLFA 4UARA 5I9MA 3RC8A 3IMEA 5DWDA 5AW3A 2R1UA 2EJWA 2C2WA 1BS1A 2O5VA 2XKBA 4PGAA 2GF9A 4YRTA 1CIVA 4AECA 2P6RA 3NOQA 2CFTA 4ASUD 2FZ4A 2H4YA 3O3CA 3ZGYA 4B8WA 1XTQA 2IOFK 5ALNA 3GLHB 4G4JA 3L0CA 2VJKA 3JV7A 4B09A 3ZD6A 2EW1A 2OVBA 2LV8A 2RFLA 2O0KA 3BL8A 3OPXA 3FIUA 3P2MA 3CLHA 3EGCA 2FRVA 3G0CA 3RTEA 3TLJA 3B60A 4CKWB 5F3WB 1V3QE 5KNCD 5AHWA 1F14A 1LPNA 2C1XA 1YQ9A 4DCTA 5EIBD 4C0JA 2H7CA 2EJBA 1IZ9A 4RVUA 1NXPA 1H5QA 1V8DA 2C99A 2WJPA 5E6UA 3S99A 2ZTMA 4ZALA 2LBPA 4ZARA 4XPIA 2ZE8A 1THGA 5EJ9A 4FQ8A 4L8YA 2WOJA 2IPNA 2ZRLA 4LJAA 4NE2A 2PJRA 5DBOA 3RRMA 4Z4IA 1Q0SA 1VCNA 1ABFA 1MZVA 3EEIA 1TMYA 2II6A 2PA3A 3LWNA 1MRNA 3RSQA 3WJ2A 1DTSA 2PWBA 4PSVA 2GD1O 4OL9A 3ROMA 3PLNA 1XP8A 3GQVA 3DDCA 4K3UA 5H70A 3V8RA 4HNUA 1NJ2A 4JYZA 4QO7A 1XRJA 4GXQA 3VAAA 4Y0AA 3TYXA 4NDAA 4O1MA 1K88A 4D6XA 1I14A 2CL5A 5K0BA 1NN5A 3VKGA 4OLJA 1F7UA 1QH1B 3GCZA 1BVRA 5GOTA 3A3YA 3VISA 4QQNA 4YCSA 3NXSA 1SB8A 2GZ3A 4HYYA 1NF3A 4R9UC 1TAGA 4HWOA 1JQ3A 3VGJA 4NNPA 2Q8PA 3TD6A 3SJUA 3Q40A 1XVTA 1ZS9A 5LVAA 2UYCA 4OHKA 5DNUA 5KVCA 3A36A 3DDZX 5KYUA 3O8OA 4RAOA 2QL5A 1FDIA 1ONSA 2VP9A 1ZWLA 4MVJM 5G40A 5C34B 1T9CA 4A8JB 3ZCSA 1RQXA 3B3JA 3DBHA 1N5KA 3AP1A 1XELA 3R6DA 3TFOA 4PLCA 5ED4A 4R05A 2QTVB 3L7JA 3N07A 2CVOA 4A0HA 2J30A 3E35A 1T0PA 3FRHA 4GPTA 3VGPA 1VSTA 4F6RB 1KE2A 2J09A 1AKEA 4J29A 4RPJA 1AZTA 3WIDA 1YBMA 4N7MA 3W9BA 1Z2NX 3AR2A 1G5RA 4O1IA 3E5MA 3JVVA 1NW8A 1NW6A 2FSIA 3ANMA 4OP3A 5LKAA 1ZSNA 3C5VA 1ZM7A 3P97A 2W6ID 4ND1A 3V1KA 2D3TA 4KPGA 4PSAA 5DKFA 4PLTA 1IN6A 1S9DA 5B4VA 1P44A 2C57A 1VIVA 1PFKA 4KXWA 2Y27A 4RMGA 1G3UA 1JVBA 3TGLA 1HSZA 1EVLA 3QVWA 3T7KA 3TRJA 1D7AA 4P3YA 2NXJA 4J4BA 1SEVA 4HEA1 4O2AF 5K3OA 5HZKA 1RPZA 3TLYA 3GA5A 2AQHA 3D1VA 1WIWA 1YHZA 2CEKA 3UAGA 3ESCA 5DYTA 4HQRA 3ULKA 4A91A 3GZJA 3OD1A 2EDCA 4PO1A 4PC1A 2LW7A 3KD3A 2WVAA 1OV6A 3GDGA 5BN1A 4Z3KA 4QDTA 3UK2A 3KJXA 2AF3C 5FPYA 1T0UA 2DPHA 5FUBA 1X13A 4WXHA 3UV3A 5JU6A 2KPOA 3WDMA 3FLBA 2BJHA 4FCWA 4JI0B 3N53A 1DCFA 2A9KA 2CVFA 3DDNA 1GZUA 4X44A 3QYAA 4UEWA 1RZVA 2CNDA 4P38A 3ZHYA 3M6IA 4LJ5A 4P3OA 4G1CA 5JLJA 3R75A 3LK7A 3NASA 2PLRA 5CGQB 1BQEA 1EP9A 1RRGA 1IHOA 2UUOA 3SF8A 3TPFA 4F72A 1TIKA 4CG2A 2RGDA 4FDAA 1HFJA 4IDOA 1ZOIA 2IEAA 3MYRA 3O38A 3CIOA 3BRCA 4FT4A 4NMHA 3GQBA 4DB2A 4M1QA 1YCDA 3D6HA 5BQXA 1JU4A 1HK7A 3PJGA 3E81A 5EZ5A 1G20A 5DHFA 5KYWB 5KPDA 5KJFA 2JJ2D 2NPOA 5CR9A 4QVIA 1JA1A 3X1KA 4X1IB 4ZCLA 3CW9A 2QVXX 2Q8NA 5ALUA 1RXVA 3V33A 5DTIA 3OBBA 1TYEB 2AQKA 1DEXA 4G5FA 4US0R 4EATA 5B3KA 1KI2A 4DGSA 1LWNA 1E2KA 1N6NA 1E9DA 2EZUA 4R2JA 5ITWA 2VQ3A 3GD5A 3KC2A 4HH4A 4MRNA 5P8WA 4AO7A 1DQNA 2FPSA 1DPGA 1I2AA 2NXWA 1RU3A 1QH0A 3S29A 2UYQA 1OI4A 3BTVA 2XTNA 4TV9A 4L95C 4NFSA 4YWHA 2V6FA 2AG1A 4XJSA 1KO7A 1SELA 2ZRJA 3CUWA 3M83A 5D01A 1FUKA 2XDQA 3PFCA 1TZCA 1E2NA 1QZZA 3IMKA 3DZBA 3ORSA 4ZCPA 2FAXA 4D97A 4GL4A 3PQ8A 3H7AA 1PSWA 5DDIP 4P3NA 2OK8A 2VHVA 1HRDA 2G77B 3JATB 2I99A 3K0AB 4GBED 5CURA 3PQ6A 4TRRA 4GUAA 4DCMA 1SH7A 3B2EA 4REQA 1T26A 1EFAA 4Y8VA 2IEBA 3INYA 4I4TF 4R2XA 1T3GA 2HU8A 2YL2A 4IJ5A 3X3HA 4CU2A 5CB8A 4EIWA 3KVOA 1QVAA 2C8VA 4X3PA 4Z54A 3O8NA 1ULHA 4A7PA 1JFSA 4Z4FA 1SVUA 2BSXA 3KTDA 4LV6A 2OC9A 5DSZA 4MEJA 1RYBA 1PZXA 2A9RA 1GPYA 4F8JA 5IU6A 2ZU0C 1U3CA 4XIFA 2V97A 3SZGA 4B4UA 1YS9A 4COOA 3HP1A 4ZO4A 2B6HA 2Z1MA 1FPQA 3PBKA 1P2GA 4BE9A 3IX7A 1CUHA 2ZJ5A 5I4CA 2HDWA 2WABA 4R84A 5J1SB 2FUEA 1M1YB 4FGWA 2C4MA 2R6DA 1WQ1R 2GAOA 1VL2A 1JKJA 3WIUA 4EHBA 1IEQA 3GV0A 3TCXB 3WGJA 5DT9A 3BT7A 4CV0A 4Y6QA 2FK7A 1Z6XA 3WIOA 3HPRA 4NV1A 2JCYA 1K06A 1P9LA 2NM0A 5IN5A 1S3GA 2PD6A 1MHPA 1OYWA 3IPAA 4P9NA 1U0OC 2PKXA 3F96A 2JBHA 4WLEA 2GPAA 5CJJA 4JA2A 1XPJA 2ZIUB 2ECOA 1VE3A 3I12A 4MSUA 5A4FS 5B12A 1W7AA 1LZLA 2YWFA 2Q5LA 3B9BA 2GK3A 3I6MA 3P9RA 1XE3A 3LQFA 1E3SA 5EIOA 4PC6A 5CM9C 5C7OO 4KO4S 4D96A 2QGZA 1EVJA 2QLMA 5L51A 5L95A 1D03A 3HA3A 3C3DA 2IS6A 2YS7A 4WLFA 4XFJA 3A4TA 1JKFA 2HK6A 4QDXA 1NONA 3CPJB 1JEEA 1WY5A 4XCQA 1U8CB 4MV0A 4JOBA 1B0AA 3DJFA 2IYNA 2RGBA 3LKBA 4NU6A 4CI9A 1DX9A 3OT5A 2R8OA 2WHEA 2YVQA 3EFEA 3HUTA 3TRKA 1XGKA 4PIVA 1E2HA 3QUCA 4PNPA 1OBVA 4WECA 3COSA 3WLKX 4PZDA 1V37A 2IJGX 1P5FA 1ZFNA 3QGMA 1S2MA 2PBRA 4CN9A 1PT6A 1HDRA 4B3SB 2CDCA 1FL9A 4QNMA 4BATA 5ETJA 2GFHA 2LGJA 1UDBA 1KAHA 1N8SA 4GYJA 4OUDA 5DBEX 1R15A 3QVXA 4DCPA 1P6QA 3ANYB 5MN4A 3GG9A 4ZOCA 1LSJA 3ZU2A 1ZD9A 4E4YA 3BBPA 1PQ4A 1Y1PA 1ODJA 2VSQA 3ICCA 1EZ4A 2P77A 2XD4A 3L79A 4EY6A 2QTZA 2XLCA 1GTZA 3LQKA 2Q3HA 4HFJA 3UJ6A 1NUAA 3L18A 1RIFA 5KHOC 1C8VB 3KCQA 2JCBA 3L0OA 3TXAA 3A6FA 2F90A 3SPXA 1KBOA 3S4YA 4EM6A 3CR8A 5JAOA 3BKXA 5SYMA 2WYVA 3OZTA 4Y9SA 1A5ZA 1JNXX 2AJTA 3P2JA 3R40A 3QW2A 2XCIA 1R88A 4MVJI 5A02A 2DR2A 1RI2A 1QKIA 4PC3A 4WL0A 1BDHA 1W9MA 1LCIA 3H86A 3IB3A 1Y89A 2ET6A 4P92A 3PX3A 1U3GA 3HGMA 4YP0A 3FCAA 1L8OA 4BU0A 4QLAA 4WCDA 1H4SA 4DXHA 4W1RA 1N2OA 1FX0B 2ZS9A 4QX6A 4XM2A 5JAUA 1WUTA 3TW6A 1TO6A 1OBOA 3DYVA 3PGA1 4Q3NA 3S2UA 2I2CA 4N9WA 4UMFA 1TCBA 4L0CA 2E82A 4FQ7A 5EFZA 4XE5A 1RCFA 4OIFA 2AOWA 2NP7A 2I7VA 3ZQJA 1QLJA 2AFIB 2YZMA 2GCNA 1MO5A 1NLFA 1RP1A 1V1RB 2IOYA 3OQIA 3WVNA 4CODB 2FDXA 2VDVE 4N3NA 1VRWA 1SO8A 1BRMA 3T15A 2FZGA 2NW6A 2G9VA 2VXOA 3TQIA 2JHCA 4L0MA 3H3FA 2H4HA 3FAZA 1NQTA 1AX9A 5BOSA 2XI4A 2ENWA 1DJNA 3EXG1 3I2KA 2XV1A 3M1LA 4NARA 1HI9A 3IAUA 1HE5A 1A50B 2Q3JA 4DS3A 5CFPA 5CNMA 1S02A 1VPLA 2B2XA 2QMYA 4UDOA 4KAJA 3BMCA 1JFFB 3GC6A 2AVNA 5F78A 4XQ0A 3IPYA 1T2AA 2W22A 4V0SA 3TX6A 4TTIA 4W82A 2YDXA 5JPCA 4I4LA 1JHZA 1NOKA 1RHKA 2J85A 2VPTA 2D1TA 3AM3A 3MRTA 2JFFA 3H6KA 3QXXA 4RHCA 3S2EA 3PUZA 2JIDA 1FY2A 1DAHA 1NDUA 1K92A 1O54A 4X7BA 4CHGA 4LXHA 3WAGA 3C5HA 3L93A 3UANA 4EF5A 4KE9A 1PTJC 1Q7EA 4MYCA 1QG4A 3AIKA 1TFRA 3BEOA 3EA4A 3G8CA 3M81A 4L7VA 5EWMB 2HD4A 2BFBA 2RSLA 4P5PA 5KQPA 1IM2A 1UZNA 3WRYC 4U7HA 4KVZA 3TEJA 1RFLA 2XITA 4O4JB 3IDOA 3ENZA 4CIVA 2NADA 1IXZA 1NLMA 3CVOA 1QE5A 5EJ2A 3WMGA 1P1IA 2VHZA 1ZGGA 2BGRA 3A9UA 2A1IA 2R6R1 4PBTA 4UBKA 1P9WA 4BO4A 4BY9E 4PN3A 1FW8A 3DAPA 4HAOA 1AD2A 2GM9A 4GPAA 3QEMA 4HUJA 4ER3A 1XDSA 4W99A 2WG2A 4Z99A 5JVDF 2P69A 2W4IA 4P4NA 4F4UA 2OQRA 4M1OA 2BFPA 2ZRMA 3RKRA 3WC4A 4E1BA 3LCCA 4V0LA 3Q3HA 1GOTA 4UAVA 1CUCA 2HA0A 3KJGA 3RODA 3U3OA 1V41E 2CK3A 5JZBA 1XD2B 1L3IA 1F0NA 2FOIA 4EB6B 2DHDA 2RJOA 2QRLA 5FBQB 5IAGA 1FMJA 2E1RA 4RZ3A 4Y3UA 2R0QC 1G16A 1JXAA 1S9HA 2ZR7A 2AR9A 3E1KA 3E9YA 1ECJA 3GN1A 3N9IA 3H5WA 2H17A 2Z5LA 4FNMA 3WJ7A 5LQKA 3RWBA 4BX9A 4I5DA 4ZYVA 2F43B 3VZSA 4K5QA 3CUSA 1PT7A 4FFNA 3T9BA 1M0WA 1YCHA 1GVHA 2O4CA 5T3YA 1FP6A 3R7BA 4DMFA 4BVBA 3BUSA 2I71A 2IYYA 4QECA 1EESA 3L8GA 4DDWA 3O1IC 1CQWA 3PHBE 1WNTA 3HJGA 2GKOA 4MCAA 4HWSA 4EG6A 3VR0A 4MVYA 2QLNA 5EVCA 2DFTA 2IIVA 3BWDD 4ZANA 1G5QA 5FEUA 3KOMA 3QU4A 2R47A 4DBLC 3AZQA 5DLPA 4WKGA 4RGQA 1YIDA 4GKJB 2AMYA 1RQPA 2CHGA 3PI7A 2CBXA 4C03A 3U0VA 1NYQA 1T24A 3USES 4HRAA 4V2IA 5E0KB 3T95A 3RTCA 5B57C 4X20A 5HQJA 5JD6A 1OAOC 1AK1A 2ZPUA 2SECE 4RXMA 2NPFA 1QHHA 4FCVA 5AW2A 3MFYA 3O5AA 1AGRA 1U0HC 2I03A 4BB5A 1DDGA 3P32A 2ID7A 4DLXA 3PQEA 3DKVA 5CW2A 3GYGA 3P2YA 4YRPA 1VHTA 5EXXA 4KI0A 4A2WA 3ZVMA 1GUFA 2PZ8A 3LPNA 4JFAA 5I5GA 2EG9A 4CETA 2ECPA 4IAOA 3IXMA 2QTMA 3NWBA 2JRCA 2PRIA 4CLDA 1ZJ6A 4QWMA 3ZNPA 4EEKA 4F3TA 3WO0A 4X8OA 1XTTA 3DV0A 4IZOA 3RF6A 3WZ2A 5JXIA 1QHFA 1I1QB 1TT5B 1KHHA 4EVSA 2Q2QA 5KSYA 1QPZA 4Z6KA 1Y9EA 3IIJA 2HF2A 2IYTA 4ZK6A 2R87A 1QH8B 2H16A 2WNIA 3DZCA 2ZDHA 1TVKB 3IB6A 4G0PA 3EDCA 3DE6X 4MQFA 3CE6A 3VNQA 3E3OA 2YOGA 2X1HA 3PQ7A 5IVDA 1Y6RA 4YCBA 4UM7A 4FFSA 1IFXA 1JE0A 3AEKB 4BYGA 1MW9X 1JPVA 1S96A 2YHIB 1PWXA 2WMYA 2V58A 2ZSIA 3AY0A 4HMOA 4MVJP 4HGRA 3DAYA 1DS6A 5L40A 1EWKA 3IIEA 4JDPA 2XEXA 1NBWB 4HB0A 2D5BA 3GY0A 1ZAYA 4NCBA 1SNYA 5G02A 2B0CA 3CLTD 3MJRA 3RW9A 4KJXA 3DQZA 5DX8A 2ISQA 4S24A 3U49A 3E27A 1AU9A 1N34B 1ADJA 1Y3HA 3BDAA 2IPAB 2NZYA 2WUWE 2Y1WA 2UZ4A 3LT5A 4Y2SA 3RI3A 2VT2A 5DN9A 3RVSA 4AULA 3TWOA 1N7JA 4II2A 1BH6A 4YRZA 1DU4A 2C9CA 1JTVA 1YI0A 2ZRPA 4K40A 2HBQA 4RZHA 5IAEA 4EVQA 1H8ED 1SUBA 2AS0A 4ZZ0A 1SEPA 4CF4A 3EA5A 1XT6A 3A4VA 4S35A 2H18A 1ENOA 2Z1NA 3JQ7A 4FBGA 3ZX4A 2WWHA 2PSHA 2Z08A 3MJDA 3GRPA 3PQ4A 4IHKA 4Q3CA 4I4NA 4POAA 5FADA 3UKOA 3CB2A 4CM4A 4ZYUA 5JBQA 2WINI 2QZ9A 4MGYR 2IS2A 5L53A 2XT0A 5HPYB 1G4HA 3STUA 3RVNA 3EXEB 3C43A 1L7AA 3EWAA 3RS9A 3VO9A 4WNCA 4I2NA 1HE8B 2HAEA 5AVRA 1E69A 1ACJA 4ZU3A 1GIAA 3HI4A 4ROTA 2W9XA 3PGJA 4S1WA 2VC2B 3DM5A 4D9BA 1J8VA 4D80A 4LXGA 2DC1A 3W2EA 4QOJA 3SEZA 2EL7A 3ABRB 1NDHA 5C18A 4UEQA 1T5HX 5HBRA 2EKPA 1LPPA 3AVTA 5FPHA 1N2ZA 3DGEC 5FWDA 5CDFA 1ZGJA 4C22A 4DLLA 3QPCA 1GZDA 2DLDA 2CLSA 3IUYA 4LEIA 4HPJB 3QKIA 4QGAA 1C0EA 1P74A 3B2QA 3KWMA 1KQPA 3MQ4A 3QPBA 2R1TA 3WLTA 4FZVA 1IB6A 1M9NA 1KYYA 5DGDA 3Q41A 3WSVA 5BR1A 4M0CA 4MPJA 5A1TA 3RYHB 2F64A 3H9UA 3UFXA 5JNWA 1THZA 3GJTA 4HYQA 4J07A 1U7TA 2GMWA 1DX6A 2B2NA 3HB4X 3IE2A 3IV7A 4Y2TA 3AQ4A 3UYLA 2E4ZA 5CG1A 2HPAA 2L2QA 2VEOA 1QCDA 2IYQA 2CVZA 6NULA 3DPSA 1QBKC 1J0BA 3MERA 3PS9A 1T3HA 1EBBA 2YYAA 2D13A 2QP4A 2AUMA 1TA4A 2H5EA 2QE7D 3OHPA 1Y6FA 5FA5A 3ZY6A 5B7QA 5AJXA 5LQUA 3PYLA 4PQFA 3K6JA 3JQ9C 4OYHA 2X0JA 2FPGA 4FFPA 1NPYA 1QHXA 2VUHB 4KN5A 1I4EB 4QIHA 1UFQA 2FUCA 1WTAA 4CUKA 3GRUA 3FZEA 4MAAA 4QQKA 2DFKB 1MG5A 3E3NA 3OLXA 3ACCA 4IIFA 3UHFA 3V2GA 5TVKA 1N7GA 1FDWA 1G5HA 2HSEA 3FYDA 4KVGA 1VHDA 4TTJA 3OPYI 5BSMA 1H05A 1RJ9B 3E9RA 4P31A 3WISA 3KUKA 2O2EA 3RROA 4KXFB 1DGQA 1PR0A 2I6TA 1WS6A 1NQXA 4X7PA 3PICA 3TIGA 3PTAA 1OIXA 1CEYA 3NFYA 5AHKA 2FN7A 2OHHA 3RGWS 4F60A 4MCJA 4EA8A 3P0HA 4IGKA 1NNSA 1A9XB 2HLDA 1F9AA 2CJYA 2ZE6A 1R12A 3RC9A 4ZP1A 4AB1A 2ZWVA 4BJ5A 5HJ7A 3U44B 1JJVA 4N3CA 4FTWA 2JHPA 5H5JA 2QSYA 2VJYA 2WIGA 3T0GA 4CT0A 4F1KA 4DJTA 3G49A 1Z37A 2F8MA 2JAOA 3DLAA 4O4IA 4D4HA 1QMPA 1USGA 2W6QA 3BRQA 3C6KA 3HYCA 4R9RA 2WM8A 3OZFA 3CJTA 5FI3A 4BRZA 3M2PA 5IKPA 5AM1A 5JH7B 1P60A 3NNNA 4PZPA 4ZHSA 1WMSA 4MQ4A 2ZR8A 4REOA 1GNLA 2YFHA 4MW1A 3E7DA 4YDHB 4TSRA 5JSZA 4KKVA 2ZRQA 4P36A 2ZTSA 1MGOA 1WCIA 4LY0A 4AZ0A 4BO5A 5KC8A 1KFKB 2CLIB 3B53X 3IIKA 5DHQA 1Z22A 1UP7A 3FDJA 2FPIA 3D8BA 2WVGA 3PRYA 1U8TA 2QZPA 1YA4A 3A0UA 3PEEA 1RCTE 5K0LA 3G7UA 3W5SA 5FA6A 2ASVA 2Y1EA 4MUFA 5LBIA 2VK8A 1OZFA 4HOYA 4LF4B 2D2FA 2QUZA 3IMCA 1X7YB 4KG7A 4RXTA 1XJWA 3O8CA 5C31A 3D2CA 2Z83A 3NOXA 3RS7A 4PG4A 3MBKA 1XRRA 3NUZA 2WICA 3V4LA 4MDYA 1I1NA 1YQEA 4MGZR 3FYTA 3SKXA 3IEVA 3IVGA 3BZBA 3NETA 3ZGLA 4F2WA 3QEBZ 1FQKA 3CW2A 3T38A 2PG3A 3CRMA 2IH2A 2YN2A 3L7AA 1UWCA 4QYIA 4R2KA 2FB9A