1DC9A

Properties and crystal structure of a beta-barrel folding mutant, v60n intestinal fatty acid binding protein (ifabp)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
b'AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTESTINAL FATTY ACID BINDING PROTEIN
publication title Properties and crystal structure of a beta-barrel folding mutant.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1999-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1dc9A00
3PPTA 1TW4A 1KZWA 2RCQA 1FENA 1VYGA 4IAWA 4OS0A 5F1EA 3HK1A 4TNNA 3T1DA 5IO5A 5L8NA 1GT1A 5IO7A 5LKFA 1MDCA 4XMGA 1I04A 3HWDA 1LPJA 1MX8A 2OZQA 3EYCA 1LIFA 4LKPA 2ACPX 1X8UA 3EBWA 4TLJA 1B8EA 3K3LA 1DV9A 1ADLA 1B0OA 2HYSA 4ZHHA 1UREA 5H9KA 1IW2A 4OMXA 2FTBA 1KZXA 2WUTA 4YCEA 2OVEA 2IFBA 4OMWA 3FMZA 4ZHFA 1U17A 3B2LA 3NADA 3IFBA 4AYHA 5BVTA 1X8PA 3G7XA 1YIVA 2Q39A 4LZVA 5H9LA 3WVMA 4AZMA 1BSOA 2KT4B 5HCEC 4ORUA 5H9NA 1OEKA 3FR4A 2WR6A 3P6DA 5HWZA 3CWKA 4AZNA 2K23A 2GJ5A 3NX1A 3BDRA 2A2UA 1AVGI 1NP4A 4HFOA 4RUUA 1MUPA 3HWGA 5EEEA 4GRJA 1HMSA 3F8AA 1ACDA 2X46A 4I3BA 2G79A 3MBTA 1B4MA 2FS7A 3BSZE 3BX7A 3I17A 1EIOA 1BLRA 3PEDA 3CMPA 4QGWA 1PM1X 4LZUA 1A57A 1SA8A 1BSYA 2FT9A 2HMBA 1HMRA 2N93A 4I9SA 1JJJA 1O1UA 3EBKA 1JBHA 1QFTA 5EPQA 4QZUA 1B56A 5D8JA 5IO6A 4AZRA 1PMPA 1QWDA 2R56A 3KFFA 4IB7A 4NYRA 4YCHA 1SXXA 4ORSA 1EW3A 1I05A 5HAEA 2QO5A 4QZTA 3U9PC 1PBOA 1E00A 2RQ0A 1R0UA 3B2KA 4EFGA 3AKNA 1RLBE 2LKKA 3FA6A 4BQUA 1BJ7A 2QM9A 3CQNA 5HZ6A 3WJEA 4WFUA 4ZFXA 1GKAA 3TF6A 2AT6X 1CBQA 1E5PA 2FLJA 4KIIA 1S44A 1S2PA 2XKLA 3FA9A 1FE3A 5KHPA 2GC9A 1O1VA 1U0XA 3UEWA 1LIBA 1KT5A 4ZGUA 4ZH9A 3APUA 2ALLX 4QYPA 1TVQA 3D97A 4EEJA 3NQ3A 4D6AA 1ZNLA 1LF7A 3I0AA 4NNSA 2FR3A 4D6BA 5LJHA 1BM5A 4UU2A 5K06A 1T0VA 3KFIA 2ACOA 2JU3A 4Y0QA 5HZ9A 1SXUA 4IB8A 3ZUIA 4DQ4A 3FEKA 4YGHA 5C0NA 1TXLA 3STNA 1I06A 1OPBA 5D47A 2NNQA 4IB9A 1A3YA 1XCAA 4WBKA 1GKAB 2A3FX 3ZQ3A 2FR2A 1FELA 4MVIA 5FAZA 1FEMA 2WQ9A 4ZHGA 1X89A 4AZOA 4OS8A 1SXYA 1TOWA 1JJXA 5LJKA 1YWBA 4ORRA 1AELA 3EMMA 1P6PA 3C78X 3ELZA 4CK4A 4ORYA 4M7MA 3FIQA 2R74A 3NX2A 2L68A 2LBVA 3TGAA 2ASNX 1YWCA 4DQ3A 2QO6A 1EIIA 3P6EA 4IBAA 5LJBA 3Q6LA 2YG2A 1KQWA 3QKGA 4ALOA 4QGVA 2AT3X 5KIDA 4HPBA 1LKEA 1JV4A 1MVGA 4BVMA 4ARHA 1KT6A 4YDAA 1L6MA 2NP1A 1BBPA 1RBPA 2NNDA 1CRBA 5H8TA 4ZHCA 3C77X 2CM9A 4WFVA 2JN3A 4IMOA 4ORXA 5D4AA 4AZPA 3BU1A 1HQPA 5EZ2A 3FENA 3FR5A 3TZSA 1U18A 4ZR2A 1OEJA 2QOSC 3VG2A 4YH0A 1HBPA 1NP1A 1KXOA 2MJIA 3PECA 1GM6A 1MX7A 1D3SA 5LJEA 4GNWA 4A8ZA 4ODDA 2A0AA 3WBGA 1QFVA 1QG5A 3P6HA 1YWAA 2HZRA 1D2UA 1BRPA 2FRSA 4IAXA 4I3CA 4ZCBA 1ZNDA 3P6FA 1G5WA 5HBSA 1YP7A 3D96A 1KT4A 4TQ2A 1KT7A 1IIUA 3ELXA 2PY1A 3AKMA 1IKJA 1CBRA 2CM4A 4HPDA 4LKTA 1ICMA 4IB6A 1GT3A 3APXA 4QGXA 3KZAA 2LBAA 2G7BA 2MO5A 3NP1A 1EQDA 4K19A 5HTDA 5HA0A 1CBSA 4ZHDA 1OBUA 5HZQA 3WXQA 1ERBA 3PH6A 2Q2MA 3P6CA 4NP1A 3STMX 1DZPA 1ERXA 2JOZA 1UZ2X 3APVA 4GH7A 3FA8A 5BVSA 5D45A 4TKBA 1LNMA 1G74A 5BVQA 3FEPA 1HN2A 1O8VA 3TGBA 3MVFA 4MVKA 1SY0A 5CE4A 3JSQA 1JYJA 1X8NA 3FW4A 4YBUA 3BLGA 3O2YA 2RCTA 1OBPA 4YFQA 4I9RA 1ZNGA 2O62A 2F73A 4EXZA 1GX8A 1E06A 1EPBA 1S7DA 1BWYA 1I4UA 2L5PA 2Q9SA 4Y0RA 3WJDA 3WJCA 1ICNA 2FS6A 3VG3A 2Q2PA 2XSTA 5DPQA 3FLLA 1DZMA 4TJZA 4BOEA 3VG4A 3S26A 2WEXA 1AQBA 1QABE 1XKIA 3BU9A 3DTQA 4N7DA 2E4JA 4YKOA 2GTFX 3SAOA 3U0DA 4NLJA 1BSQA 3FR2A 5D48A 3HWFA 4XMCA 5HZ5A 5F6BA 1DF3A 4GKCA 1E02A 4XMFA 1VYFA 1X8QA 1BRQA 1EPAA 5L8IA 4IMNA 3BY0A 2K62A 1ML7A 2W2FA 3DSZA 1DZJA 3FELA 3WJFA 4UU3A 4Y0PA 3APWA 3B2HA 1SY1A 4YBPA 3STKA 4I3DA 4Y0SA 1KOIA 2NNEA 3RSWA 3CBCA 1KGLA 2OFRX 5LJGA 3RZYA 2EU7X 2R73A 5LJDA 1N0SA 3UEVA 4XMHA 4YMYA 1EXSA 4ZJ0A 2FWVA 1GGLA 4NNTA 5KICA 5F6ZA 1QY2A 1JYDA 2HNXA 4M6SA 5HTEA 5B27A 4AZQA 4QAEA 1LIDA 3PP6A 4ALBA 1CBIA 2AT0X 3CQRA 3CBSA 3KQ0A 4XMDA 3ZUOA 1CJ5A 3TGCA 2AT8X 4NYQA 2CBSA 2AH7X 1IKEA 2CZUA 1GT5A 1BEBA 4A60A 3D95A 3NR3A 4TKJA 4A1HA 5HCCC 2JU8A 1GX9A 1HMTA 4GETA 2WQAE 4AW8A 2MM3A 2CBRA 2LB6A 5B29A 1X71A 2P8GA 3WJGA 1JZUA 1EUOA 1OBQA 1DC9A 2A2GA 3BS2A 3L4RA 1Z24A 2X45A 3JS1A 3UEUA 4PSQA 4GE1A 2BLGA 3OJYC 5F7GA 2WSJA 3VG6A 1A2DA 4MVLA 1ZNKA 1ZRYA 3NQ9A 1QY1A 3UEXA 2AL0X 1FTPA 5EDCA 1EALA 3O19A 2LFOA 2OFMX 2RD7C 2QO4A 3IA8A 1LFOA 2HLVA 1VPRA 5JR8A 5LJCA 1YWDA 4OS3A 1LIEA 1OPAA 2DM5A 1T8VA 1DZKA 1YP6A 2RA6A 5L8OA 4GNYA 2A13A 3FW5A 5F58A 5LKEA 3EM0A 2AT5X 3BRNA 1G7NA 2OVAA 3NPOA 1ZNHA 4N7CA 3O22A 5HA1A 1QQSA 4NLIA 4YFPA 5HZ8A 1GXAA 4O9SA 4QYNA 2WEWA 3P6GA 1G85A 1HBQA 1IFBA 1NGLA 2JU7A 3KFHA 3F9DA 4YGGA 5FENA 1GT4A 1QY0A 4YFRA 1YUPA 1H91A 2G78A 5EEDA 5HCDC 4YGZA 3HWEA 1LICA 3KFGA 2Q4NA 3BX8A 2W2AA 4TKHA 1T68X 4ZH6A 2W2BA 1AB0A 1X8OA 4YKMA 2CZTA 2AMMX 2POAA 2L67A 1SXWA 3FA7A 1SY2A 3PH5A 5H9AA 3VG7A 2OVDA 4R0BA 2WWPA 4HPCA 3VG5A 5FFHA 1IFCA 5DG4A 1KT3A 1KQXA 2HZQA 4ES7A 1SY3A 3GAQA 1FDQA 2KTDA 3CR6A 4EDEA 4YDBA 5EDBA 2ANSA 1DFVA 1TOUA 4ORWA 1PEEA 4A1YA 2AKQA 2L9CA 3B2JA 3C76X 1OEEA 4HPAA 3B2IA 3WJBA 4RUNA 4XMEA 1A18A 1ZNEA 3U03A 1ALBA 5AQ6A
chains in the Genus database with same CATH superfamily
3PPTA 1TW4A 1KZWA 1STRB 2RTHB 3AUMO 1Y53X 2RCQA 1FENA 1VYGA 1Y52X 4IAWA 4OS0A 3HK1A 4TNNA 5F1EA 2PI3O 3T1DA 5IO5A 1GT1A 5IO7A 5LKFA 1MDCA 2BT9A 4XMGA 4KC7A 2ZSCA 1I04A 3HWDA 1LPJA 4U8UM 1MX8A 2OZQA 2Z4IA 3EYCA 1LIFA 4LKPA 5B5GA 2A5BA 2X34A 5K68A 2C1QA 2ACPX 1X8UA 3EBWA 1VWHB 2X8SA 4TLJA 2RTIB 4Y59A 1SWLA 1SLFB 1B8EA 3K3LA 4O3YA 1DV9A 1ADLA 4Y5DA 2X56A 4GDZA 5JD2A 1SWDA 1B0OA 1VWDB 2HYSA 3VHHA 4JNJA 1UREA 5H9KA 3WYQA 1VWLB 4ZHHA 3S5VA 1IW2A 4OMXA 2FTBA 1KZXA 2WUTA 2FKJA 4YCEA 2OVEA 2IFBA 3FDCA 4OMWA 5FQ7E 4BX5B 3FMZA 4GJVA 2RN4A 4ZHFA 1U17A 3B2LA 3RY2A 3NADA 2KW1A 2RTOB 3IFBA 4AYHA 5BVTA 1X8PA 3G7XA 1YIVA 2Q39A 4LZVA 5H9LA 2I5VO 4ON1A 1JMZA 3HOLA 3WVMA 4U8UN 4AZMA 1BSOA 2KT4B 2IZGB 5HCEC 4ORUA 1VWPB 1OEKA 3JQOA 3FR4A 2WR6A 3P6DA 5H9NA 5HWZA 3EW1A 1SWCA 3CWKA 4MEEA 4AZNA 2K23A 2GJ5A 3NX1A 3BDRA 2A2UA 1I78A 1AVGI 1JMXA 1NP4A 1SLGB 4HFOA 4Z2PA 2BSZA 2C4IA 4RUUA 1MUPA 4CDFA 3HWGA 2QCBA 5EEEA 1SWTA 4GRJA 1HMSA 3F8AA 3GE2A 2RTFB 5B3MO 4CPFA 2RTQB 1ACDA 2X46A 2Y32A 1VWBB 2G79A 2FGSA 4I60A 4I3BA 3MBTA 1B4MA 2FS7A 1Y9LA 3BSZE 3BX7A 2AVIA 3I17A 2DJGA 4DCBA 1BLRA 1EIOA 3PEDA 3CMPA 4QGWA 1PM1X 4LZUA 1A57A 1JQPA 1SA8A 1BSYA 2FT9A 2HMBA 1HMRA 2N93A 4I9SA 1JJJA 2X8TA 4FBOA 2A5CA 1O1UA 3X00A 4IRWA 1KFFA 2F09A 3EBKA 1JBHA 1QFTA 5EPQA 4QZUA 1B56A 1STPA 3S60A 5D8JA 5IO6A 1VYOA 4AZRA 4DNEA 1PMPA 1RSTB 1QWDA 2R56A 3KFFA 4IB7A 4NYRA 1N9YA 1LCVA 1FJ1E 4YCHA 1SXXA 4ORSA 5BYPA 2IZHB 2C1SA 2CAMA 3T2XA 1EW3A 1I05A 5HAEA 2QO5A 4QZTA 3U9PC 1SWPA 1PBOA 5F2BA 1E00A 2RQ0A 4ZGFA 4CDDA 1R0UA 3B2KA 3VE2A 3AKNA 3VHIA 1RLBE 4EFGA 2DJFA 3PK2A 3EC5A 2LKKA 5IRUA 3FA6A 3NQKA 4O4UA 4BQUA 4EQAC 1BJ7A 2QM9A 3CQNA 2LA7A 3P02A 3WJEA 4WFUA 4ZFXA 5HZ6A 1VWIB 1GKAA 3TF6A 4KT5A 2AT6X 4GD9A 2KTSA 4MISA 5L8NA 1CBQA 1E5PA 3CKFA 2FLJA 4KIIA 1S44A 1S2PA 2XKLA 3FA9A 1FE3A 4GDAA 5KHPA 2GC9A 1O1VA 1U0XA 3UEWA 1LIBA 2RTCB 1KT5A 1LUQA 4MVEA 4KH8A 4ZGUA 1VWEB 1SWJA 2JMBA 2OL7A 4GGRA 4ZH9A 3APUA 2ALLX 1NBXA 2X32A 4QYPA 1SWKA 1TVQA 3D97A 4EEJA 5AEOA 3NQ3A 2OL8O 4BX6A 4D6AA 1ZNLA 1LF7A 3H3IA 3I0AA 4NNSA 2FR3A 4D6BA 5LJHA 1BM5A 4UU2A 5K06A 1T0VA 3KFIA 2ACOA 2JU3A 1NQMA 1VWQB 4Y0QA 5HZ9A 1SXUA 4IB8A 1DF8A 1HXZA 1MM9A 4O49A 2GTLO 3ZUIA 4DQ4A 3FEKA 3WZQA 4YGHA 1UYNX 5L3YA 4JHQA 5C0NA 1TXLA 3STNA 3T6FA 1I06A 4HWMA 5CHKA 1OPBA 4L3RA 5D47A 2NNQA 2IZAA 1A3YA 4IB9A 4U46A 1XCAA 4WBKA 1GKAB 2A3FX 3RDSA 3ZQ3A 2FR2A 2IZCB 5FQ6E 1FELA 4MVIA 5FAZA 1FEMA 1N9MA 2OF8A 2RTMA 2WQ9A 5CSEA 1X89A 3VPJE 4ZHGA 3QQ2A 4KC8A 1SWBA 4AZOA 4OS8A 1SXYA 1TOWA 1JJXA 5LJKA 1YWBA 1SWOA 2KD2A 3WYPA 4ORRA 2RTNB 1AELA 3EMMA 1VWRB 3HPEA 1P6PA 2IZIA 3C78X 3ELZA 4CK4A 1MEPA 1W6FA 4Z2VA 4ORYA 3VGWA 2GH7A 4BX6B 2RTEB 3FIQA 2R74A 3NX2A 4M7MA 4BJ8A 2L68A 2LBVA 3WZOA 1PBYA 4WHIA 2ASNX 1YWCA 3TGAA 4DQ3A 2QO6A 1EIIA 3P6EA 4PJ2A 4IBAA 5LJBA 3Q6LA 1K24A 1KQWA 2MHDA 2YG2A 3QKGA 2MF6A 4ALOA 4QGVA 2AT3X 5KIDA 4O3XB 4HPBA 1LDOA 1LKEA 4O4XA 1KGLA 1JV4A 1MVGA 4BVMA 1AVDA 3LV4A 4ARHA 2F01A 2OY8A 4GGTA 1KT6A 4YDAA 1L6MA 1N43A 2NP1A 1BBPA 1RBPA 4JO6A 2NNDA 2RTJA 4CDEA 1CRBA 3HTYA 5H8TA 3C77X 2CM9A 1SLDB 4INNA 4WFVA 2JN3A 4ZHCA 2VFCA 4IMOA 4ORXA 2OY1O 5D4AA 4AZPA 4BCSA 3BU1A 1HQPA 5EZ2A 3FENA 3FR5A 3TZSA 1U18A 4ZR2A 1OEJA 2QOSC 1VWMB 2RTKA 2Z4HA 4JGLA 3VG2A 1NDJA 4YH0A 3WZPA 1SRHA 1HBPA 4BGFA 1NP1A 1KXOA 2MJIA 3PECA 1GM6A 1MX7A 1D3SA 1LCZA 5LJEA 4GNWA 2MWHA 4A8ZA 1RSUB 2VFBA 4ODDA 2A0AA 4NV7A 1QFVA 1LDQA 3WBGA 1SWNA 3SLJA 2AF5A 1W5RA 1QG5A 2IZDB 4BX7B 2RTRB 3SLTA 1MK5A 3PDFA 3P6HA 1YWAA 4U8UO 4CPHB 2HZRA 4Z2OA 1D2UA 1BRPA 1HXLA 1VWNB 2FRSA 4I3CA 4IAXA 3FIDA 1ZNDA 3P6FA 4ZCBA 4ML7B 1G5WA 5HBSA 1YP7A 3D96A 1KT4A 2X55A 4TQ2A 1KT7A 1IIUA 3ELXA 3P24A 2PY1A 3AKMA 1IKJA 1CBRA 2CM4A 4HPDA 1Y55X 1ICMA 4IB6A 1VWGB 1GT3A 3APXA 4LKTA 4QGXA 3KZAA 2LBAA 2ZAIA 2G7BA 2MO5A 3NP1A 1EQDA 4K19A 5HTDA 4L1NA 4B55A 1I9HA 3OE3A 5HA0A 1CBSA 4ZHDA 1OBUA 5HZQA 1IJ8A 1RXHA 4O4SA 3WXQA 3KVNA 1ERBA 5B2AO 3PH6A 2Q2MA 3P6CA 5B11O 4GU8A 2RTLA 3MM0A 4NP1A 3STMX 5FQ8E 1DZPA 1ERXA 2JOZA 1UZ2X 3APVA 4GH7A 4BBOA 3FA8A 5BVSA 5D45A 4TKBA 1LNMA 3N91A 4QRLA 1G74A 5BVQA 2BC3A 1HQQA 3FEPA 3VE1A 1HN2A 1O8VA 1STSB 3ZW1B 3TGBA 3MVFA 3NBXX 2FHNX 3T6LA 4MVKA 5AJBA 4QQ1A 5AJCA 1SY0A 5CE4A 3JSQA 1JYJA 2ZAGA 2I5ZO 1X8NA 3FW4A 4NV8A 4YBUA 1RXJA 2UZ2A 3BLGA 3O2YA 3RKGA 2RCTA 1OBPA 1SWAA 2QMIA 4YFQA 4I9RA 3ZW0A 1UYOX 1ZNGA 2O62A 1N4JA 1HY2A 2F73A 3MX7A 1GX8A 1E06A 4IABA 4KCAA 4EXZA 1EPBA 3SZJA 1S7DA 1LELA 4O3ZA 2RTBB 1BWYA 1I4UA 4I6SA 2G5LA 2L5PA 3SLOA 1JIWI 1SLEB 2Q9SA 1SRIA 2IZEB 4Y0RA 3WJDA 3WJCA 1ICNA 1K3BA 2FS6A 1VWOB 3VG3A 2Q2PA 1Y9TA 2OY7A 2HKDA 2XSTA 1SWRA 5DPQA 1RAVA 3FLLA 1DZMA 4TJZA 4BOEA 3VG4A 3S26A 2WEXA 1AQBA 1QABE 1XKIA 1MOYA 3BU9A 3DTQA 2E4JA 4N7DA 4YKOA 2GTFX 4Z28A 3SAOA 1EI5A 3SOTA 1RXKA 1E2TA 4OEMA 4CPIA 5IRWA 3ZW2A 2M4LA 3U0DA 4NLJA 1SREA 1BSQA 5K67A 3FR2A 5D48A 3HWFA 4XMCA 5HZ5A 5F6BA 4CSBA 1DF3A 4GKCA 2FHLA 1E02A 4XMFA 1VYFA 2OFAA 1X8QA 3ZWEA 1BRQA 1EPAA 5L8IA 2BHVA 4IMNA 3V8UA 1WUBA 3BY0A 2K62A 1KL5A 4LQZA 1ML7A 3RE5A 2W2FA 4FQBB 3DSZA 1DZJA 3FELA 3ZW0B 3WJFA 3RDUA 4UU3A 4Y0PA 3APWA 3B2HA 4BX7A 1SY1A 3VHMA 3STKA 4YBPA 1GX3A 2IZLB 4I3DA 4YVBA 4Y0SA 1KOIA 1VWJB 2NNEA 3CBCA 3D9WA 3RSWA 2OFRX 4GGZA 5LJGA 3RZYA 4OKAA 1SWGA 3SZIA 4CPHA 2EU7X 2R73A 3WZNA 4CPEA 5LJDA 2OVSA 1N0SA 1OSPO 4GZVA 5IRAA 4XMHA 3UEVA 2RTAA 3EW2A 4YMYA 1EXSA 2BS5A 4ZJ0A 2FWVA 1GGLA 3E3CA 4NNTA 4MIRA 5KICA 5IXGA 5F6ZA 1QY2A 1JYDA 2FKGA 2HNXA 4M6SA 5B27A 5HTEA 4AZQA 4QAEA 1LIDA 3PP6A 4ALBA 4NW4A 1CBIA 2AT0X 2RTDB 3CQRA 3CBSA 3KQ0A 3PQSA 4XMDA 3ZUOA 1CJ5A 3TGCA 2AT8X 4NYQA 3LHNA 3RDXA 2CBSA 2AH7X 1IKEA 2CZUA 4COTA 1GT5A 3SZHA 1BEBA 3S5XA 1NC9A 3D95A 3NR3A 4TKJA 2RTPB 4A1HA 4A60A 5HCCC 2JU8A 1GX9A 1HMTA 4GETA 2WQAE 4AW8A 2MM3A 3F6ZB 2CBRA 2LB6A 4Z27A 5B29A 1X71A 2P8GA 3WJGA 1JJUA 3ZW1A 1JZUA 1EUOA 1OBQA 3RE6A 3WOVA 1DC9A 2A2GA 3BS2A 3HOEA 3L4RA 1N7YA 1Z24A 4OELA 2X45A 2OL6O 3JS1A 3UEUA 2IZJA 3AEHA 4PSQA 4GE1A 2BLGA 3OJYC 1KL4A 5F7GA 2WSJA 3VG6A 1A2DA 4MVLA 1ZNKA 1ZRYA 3LTWA 3UAQA 3NQ9A 1QY1A 1VWKB 1Y0GA 3UEXA 3CKGA 4U9CA 2AL0X 4Z6JA 1FTPA 1W4TA 5EDCA 1EALA 3O19A 2LFOA 2OFMX 2YMSA 2RD7C 2QO4A 3IA8A 2OY5O 1LFOA 1NQNA 2HLVA 1SMPI 1VPRA 2OF9A 3T2WA 4O4OA 2Y3EA 1YWDA 3PQUA 5JR8A 5LJCA 1SRGA 3OD9A 4OS3A 1LIEA 1OPAA 2DM5A 1T8VA 1DZKA 2OFBA 1WBIA 1YP6A 2IZFB 2RA6A 5L8OA 3RY1A 4GNYA 1SRFA 2A13A 3FW5A 5F58A 2GTLM 5LKEA 3EM0A 3OBLA 2AT5X 3BRNA 4U3QA 1G7NA 2OVAA 1VWAB 3NPOA 1ZNHA 4GUZA 1PTSA 3O22A 4N7CA 2BS6A 5HA1A 1QQSA 4NLIA 4YFPA 5HZ8A 1GXAA 4O9SA 4QYNA 2WEWA 4FGIB 3RBYA 3RDQA 3P6GA 1G85A 1HBQA 1IFBA 1NGLA 2JU7A 3KFHA 3F9DA 4YGGA 1LCWA 4CV7A 5FENA 1GT4A 1QY0A 2RTGB 4YFRA 1KL3A 1H91A 1YUPA 2G78A 2IZKA 5EEDA 3RDMA 5HCDC 3D4RA 4YGZA 3HWEA 1LICA 1SRJA 3KFGA 2Q4NA 2OYBO 3BX8A 3FYFA 2UYWA 2IZBA 2W2AA 4ID2A 4TKHA 4CDCA 4C5PA 1T68X 4ZH6A 2W2BA 1AB0A 1X8OA 4FBRA 3VU1A 4YKMA 2CZTA 2X8FA 2AMMX 2POAA 1SWEA 1SXWA 2L67A 3FA7A 2X4MA 1SY2A 2A8GA 3PH5A 5H9AA 3VG7A 2GTLN 1SWSA 2OVDA 4R0BA 3ZI8A 1SWUA 2WWPA 4HPCA 3VG5A 2WPUA 5FFHA 1IFCA 1SWQA 2JGSA 5DG4A 4GJSA 1KT3A 1SWFA 5B10O 1KQXA 2HZQA 4ES7A 1SY3A 3Q34A 3GAQA 1FDQA 2KTDA 3CR6A 4GK9A 4EDEA 4YDBA 5EDBA 3RDOA 4O3WA 2ANSA 5B5FA 1DFVA 1TOUA 4QNIA 2JW1A 3RWXA 4I95A 4ORWA 1PEEA 4A1YA 1AVEA 2AKQA 2L9CA 3B2JA 3C76X 5CYBA 2VDFA 1OEEA 2QOMA 4HPAA 2G8CO 3B2IA 3WJBA 4RUNA 4EKVA 1SWHA 1VWFB 1VWCB 4FBVA 4BX5A 4XMEA 1A18A 1ZNEA 3MG5A 2Y3FA 3ZZVA 3U03A 1ALBA 5AQ6A
chains in the Genus database with same CATH topology
3PPTA 1TW4A 1KZWA 2RCQA 1FENA 1VYGA 4IAWA 4OS0A 5F1EA 3HK1A 4TNNA 3T1DA 5IO5A 5L8NA 1GT1A 5IO7A 5LKFA 1MDCA 2BT9A 4XMGA 4KC7A 1I04A 3HWDA 1LPJA 4U8UM 1MX8A 2OZQA 2Z4IA 3EYCA 1LIFA 4LKPA 2ACPX 1X8UA 3EBWA 2X8SA 4TLJA 1B8EA 3K3LA 4O3YA 1DV9A 1ADLA 4GDZA 1B0OA 2HYSA 4ZHHA 1UREA 5H9KA 3S5VA 1IW2A 4OMXA 2FTBA 1KZXA 2WUTA 4YCEA 2OVEA 2IFBA 4OMWA 5FQ7E 3FMZA 4ZHFA 2RN4A 1U17A 3B2LA 3NADA 2KW1A 3IFBA 4AYHA 5BVTA 1X8PA 3G7XA 1YIVA 2Q39A 4LZVA 5H9LA 4ON1A 3HOLA 3WVMA 4U8UN 4AZMA 1BSOA 2KT4B 5HCEC 4ORUA 5H9NA 1OEKA 3JQOA 3FR4A 2WR6A 3P6DA 5HWZA 3CWKA 4AZNA 2K23A 2GJ5A 3NX1A 3BDRA 2A2UA 1AVGI 1NP4A 4HFOA 4RUUA 1MUPA 3HWGA 5EEEA 4GRJA 1HMSA 3F8AA 3GE2A 1ACDA 2X46A 4I3BA 2G79A 3MBTA 1B4MA 2FS7A 1Y9LA 3BSZE 3BX7A 3I17A 1EIOA 1BLRA 3PEDA 3CMPA 4QGWA 1PM1X 4LZUA 1A57A 1SA8A 1BSYA 2FT9A 2HMBA 1HMRA 2N93A 4I9SA 1JJJA 2X8TA 4FBOA 1O1UA 2F09A 3EBKA 1JBHA 1QFTA 5EPQA 4QZUA 1B56A 3S60A 5D8JA 5IO6A 4AZRA 1PMPA 1QWDA 2R56A 3KFFA 4IB7A 4NYRA 4YCHA 1SXXA 4ORSA 5BYPA 1EW3A 1I05A 5HAEA 2QO5A 4QZTA 3U9PC 1PBOA 1E00A 2RQ0A 4ZGFA 1R0UA 3B2KA 3VE2A 3AKNA 4EFGA 1RLBE 2LKKA 3FA6A 3NQKA 4O4UA 4BQUA 4EQAC 1BJ7A 2QM9A 3CQNA 2LA7A 3P02A 3WJEA 4WFUA 4ZFXA 5HZ6A 1GKAA 3TF6A 4KT5A 2AT6X 2KTSA 4MISA 1CBQA 1E5PA 2FLJA 4KIIA 1S44A 1S2PA 2XKLA 3FA9A 1FE3A 5KHPA 2GC9A 1O1VA 1U0XA 3UEWA 1LIBA 1KT5A 4MVEA 4KH8A 4ZGUA 2JMBA 4ZH9A 3APUA 2ALLX 4QYPA 1TVQA 3D97A 4EEJA 5AEOA 3NQ3A 4D6AA 1ZNLA 1LF7A 3H3IA 3I0AA 4NNSA 2FR3A 4D6BA 5LJHA 1BM5A 4UU2A 5K06A 1T0VA 3KFIA 2ACOA 2JU3A 4Y0QA 5HZ9A 1SXUA 4IB8A 4O49A 2GTLO 3ZUIA 4DQ4A 3FEKA 4YGHA 5C0NA 1TXLA 3STNA 1I06A 4HWMA 1OPBA 4L3RA 5D47A 2NNQA 4IB9A 1A3YA 1XCAA 4WBKA 1GKAB 2A3FX 3ZQ3A 2FR2A 5FQ6E 1FELA 4MVIA 5FAZA 1FEMA 2WQ9A 3VPJE 4ZHGA 1X89A 4KC8A 4AZOA 4OS8A 1SXYA 1TOWA 1JJXA 5LJKA 1YWBA 2KD2A 4ORRA 1AELA 3EMMA 1P6PA 3C78X 3ELZA 4CK4A 4ORYA 4M7MA 3FIQA 2R74A 3NX2A 2L68A 2LBVA 4WHIA 2ASNX 1YWCA 3TGAA 4DQ3A 2QO6A 1EIIA 3P6EA 4PJ2A 4IBAA 5LJBA 3Q6LA 2YG2A 1KQWA 2MHDA 3QKGA 4ALOA 4QGVA 2AT3X 5KIDA 4O3XB 4HPBA 1LKEA 4O4XA 1JV4A 1MVGA 4BVMA 3LV4A 4ARHA 1KT6A 4YDAA 1L6MA 2NP1A 1BBPA 1RBPA 2NNDA 1CRBA 3HTYA 5H8TA 3C77X 2CM9A 4INNA 4ZHCA 4WFVA 2JN3A 4IMOA 4ORXA 5D4AA 4AZPA 3BU1A 1HQPA 5EZ2A 3FENA 3FR5A 3TZSA 1U18A 4ZR2A 1OEJA 2QOSC 2Z4HA 4JGLA 3VG2A 4YH0A 1HBPA 1NP1A 1KXOA 2MJIA 3PECA 1GM6A 1MX7A 1D3SA 5LJEA 4GNWA 2MWHA 4A8ZA 4ODDA 2A0AA 3WBGA 1QFVA 1QG5A 3P6HA 1YWAA 4U8UO 2HZRA 1D2UA 1BRPA 2FRSA 4IAXA 4I3CA 4ZCBA 1ZNDA 3P6FA 4ML7B 1G5WA 5HBSA 1YP7A 3D96A 1KT4A 4TQ2A 1KT7A 1IIUA 3ELXA 3P24A 2PY1A 3AKMA 1IKJA 1CBRA 2CM4A 4HPDA 4LKTA 1ICMA 4IB6A 1GT3A 3APXA 4QGXA 3KZAA 2LBAA 2ZAIA 2G7BA 2MO5A 3NP1A 1EQDA 4K19A 5HTDA 4L1NA 3OE3A 5HA0A 1CBSA 4ZHDA 1OBUA 5HZQA 4O4SA 3WXQA 1ERBA 3PH6A 2Q2MA 3P6CA 4GU8A 4NP1A 3STMX 5FQ8E 1DZPA 1ERXA 2JOZA 1UZ2X 3APVA 4GH7A 3FA8A 5BVSA 5D45A 4TKBA 1LNMA 3N91A 4QRLA 1G74A 5BVQA 3ZW1B 3FEPA 3VE1A 1HN2A 1O8VA 3TGBA 3MVFA 3NBXX 4MVKA 5AJBA 4QQ1A 5AJCA 1SY0A 5CE4A 3JSQA 1JYJA 2ZAGA 1X8NA 3FW4A 4YBUA 3BLGA 3RKGA 3O2YA 2RCTA 1OBPA 4YFQA 2QMIA 4I9RA 3ZW0A 1ZNGA 2O62A 2F73A 4EXZA 3MX7A 1GX8A 1E06A 4IABA 4KCAA 1EPBA 1S7DA 4O3ZA 1BWYA 1I4UA 4I6SA 2L5PA 1JIWI 2Q9SA 4Y0RA 3WJDA 3WJCA 1ICNA 2FS6A 3VG3A 2Q2PA 1Y9TA 2XSTA 5DPQA 3FLLA 1DZMA 4TJZA 4BOEA 3VG4A 3S26A 2WEXA 1AQBA 1QABE 1XKIA 3BU9A 3DTQA 4N7DA 2E4JA 4YKOA 2GTFX 3SAOA 1EI5A 3SOTA 3ZW2A 2M4LA 3U0DA 4NLJA 1BSQA 3FR2A 5D48A 3HWFA 4XMCA 5HZ5A 5F6BA 4CSBA 1DF3A 4GKCA 1E02A 4XMFA 1VYFA 1X8QA 3ZWEA 1BRQA 1EPAA 5L8IA 2BHVA 4IMNA 3V8UA 3BY0A 2K62A 4LQZA 1ML7A 2W2FA 4FQBB 3DSZA 1DZJA 3FELA 3ZW0B 3WJFA 4UU3A 4Y0PA 3APWA 3B2HA 1SY1A 4YBPA 3STKA 4I3DA 4Y0SA 1KOIA 2NNEA 3RSWA 3CBCA 1KGLA 2OFRX 5LJGA 3RZYA 2EU7X 2R73A 5LJDA 2OVSA 1N0SA 3UEVA 4GZVA 4XMHA 4YMYA 1EXSA 2BS5A 4ZJ0A 2FWVA 1GGLA 3E3CA 4NNTA 4MIRA 5KICA 5F6ZA 1QY2A 1JYDA 2HNXA 4M6SA 5HTEA 5B27A 4AZQA 4QAEA 1LIDA 3PP6A 4ALBA 4NW4A 1CBIA 2AT0X 3PQSA 3CQRA 3CBSA 3KQ0A 4XMDA 3ZUOA 1CJ5A 3TGCA 2AT8X 4NYQA 3LHNA 4COTA 2CBSA 2AH7X 1IKEA 2CZUA 1GT5A 1BEBA 3S5XA 4A60A 3D95A 3NR3A 4TKJA 4A1HA 5HCCC 2JU8A 1GX9A 1HMTA 4GETA 2WQAE 4AW8A 2MM3A 3F6ZB 2CBRA 2LB6A 5B29A 1X71A 2P8GA 3WJGA 3ZW1A 1JZUA 1EUOA 1OBQA 3WOVA 1DC9A 2A2GA 3BS2A 3HOEA 3L4RA 1Z24A 2X45A 3JS1A 3UEUA 4PSQA 4GE1A 2BLGA 3OJYC 5F7GA 2WSJA 3VG6A 1A2DA 4MVLA 1ZNKA 1ZRYA 3UAQA 3NQ9A 1QY1A 3UEXA 4U9CA 2AL0X 1FTPA 5EDCA 1EALA 3O19A 2LFOA 2OFMX 2YMSA 2RD7C 2QO4A 3IA8A 1LFOA 2HLVA 1SMPI 1VPRA 5JR8A 4O4OA 3PQUA 1YWDA 5LJCA 3OD9A 4OS3A 1LIEA 1OPAA 2DM5A 1T8VA 1DZKA 1YP6A 2RA6A 5L8OA 4GNYA 2A13A 3FW5A 5F58A 2GTLM 5LKEA 3EM0A 3OBLA 2AT5X 3BRNA 4U3QA 1G7NA 2OVAA 3NPOA 1ZNHA 4N7CA 3O22A 2BS6A 5HA1A 1QQSA 4NLIA 4YFPA 5HZ8A 1GXAA 4O9SA 4QYNA 2WEWA 4FGIB 3RBYA 3P6GA 1G85A 1HBQA 1IFBA 1NGLA 2JU7A 3KFHA 3F9DA 4YGGA 4CV7A 5FENA 1GT4A 1QY0A 4YFRA 1YUPA 1H91A 2G78A 5EEDA 5HCDC 3D4RA 4YGZA 3HWEA 1LICA 3KFGA 2Q4NA 3BX8A 3FYFA 2W2AA 4ID2A 4TKHA 1T68X 4ZH6A 2W2BA 1AB0A 1X8OA 4FBRA 3VU1A 4YKMA 2CZTA 2X8FA 2AMMX 2POAA 2L67A 1SXWA 3FA7A 1SY2A 3PH5A 5H9AA 3VG7A 2GTLN 2OVDA 4R0BA 3ZI8A 2WWPA 4HPCA 3VG5A 5FFHA 1IFCA 5DG4A 1KT3A 1KQXA 2HZQA 4ES7A 1SY3A 3GAQA 1FDQA 2KTDA 3CR6A 4GK9A 4EDEA 4YDBA 5EDBA 4O3WA 2ANSA 1DFVA 1TOUA 4QNIA 2JW1A 3RWXA 4I95A 4ORWA 1PEEA 4A1YA 2AKQA 2L9CA 3B2JA 3C76X 5CYBA 1OEEA 4HPAA 3B2IA 3WJBA 4RUNA 4FBVA 4XMEA 1A18A 1ZNEA 3U03A 3ZZVA 1ALBA 5AQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PPT A;  1TW4 A;  1KZW A;  2RCQ A;  1FEN A;  1VYG A;  4IAW A;  4OS0 A;  5F1E A;  3HK1 A;  4TNN A;  3T1D A;  5IO5 A;  5L8N A;  1GT1 A;  5IO7 A;  5LKF A;  1MDC A;  4XMG A;  1I04 A;  3HWD A;  1LPJ A;  1MX8 A;  2OZQ A;  3EYC A;  1LIF A;  4LKP A;  2ACP X;  1X8U A;  3EBW A;  4TLJ A;  1B8E A;  3K3L A;  1DV9 A;  1ADL A;  1B0O A;  2HYS A;  4ZHH A;  1URE A;  5H9K A;  1IW2 A;  4OMX A;  2FTB A;  1KZX A;  2WUT A;  4YCE A;  2OVE A;  2IFB A;  4OMW A;  3FMZ A;  4ZHF A;  1U17 A;  3B2L A;  3NAD A;  3IFB A;  4AYH A;  5BVT A;  1X8P A;  3G7X A;  1YIV A;  2Q39 A;  4LZV A;  5H9L A;  3WVM A;  4AZM A;  1BSO A;  2KT4 B;  5HCE C;  4ORU A;  5H9N A;  1OEK A;  3FR4 A;  2WR6 A;  3P6D A;  5HWZ A;  3CWK A;  4AZN A;  2K23 A;  2GJ5 A;  3NX1 A;  3BDR A;  2A2U A;  1AVG I;  1NP4 A;  4HFO A;  4RUU A;  1MUP A;  3HWG A;  5EEE A;  4GRJ A;  1HMS A;  3F8A A;  1ACD A;  2X46 A;  4I3B A;  2G79 A;  3MBT A;  1B4M A;  2FS7 A;  3BSZ E;  3BX7 A;  3I17 A;  1EIO A;  1BLR A;  3PED A;  3CMP A;  4QGW A;  1PM1 X;  4LZU A;  1A57 A;  1SA8 A;  1BSY A;  2FT9 A;  2HMB A;  1HMR A;  2N93 A;  4I9S A;  1JJJ A;  1O1U A;  3EBK A;  1JBH A;  1QFT A;  5EPQ A;  4QZU A;  1B56 A;  5D8J A;  5IO6 A;  4AZR A;  1PMP A;  1QWD A;  2R56 A;  3KFF A;  4IB7 A;  4NYR A;  4YCH A;  1SXX A;  4ORS A;  1EW3 A;  1I05 A;  5HAE A;  2QO5 A;  4QZT A;  3U9P C;  1PBO A;  1E00 A;  2RQ0 A;  1R0U A;  3B2K A;  4EFG A;  3AKN A;  1RLB E;  2LKK A;  3FA6 A;  4BQU A;  1BJ7 A;  2QM9 A;  3CQN A;  5HZ6 A;  3WJE A;  4WFU A;  4ZFX A;  1GKA A;  3TF6 A;  2AT6 X;  1CBQ A;  1E5P A;  2FLJ A;  4KII A;  1S44 A;  1S2P A;  2XKL A;  3FA9 A;  1FE3 A;  5KHP A;  2GC9 A;  1O1V A;  1U0X A;  3UEW A;  1LIB A;  1KT5 A;  4ZGU A;  4ZH9 A;  3APU A;  2ALL X;  4QYP A;  1TVQ A;  3D97 A;  4EEJ A;  3NQ3 A;  4D6A A;  1ZNL A;  1LF7 A;  3I0A A;  4NNS A;  2FR3 A;  4D6B A;  5LJH A;  1BM5 A;  4UU2 A;  5K06 A;  1T0V A;  3KFI A;  2ACO A;  2JU3 A;  4Y0Q A;  5HZ9 A;  1SXU A;  4IB8 A;  3ZUI A;  4DQ4 A;  3FEK A;  4YGH A;  5C0N A;  1TXL A;  3STN A;  1I06 A;  1OPB A;  5D47 A;  2NNQ A;  4IB9 A;  1A3Y A;  1XCA A;  4WBK A;  1GKA B;  2A3F X;  3ZQ3 A;  2FR2 A;  1FEL A;  4MVI A;  5FAZ A;  1FEM A;  2WQ9 A;  4ZHG A;  1X89 A;  4AZO A;  4OS8 A;  1SXY A;  1TOW A;  1JJX A;  5LJK A;  1YWB A;  4ORR A;  1AEL A;  3EMM A;  1P6P A;  3C78 X;  3ELZ A;  4CK4 A;  4ORY A;  4M7M A;  3FIQ A;  2R74 A;  3NX2 A;  2L68 A;  2LBV A;  3TGA A;  2ASN X;  1YWC A;  4DQ3 A;  2QO6 A;  1EII A;  3P6E A;  4IBA A;  5LJB A;  3Q6L A;  2YG2 A;  1KQW A;  3QKG A;  4ALO A;  4QGV A;  2AT3 X;  5KID A;  4HPB A;  1LKE A;  1JV4 A;  1MVG A;  4BVM A;  4ARH A;  1KT6 A;  4YDA A;  1L6M A;  2NP1 A;  1BBP A;  1RBP A;  2NND A;  1CRB A;  5H8T A;  4ZHC A;  3C77 X;  2CM9 A;  4WFV A;  2JN3 A;  4IMO A;  4ORX A;  5D4A A;  4AZP A;  3BU1 A;  1HQP A;  5EZ2 A;  3FEN A;  3FR5 A;  3TZS A;  1U18 A;  4ZR2 A;  1OEJ A;  2QOS C;  3VG2 A;  4YH0 A;  1HBP A;  1NP1 A;  1KXO A;  2MJI A;  3PEC A;  1GM6 A;  1MX7 A;  1D3S A;  5LJE A;  4GNW A;  4A8Z A;  4ODD A;  2A0A A;  3WBG A;  1QFV A;  1QG5 A;  3P6H A;  1YWA A;  2HZR A;  1D2U A;  1BRP A;  2FRS A;  4IAX A;  4I3C A;  4ZCB A;  1ZND A;  3P6F A;  1G5W A;  5HBS A;  1YP7 A;  3D96 A;  1KT4 A;  4TQ2 A;  1KT7 A;  1IIU A;  3ELX A;  2PY1 A;  3AKM A;  1IKJ A;  1CBR A;  2CM4 A;  4HPD A;  4LKT A;  1ICM A;  4IB6 A;  1GT3 A;  3APX A;  4QGX A;  3KZA A;  2LBA A;  2G7B A;  2MO5 A;  3NP1 A;  1EQD A;  4K19 A;  5HTD A;  5HA0 A;  1CBS A;  4ZHD A;  1OBU A;  5HZQ A;  3WXQ A;  1ERB A;  3PH6 A;  2Q2M A;  3P6C A;  4NP1 A;  3STM X;  1DZP A;  1ERX A;  2JOZ A;  1UZ2 X;  3APV A;  4GH7 A;  3FA8 A;  5BVS A;  5D45 A;  4TKB A;  1LNM A;  1G74 A;  5BVQ A;  3FEP A;  1HN2 A;  1O8V A;  3TGB A;  3MVF A;  4MVK A;  1SY0 A;  5CE4 A;  3JSQ A;  1JYJ A;  1X8N A;  3FW4 A;  4YBU A;  3BLG A;  3O2Y A;  2RCT A;  1OBP A;  4YFQ A;  4I9R A;  1ZNG A;  2O62 A;  2F73 A;  4EXZ A;  1GX8 A;  1E06 A;  1EPB A;  1S7D A;  1BWY A;  1I4U A;  2L5P A;  2Q9S A;  4Y0R A;  3WJD A;  3WJC A;  1ICN A;  2FS6 A;  3VG3 A;  2Q2P A;  2XST A;  5DPQ A;  3FLL A;  1DZM A;  4TJZ A;  4BOE A;  3VG4 A;  3S26 A;  2WEX A;  1AQB A;  1QAB E;  1XKI A;  3BU9 A;  3DTQ A;  4N7D A;  2E4J A;  4YKO A;  2GTF X;  3SAO A;  3U0D A;  4NLJ A;  1BSQ A;  3FR2 A;  5D48 A;  3HWF A;  4XMC A;  5HZ5 A;  5F6B A;  1DF3 A;  4GKC A;  1E02 A;  4XMF A;  1VYF A;  1X8Q A;  1BRQ A;  1EPA A;  5L8I A;  4IMN A;  3BY0 A;  2K62 A;  1ML7 A;  2W2F A;  3DSZ A;  1DZJ A;  3FEL A;  3WJF A;  4UU3 A;  4Y0P A;  3APW A;  3B2H A;  1SY1 A;  4YBP A;  3STK A;  4I3D A;  4Y0S A;  1KOI A;  2NNE A;  3RSW A;  3CBC A;  1KGL A;  2OFR X;  5LJG A;  3RZY A;  2EU7 X;  2R73 A;  5LJD A;  1N0S A;  3UEV A;  4XMH A;  4YMY A;  1EXS A;  4ZJ0 A;  2FWV A;  1GGL A;  4NNT A;  5KIC A;  5F6Z A;  1QY2 A;  1JYD A;  2HNX A;  4M6S A;  5HTE A;  5B27 A;  4AZQ A;  4QAE A;  1LID A;  3PP6 A;  4ALB A;  1CBI A;  2AT0 X;  3CQR A;  3CBS A;  3KQ0 A;  4XMD A;  3ZUO A;  1CJ5 A;  3TGC A;  2AT8 X;  4NYQ A;  2CBS A;  2AH7 X;  1IKE A;  2CZU A;  1GT5 A;  1BEB A;  4A60 A;  3D95 A;  3NR3 A;  4TKJ A;  4A1H A;  5HCC C;  2JU8 A;  1GX9 A;  1HMT A;  4GET A;  2WQA E;  4AW8 A;  2MM3 A;  2CBR A;  2LB6 A;  5B29 A;  1X71 A;  2P8G A;  3WJG A;  1JZU A;  1EUO A;  1OBQ A;  1DC9 A;  2A2G A;  3BS2 A;  3L4R A;  1Z24 A;  2X45 A;  3JS1 A;  3UEU A;  4PSQ A;  4GE1 A;  2BLG A;  3OJY C;  5F7G A;  2WSJ A;  3VG6 A;  1A2D A;  4MVL A;  1ZNK A;  1ZRY A;  3NQ9 A;  1QY1 A;  3UEX A;  2AL0 X;  1FTP A;  5EDC A;  1EAL A;  3O19 A;  2LFO A;  2OFM X;  2RD7 C;  2QO4 A;  3IA8 A;  1LFO A;  2HLV A;  1VPR A;  5JR8 A;  5LJC A;  1YWD A;  4OS3 A;  1LIE A;  1OPA A;  2DM5 A;  1T8V A;  1DZK A;  1YP6 A;  2RA6 A;  5L8O A;  4GNY A;  2A13 A;  3FW5 A;  5F58 A;  5LKE A;  3EM0 A;  2AT5 X;  3BRN A;  1G7N A;  2OVA A;  3NPO A;  1ZNH A;  4N7C A;  3O22 A;  5HA1 A;  1QQS A;  4NLI A;  4YFP A;  5HZ8 A;  1GXA A;  4O9S A;  4QYN A;  2WEW A;  3P6G A;  1G85 A;  1HBQ A;  1IFB A;  1NGL A;  2JU7 A;  3KFH A;  3F9D A;  4YGG A;  5FEN A;  1GT4 A;  1QY0 A;  4YFR A;  1YUP A;  1H91 A;  2G78 A;  5EED A;  5HCD C;  4YGZ A;  3HWE A;  1LIC A;  3KFG A;  2Q4N A;  3BX8 A;  2W2A A;  4TKH A;  1T68 X;  4ZH6 A;  2W2B A;  1AB0 A;  1X8O A;  4YKM A;  2CZT A;  2AMM X;  2POA A;  2L67 A;  1SXW A;  3FA7 A;  1SY2 A;  3PH5 A;  5H9A A;  3VG7 A;  2OVD A;  4R0B A;  2WWP A;  4HPC A;  3VG5 A;  5FFH A;  1IFC A;  5DG4 A;  1KT3 A;  1KQX A;  2HZQ A;  4ES7 A;  1SY3 A;  3GAQ A;  1FDQ A;  2KTD A;  3CR6 A;  4EDE A;  4YDB A;  5EDB A;  2ANS A;  1DFV A;  1TOU A;  4ORW A;  1PEE A;  4A1Y A;  2AKQ A;  2L9C A;  3B2J A;  3C76 X;  1OEE A;  4HPA A;  3B2I A;  3WJB A;  4RUN A;  4XME A;  1A18 A;  1ZNE A;  3U03 A;  1ALB A;  5AQ6 A; 
#chains in the Genus database with same CATH topology
 3PPT A;  1TW4 A;  1KZW A;  1STR B;  2RTH B;  3AUM O;  1Y53 X;  2RCQ A;  1FEN A;  1VYG A;  1Y52 X;  4IAW A;  4OS0 A;  3HK1 A;  4TNN A;  5F1E A;  2PI3 O;  3T1D A;  5IO5 A;  1GT1 A;  5IO7 A;  5LKF A;  1MDC A;  2BT9 A;  4XMG A;  4KC7 A;  2ZSC A;  1I04 A;  3HWD A;  1LPJ A;  4U8U M;  1MX8 A;  2OZQ A;  2Z4I A;  3EYC A;  1LIF A;  4LKP A;  5B5G A;  2A5B A;  2X34 A;  5K68 A;  2C1Q A;  2ACP X;  1X8U A;  3EBW A;  1VWH B;  2X8S A;  4TLJ A;  2RTI B;  4Y59 A;  1SWL A;  1SLF B;  1B8E A;  3K3L A;  4O3Y A;  1DV9 A;  1ADL A;  4Y5D A;  2X56 A;  4GDZ A;  5JD2 A;  1SWD A;  1B0O A;  1VWD B;  2HYS A;  3VHH A;  4JNJ A;  1URE A;  5H9K A;  3WYQ A;  1VWL B;  4ZHH A;  3S5V A;  1IW2 A;  4OMX A;  2FTB A;  1KZX A;  2WUT A;  2FKJ A;  4YCE A;  2OVE A;  2IFB A;  3FDC A;  4OMW A;  5FQ7 E;  4BX5 B;  3FMZ A;  4GJV A;  2RN4 A;  4ZHF A;  1U17 A;  3B2L A;  3RY2 A;  3NAD A;  2KW1 A;  2RTO B;  3IFB A;  4AYH A;  5BVT A;  1X8P A;  3G7X A;  1YIV A;  2Q39 A;  4LZV A;  5H9L A;  2I5V O;  4ON1 A;  1JMZ A;  3HOL A;  3WVM A;  4U8U N;  4AZM A;  1BSO A;  2KT4 B;  2IZG B;  5HCE C;  4ORU A;  1VWP B;  1OEK A;  3JQO A;  3FR4 A;  2WR6 A;  3P6D A;  5H9N A;  5HWZ A;  3EW1 A;  1SWC A;  3CWK A;  4MEE A;  4AZN A;  2K23 A;  2GJ5 A;  3NX1 A;  3BDR A;  2A2U A;  1I78 A;  1AVG I;  1JMX A;  1NP4 A;  1SLG B;  4HFO A;  4Z2P A;  2BSZ A;  2C4I A;  4RUU A;  1MUP A;  4CDF A;  3HWG A;  2QCB A;  5EEE A;  1SWT A;  4GRJ A;  1HMS A;  3F8A A;  3GE2 A;  2RTF B;  5B3M O;  4CPF A;  2RTQ B;  1ACD A;  2X46 A;  2Y32 A;  1VWB B;  2G79 A;  2FGS A;  4I60 A;  4I3B A;  3MBT A;  1B4M A;  2FS7 A;  1Y9L A;  3BSZ E;  3BX7 A;  2AVI A;  3I17 A;  2DJG A;  4DCB A;  1BLR A;  1EIO A;  3PED A;  3CMP A;  4QGW A;  1PM1 X;  4LZU A;  1A57 A;  1JQP A;  1SA8 A;  1BSY A;  2FT9 A;  2HMB A;  1HMR A;  2N93 A;  4I9S A;  1JJJ A;  2X8T A;  4FBO A;  2A5C A;  1O1U A;  3X00 A;  4IRW A;  1KFF A;  2F09 A;  3EBK A;  1JBH A;  1QFT A;  5EPQ A;  4QZU A;  1B56 A;  1STP A;  3S60 A;  5D8J A;  5IO6 A;  1VYO A;  4AZR A;  4DNE A;  1PMP A;  1RST B;  1QWD A;  2R56 A;  3KFF A;  4IB7 A;  4NYR A;  1N9Y A;  1LCV A;  1FJ1 E;  4YCH A;  1SXX A;  4ORS A;  5BYP A;  2IZH B;  2C1S A;  2CAM A;  3T2X A;  1EW3 A;  1I05 A;  5HAE A;  2QO5 A;  4QZT A;  3U9P C;  1SWP A;  1PBO A;  5F2B A;  1E00 A;  2RQ0 A;  4ZGF A;  4CDD A;  1R0U A;  3B2K A;  3VE2 A;  3AKN A;  3VHI A;  1RLB E;  4EFG A;  2DJF A;  3PK2 A;  3EC5 A;  2LKK A;  5IRU A;  3FA6 A;  3NQK A;  4O4U A;  4BQU A;  4EQA C;  1BJ7 A;  2QM9 A;  3CQN A;  2LA7 A;  3P02 A;  3WJE A;  4WFU A;  4ZFX A;  5HZ6 A;  1VWI B;  1GKA A;  3TF6 A;  4KT5 A;  2AT6 X;  4GD9 A;  2KTS A;  4MIS A;  5L8N A;  1CBQ A;  1E5P A;  3CKF A;  2FLJ A;  4KII A;  1S44 A;  1S2P A;  2XKL A;  3FA9 A;  1FE3 A;  4GDA A;  5KHP A;  2GC9 A;  1O1V A;  1U0X A;  3UEW A;  1LIB A;  2RTC B;  1KT5 A;  1LUQ A;  4MVE A;  4KH8 A;  4ZGU A;  1VWE B;  1SWJ A;  2JMB A;  2OL7 A;  4GGR A;  4ZH9 A;  3APU A;  2ALL X;  1NBX A;  2X32 A;  4QYP A;  1SWK A;  1TVQ A;  3D97 A;  4EEJ A;  5AEO A;  3NQ3 A;  2OL8 O;  4BX6 A;  4D6A A;  1ZNL A;  1LF7 A;  3H3I A;  3I0A A;  4NNS A;  2FR3 A;  4D6B A;  5LJH A;  1BM5 A;  4UU2 A;  5K06 A;  1T0V A;  3KFI A;  2ACO A;  2JU3 A;  1NQM A;  1VWQ B;  4Y0Q A;  5HZ9 A;  1SXU A;  4IB8 A;  1DF8 A;  1HXZ A;  1MM9 A;  4O49 A;  2GTL O;  3ZUI A;  4DQ4 A;  3FEK A;  3WZQ A;  4YGH A;  1UYN X;  5L3Y A;  4JHQ A;  5C0N A;  1TXL A;  3STN A;  3T6F A;  1I06 A;  4HWM A;  5CHK A;  1OPB A;  4L3R A;  5D47 A;  2NNQ A;  2IZA A;  1A3Y A;  4IB9 A;  4U46 A;  1XCA A;  4WBK A;  1GKA B;  2A3F X;  3RDS A;  3ZQ3 A;  2FR2 A;  2IZC B;  5FQ6 E;  1FEL A;  4MVI A;  5FAZ A;  1FEM A;  1N9M A;  2OF8 A;  2RTM A;  2WQ9 A;  5CSE A;  1X89 A;  3VPJ E;  4ZHG A;  3QQ2 A;  4KC8 A;  1SWB A;  4AZO A;  4OS8 A;  1SXY A;  1TOW A;  1JJX A;  5LJK A;  1YWB A;  1SWO A;  2KD2 A;  3WYP A;  4ORR A;  2RTN B;  1AEL A;  3EMM A;  1VWR B;  3HPE A;  1P6P A;  2IZI A;  3C78 X;  3ELZ A;  4CK4 A;  1MEP A;  1W6F A;  4Z2V A;  4ORY A;  3VGW A;  2GH7 A;  4BX6 B;  2RTE B;  3FIQ A;  2R74 A;  3NX2 A;  4M7M A;  4BJ8 A;  2L68 A;  2LBV A;  3WZO A;  1PBY A;  4WHI A;  2ASN X;  1YWC A;  3TGA A;  4DQ3 A;  2QO6 A;  1EII A;  3P6E A;  4PJ2 A;  4IBA A;  5LJB A;  3Q6L A;  1K24 A;  1KQW A;  2MHD A;  2YG2 A;  3QKG A;  2MF6 A;  4ALO A;  4QGV A;  2AT3 X;  5KID A;  4O3X B;  4HPB A;  1LDO A;  1LKE A;  4O4X A;  1KGL A;  1JV4 A;  1MVG A;  4BVM A;  1AVD A;  3LV4 A;  4ARH A;  2F01 A;  2OY8 A;  4GGT A;  1KT6 A;  4YDA A;  1L6M A;  1N43 A;  2NP1 A;  1BBP A;  1RBP A;  4JO6 A;  2NND A;  2RTJ A;  4CDE A;  1CRB A;  3HTY A;  5H8T A;  3C77 X;  2CM9 A;  1SLD B;  4INN A;  4WFV A;  2JN3 A;  4ZHC A;  2VFC A;  4IMO A;  4ORX A;  2OY1 O;  5D4A A;  4AZP A;  4BCS A;  3BU1 A;  1HQP A;  5EZ2 A;  3FEN A;  3FR5 A;  3TZS A;  1U18 A;  4ZR2 A;  1OEJ A;  2QOS C;  1VWM B;  2RTK A;  2Z4H A;  4JGL A;  3VG2 A;  1NDJ A;  4YH0 A;  3WZP A;  1SRH A;  1HBP A;  4BGF A;  1NP1 A;  1KXO A;  2MJI A;  3PEC A;  1GM6 A;  1MX7 A;  1D3S A;  1LCZ A;  5LJE A;  4GNW A;  2MWH A;  4A8Z A;  1RSU B;  2VFB A;  4ODD A;  2A0A A;  4NV7 A;  1QFV A;  1LDQ A;  3WBG A;  1SWN A;  3SLJ A;  2AF5 A;  1W5R A;  1QG5 A;  2IZD B;  4BX7 B;  2RTR B;  3SLT A;  1MK5 A;  3PDF A;  3P6H A;  1YWA A;  4U8U O;  4CPH B;  2HZR A;  4Z2O A;  1D2U A;  1BRP A;  1HXL A;  1VWN B;  2FRS A;  4I3C A;  4IAX A;  3FID A;  1ZND A;  3P6F A;  4ZCB A;  4ML7 B;  1G5W A;  5HBS A;  1YP7 A;  3D96 A;  1KT4 A;  2X55 A;  4TQ2 A;  1KT7 A;  1IIU A;  3ELX A;  3P24 A;  2PY1 A;  3AKM A;  1IKJ A;  1CBR A;  2CM4 A;  4HPD A;  1Y55 X;  1ICM A;  4IB6 A;  1VWG B;  1GT3 A;  3APX A;  4LKT A;  4QGX A;  3KZA A;  2LBA A;  2ZAI A;  2G7B A;  2MO5 A;  3NP1 A;  1EQD A;  4K19 A;  5HTD A;  4L1N A;  4B55 A;  1I9H A;  3OE3 A;  5HA0 A;  1CBS A;  4ZHD A;  1OBU A;  5HZQ A;  1IJ8 A;  1RXH A;  4O4S A;  3WXQ A;  3KVN A;  1ERB A;  5B2A O;  3PH6 A;  2Q2M A;  3P6C A;  5B11 O;  4GU8 A;  2RTL A;  3MM0 A;  4NP1 A;  3STM X;  5FQ8 E;  1DZP A;  1ERX A;  2JOZ A;  1UZ2 X;  3APV A;  4GH7 A;  4BBO A;  3FA8 A;  5BVS A;  5D45 A;  4TKB A;  1LNM A;  3N91 A;  4QRL A;  1G74 A;  5BVQ A;  2BC3 A;  1HQQ A;  3FEP A;  3VE1 A;  1HN2 A;  1O8V A;  1STS B;  3ZW1 B;  3TGB A;  3MVF A;  3NBX X;  2FHN X;  3T6L A;  4MVK A;  5AJB A;  4QQ1 A;  5AJC A;  1SY0 A;  5CE4 A;  3JSQ A;  1JYJ A;  2ZAG A;  2I5Z O;  1X8N A;  3FW4 A;  4NV8 A;  4YBU A;  1RXJ A;  2UZ2 A;  3BLG A;  3O2Y A;  3RKG A;  2RCT A;  1OBP A;  1SWA A;  2QMI A;  4YFQ A;  4I9R A;  3ZW0 A;  1UYO X;  1ZNG A;  2O62 A;  1N4J A;  1HY2 A;  2F73 A;  3MX7 A;  1GX8 A;  1E06 A;  4IAB A;  4KCA A;  4EXZ A;  1EPB A;  3SZJ A;  1S7D A;  1LEL A;  4O3Z A;  2RTB B;  1BWY A;  1I4U A;  4I6S A;  2G5L A;  2L5P A;  3SLO A;  1JIW I;  1SLE B;  2Q9S A;  1SRI A;  2IZE B;  4Y0R A;  3WJD A;  3WJC A;  1ICN A;  1K3B A;  2FS6 A;  1VWO B;  3VG3 A;  2Q2P A;  1Y9T A;  2OY7 A;  2HKD A;  2XST A;  1SWR A;  5DPQ A;  1RAV A;  3FLL A;  1DZM A;  4TJZ A;  4BOE A;  3VG4 A;  3S26 A;  2WEX A;  1AQB A;  1QAB E;  1XKI A;  1MOY A;  3BU9 A;  3DTQ A;  2E4J A;  4N7D A;  4YKO A;  2GTF X;  4Z28 A;  3SAO A;  1EI5 A;  3SOT A;  1RXK A;  1E2T A;  4OEM A;  4CPI A;  5IRW A;  3ZW2 A;  2M4L A;  3U0D A;  4NLJ A;  1SRE A;  1BSQ A;  5K67 A;  3FR2 A;  5D48 A;  3HWF A;  4XMC A;  5HZ5 A;  5F6B A;  4CSB A;  1DF3 A;  4GKC A;  2FHL A;  1E02 A;  4XMF A;  1VYF A;  2OFA A;  1X8Q A;  3ZWE A;  1BRQ A;  1EPA A;  5L8I A;  2BHV A;  4IMN A;  3V8U A;  1WUB A;  3BY0 A;  2K62 A;  1KL5 A;  4LQZ A;  1ML7 A;  3RE5 A;  2W2F A;  4FQB B;  3DSZ A;  1DZJ A;  3FEL A;  3ZW0 B;  3WJF A;  3RDU A;  4UU3 A;  4Y0P A;  3APW A;  3B2H A;  4BX7 A;  1SY1 A;  3VHM A;  3STK A;  4YBP A;  1GX3 A;  2IZL B;  4I3D A;  4YVB A;  4Y0S A;  1KOI A;  1VWJ B;  2NNE A;  3CBC A;  3D9W A;  3RSW A;  2OFR X;  4GGZ A;  5LJG A;  3RZY A;  4OKA A;  1SWG A;  3SZI A;  4CPH A;  2EU7 X;  2R73 A;  3WZN A;  4CPE A;  5LJD A;  2OVS A;  1N0S A;  1OSP O;  4GZV A;  5IRA A;  4XMH A;  3UEV A;  2RTA A;  3EW2 A;  4YMY A;  1EXS A;  2BS5 A;  4ZJ0 A;  2FWV A;  1GGL A;  3E3C A;  4NNT A;  4MIR A;  5KIC A;  5IXG A;  5F6Z A;  1QY2 A;  1JYD A;  2FKG A;  2HNX A;  4M6S A;  5B27 A;  5HTE A;  4AZQ A;  4QAE A;  1LID A;  3PP6 A;  4ALB A;  4NW4 A;  1CBI A;  2AT0 X;  2RTD B;  3CQR A;  3CBS A;  3KQ0 A;  3PQS A;  4XMD A;  3ZUO A;  1CJ5 A;  3TGC A;  2AT8 X;  4NYQ A;  3LHN A;  3RDX A;  2CBS A;  2AH7 X;  1IKE A;  2CZU A;  4COT A;  1GT5 A;  3SZH A;  1BEB A;  3S5X A;  1NC9 A;  3D95 A;  3NR3 A;  4TKJ A;  2RTP B;  4A1H A;  4A60 A;  5HCC C;  2JU8 A;  1GX9 A;  1HMT A;  4GET A;  2WQA E;  4AW8 A;  2MM3 A;  3F6Z B;  2CBR A;  2LB6 A;  4Z27 A;  5B29 A;  1X71 A;  2P8G A;  3WJG A;  1JJU A;  3ZW1 A;  1JZU A;  1EUO A;  1OBQ A;  3RE6 A;  3WOV A;  1DC9 A;  2A2G A;  3BS2 A;  3HOE A;  3L4R A;  1N7Y A;  1Z24 A;  4OEL A;  2X45 A;  2OL6 O;  3JS1 A;  3UEU A;  2IZJ A;  3AEH A;  4PSQ A;  4GE1 A;  2BLG A;  3OJY C;  1KL4 A;  5F7G A;  2WSJ A;  3VG6 A;  1A2D A;  4MVL A;  1ZNK A;  1ZRY A;  3LTW A;  3UAQ A;  3NQ9 A;  1QY1 A;  1VWK B;  1Y0G A;  3UEX A;  3CKG A;  4U9C A;  2AL0 X;  4Z6J A;  1FTP A;  1W4T A;  5EDC A;  1EAL A;  3O19 A;  2LFO A;  2OFM X;  2YMS A;  2RD7 C;  2QO4 A;  3IA8 A;  2OY5 O;  1LFO A;  1NQN A;  2HLV A;  1SMP I;  1VPR A;  2OF9 A;  3T2W A;  4O4O A;  2Y3E A;  1YWD A;  3PQU A;  5JR8 A;  5LJC A;  1SRG A;  3OD9 A;  4OS3 A;  1LIE A;  1OPA A;  2DM5 A;  1T8V A;  1DZK A;  2OFB A;  1WBI A;  1YP6 A;  2IZF B;  2RA6 A;  5L8O A;  3RY1 A;  4GNY A;  1SRF A;  2A13 A;  3FW5 A;  5F58 A;  2GTL M;  5LKE A;  3EM0 A;  3OBL A;  2AT5 X;  3BRN A;  4U3Q A;  1G7N A;  2OVA A;  1VWA B;  3NPO A;  1ZNH A;  4GUZ A;  1PTS A;  3O22 A;  4N7C A;  2BS6 A;  5HA1 A;  1QQS A;  4NLI A;  4YFP A;  5HZ8 A;  1GXA A;  4O9S A;  4QYN A;  2WEW A;  4FGI B;  3RBY A;  3RDQ A;  3P6G A;  1G85 A;  1HBQ A;  1IFB A;  1NGL A;  2JU7 A;  3KFH A;  3F9D A;  4YGG A;  1LCW A;  4CV7 A;  5FEN A;  1GT4 A;  1QY0 A;  2RTG B;  4YFR A;  1KL3 A;  1H91 A;  1YUP A;  2G78 A;  2IZK A;  5EED A;  3RDM A;  5HCD C;  3D4R A;  4YGZ A;  3HWE A;  1LIC A;  1SRJ A;  3KFG A;  2Q4N A;  2OYB O;  3BX8 A;  3FYF A;  2UYW A;  2IZB A;  2W2A A;  4ID2 A;  4TKH A;  4CDC A;  4C5P A;  1T68 X;  4ZH6 A;  2W2B A;  1AB0 A;  1X8O A;  4FBR A;  3VU1 A;  4YKM A;  2CZT A;  2X8F A;  2AMM X;  2POA A;  1SWE A;  1SXW A;  2L67 A;  3FA7 A;  2X4M A;  1SY2 A;  2A8G A;  3PH5 A;  5H9A A;  3VG7 A;  2GTL N;  1SWS A;  2OVD A;  4R0B A;  3ZI8 A;  1SWU A;  2WWP A;  4HPC A;  3VG5 A;  2WPU A;  5FFH A;  1IFC A;  1SWQ A;  2JGS A;  5DG4 A;  4GJS A;  1KT3 A;  1SWF A;  5B10 O;  1KQX A;  2HZQ A;  4ES7 A;  1SY3 A;  3Q34 A;  3GAQ A;  1FDQ A;  2KTD A;  3CR6 A;  4GK9 A;  4EDE A;  4YDB A;  5EDB A;  3RDO A;  4O3W A;  2ANS A;  5B5F A;  1DFV A;  1TOU A;  4QNI A;  2JW1 A;  3RWX A;  4I95 A;  4ORW A;  1PEE A;  4A1Y A;  1AVE A;  2AKQ A;  2L9C A;  3B2J A;  3C76 X;  5CYB A;  2VDF A;  1OEE A;  2QOM A;  4HPA A;  2G8C O;  3B2I A;  3WJB A;  4RUN A;  4EKV A;  1SWH A;  1VWF B;  1VWC B;  4FBV A;  4BX5 A;  4XME A;  1A18 A;  1ZNE A;  3MG5 A;  2Y3F A;  3ZZV A;  3U03 A;  1ALB A;  5AQ6 A; 
#chains in the Genus database with same CATH homology
 3PPT A;  1TW4 A;  1KZW A;  2RCQ A;  1FEN A;  1VYG A;  4IAW A;  4OS0 A;  5F1E A;  3HK1 A;  4TNN A;  3T1D A;  5IO5 A;  5L8N A;  1GT1 A;  5IO7 A;  5LKF A;  1MDC A;  2BT9 A;  4XMG A;  4KC7 A;  1I04 A;  3HWD A;  1LPJ A;  4U8U M;  1MX8 A;  2OZQ A;  2Z4I A;  3EYC A;  1LIF A;  4LKP A;  2ACP X;  1X8U A;  3EBW A;  2X8S A;  4TLJ A;  1B8E A;  3K3L A;  4O3Y A;  1DV9 A;  1ADL A;  4GDZ A;  1B0O A;  2HYS A;  4ZHH A;  1URE A;  5H9K A;  3S5V A;  1IW2 A;  4OMX A;  2FTB A;  1KZX A;  2WUT A;  4YCE A;  2OVE A;  2IFB A;  4OMW A;  5FQ7 E;  3FMZ A;  4ZHF A;  2RN4 A;  1U17 A;  3B2L A;  3NAD A;  2KW1 A;  3IFB A;  4AYH A;  5BVT A;  1X8P A;  3G7X A;  1YIV A;  2Q39 A;  4LZV A;  5H9L A;  4ON1 A;  3HOL A;  3WVM A;  4U8U N;  4AZM A;  1BSO A;  2KT4 B;  5HCE C;  4ORU A;  5H9N A;  1OEK A;  3JQO A;  3FR4 A;  2WR6 A;  3P6D A;  5HWZ A;  3CWK A;  4AZN A;  2K23 A;  2GJ5 A;  3NX1 A;  3BDR A;  2A2U A;  1AVG I;  1NP4 A;  4HFO A;  4RUU A;  1MUP A;  3HWG A;  5EEE A;  4GRJ A;  1HMS A;  3F8A A;  3GE2 A;  1ACD A;  2X46 A;  4I3B A;  2G79 A;  3MBT A;  1B4M A;  2FS7 A;  1Y9L A;  3BSZ E;  3BX7 A;  3I17 A;  1EIO A;  1BLR A;  3PED A;  3CMP A;  4QGW A;  1PM1 X;  4LZU A;  1A57 A;  1SA8 A;  1BSY A;  2FT9 A;  2HMB A;  1HMR A;  2N93 A;  4I9S A;  1JJJ A;  2X8T A;  4FBO A;  1O1U A;  2F09 A;  3EBK A;  1JBH A;  1QFT A;  5EPQ A;  4QZU A;  1B56 A;  3S60 A;  5D8J A;  5IO6 A;  4AZR A;  1PMP A;  1QWD A;  2R56 A;  3KFF A;  4IB7 A;  4NYR A;  4YCH A;  1SXX A;  4ORS A;  5BYP A;  1EW3 A;  1I05 A;  5HAE A;  2QO5 A;  4QZT A;  3U9P C;  1PBO A;  1E00 A;  2RQ0 A;  4ZGF A;  1R0U A;  3B2K A;  3VE2 A;  3AKN A;  4EFG A;  1RLB E;  2LKK A;  3FA6 A;  3NQK A;  4O4U A;  4BQU A;  4EQA C;  1BJ7 A;  2QM9 A;  3CQN A;  2LA7 A;  3P02 A;  3WJE A;  4WFU A;  4ZFX A;  5HZ6 A;  1GKA A;  3TF6 A;  4KT5 A;  2AT6 X;  2KTS A;  4MIS A;  1CBQ A;  1E5P A;  2FLJ A;  4KII A;  1S44 A;  1S2P A;  2XKL A;  3FA9 A;  1FE3 A;  5KHP A;  2GC9 A;  1O1V A;  1U0X A;  3UEW A;  1LIB A;  1KT5 A;  4MVE A;  4KH8 A;  4ZGU A;  2JMB A;  4ZH9 A;  3APU A;  2ALL X;  4QYP A;  1TVQ A;  3D97 A;  4EEJ A;  5AEO A;  3NQ3 A;  4D6A A;  1ZNL A;  1LF7 A;  3H3I A;  3I0A A;  4NNS A;  2FR3 A;  4D6B A;  5LJH A;  1BM5 A;  4UU2 A;  5K06 A;  1T0V A;  3KFI A;  2ACO A;  2JU3 A;  4Y0Q A;  5HZ9 A;  1SXU A;  4IB8 A;  4O49 A;  2GTL O;  3ZUI A;  4DQ4 A;  3FEK A;  4YGH A;  5C0N A;  1TXL A;  3STN A;  1I06 A;  4HWM A;  1OPB A;  4L3R A;  5D47 A;  2NNQ A;  4IB9 A;  1A3Y A;  1XCA A;  4WBK A;  1GKA B;  2A3F X;  3ZQ3 A;  2FR2 A;  5FQ6 E;  1FEL A;  4MVI A;  5FAZ A;  1FEM A;  2WQ9 A;  3VPJ E;  4ZHG A;  1X89 A;  4KC8 A;  4AZO A;  4OS8 A;  1SXY A;  1TOW A;  1JJX A;  5LJK A;  1YWB A;  2KD2 A;  4ORR A;  1AEL A;  3EMM A;  1P6P A;  3C78 X;  3ELZ A;  4CK4 A;  4ORY A;  4M7M A;  3FIQ A;  2R74 A;  3NX2 A;  2L68 A;  2LBV A;  4WHI A;  2ASN X;  1YWC A;  3TGA A;  4DQ3 A;  2QO6 A;  1EII A;  3P6E A;  4PJ2 A;  4IBA A;  5LJB A;  3Q6L A;  2YG2 A;  1KQW A;  2MHD A;  3QKG A;  4ALO A;  4QGV A;  2AT3 X;  5KID A;  4O3X B;  4HPB A;  1LKE A;  4O4X A;  1JV4 A;  1MVG A;  4BVM A;  3LV4 A;  4ARH A;  1KT6 A;  4YDA A;  1L6M A;  2NP1 A;  1BBP A;  1RBP A;  2NND A;  1CRB A;  3HTY A;  5H8T A;  3C77 X;  2CM9 A;  4INN A;  4ZHC A;  4WFV A;  2JN3 A;  4IMO A;  4ORX A;  5D4A A;  4AZP A;  3BU1 A;  1HQP A;  5EZ2 A;  3FEN A;  3FR5 A;  3TZS A;  1U18 A;  4ZR2 A;  1OEJ A;  2QOS C;  2Z4H A;  4JGL A;  3VG2 A;  4YH0 A;  1HBP A;  1NP1 A;  1KXO A;  2MJI A;  3PEC A;  1GM6 A;  1MX7 A;  1D3S A;  5LJE A;  4GNW A;  2MWH A;  4A8Z A;  4ODD A;  2A0A A;  3WBG A;  1QFV A;  1QG5 A;  3P6H A;  1YWA A;  4U8U O;  2HZR A;  1D2U A;  1BRP A;  2FRS A;  4IAX A;  4I3C A;  4ZCB A;  1ZND A;  3P6F A;  4ML7 B;  1G5W A;  5HBS A;  1YP7 A;  3D96 A;  1KT4 A;  4TQ2 A;  1KT7 A;  1IIU A;  3ELX A;  3P24 A;  2PY1 A;  3AKM A;  1IKJ A;  1CBR A;  2CM4 A;  4HPD A;  4LKT A;  1ICM A;  4IB6 A;  1GT3 A;  3APX A;  4QGX A;  3KZA A;  2LBA A;  2ZAI A;  2G7B A;  2MO5 A;  3NP1 A;  1EQD A;  4K19 A;  5HTD A;  4L1N A;  3OE3 A;  5HA0 A;  1CBS A;  4ZHD A;  1OBU A;  5HZQ A;  4O4S A;  3WXQ A;  1ERB A;  3PH6 A;  2Q2M A;  3P6C A;  4GU8 A;  4NP1 A;  3STM X;  5FQ8 E;  1DZP A;  1ERX A;  2JOZ A;  1UZ2 X;  3APV A;  4GH7 A;  3FA8 A;  5BVS A;  5D45 A;  4TKB A;  1LNM A;  3N91 A;  4QRL A;  1G74 A;  5BVQ A;  3ZW1 B;  3FEP A;  3VE1 A;  1HN2 A;  1O8V A;  3TGB A;  3MVF A;  3NBX X;  4MVK A;  5AJB A;  4QQ1 A;  5AJC A;  1SY0 A;  5CE4 A;  3JSQ A;  1JYJ A;  2ZAG A;  1X8N A;  3FW4 A;  4YBU A;  3BLG A;  3RKG A;  3O2Y A;  2RCT A;  1OBP A;  4YFQ A;  2QMI A;  4I9R A;  3ZW0 A;  1ZNG A;  2O62 A;  2F73 A;  4EXZ A;  3MX7 A;  1GX8 A;  1E06 A;  4IAB A;  4KCA A;  1EPB A;  1S7D A;  4O3Z A;  1BWY A;  1I4U A;  4I6S A;  2L5P A;  1JIW I;  2Q9S A;  4Y0R A;  3WJD A;  3WJC A;  1ICN A;  2FS6 A;  3VG3 A;  2Q2P A;  1Y9T A;  2XST A;  5DPQ A;  3FLL A;  1DZM A;  4TJZ A;  4BOE A;  3VG4 A;  3S26 A;  2WEX A;  1AQB A;  1QAB E;  1XKI A;  3BU9 A;  3DTQ A;  4N7D A;  2E4J A;  4YKO A;  2GTF X;  3SAO A;  1EI5 A;  3SOT A;  3ZW2 A;  2M4L A;  3U0D A;  4NLJ A;  1BSQ A;  3FR2 A;  5D48 A;  3HWF A;  4XMC A;  5HZ5 A;  5F6B A;  4CSB A;  1DF3 A;  4GKC A;  1E02 A;  4XMF A;  1VYF A;  1X8Q A;  3ZWE A;  1BRQ A;  1EPA A;  5L8I A;  2BHV A;  4IMN A;  3V8U A;  3BY0 A;  2K62 A;  4LQZ A;  1ML7 A;  2W2F A;  4FQB B;  3DSZ A;  1DZJ A;  3FEL A;  3ZW0 B;  3WJF A;  4UU3 A;  4Y0P A;  3APW A;  3B2H A;  1SY1 A;  4YBP A;  3STK A;  4I3D A;  4Y0S A;  1KOI A;  2NNE A;  3RSW A;  3CBC A;  1KGL A;  2OFR X;  5LJG A;  3RZY A;  2EU7 X;  2R73 A;  5LJD A;  2OVS A;  1N0S A;  3UEV A;  4GZV A;  4XMH A;  4YMY A;  1EXS A;  2BS5 A;  4ZJ0 A;  2FWV A;  1GGL A;  3E3C A;  4NNT A;  4MIR A;  5KIC A;  5F6Z A;  1QY2 A;  1JYD A;  2HNX A;  4M6S A;  5HTE A;  5B27 A;  4AZQ A;  4QAE A;  1LID A;  3PP6 A;  4ALB A;  4NW4 A;  1CBI A;  2AT0 X;  3PQS A;  3CQR A;  3CBS A;  3KQ0 A;  4XMD A;  3ZUO A;  1CJ5 A;  3TGC A;  2AT8 X;  4NYQ A;  3LHN A;  4COT A;  2CBS A;  2AH7 X;  1IKE A;  2CZU A;  1GT5 A;  1BEB A;  3S5X A;  4A60 A;  3D95 A;  3NR3 A;  4TKJ A;  4A1H A;  5HCC C;  2JU8 A;  1GX9 A;  1HMT A;  4GET A;  2WQA E;  4AW8 A;  2MM3 A;  3F6Z B;  2CBR A;  2LB6 A;  5B29 A;  1X71 A;  2P8G A;  3WJG A;  3ZW1 A;  1JZU A;  1EUO A;  1OBQ A;  3WOV A;  1DC9 A;  2A2G A;  3BS2 A;  3HOE A;  3L4R A;  1Z24 A;  2X45 A;  3JS1 A;  3UEU A;  4PSQ A;  4GE1 A;  2BLG A;  3OJY C;  5F7G A;  2WSJ A;  3VG6 A;  1A2D A;  4MVL A;  1ZNK A;  1ZRY A;  3UAQ A;  3NQ9 A;  1QY1 A;  3UEX A;  4U9C A;  2AL0 X;  1FTP A;  5EDC A;  1EAL A;  3O19 A;  2LFO A;  2OFM X;  2YMS A;  2RD7 C;  2QO4 A;  3IA8 A;  1LFO A;  2HLV A;  1SMP I;  1VPR A;  5JR8 A;  4O4O A;  3PQU A;  1YWD A;  5LJC A;  3OD9 A;  4OS3 A;  1LIE A;  1OPA A;  2DM5 A;  1T8V A;  1DZK A;  1YP6 A;  2RA6 A;  5L8O A;  4GNY A;  2A13 A;  3FW5 A;  5F58 A;  2GTL M;  5LKE A;  3EM0 A;  3OBL A;  2AT5 X;  3BRN A;  4U3Q A;  1G7N A;  2OVA A;  3NPO A;  1ZNH A;  4N7C A;  3O22 A;  2BS6 A;  5HA1 A;  1QQS A;  4NLI A;  4YFP A;  5HZ8 A;  1GXA A;  4O9S A;  4QYN A;  2WEW A;  4FGI B;  3RBY A;  3P6G A;  1G85 A;  1HBQ A;  1IFB A;  1NGL A;  2JU7 A;  3KFH A;  3F9D A;  4YGG A;  4CV7 A;  5FEN A;  1GT4 A;  1QY0 A;  4YFR A;  1YUP A;  1H91 A;  2G78 A;  5EED A;  5HCD C;  3D4R A;  4YGZ A;  3HWE A;  1LIC A;  3KFG A;  2Q4N A;  3BX8 A;  3FYF A;  2W2A A;  4ID2 A;  4TKH A;  1T68 X;  4ZH6 A;  2W2B A;  1AB0 A;  1X8O A;  4FBR A;  3VU1 A;  4YKM A;  2CZT A;  2X8F A;  2AMM X;  2POA A;  2L67 A;  1SXW A;  3FA7 A;  1SY2 A;  3PH5 A;  5H9A A;  3VG7 A;  2GTL N;  2OVD A;  4R0B A;  3ZI8 A;  2WWP A;  4HPC A;  3VG5 A;  5FFH A;  1IFC A;  5DG4 A;  1KT3 A;  1KQX A;  2HZQ A;  4ES7 A;  1SY3 A;  3GAQ A;  1FDQ A;  2KTD A;  3CR6 A;  4GK9 A;  4EDE A;  4YDB A;  5EDB A;  4O3W A;  2ANS A;  1DFV A;  1TOU A;  4QNI A;  2JW1 A;  3RWX A;  4I95 A;  4ORW A;  1PEE A;  4A1Y A;  2AKQ A;  2L9C A;  3B2J A;  3C76 X;  5CYB A;  1OEE A;  4HPA A;  3B2I A;  3WJB A;  4RUN A;  4FBV A;  4XME A;  1A18 A;  1ZNE A;  3U03 A;  3ZZV A;  1ALB A;  5AQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...